2AMIA

Solution structure of the calcium-loaded n-terminal sensor domain of centrin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
b'RVGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caltractin
publication title Structure of the N-terminal calcium sensor domain of centrin reveals the biochemical basis for domain-specific function.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Cell cycle
total genus 29
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2amiA00
1PULA 2LMVA 2WOSA 2OS8B 5BPJA 1KCYA 2L4IA 1J7RA 3EK4A 2ZFDA 1EH2A 1CM1A 2A4JA 4XYNA 3PN7C 2JTTA 2I94A 5D69A 3PSRA 1NYAA 1TN4A 1K96A 2JOJA 4MBEA 1VRKA 3BUWB 2K7CA 3DVMA 5KTYA 3JVTB 1KQMC 3DVKA 3PFVA 2LCPA 1KFUS 1OOJA 1RFJA 2F2OA 1SR6C 3SG4A 2F8PA 5I2LA 1XFXO 4QJ4B 1M45A 1UWOA 4XJKA 1DVIA 1X02A 1M39A 3TUYC 1BG1A 1U5IB 1QXPA 3O78A 2IS9A 1V1GA 3LCPC 1IKUA 3GOFA 2WCEA 2K7DA 1QJTA 3TS5B 1QATA 4GGNA 5ER5A 2ZKMX 5JOLA 4USLA 3AAJA 1UHIA 2KI4C 1K8UA 2HQWA 3LLEA 4JPZB 1CFCA 1WY9A 2KFGA 3DD4A 4GNKB 4MVFA 1XK4C 5CSJA 3SG5A 1F71A 1SNLA 2CCMA 1KQVA 2KDHA 1DJXA 5I2OA 2WCBA 1KK8C 2JWWA 4HRGA 4ICBA 2K2AA 1NSHA 1BLQA 1N65A 5HKWA 3LK0A 1RROA 2LUCA 4WQ2A 4BY5A 1DF0B 1K2HA 1ZOTB 1H8BA 5AFPA 1EXRA 5DKNA 3RLZA 1S26D 5FYXA 2NLNA 1NPQA 3SJSA 1KSMA 1J7OA 2K7BA 1NX1A 2BCBA 4BY4A 1IGVA 2M9GA 1M46A 1Y1AA 3FS7A 3BOWA 1K9UA 1JF2A 3CGAA 3E3RA 2HF5A 1DMOA 4YGDB 2KQ6A 2K61A 1AHRA 1KK7Y 1F54A 1LVCD 1AJ5A 2M7LA 2O60A 3VRPA 4N5XA 2AMIA 1KFUL 1IQ3A 1AUIB 1F8HA 5CSNA 2LP2A 2KAYA 2ISDA 2M7NA 1DGUA 4YGBB 2MLEC 2F3YA 3DVJA 3FWBA 4MZLA 1WDCC 1QLSA 1RTP1 1XA5A 2PMYA 4C0JA 3JTDC 3WXAA 2MJWB 2M0RA 2VRGA 1C7WA 4F0ZB 3I5IC 2L2EA 2MRDA 4UPGA 4QJ5B 1CMGA 3O2PA 1K94A 1SL7A 3CWGA 2GGMA 5DKRA 2JXLA 2KNEA 5I2QA 1EJ3A 1XK4A 2OTGC 3FIAA 1KFXS 1L2OB 1IWQA 1WLZA 2ZRTA 2PALA 1CLBA 1GGZA 4M2QA 2ZNDA 3DF0A 1KWOC 4NDDA 3BQ3A 4OV2A 3SG7A 3PATA 1BR4B 2JT0A 1PSBA 3NSKA 3BXKA 5HLOA 1CDLA 1SL8A 2H2KA 3PM8A 2QPTA 4C0LA 1B8CA 1PSRA 1YUUA 3DVEA 3I5GB 2OS8C 3KPXA 1CLMA 3VRQA 1B4CA 2L5XB 2Y5IA 1IQ5A 1BF5A 2K0JA 1SCVA 1F4OA 2COLB 3A4UB 1SPYA 2NCOA 4D1EA 1YR5A 2LC5A 1FI6A 4GPLB 1A4PA 3JVTC 1CB1A 1DJWA 4CFQA 4ETOA 1PK0D 1DJHA 4E68A 5KSZA 1HQVA 4PCWA 1ODBA 4CFRA 1CFDA 1MF8B 4PHKA 1WRZA 3D0YA 1OZOA 1W7IB 4DCKA 1QTXA 3AKBA 1TTXA 2B1UA 1SW8A 1BT6A 1UHKA 4AOMA 5ER4X 1WRKA 2LV7A 2JULA 3MSEB 1PVBA 3OX5A 1S6IA 3TS5C 4I5JA 1A75A 2EC6B 3OB2B 4MRYA 3GK1A 2KYFA 2M97A 2LLSA 1D1OA 1R6PA 4HRHA 1S6CA 1JF0A 3EVVA 1B7TZ 1QLKA 2G2BA 1KFXL 1BOCA 4XJKB 5I8NA 2SASA 1QVIZ 1SMGA 1YUTA 2BCAA 3KO0A 1M63B 4CPVA 1PALA 2FOTA 1TNQA 2QACA 1CM4A 3OP0A 1CNPA 1PVAA 1JC2A 2LVKA 2KBIA 2RGIA 1KSOA 1RECA 1XYDA 4DUQA 1W7JB 3TDUA 2JT3A 2LP3A 1N2DA 3HX4A 1OMDA 2FCDA 2CXJA 2KFFA 1FF1A 1S5GZ 3VRRA 1DJGA 2LMUA 2MLFC 4NDCA 1CMFA 4JQ0D 3I5FB 1J7QA 2Q91A 2K2FA 2FCEA 2KSPA 4DIRA 3IQQA 1ZFSA 4N1GA 1MWNA 3HCMA 4OR9B 1Q80A 2R2IA 1C07A 3LL8B 4PHMA 2V53A 4CIDA 1QASA 1ZUZA 1FBVA 2BE4A 1B1GA 2KYCA 2L0PA 4HREE 1R2UA 2EHBA 2ZN8A 1OE9B 1IRJA 3GK4X 2BL0B 1YUSA 5AANA 2BCXA 4I5LB 2M49B 4GGFA 2G9BA 2JQ6A 3IQOA 1G8IA 3OB1B 4YGAA 3ZWHA 2GGZA 3AKAA 2E30A 3SIAA 2CT9A 1IJ5A 3O4YA 3TZ1A 2O5GA 3H4SE 4MZKA 1A29A 2OPOA 4AQJA 1K9PA 1AVSA 1YRTB 2KI6D 2M1KB 4R1EA 2BBMA 3K21A 4WQ3A 2E6WA 4NDBA 4QJ3B 4YGEB 1UURA 1L2OC 2JC2A 2LLTA 2LMTA 2LM5A 3IF7A 2ZNEA 5KU1A 1UP5A 2CBLA 1TNPA 1FI5A 2GV5A 2I2RE 1XFWO 2KGBC 2MHHA 5B8IB 2LVJA 3C1VA 4C0KA 3ICBA 2JRFA 3BUMB 4I5KA 2NZ0A 3EVUA 3BYAA 1Y1XA 3I5HB 3SG6A 1JUOA 3I5GC 1GJYA 1SL9A 2K7OA 4PDZA 3CS1A 1L7ZA 1SCMC 2LE9B 4DS7A 2WCFA 1YX8A 3DF0B 4PE1A 3TDIA 4A4BA 1JFJA 3LK1A 4MSPA 4MN0A 1B8RA 1XFUO 1B7TY 2LUXA 2PASA 2KQYA 1G4YR 2L98A 2P6BB 1S3PA 1QVIY 2WNDA 1EG4A 2JZIA 1PRWA 1UHHA 1YURA 1DT7B 1FW4A 1JFKA 5IBWA 3FWCA 2EGDA 5HLVA 1EL4A 4YI8A 1TNXA 5TNCA 3WHUB 2EC6C 1LXFC 1DJYA 1LINA 5F6TA 2M3WA 1M31A 1S5GY 1V1FA 1YVLA 3SIBA 4YBHB 1YTZC 4GAOA 1MXLC 1F70A 4Q04A 1K90D 1DGVA 2WC8A 1B9AA 1UHNA 5AEQA 2LVIA 5CSFA 2F3ZA 3EKHA 1NWDA 4M2PA 5J3XA 4FTGA 1A2XA 3EK8A 3F45A 5D7FA 5HYDA 3AAKA 1G33A 1RK9A 1WRLA 2M29A 2L50A 4MLWA 4PHNA 1YX7A 2HPSA 4OKHA 5CSIA 2KFHA 2KAVA 4PE0A 2JNFA 1DJZA 2K8MB 1HT9A 1XFVO 3I5FC 4PE4A 2H61C 4AQIA 1XVJA 5K89A 1ZMZA 1S36A 1ALVA 3CR4X 1TIZA 1IJ6A 2MA2A 2JTZA 2BECA 3CTNA 3CLNA 5HKYA 2I18A 3QRXA 3O6BA 2I7AA 1QX7A 1AP4A 1TCOB 3BUOB 2BL0C 1MR8A 1A03A 1SRAA 1XFYO 2DOQA 2JPTA 3GK2A 1LA0A 4GUKA 2SCPA 3VGOA 4HSZA 1CDMA 3NSIA 4ZCVA 1TNWA 3CR5X 3WHTB 1NP8A 1NCZA 1JWDA 1LA3A 2KBMA 4GBAA 2LVVA 1SKTA 4OCIA 1YRUB 1N0YA 3SG3A 1NIWA 4ORBB 2LHIA 3ZNIA 1CTRA 1QV1A 4YRUA 1E8AA 2JU0A 3CZTX 3VROA 1CDNA 2AAOA 2HQ8A 3BOWB 3NSOA 3OHMB 1U5IA 1NX2A 3I5HC 2NCPA 2CNPA 3PN7B 5JJGA 4ORAB 1JBAA 1S1EA 4CLNA 1OMVA 4A4CA 1B8LA 3EKJA 2KHNA 5DKQA 4MRXA 2M1UA 1MXEA 2ZRSA 1KQMB 1MQ1A 1OQPA 1RJVA 1SR6B 4MEWA 2PRUA 2H61A 5AXIA 2F33A 1NUBA 2Y4QA 3A8RA 2WORA 4MZJA 1MHOA 3TUYB 1XO5A 2PSRA 2FJUB 2BE6A 2JT8A 2ZN9A 1FPWA 2Q4UA 1NCYA 1J1EA 4NQGA 4IL1A 1SYMA 3D10A 1DF0A 1BODA 1CKKA 2BKIB 1QIVA 2KI4B 4P5OE 2LAPA 3PALA 1QIWA 1NCXA 2NXQA 1QV0A 1Y6WA 2AUCA 2PVBA 1EG3A 3KF9A 1NX3A 5G08A 1SBJA 4OVNF 2M8UA 2KOTA 1KK8B 2D8NA 1AJ4A 2LNKA 1BJFA 1UHJA 2L4HA 4I5NB 3WNXB 3PLFB 1OSAA 1CFFA 2LHLA 1GGWA 5GQQC 1TCFA 4JWQA 4N1FA 3TDZA 2JNXA 1BR1B 2BBNA 4PHJA 1MUXA 1BU3A 5CPVA 1C7VA 3VRNA 4P2YB 4GFTA 1J1DA 1DTLA 1NX0A 1Y1UA 5PALA 1OMRA 1QX5B 2KGRA 1IH0A 2LANA 2MBXA 1JSAA 4PE7A 1RWYA 1YVHA 4L9MA 1XFZO 1UUSA 1ALWA 1K9KA 4WRIA 3SG2A 3RM1A 1F4QA 1QX2A 1CLLA 2JXCA 1Y0VH 2L51A 4DRWA 3D0YB 1B47A 1GQMA 4U8DA 3M0WA 1DJIA 1WDCB 1TRFA 3EK7A 1ZACA 1J55A 3BUNB 2F2PA 3JTDB 2CTNA 4YI9A 1F55A 1QS7A 4TNCA 1A75B 1OZSA 2TN4A 1CFPA 3I5IB 3KHEA 3NXAA 1CDPA 1BMOA 1KK7Z 2LLUA 3KEVA 1IG5A 2KI6C 2Y1MA 5AERA 1SCMB 1SY9A 2KAXA 2MAZA 4M2OA 1TOPA 4YGCB 4ZCUA 1LKJA 1SK6D 2OTGB 3CR2A 4FQOA 2Y1NA 1K93D 3NSLA 1WLMA 4PALA 3OX6A 2HETA 1KWOB 5HKZA 3BUXB 1S6JA 4GGFC 1J7PA 2BKHB 4ORCB 1K95A 3EVRA 1H4BA 1AK8A
chains in the Genus database with same CATH superfamily
1PULA 2LMVA 2WOSA 2OS8B 5BPJA 1KCYA 2L4IA 1J7RA 3EK4A 2ZFDA 2PYQA 1EH2A 1CM1A 2A4JA 4XYNA 3PN7C 2JTTA 2QDIA 2I94A 5D69A 3PSRA 1NYAA 1TN4A 1K96A 2JOJA 4MBEA 1VRKA 3BUWB 2K7CA 2QEVA 2QEOA 3DVMA 5KTYA 3JVTB 1KQMC 3DVKA 3PFVA 2LCPA 1KFUS 1OOJA 1RFJA 2F2OA 1SR6C 3SG4A 1DEKA 2F8PA 5I2LA 1XFXO 4QJ4B 1M45A 1UWOA 4XJKA 1DVIA 1X02A 1M39A 3TUYC 1BG1A 1U5IB 1QXPA 3O78A 2IS9A 1V1GA 3LCPC 2WC5A 3GOFA 1IKUA 2WCEA 3QMEA 2K7DA 1QJTA 3TS5B 1QATA 1Z2CB 4GGNA 5ER5A 2ZKMX 5JOLA 4USLA 3AAJA 1UHIA 2KI4C 1K8UA 2HQWA 1OOGA 3LLEA 4JPZB 1WY9A 2KFGA 3DD4A 3EG5B 3N7HA 1XK4C 4GNKB 4MVFA 5CSJA 3SS4A 3SG5A 1SNLA 2CCMA 1KQVA 2KDHA 1DJXA 5I2OA 2QEBA 2WCBA 1KK8C 2JWWA 4HRGA 4ICBA 2K2AA 1NSHA 1BLQA 1N65A 2JPOA 5HKWA 3LK0A 1RROA 2LUCA 4WQ2A 4BY5A 1DF0B 1K2HA 1ZOTB 1H8BA 5AFPA 1EXRA 5DKNA 3VB1A 3V2LA 3RLZA 1S26D 5FYXA 2NLNA 1NPQA 3SJSA 1KSMA 3D76A 1J7OA 2K7BA 1NX1A 2BCBA 4BY4A 1IGVA 2M9GA 1M46A 1Y1AA 3FS7A 3BFBA 1K9UA 3BOWA 1JF2A 3CGAA 3E3RA 2HF5A 2P70A 4YGDB 2KQ6A 2K61A 1DMOA 1AHRA 1KK7Y 1F54A 1LVCD 3B7AA 1AJ5A 2M7LA 2O60A 3NHTA 4N5XA 3VRPA 2AMIA 1KFUL 1IQ3A 1AUIB 1F8HA 3BFAA 3O4XA 5CSNA 2LP2A 1OW4A 2KAYA 2WCHA 2ISDA 2M7NA 1DGUA 4YGBB 2MLEC 2F3YA 3DVJA 3FWBA 1TUJA 4MZLA 1WDCC 1QLSA 1RTP1 1XA5A 2PMYA 4C0JA 3JTDC 3WXAA 2MJWB 2M0RA 3K1EA 2VRGA 1C7WA 4INWA 1CFCA 4F0ZB 3I5IC 2L2EA 2MRDA 4UPGA 4QJ5B 1CMGA 3O2PA 1K94A 1SL7A 1C3YA 3CWGA 2GGMA 5DKRA 2JXLA 2KNEA 5I2QA 1EJ3A 1XK4A 2OTGC 3FIAA 1KFXS 1L2OB 1IWQA 1WLZA 2ZRTA 2PALA 1CLBA 1GGZA 4M2QA 2H8VA 2ZNDA 3DF0A 1TUZA 1KWOC 4NDDA 3L47A 1ORGA 2P71A 1LS8A 3BQ3A 4OV2A 3SG7A 3PATA 1BR4B 2JT0A 1PSBA 3NSKA 3BXKA 5HLOA 1CDLA 1SL8A 2H2KA 3PM8A 2QPTA 4C0LA 1B8CA 1PSRA 1YUUA 3DVEA 3I5GB 2OS8C 2WC6A 3KPXA 1CLMA 3VRQA 1B4CA 2L5XB 2Y5IA 1IQ5A 1BF5A 3UNWA 2K0JA 1SCVA 1F4OA 2COLB 3A4UB 1SPYA 2NCOA 4D1EA 1YR5A 2LC5A 3CYZA 3FE9A 1FI6A 1OOFA 4GPLB 3S0FA 1A4PA 3JVTC 1CB1A 1DJWA 4CFQA 4ETOA 1PK0D 3PM2A 1DJHA 4E68A 5KSZA 1HQVA 1XFRA 3FE8A 1ODBA 4PCWA 4CFRA 1CFDA 1MF8B 4PHKA 1WRZA 1TWOA 3D0YA 1OZOA 1W7IB 2WCLA 1QTXA 3AKBA 4DCKA 1TTXA 1SW8A 2B1UA 1BT6A 2ERBA 1UHKA 3R1VA 4AOMA 5ER4X 1WRKA 2LV7A 2JULA 3MSEB 1PVBA 3B88A 3OX5A 1S6IA 3TS5C 4I5JA 1A75A 2EC6B 3OB2B 4MRYA 3GK1A 2KYFA 2M97A 2LLSA 2YGUA 1D1OA 1R6PA 4HRHA 1S6CA 1JF0A 1GM0A 3EVVA 1B7TZ 1QLKA 2BAPA 2G2BA 3DZTA 3UO9A 1KFXL 4JD9A 1BOCA 1DC1A 4XJKB 5I8NA 2SASA 1QVIZ 1SMGA 1YUTA 2BCAA 3KO0A 1DQEA 1M63B 4CPVA 1PALA 2FOTA 1TNQA 2QACA 1CM4A 3OP0A 1CNPA 1PVAA 1JC2A 2LVKA 2KBIA 2RGIA 1KSOA 1RECA 1XYDA 4DUQA 1W7JB 3TDUA 5I94A 3B6XA 2JT3A 2LP3A 1N2DA 3PJIA 3HX4A 5EL2A 1OMDA 2FCDA 2CXJA 3L4AA 2KFFA 3R1PA 1S5GZ 3VRRA 1DJGA 1P28A 2LMUA 2MLFC 1FF1A 4NDCA 3FE6A 3S0GA 5HL1A 1CMFA 4JQ0D 3I5FB 3CZ2A 1J7QA 2Q91A 2K2FA 2FCEA 2KSPA 4DIRA 3IQQA 1ZFSA 4N1GA 1MWNA 3L4LA 3HCMA 4OR9B 1Q80A 2R2IA 1C07A 3LL8B 4PHMA 2V53A 4CIDA 1QASA 1ZUZA 1FBVA 2BE4A 1B1GA 2KYCA 2L0PA 4HREE 1R2UA 2EHBA 2ZN8A 1OE9B 1IRJA 3GK4X 2BL0B 1YUSA 5AANA 2BCXA 4I5LB 2M49B 4GGFA 2G9BA 2JQ6A 3IQOA 1G8IA 3OB1B 4YGAA 3ZWHA 2GGZA 3AKAA 3CZ0A 2E30A 3R72A 2CT9A 1IJ5A 3O4YA 3SIAA 3TZ1A 2O5GA 3H4SE 4MZKA 1A29A 2OPOA 4AQJA 1K9PA 1AVSA 1YRTB 2KI6D 2M1KB 4R1EA 2BBMA 3K21A 4WQ3A 2E6WA 4NDBA 4QJ3B 4YGEB 4JKTA 1UURA 1L2OC 2JC2A 2LLTA 2LMTA 2LM5A 3IF7A 2ZNEA 5KU1A 1UP5A 2CBLA 1TNPA 1FI5A 2GV5A 2I2RE 1XFWO 2KGBC 2MHHA 5B8IB 2LVJA 3C1VA 4C0KA 3ICBA 2JRFA 3BUMB 3BJHA 4I5KA 2NZ0A 3EVUA 3BYAA 1Y1XA 3I5HB 5D3OA 3SG6A 1JUOA 3I5GC 1GJYA 1SL9A 2K7OA 4PDZA 3CS1A 1L7ZA 1SCMC 2LE9B 4DS7A 3Q8IA 2WCFA 1YX8A 3DF0B 4PE1A 2FJYA 3TDIA 4A4BA 1JFJA 3LK1A 1C3ZA 4MSPA 4MN0A 1B8RA 1XFUO 3D77A 1B7TY 2WCJA 2LUXA 2PASA 2KQYA 1G4YR 2L98A 2P6BB 1S3PA 1QVIY 2WNDA 1EG4A 3CZ1A 2JZIA 1PRWA 1UHHA 1YURA 3D73A 1FW4A 1JFKA 5IBWA 1DT7B 3FWCA 2EGDA 5HLVA 1EL4A 4YI8A 3OGNA 1TNXA 5TNCA 3WHUB 2EC6C 1LXFC 3NHIA 1DJYA 3IVTA 1LINA 5F6TA 2M3WA 1M31A 1S5GY 1V1FA 1YVLA 3SIBA 4YBHB 1YTZC 4GAOA 2KLEA 1MXLC 1F70A 4Q04A 1K90D 1DGVA 2WC8A 1B9AA 1UHNA 5AEQA 1IIOA 2LVIA 3B87A 5CSFA 2F3ZA 3EKHA 1NWDA 4M2PA 5J3XA 4FTGA 1A2XA 3EK8A 3F45A 5D7FA 5HYDA 3AAKA 1G33A 1RK9A 1WRLA 2M29A 2L50A 4MLWA 4PHNA 1YX7A 3CABA 2HPSA 4OKHA 3R1OA 5CSIA 2KFHA 2KAVA 4PE0A 2JNFA 1DJZA 2K8MB 1HT9A 1XFVO 3I5FC 4PE4A 2H61C 4AQIA 1XVJA 5K89A 1ZMZA 1S36A 1ALVA 2L5YA 3CR4X 1TIZA 1IJ6A 2MA2A 2JTZA 3D78A 2BECA 3CTNA 3CLNA 5HKYA 2I18A 3QRXA 3O6BA 2I7AA 1QX7A 5FI6A 3CDNA 1TCOB 1AP4A 3BUOB 2BL0C 1MR8A 1A03A 1SRAA 1XFYO 2DOQA 2K60A 2JPTA 3GK2A 4INXA 1LA0A 4GUKA 2SCPA 2PQLA 3VGOA 4HSZA 1OOIX 1CDMA 3NSIA 4ZCVA 1TNWA 3CR5X 3WHTB 4IJ7A 1NP8A 1NCZA 1JWDA 5FI7A 3D74A 1LA3A 2KBMA 3S0AA 4GBAA 2WCMA 2LVVA 1SKTA 4OCIA 1YRUB 3DY9A 1N0YA 3SG3A 1NIWA 4ORBB 2LHIA 3B86A 3ZNIA 1CTRA 1QV1A 4YRUA 1E8AA 2JU0A 3CZTX 3VROA 1CDNA 2AAOA 2HQ8A 3BOWB 3NSOA 3OHMB 1U5IA 1NX2A 3I5HC 2NCPA 2CNPA 3PN7B 5JJGA 1DELA 4ORAB 2GTEA 1S1EA 4CLNA 1JBAA 1OMVA 4A4CA 4PT1A 1B8LA 3EKJA 4KYNA 2KHNA 4FQTA 5DKQA 1SSEB 2M1UA 4MRXA 1MXEA 2ZRSA 1KQMB 1MQ1A 3RZSA 1T14A 1OQPA 1RJVA 1SR6B 4MEWA 2PRUA 2H61A 5AXIA 2F33A 1NUBA 2Y4QA 1F71A 3A8RA 2WORA 4MZJA 1MHOA 3TUYB 1XO5A 2PSRA 3OBVA 2FJUB 2BE6A 2JT8A 2ZN9A 1FPWA 2Q4UA 1NCYA 1J1EA 4NQGA 4IL1A 1SYMA 3D10A 1DF0A 1BODA 1CKKA 2BKIB 1QIVA 2KI4B 1AK8A 4P5OE 2LAPA 3PALA 1QIWA 3DYEA 1NCXA 2NXQA 1QV0A 1Y6WA 2AUCA 2PVBA 1EG3A 1W9ZA 1NX3A 3KF9A 1SBJA 4OVNF 5G08A 2M8UA 2KOTA 1KK8B 2D8NA 1AJ4A 2LNKA 1BJFA 1UHJA 2L4HA 4OZDA 4I5NB 3WNXB 4F7FA 3S0DA 3PLFB 1OSAA 1CFFA 2LHLA 1GGWA 5GQQC 1TCFA 4JWQA 4N1FA 3TDZA 2JNXA 1BR1B 2WCKA 2BBNA 4PHJA 1MUXA 1BU3A 5CPVA 1C7VA 3VRNA 4P2YB 4GFTA 1J1DA 1DTLA 1NX0A 1Y1UA 5PALA 1OMRA 1QX5B 2KGRA 1IH0A 3BFHA 2LANA 2MBXA 3S0BA 1JSAA 4PE7A 1RWYA 1YVHA 2KLDA 5DICA 4L9MA 1XFZO 1UUSA 1ALWA 1K9KA 4WRIA 3SG2A 3RM1A 1F4QA 1QX2A 1CLLA 2JXCA 2L2CA 1Y0VH 2L51A 3SS5A 3D0YB 4DRWA 1B47A 1GQMA 4U8DA 3M0WA 1DJIA 1WDCB 1TRFA 2QEHA 1ZACA 3D75A 3EK7A 1J55A 5FI2A 3BUNB 2F2PA 3JTDB 2CTNA 4YI9A 1F55A 1QS7A 4TNCA 1Z4HA 1A75B 1OZSA 2TN4A 1CFPA 3I5IB 3KHEA 3NXAA 1CDPA 1BMOA 1KK7Z 2LLUA 3KEVA 3SS3A 3S0EA 1IG5A 2KI6C 2Y1MA 5AERA 1SCMB 1SY9A 2KAXA 2MAZA 4M2OA 3DXLA 1TOPA 4YGCB 2KPHA 4ZCUA 1LKJA 1SK6D 2OTGB 3CR2A 4FQOA 2BNXA 2Y1NA 1K93D 3NSLA 1WLMA 4PALA 3OX6A 2HETA 1KWOB 5HKZA 3BUXB 1QWVA 1S6JA 3NGVA 4GGFC 1J7PA 2BKHB 4ORCB 1K95A 3EVRA 1H4BA 1OOHA
chains in the Genus database with same CATH topology
1PULA 2LMVA 2WOSA 2OS8B 5BPJA 1KCYA 2L4IA 1J7RA 3EK4A 2ZFDA 1EH2A 1CM1A 2A4JA 4XYNA 3PN7C 2JTTA 2I94A 5D69A 3PSRA 1NYAA 1TN4A 1K96A 2JOJA 4MBEA 1VRKA 3BUWB 2K7CA 3DVMA 5KTYA 3JVTB 1KQMC 3DVKA 3PFVA 2LCPA 1KFUS 1OOJA 1RFJA 2F2OA 1SR6C 3SG4A 2F8PA 5I2LA 1XFXO 4QJ4B 1M45A 1UWOA 4XJKA 1DVIA 1X02A 1M39A 3TUYC 1BG1A 1U5IB 1QXPA 3O78A 2IS9A 1V1GA 3LCPC 1IKUA 3GOFA 2WCEA 2K7DA 1QJTA 3TS5B 1QATA 4GGNA 5ER5A 2ZKMX 5JOLA 4USLA 3AAJA 1UHIA 2KI4C 1K8UA 2HQWA 3LLEA 4JPZB 1CFCA 1WY9A 2KFGA 3DD4A 4GNKB 4MVFA 1XK4C 5CSJA 3SG5A 1F71A 1SNLA 2CCMA 1KQVA 2KDHA 1DJXA 5I2OA 2WCBA 1KK8C 2JWWA 4HRGA 4ICBA 2K2AA 1NSHA 1BLQA 1N65A 5HKWA 3LK0A 1RROA 2LUCA 4WQ2A 4BY5A 1DF0B 1K2HA 1ZOTB 1H8BA 5AFPA 1EXRA 5DKNA 3RLZA 1S26D 5FYXA 2NLNA 1NPQA 3SJSA 1KSMA 1J7OA 2K7BA 1NX1A 2BCBA 4BY4A 1IGVA 2M9GA 1M46A 1Y1AA 3FS7A 3BOWA 1K9UA 1JF2A 3CGAA 3E3RA 2HF5A 1DMOA 4YGDB 2KQ6A 2K61A 1AHRA 1KK7Y 1F54A 1LVCD 1AJ5A 2M7LA 2O60A 3VRPA 4N5XA 2AMIA 1KFUL 1IQ3A 1AUIB 1F8HA 5CSNA 2LP2A 2KAYA 2ISDA 2M7NA 1DGUA 4YGBB 2MLEC 2F3YA 3DVJA 3FWBA 4MZLA 1WDCC 1QLSA 1RTP1 1XA5A 2PMYA 4C0JA 3JTDC 3WXAA 2MJWB 2M0RA 2VRGA 1C7WA 4F0ZB 3I5IC 2L2EA 2MRDA 4UPGA 4QJ5B 1CMGA 3O2PA 1K94A 1SL7A 3CWGA 2GGMA 5DKRA 2JXLA 2KNEA 5I2QA 1EJ3A 1XK4A 2OTGC 3FIAA 1KFXS 1L2OB 1IWQA 1WLZA 2ZRTA 2PALA 1CLBA 1GGZA 4M2QA 2ZNDA 3DF0A 1KWOC 4NDDA 3BQ3A 4OV2A 3SG7A 3PATA 1BR4B 2JT0A 1PSBA 3NSKA 3BXKA 5HLOA 1CDLA 1SL8A 2H2KA 3PM8A 2QPTA 4C0LA 1B8CA 1PSRA 1YUUA 3DVEA 3I5GB 2OS8C 3KPXA 1CLMA 3VRQA 1B4CA 2L5XB 2Y5IA 1IQ5A 1BF5A 2K0JA 1SCVA 1F4OA 2COLB 3A4UB 1SPYA 2NCOA 4D1EA 1YR5A 2LC5A 1FI6A 4GPLB 1A4PA 3JVTC 1CB1A 1DJWA 4CFQA 4ETOA 1PK0D 1DJHA 4E68A 5KSZA 1HQVA 4PCWA 1ODBA 4CFRA 1CFDA 1MF8B 4PHKA 1WRZA 3D0YA 1OZOA 1W7IB 4DCKA 1QTXA 3AKBA 1TTXA 2B1UA 1SW8A 1BT6A 1UHKA 4AOMA 5ER4X 1WRKA 2LV7A 2JULA 3MSEB 1PVBA 3OX5A 1S6IA 3TS5C 4I5JA 1A75A 2EC6B 3OB2B 4MRYA 3GK1A 2KYFA 2M97A 2LLSA 1D1OA 1R6PA 4HRHA 1S6CA 1JF0A 3EVVA 1B7TZ 1QLKA 2G2BA 1KFXL 1BOCA 4XJKB 5I8NA 2SASA 1QVIZ 1SMGA 1YUTA 2BCAA 3KO0A 1M63B 4CPVA 1PALA 2FOTA 1TNQA 2QACA 1CM4A 3OP0A 1CNPA 1PVAA 1JC2A 2LVKA 2KBIA 2RGIA 1KSOA 1RECA 1XYDA 4DUQA 1W7JB 3TDUA 2JT3A 2LP3A 1N2DA 3HX4A 1OMDA 2FCDA 2CXJA 2KFFA 1FF1A 1S5GZ 3VRRA 1DJGA 2LMUA 2MLFC 4NDCA 1CMFA 4JQ0D 3I5FB 1J7QA 2Q91A 2K2FA 2FCEA 2KSPA 4DIRA 3IQQA 1ZFSA 4N1GA 1MWNA 3HCMA 4OR9B 1Q80A 2R2IA 1C07A 3LL8B 4PHMA 2V53A 4CIDA 1QASA 1ZUZA 1FBVA 2BE4A 1B1GA 2KYCA 2L0PA 4HREE 1R2UA 2EHBA 2ZN8A 1OE9B 1IRJA 3GK4X 2BL0B 1YUSA 5AANA 2BCXA 4I5LB 2M49B 4GGFA 2G9BA 2JQ6A 3IQOA 1G8IA 3OB1B 4YGAA 3ZWHA 2GGZA 3AKAA 2E30A 3SIAA 2CT9A 1IJ5A 3O4YA 3TZ1A 2O5GA 3H4SE 4MZKA 1A29A 2OPOA 4AQJA 1K9PA 1AVSA 1YRTB 2KI6D 2M1KB 4R1EA 2BBMA 3K21A 4WQ3A 2E6WA 4NDBA 4QJ3B 4YGEB 1UURA 1L2OC 2JC2A 2LLTA 2LMTA 2LM5A 3IF7A 2ZNEA 5KU1A 1UP5A 2CBLA 1TNPA 1FI5A 2GV5A 2I2RE 1XFWO 2KGBC 2MHHA 5B8IB 2LVJA 3C1VA 4C0KA 3ICBA 2JRFA 3BUMB 4I5KA 2NZ0A 3EVUA 3BYAA 1Y1XA 3I5HB 3SG6A 1JUOA 3I5GC 1GJYA 1SL9A 2K7OA 4PDZA 3CS1A 1L7ZA 1SCMC 2LE9B 4DS7A 2WCFA 1YX8A 3DF0B 4PE1A 3TDIA 4A4BA 1JFJA 3LK1A 4MSPA 4MN0A 1B8RA 1XFUO 1B7TY 2LUXA 2PASA 2KQYA 1G4YR 2L98A 2P6BB 1S3PA 1QVIY 2WNDA 1EG4A 2JZIA 1PRWA 1UHHA 1YURA 1DT7B 1FW4A 1JFKA 5IBWA 3FWCA 2EGDA 5HLVA 1EL4A 4YI8A 1TNXA 5TNCA 3WHUB 2EC6C 1LXFC 1DJYA 1LINA 5F6TA 2M3WA 1M31A 1S5GY 1V1FA 1YVLA 3SIBA 4YBHB 1YTZC 4GAOA 1MXLC 1F70A 4Q04A 1K90D 1DGVA 2WC8A 1B9AA 1UHNA 5AEQA 2LVIA 5CSFA 2F3ZA 3EKHA 1NWDA 4M2PA 5J3XA 4FTGA 1A2XA 3EK8A 3F45A 5D7FA 5HYDA 3AAKA 1G33A 1RK9A 1WRLA 2M29A 2L50A 4MLWA 4PHNA 1YX7A 2HPSA 4OKHA 5CSIA 2KFHA 2KAVA 4PE0A 2JNFA 1DJZA 2K8MB 1HT9A 1XFVO 3I5FC 4PE4A 2H61C 4AQIA 1XVJA 5K89A 1ZMZA 1S36A 1ALVA 3CR4X 1TIZA 1IJ6A 2MA2A 2JTZA 2BECA 3CTNA 3CLNA 5HKYA 2I18A 3QRXA 3O6BA 2I7AA 1QX7A 1AP4A 1TCOB 3BUOB 2BL0C 1MR8A 1A03A 1SRAA 1XFYO 2DOQA 2JPTA 3GK2A 1LA0A 4GUKA 2SCPA 3VGOA 4HSZA 1CDMA 3NSIA 4ZCVA 1TNWA 3CR5X 3WHTB 1NP8A 1NCZA 1JWDA 1LA3A 2KBMA 4GBAA 2LVVA 1SKTA 4OCIA 1YRUB 1N0YA 3SG3A 1NIWA 4ORBB 2LHIA 3ZNIA 1CTRA 1QV1A 4YRUA 1E8AA 2JU0A 3CZTX 3VROA 1CDNA 2AAOA 2HQ8A 3BOWB 3NSOA 3OHMB 1U5IA 1NX2A 3I5HC 2NCPA 2CNPA 3PN7B 5JJGA 4ORAB 1JBAA 1S1EA 4CLNA 1OMVA 4A4CA 1B8LA 3EKJA 2KHNA 5DKQA 4MRXA 2M1UA 1MXEA 2ZRSA 1KQMB 1MQ1A 1OQPA 1RJVA 1SR6B 4MEWA 2PRUA 2H61A 5AXIA 2F33A 1NUBA 2Y4QA 3A8RA 2WORA 4MZJA 1MHOA 3TUYB 1XO5A 2PSRA 2FJUB 2BE6A 2JT8A 2ZN9A 1FPWA 2Q4UA 1NCYA 1J1EA 4NQGA 4IL1A 1SYMA 3D10A 1DF0A 1BODA 1CKKA 2BKIB 1QIVA 2KI4B 4P5OE 2LAPA 3PALA 1QIWA 1NCXA 2NXQA 1QV0A 1Y6WA 2AUCA 2PVBA 1EG3A 3KF9A 1NX3A 5G08A 1SBJA 4OVNF 2M8UA 2KOTA 1KK8B 2D8NA 1AJ4A 2LNKA 1BJFA 1UHJA 2L4HA 4I5NB 3WNXB 3PLFB 1OSAA 1CFFA 2LHLA 1GGWA 5GQQC 1TCFA 4JWQA 4N1FA 3TDZA 2JNXA 1BR1B 2BBNA 4PHJA 1MUXA 1BU3A 5CPVA 1C7VA 3VRNA 4P2YB 4GFTA 1J1DA 1DTLA 1NX0A 1Y1UA 5PALA 1OMRA 1QX5B 2KGRA 1IH0A 2LANA 2MBXA 1JSAA 4PE7A 1RWYA 1YVHA 4L9MA 1XFZO 1UUSA 1ALWA 1K9KA 4WRIA 3SG2A 3RM1A 1F4QA 1QX2A 1CLLA 2JXCA 1Y0VH 2L51A 4DRWA 3D0YB 1B47A 1GQMA 4U8DA 3M0WA 1DJIA 1WDCB 1TRFA 3EK7A 1ZACA 1J55A 3BUNB 2F2PA 3JTDB 2CTNA 4YI9A 1F55A 1QS7A 4TNCA 1A75B 1OZSA 2TN4A 1CFPA 3I5IB 3KHEA 3NXAA 1CDPA 1BMOA 1KK7Z 2LLUA 3KEVA 1IG5A 2KI6C 2Y1MA 5AERA 1SCMB 1SY9A 2KAXA 2MAZA 4M2OA 1TOPA 4YGCB 4ZCUA 1LKJA 1SK6D 2OTGB 3CR2A 4FQOA 2Y1NA 1K93D 3NSLA 1WLMA 4PALA 3OX6A 2HETA 1KWOB 5HKZA 3BUXB 1S6JA 4GGFC 1J7PA 2BKHB 4ORCB 1K95A 3EVRA 1H4BA 1AK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUL A;  2LMV A;  2WOS A;  2OS8 B;  5BPJ A;  1KCY A;  2L4I A;  1J7R A;  3EK4 A;  2ZFD A;  1EH2 A;  1CM1 A;  2A4J A;  4XYN A;  3PN7 C;  2JTT A;  2I94 A;  5D69 A;  3PSR A;  1NYA A;  1TN4 A;  1K96 A;  2JOJ A;  4MBE A;  1VRK A;  3BUW B;  2K7C A;  3DVM A;  5KTY A;  3JVT B;  1KQM C;  3DVK A;  3PFV A;  2LCP A;  1KFU S;  1OOJ A;  1RFJ A;  2F2O A;  1SR6 C;  3SG4 A;  2F8P A;  5I2L A;  1XFX O;  4QJ4 B;  1M45 A;  1UWO A;  4XJK A;  1DVI A;  1X02 A;  1M39 A;  3TUY C;  1BG1 A;  1U5I B;  1QXP A;  3O78 A;  2IS9 A;  1V1G A;  3LCP C;  1IKU A;  3GOF A;  2WCE A;  2K7D A;  1QJT A;  3TS5 B;  1QAT A;  4GGN A;  5ER5 A;  2ZKM X;  5JOL A;  4USL A;  3AAJ A;  1UHI A;  2KI4 C;  1K8U A;  2HQW A;  3LLE A;  4JPZ B;  1CFC A;  1WY9 A;  2KFG A;  3DD4 A;  4GNK B;  4MVF A;  1XK4 C;  5CSJ A;  3SG5 A;  1F71 A;  1SNL A;  2CCM A;  1KQV A;  2KDH A;  1DJX A;  5I2O A;  2WCB A;  1KK8 C;  2JWW A;  4HRG A;  4ICB A;  2K2A A;  1NSH A;  1BLQ A;  1N65 A;  5HKW A;  3LK0 A;  1RRO A;  2LUC A;  4WQ2 A;  4BY5 A;  1DF0 B;  1K2H A;  1ZOT B;  1H8B A;  5AFP A;  1EXR A;  5DKN A;  3RLZ A;  1S26 D;  5FYX A;  2NLN A;  1NPQ A;  3SJS A;  1KSM A;  1J7O A;  2K7B A;  1NX1 A;  2BCB A;  4BY4 A;  1IGV A;  2M9G A;  1M46 A;  1Y1A A;  3FS7 A;  3BOW A;  1K9U A;  1JF2 A;  3CGA A;  3E3R A;  2HF5 A;  1DMO A;  4YGD B;  2KQ6 A;  2K61 A;  1AHR A;  1KK7 Y;  1F54 A;  1LVC D;  1AJ5 A;  2M7L A;  2O60 A;  3VRP A;  4N5X A;  2AMI A;  1KFU L;  1IQ3 A;  1AUI B;  1F8H A;  5CSN A;  2LP2 A;  2KAY A;  2ISD A;  2M7N A;  1DGU A;  4YGB B;  2MLE C;  2F3Y A;  3DVJ A;  3FWB A;  4MZL A;  1WDC C;  1QLS A;  1RTP 1;  1XA5 A;  2PMY A;  4C0J A;  3JTD C;  3WXA A;  2MJW B;  2M0R A;  2VRG A;  1C7W A;  4F0Z B;  3I5I C;  2L2E A;  2MRD A;  4UPG A;  4QJ5 B;  1CMG A;  3O2P A;  1K94 A;  1SL7 A;  3CWG A;  2GGM A;  5DKR A;  2JXL A;  2KNE A;  5I2Q A;  1EJ3 A;  1XK4 A;  2OTG C;  3FIA A;  1KFX S;  1L2O B;  1IWQ A;  1WLZ A;  2ZRT A;  2PAL A;  1CLB A;  1GGZ A;  4M2Q A;  2ZND A;  3DF0 A;  1KWO C;  4NDD A;  3BQ3 A;  4OV2 A;  3SG7 A;  3PAT A;  1BR4 B;  2JT0 A;  1PSB A;  3NSK A;  3BXK A;  5HLO A;  1CDL A;  1SL8 A;  2H2K A;  3PM8 A;  2QPT A;  4C0L A;  1B8C A;  1PSR A;  1YUU A;  3DVE A;  3I5G B;  2OS8 C;  3KPX A;  1CLM A;  3VRQ A;  1B4C A;  2L5X B;  2Y5I A;  1IQ5 A;  1BF5 A;  2K0J A;  1SCV A;  1F4O A;  2COL B;  3A4U B;  1SPY A;  2NCO A;  4D1E A;  1YR5 A;  2LC5 A;  1FI6 A;  4GPL B;  1A4P A;  3JVT C;  1CB1 A;  1DJW A;  4CFQ A;  4ETO A;  1PK0 D;  1DJH A;  4E68 A;  5KSZ A;  1HQV A;  4PCW A;  1ODB A;  4CFR A;  1CFD A;  1MF8 B;  4PHK A;  1WRZ A;  3D0Y A;  1OZO A;  1W7I B;  4DCK A;  1QTX A;  3AKB A;  1TTX A;  2B1U A;  1SW8 A;  1BT6 A;  1UHK A;  4AOM A;  5ER4 X;  1WRK A;  2LV7 A;  2JUL A;  3MSE B;  1PVB A;  3OX5 A;  1S6I A;  3TS5 C;  4I5J A;  1A75 A;  2EC6 B;  3OB2 B;  4MRY A;  3GK1 A;  2KYF A;  2M97 A;  2LLS A;  1D1O A;  1R6P A;  4HRH A;  1S6C A;  1JF0 A;  3EVV A;  1B7T Z;  1QLK A;  2G2B A;  1KFX L;  1BOC A;  4XJK B;  5I8N A;  2SAS A;  1QVI Z;  1SMG A;  1YUT A;  2BCA A;  3KO0 A;  1M63 B;  4CPV A;  1PAL A;  2FOT A;  1TNQ A;  2QAC A;  1CM4 A;  3OP0 A;  1CNP A;  1PVA A;  1JC2 A;  2LVK A;  2KBI A;  2RGI A;  1KSO A;  1REC A;  1XYD A;  4DUQ A;  1W7J B;  3TDU A;  2JT3 A;  2LP3 A;  1N2D A;  3HX4 A;  1OMD A;  2FCD A;  2CXJ A;  2KFF A;  1FF1 A;  1S5G Z;  3VRR A;  1DJG A;  2LMU A;  2MLF C;  4NDC A;  1CMF A;  4JQ0 D;  3I5F B;  1J7Q A;  2Q91 A;  2K2F A;  2FCE A;  2KSP A;  4DIR A;  3IQQ A;  1ZFS A;  4N1G A;  1MWN A;  3HCM A;  4OR9 B;  1Q80 A;  2R2I A;  1C07 A;  3LL8 B;  4PHM A;  2V53 A;  4CID A;  1QAS A;  1ZUZ A;  1FBV A;  2BE4 A;  1B1G A;  2KYC A;  2L0P A;  4HRE E;  1R2U A;  2EHB A;  2ZN8 A;  1OE9 B;  1IRJ A;  3GK4 X;  2BL0 B;  1YUS A;  5AAN A;  2BCX A;  4I5L B;  2M49 B;  4GGF A;  2G9B A;  2JQ6 A;  3IQO A;  1G8I A;  3OB1 B;  4YGA A;  3ZWH A;  2GGZ A;  3AKA A;  2E30 A;  3SIA A;  2CT9 A;  1IJ5 A;  3O4Y A;  3TZ1 A;  2O5G A;  3H4S E;  4MZK A;  1A29 A;  2OPO A;  4AQJ A;  1K9P A;  1AVS A;  1YRT B;  2KI6 D;  2M1K B;  4R1E A;  2BBM A;  3K21 A;  4WQ3 A;  2E6W A;  4NDB A;  4QJ3 B;  4YGE B;  1UUR A;  1L2O C;  2JC2 A;  2LLT A;  2LMT A;  2LM5 A;  3IF7 A;  2ZNE A;  5KU1 A;  1UP5 A;  2CBL A;  1TNP A;  1FI5 A;  2GV5 A;  2I2R E;  1XFW O;  2KGB C;  2MHH A;  5B8I B;  2LVJ A;  3C1V A;  4C0K A;  3ICB A;  2JRF A;  3BUM B;  4I5K A;  2NZ0 A;  3EVU A;  3BYA A;  1Y1X A;  3I5H B;  3SG6 A;  1JUO A;  3I5G C;  1GJY A;  1SL9 A;  2K7O A;  4PDZ A;  3CS1 A;  1L7Z A;  1SCM C;  2LE9 B;  4DS7 A;  2WCF A;  1YX8 A;  3DF0 B;  4PE1 A;  3TDI A;  4A4B A;  1JFJ A;  3LK1 A;  4MSP A;  4MN0 A;  1B8R A;  1XFU O;  1B7T Y;  2LUX A;  2PAS A;  2KQY A;  1G4Y R;  2L98 A;  2P6B B;  1S3P A;  1QVI Y;  2WND A;  1EG4 A;  2JZI A;  1PRW A;  1UHH A;  1YUR A;  1DT7 B;  1FW4 A;  1JFK A;  5IBW A;  3FWC A;  2EGD A;  5HLV A;  1EL4 A;  4YI8 A;  1TNX A;  5TNC A;  3WHU B;  2EC6 C;  1LXF C;  1DJY A;  1LIN A;  5F6T A;  2M3W A;  1M31 A;  1S5G Y;  1V1F A;  1YVL A;  3SIB A;  4YBH B;  1YTZ C;  4GAO A;  1MXL C;  1F70 A;  4Q04 A;  1K90 D;  1DGV A;  2WC8 A;  1B9A A;  1UHN A;  5AEQ A;  2LVI A;  5CSF A;  2F3Z A;  3EKH A;  1NWD A;  4M2P A;  5J3X A;  4FTG A;  1A2X A;  3EK8 A;  3F45 A;  5D7F A;  5HYD A;  3AAK A;  1G33 A;  1RK9 A;  1WRL A;  2M29 A;  2L50 A;  4MLW A;  4PHN A;  1YX7 A;  2HPS A;  4OKH A;  5CSI A;  2KFH A;  2KAV A;  4PE0 A;  2JNF A;  1DJZ A;  2K8M B;  1HT9 A;  1XFV O;  3I5F C;  4PE4 A;  2H61 C;  4AQI A;  1XVJ A;  5K89 A;  1ZMZ A;  1S36 A;  1ALV A;  3CR4 X;  1TIZ A;  1IJ6 A;  2MA2 A;  2JTZ A;  2BEC A;  3CTN A;  3CLN A;  5HKY A;  2I18 A;  3QRX A;  3O6B A;  2I7A A;  1QX7 A;  1AP4 A;  1TCO B;  3BUO B;  2BL0 C;  1MR8 A;  1A03 A;  1SRA A;  1XFY O;  2DOQ A;  2JPT A;  3GK2 A;  1LA0 A;  4GUK A;  2SCP A;  3VGO A;  4HSZ A;  1CDM A;  3NSI A;  4ZCV A;  1TNW A;  3CR5 X;  3WHT B;  1NP8 A;  1NCZ A;  1JWD A;  1LA3 A;  2KBM A;  4GBA A;  2LVV A;  1SKT A;  4OCI A;  1YRU B;  1N0Y A;  3SG3 A;  1NIW A;  4ORB B;  2LHI A;  3ZNI A;  1CTR A;  1QV1 A;  4YRU A;  1E8A A;  2JU0 A;  3CZT X;  3VRO A;  1CDN A;  2AAO A;  2HQ8 A;  3BOW B;  3NSO A;  3OHM B;  1U5I A;  1NX2 A;  3I5H C;  2NCP A;  2CNP A;  3PN7 B;  5JJG A;  4ORA B;  1JBA A;  1S1E A;  4CLN A;  1OMV A;  4A4C A;  1B8L A;  3EKJ A;  2KHN A;  5DKQ A;  4MRX A;  2M1U A;  1MXE A;  2ZRS A;  1KQM B;  1MQ1 A;  1OQP A;  1RJV A;  1SR6 B;  4MEW A;  2PRU A;  2H61 A;  5AXI A;  2F33 A;  1NUB A;  2Y4Q A;  3A8R A;  2WOR A;  4MZJ A;  1MHO A;  3TUY B;  1XO5 A;  2PSR A;  2FJU B;  2BE6 A;  2JT8 A;  2ZN9 A;  1FPW A;  2Q4U A;  1NCY A;  1J1E A;  4NQG A;  4IL1 A;  1SYM A;  3D10 A;  1DF0 A;  1BOD A;  1CKK A;  2BKI B;  1QIV A;  2KI4 B;  4P5O E;  2LAP A;  3PAL A;  1QIW A;  1NCX A;  2NXQ A;  1QV0 A;  1Y6W A;  2AUC A;  2PVB A;  1EG3 A;  3KF9 A;  1NX3 A;  5G08 A;  1SBJ A;  4OVN F;  2M8U A;  2KOT A;  1KK8 B;  2D8N A;  1AJ4 A;  2LNK A;  1BJF A;  1UHJ A;  2L4H A;  4I5N B;  3WNX B;  3PLF B;  1OSA A;  1CFF A;  2LHL A;  1GGW A;  5GQQ C;  1TCF A;  4JWQ A;  4N1F A;  3TDZ A;  2JNX A;  1BR1 B;  2BBN A;  4PHJ A;  1MUX A;  1BU3 A;  5CPV A;  1C7V A;  3VRN A;  4P2Y B;  4GFT A;  1J1D A;  1DTL A;  1NX0 A;  1Y1U A;  5PAL A;  1OMR A;  1QX5 B;  2KGR A;  1IH0 A;  2LAN A;  2MBX A;  1JSA A;  4PE7 A;  1RWY A;  1YVH A;  4L9M A;  1XFZ O;  1UUS A;  1ALW A;  1K9K A;  4WRI A;  3SG2 A;  3RM1 A;  1F4Q A;  1QX2 A;  1CLL A;  2JXC A;  1Y0V H;  2L51 A;  4DRW A;  3D0Y B;  1B47 A;  1GQM A;  4U8D A;  3M0W A;  1DJI A;  1WDC B;  1TRF A;  3EK7 A;  1ZAC A;  1J55 A;  3BUN B;  2F2P A;  3JTD B;  2CTN A;  4YI9 A;  1F55 A;  1QS7 A;  4TNC A;  1A75 B;  1OZS A;  2TN4 A;  1CFP A;  3I5I B;  3KHE A;  3NXA A;  1CDP A;  1BMO A;  1KK7 Z;  2LLU A;  3KEV A;  1IG5 A;  2KI6 C;  2Y1M A;  5AER A;  1SCM B;  1SY9 A;  2KAX A;  2MAZ A;  4M2O A;  1TOP A;  4YGC B;  4ZCU A;  1LKJ A;  1SK6 D;  2OTG B;  3CR2 A;  4FQO A;  2Y1N A;  1K93 D;  3NSL A;  1WLM A;  4PAL A;  3OX6 A;  2HET A;  1KWO B;  5HKZ A;  3BUX B;  1S6J A;  4GGF C;  1J7P A;  2BKH B;  4ORC B;  1K95 A;  3EVR A;  1H4B A;  1AK8 A; 
#chains in the Genus database with same CATH topology
 1PUL A;  2LMV A;  2WOS A;  2OS8 B;  5BPJ A;  1KCY A;  2L4I A;  1J7R A;  3EK4 A;  2ZFD A;  2PYQ A;  1EH2 A;  1CM1 A;  2A4J A;  4XYN A;  3PN7 C;  2JTT A;  2QDI A;  2I94 A;  5D69 A;  3PSR A;  1NYA A;  1TN4 A;  1K96 A;  2JOJ A;  4MBE A;  1VRK A;  3BUW B;  2K7C A;  2QEV A;  2QEO A;  3DVM A;  5KTY A;  3JVT B;  1KQM C;  3DVK A;  3PFV A;  2LCP A;  1KFU S;  1OOJ A;  1RFJ A;  2F2O A;  1SR6 C;  3SG4 A;  1DEK A;  2F8P A;  5I2L A;  1XFX O;  4QJ4 B;  1M45 A;  1UWO A;  4XJK A;  1DVI A;  1X02 A;  1M39 A;  3TUY C;  1BG1 A;  1U5I B;  1QXP A;  3O78 A;  2IS9 A;  1V1G A;  3LCP C;  2WC5 A;  3GOF A;  1IKU A;  2WCE A;  3QME A;  2K7D A;  1QJT A;  3TS5 B;  1QAT A;  1Z2C B;  4GGN A;  5ER5 A;  2ZKM X;  5JOL A;  4USL A;  3AAJ A;  1UHI A;  2KI4 C;  1K8U A;  2HQW A;  1OOG A;  3LLE A;  4JPZ B;  1WY9 A;  2KFG A;  3DD4 A;  3EG5 B;  3N7H A;  1XK4 C;  4GNK B;  4MVF A;  5CSJ A;  3SS4 A;  3SG5 A;  1SNL A;  2CCM A;  1KQV A;  2KDH A;  1DJX A;  5I2O A;  2QEB A;  2WCB A;  1KK8 C;  2JWW A;  4HRG A;  4ICB A;  2K2A A;  1NSH A;  1BLQ A;  1N65 A;  2JPO A;  5HKW A;  3LK0 A;  1RRO A;  2LUC A;  4WQ2 A;  4BY5 A;  1DF0 B;  1K2H A;  1ZOT B;  1H8B A;  5AFP A;  1EXR A;  5DKN A;  3VB1 A;  3V2L A;  3RLZ A;  1S26 D;  5FYX A;  2NLN A;  1NPQ A;  3SJS A;  1KSM A;  3D76 A;  1J7O A;  2K7B A;  1NX1 A;  2BCB A;  4BY4 A;  1IGV A;  2M9G A;  1M46 A;  1Y1A A;  3FS7 A;  3BFB A;  1K9U A;  3BOW A;  1JF2 A;  3CGA A;  3E3R A;  2HF5 A;  2P70 A;  4YGD B;  2KQ6 A;  2K61 A;  1DMO A;  1AHR A;  1KK7 Y;  1F54 A;  1LVC D;  3B7A A;  1AJ5 A;  2M7L A;  2O60 A;  3NHT A;  4N5X A;  3VRP A;  2AMI A;  1KFU L;  1IQ3 A;  1AUI B;  1F8H A;  3BFA A;  3O4X A;  5CSN A;  2LP2 A;  1OW4 A;  2KAY A;  2WCH A;  2ISD A;  2M7N A;  1DGU A;  4YGB B;  2MLE C;  2F3Y A;  3DVJ A;  3FWB A;  1TUJ A;  4MZL A;  1WDC C;  1QLS A;  1RTP 1;  1XA5 A;  2PMY A;  4C0J A;  3JTD C;  3WXA A;  2MJW B;  2M0R A;  3K1E A;  2VRG A;  1C7W A;  4INW A;  1CFC A;  4F0Z B;  3I5I C;  2L2E A;  2MRD A;  4UPG A;  4QJ5 B;  1CMG A;  3O2P A;  1K94 A;  1SL7 A;  1C3Y A;  3CWG A;  2GGM A;  5DKR A;  2JXL A;  2KNE A;  5I2Q A;  1EJ3 A;  1XK4 A;  2OTG C;  3FIA A;  1KFX S;  1L2O B;  1IWQ A;  1WLZ A;  2ZRT A;  2PAL A;  1CLB A;  1GGZ A;  4M2Q A;  2H8V A;  2ZND A;  3DF0 A;  1TUZ A;  1KWO C;  4NDD A;  3L47 A;  1ORG A;  2P71 A;  1LS8 A;  3BQ3 A;  4OV2 A;  3SG7 A;  3PAT A;  1BR4 B;  2JT0 A;  1PSB A;  3NSK A;  3BXK A;  5HLO A;  1CDL A;  1SL8 A;  2H2K A;  3PM8 A;  2QPT A;  4C0L A;  1B8C A;  1PSR A;  1YUU A;  3DVE A;  3I5G B;  2OS8 C;  2WC6 A;  3KPX A;  1CLM A;  3VRQ A;  1B4C A;  2L5X B;  2Y5I A;  1IQ5 A;  1BF5 A;  3UNW A;  2K0J A;  1SCV A;  1F4O A;  2COL B;  3A4U B;  1SPY A;  2NCO A;  4D1E A;  1YR5 A;  2LC5 A;  3CYZ A;  3FE9 A;  1FI6 A;  1OOF A;  4GPL B;  3S0F A;  1A4P A;  3JVT C;  1CB1 A;  1DJW A;  4CFQ A;  4ETO A;  1PK0 D;  3PM2 A;  1DJH A;  4E68 A;  5KSZ A;  1HQV A;  1XFR A;  3FE8 A;  1ODB A;  4PCW A;  4CFR A;  1CFD A;  1MF8 B;  4PHK A;  1WRZ A;  1TWO A;  3D0Y A;  1OZO A;  1W7I B;  2WCL A;  1QTX A;  3AKB A;  4DCK A;  1TTX A;  1SW8 A;  2B1U A;  1BT6 A;  2ERB A;  1UHK A;  3R1V A;  4AOM A;  5ER4 X;  1WRK A;  2LV7 A;  2JUL A;  3MSE B;  1PVB A;  3B88 A;  3OX5 A;  1S6I A;  3TS5 C;  4I5J A;  1A75 A;  2EC6 B;  3OB2 B;  4MRY A;  3GK1 A;  2KYF A;  2M97 A;  2LLS A;  2YGU A;  1D1O A;  1R6P A;  4HRH A;  1S6C A;  1JF0 A;  1GM0 A;  3EVV A;  1B7T Z;  1QLK A;  2BAP A;  2G2B A;  3DZT A;  3UO9 A;  1KFX L;  4JD9 A;  1BOC A;  1DC1 A;  4XJK B;  5I8N A;  2SAS A;  1QVI Z;  1SMG A;  1YUT A;  2BCA A;  3KO0 A;  1DQE A;  1M63 B;  4CPV A;  1PAL A;  2FOT A;  1TNQ A;  2QAC A;  1CM4 A;  3OP0 A;  1CNP A;  1PVA A;  1JC2 A;  2LVK A;  2KBI A;  2RGI A;  1KSO A;  1REC A;  1XYD A;  4DUQ A;  1W7J B;  3TDU A;  5I94 A;  3B6X A;  2JT3 A;  2LP3 A;  1N2D A;  3PJI A;  3HX4 A;  5EL2 A;  1OMD A;  2FCD A;  2CXJ A;  3L4A A;  2KFF A;  3R1P A;  1S5G Z;  3VRR A;  1DJG A;  1P28 A;  2LMU A;  2MLF C;  1FF1 A;  4NDC A;  3FE6 A;  3S0G A;  5HL1 A;  1CMF A;  4JQ0 D;  3I5F B;  3CZ2 A;  1J7Q A;  2Q91 A;  2K2F A;  2FCE A;  2KSP A;  4DIR A;  3IQQ A;  1ZFS A;  4N1G A;  1MWN A;  3L4L A;  3HCM A;  4OR9 B;  1Q80 A;  2R2I A;  1C07 A;  3LL8 B;  4PHM A;  2V53 A;  4CID A;  1QAS A;  1ZUZ A;  1FBV A;  2BE4 A;  1B1G A;  2KYC A;  2L0P A;  4HRE E;  1R2U A;  2EHB A;  2ZN8 A;  1OE9 B;  1IRJ A;  3GK4 X;  2BL0 B;  1YUS A;  5AAN A;  2BCX A;  4I5L B;  2M49 B;  4GGF A;  2G9B A;  2JQ6 A;  3IQO A;  1G8I A;  3OB1 B;  4YGA A;  3ZWH A;  2GGZ A;  3AKA A;  3CZ0 A;  2E30 A;  3R72 A;  2CT9 A;  1IJ5 A;  3O4Y A;  3SIA A;  3TZ1 A;  2O5G A;  3H4S E;  4MZK A;  1A29 A;  2OPO A;  4AQJ A;  1K9P A;  1AVS A;  1YRT B;  2KI6 D;  2M1K B;  4R1E A;  2BBM A;  3K21 A;  4WQ3 A;  2E6W A;  4NDB A;  4QJ3 B;  4YGE B;  4JKT A;  1UUR A;  1L2O C;  2JC2 A;  2LLT A;  2LMT A;  2LM5 A;  3IF7 A;  2ZNE A;  5KU1 A;  1UP5 A;  2CBL A;  1TNP A;  1FI5 A;  2GV5 A;  2I2R E;  1XFW O;  2KGB C;  2MHH A;  5B8I B;  2LVJ A;  3C1V A;  4C0K A;  3ICB A;  2JRF A;  3BUM B;  3BJH A;  4I5K A;  2NZ0 A;  3EVU A;  3BYA A;  1Y1X A;  3I5H B;  5D3O A;  3SG6 A;  1JUO A;  3I5G C;  1GJY A;  1SL9 A;  2K7O A;  4PDZ A;  3CS1 A;  1L7Z A;  1SCM C;  2LE9 B;  4DS7 A;  3Q8I A;  2WCF A;  1YX8 A;  3DF0 B;  4PE1 A;  2FJY A;  3TDI A;  4A4B A;  1JFJ A;  3LK1 A;  1C3Z A;  4MSP A;  4MN0 A;  1B8R A;  1XFU O;  3D77 A;  1B7T Y;  2WCJ A;  2LUX A;  2PAS A;  2KQY A;  1G4Y R;  2L98 A;  2P6B B;  1S3P A;  1QVI Y;  2WND A;  1EG4 A;  3CZ1 A;  2JZI A;  1PRW A;  1UHH A;  1YUR A;  3D73 A;  1FW4 A;  1JFK A;  5IBW A;  1DT7 B;  3FWC A;  2EGD A;  5HLV A;  1EL4 A;  4YI8 A;  3OGN A;  1TNX A;  5TNC A;  3WHU B;  2EC6 C;  1LXF C;  3NHI A;  1DJY A;  3IVT A;  1LIN A;  5F6T A;  2M3W A;  1M31 A;  1S5G Y;  1V1F A;  1YVL A;  3SIB A;  4YBH B;  1YTZ C;  4GAO A;  2KLE A;  1MXL C;  1F70 A;  4Q04 A;  1K90 D;  1DGV A;  2WC8 A;  1B9A A;  1UHN A;  5AEQ A;  1IIO A;  2LVI A;  3B87 A;  5CSF A;  2F3Z A;  3EKH A;  1NWD A;  4M2P A;  5J3X A;  4FTG A;  1A2X A;  3EK8 A;  3F45 A;  5D7F A;  5HYD A;  3AAK A;  1G33 A;  1RK9 A;  1WRL A;  2M29 A;  2L50 A;  4MLW A;  4PHN A;  1YX7 A;  3CAB A;  2HPS A;  4OKH A;  3R1O A;  5CSI A;  2KFH A;  2KAV A;  4PE0 A;  2JNF A;  1DJZ A;  2K8M B;  1HT9 A;  1XFV O;  3I5F C;  4PE4 A;  2H61 C;  4AQI A;  1XVJ A;  5K89 A;  1ZMZ A;  1S36 A;  1ALV A;  2L5Y A;  3CR4 X;  1TIZ A;  1IJ6 A;  2MA2 A;  2JTZ A;  3D78 A;  2BEC A;  3CTN A;  3CLN A;  5HKY A;  2I18 A;  3QRX A;  3O6B A;  2I7A A;  1QX7 A;  5FI6 A;  3CDN A;  1TCO B;  1AP4 A;  3BUO B;  2BL0 C;  1MR8 A;  1A03 A;  1SRA A;  1XFY O;  2DOQ A;  2K60 A;  2JPT A;  3GK2 A;  4INX A;  1LA0 A;  4GUK A;  2SCP A;  2PQL A;  3VGO A;  4HSZ A;  1OOI X;  1CDM A;  3NSI A;  4ZCV A;  1TNW A;  3CR5 X;  3WHT B;  4IJ7 A;  1NP8 A;  1NCZ A;  1JWD A;  5FI7 A;  3D74 A;  1LA3 A;  2KBM A;  3S0A A;  4GBA A;  2WCM A;  2LVV A;  1SKT A;  4OCI A;  1YRU B;  3DY9 A;  1N0Y A;  3SG3 A;  1NIW A;  4ORB B;  2LHI A;  3B86 A;  3ZNI A;  1CTR A;  1QV1 A;  4YRU A;  1E8A A;  2JU0 A;  3CZT X;  3VRO A;  1CDN A;  2AAO A;  2HQ8 A;  3BOW B;  3NSO A;  3OHM B;  1U5I A;  1NX2 A;  3I5H C;  2NCP A;  2CNP A;  3PN7 B;  5JJG A;  1DEL A;  4ORA B;  2GTE A;  1S1E A;  4CLN A;  1JBA A;  1OMV A;  4A4C A;  4PT1 A;  1B8L A;  3EKJ A;  4KYN A;  2KHN A;  4FQT A;  5DKQ A;  1SSE B;  2M1U A;  4MRX A;  1MXE A;  2ZRS A;  1KQM B;  1MQ1 A;  3RZS A;  1T14 A;  1OQP A;  1RJV A;  1SR6 B;  4MEW A;  2PRU A;  2H61 A;  5AXI A;  2F33 A;  1NUB A;  2Y4Q A;  1F71 A;  3A8R A;  2WOR A;  4MZJ A;  1MHO A;  3TUY B;  1XO5 A;  2PSR A;  3OBV A;  2FJU B;  2BE6 A;  2JT8 A;  2ZN9 A;  1FPW A;  2Q4U A;  1NCY A;  1J1E A;  4NQG A;  4IL1 A;  1SYM A;  3D10 A;  1DF0 A;  1BOD A;  1CKK A;  2BKI B;  1QIV A;  2KI4 B;  1AK8 A;  4P5O E;  2LAP A;  3PAL A;  1QIW A;  3DYE A;  1NCX A;  2NXQ A;  1QV0 A;  1Y6W A;  2AUC A;  2PVB A;  1EG3 A;  1W9Z A;  1NX3 A;  3KF9 A;  1SBJ A;  4OVN F;  5G08 A;  2M8U A;  2KOT A;  1KK8 B;  2D8N A;  1AJ4 A;  2LNK A;  1BJF A;  1UHJ A;  2L4H A;  4OZD A;  4I5N B;  3WNX B;  4F7F A;  3S0D A;  3PLF B;  1OSA A;  1CFF A;  2LHL A;  1GGW A;  5GQQ C;  1TCF A;  4JWQ A;  4N1F A;  3TDZ A;  2JNX A;  1BR1 B;  2WCK A;  2BBN A;  4PHJ A;  1MUX A;  1BU3 A;  5CPV A;  1C7V A;  3VRN A;  4P2Y B;  4GFT A;  1J1D A;  1DTL A;  1NX0 A;  1Y1U A;  5PAL A;  1OMR A;  1QX5 B;  2KGR A;  1IH0 A;  3BFH A;  2LAN A;  2MBX A;  3S0B A;  1JSA A;  4PE7 A;  1RWY A;  1YVH A;  2KLD A;  5DIC A;  4L9M A;  1XFZ O;  1UUS A;  1ALW A;  1K9K A;  4WRI A;  3SG2 A;  3RM1 A;  1F4Q A;  1QX2 A;  1CLL A;  2JXC A;  2L2C A;  1Y0V H;  2L51 A;  3SS5 A;  3D0Y B;  4DRW A;  1B47 A;  1GQM A;  4U8D A;  3M0W A;  1DJI A;  1WDC B;  1TRF A;  2QEH A;  1ZAC A;  3D75 A;  3EK7 A;  1J55 A;  5FI2 A;  3BUN B;  2F2P A;  3JTD B;  2CTN A;  4YI9 A;  1F55 A;  1QS7 A;  4TNC A;  1Z4H A;  1A75 B;  1OZS A;  2TN4 A;  1CFP A;  3I5I B;  3KHE A;  3NXA A;  1CDP A;  1BMO A;  1KK7 Z;  2LLU A;  3KEV A;  3SS3 A;  3S0E A;  1IG5 A;  2KI6 C;  2Y1M A;  5AER A;  1SCM B;  1SY9 A;  2KAX A;  2MAZ A;  4M2O A;  3DXL A;  1TOP A;  4YGC B;  2KPH A;  4ZCU A;  1LKJ A;  1SK6 D;  2OTG B;  3CR2 A;  4FQO A;  2BNX A;  2Y1N A;  1K93 D;  3NSL A;  1WLM A;  4PAL A;  3OX6 A;  2HET A;  1KWO B;  5HKZ A;  3BUX B;  1QWV A;  1S6J A;  3NGV A;  4GGF C;  1J7P A;  2BKH B;  4ORC B;  1K95 A;  3EVR A;  1H4B A;  1OOH A; 
#chains in the Genus database with same CATH homology
 1PUL A;  2LMV A;  2WOS A;  2OS8 B;  5BPJ A;  1KCY A;  2L4I A;  1J7R A;  3EK4 A;  2ZFD A;  1EH2 A;  1CM1 A;  2A4J A;  4XYN A;  3PN7 C;  2JTT A;  2I94 A;  5D69 A;  3PSR A;  1NYA A;  1TN4 A;  1K96 A;  2JOJ A;  4MBE A;  1VRK A;  3BUW B;  2K7C A;  3DVM A;  5KTY A;  3JVT B;  1KQM C;  3DVK A;  3PFV A;  2LCP A;  1KFU S;  1OOJ A;  1RFJ A;  2F2O A;  1SR6 C;  3SG4 A;  2F8P A;  5I2L A;  1XFX O;  4QJ4 B;  1M45 A;  1UWO A;  4XJK A;  1DVI A;  1X02 A;  1M39 A;  3TUY C;  1BG1 A;  1U5I B;  1QXP A;  3O78 A;  2IS9 A;  1V1G A;  3LCP C;  1IKU A;  3GOF A;  2WCE A;  2K7D A;  1QJT A;  3TS5 B;  1QAT A;  4GGN A;  5ER5 A;  2ZKM X;  5JOL A;  4USL A;  3AAJ A;  1UHI A;  2KI4 C;  1K8U A;  2HQW A;  3LLE A;  4JPZ B;  1CFC A;  1WY9 A;  2KFG A;  3DD4 A;  4GNK B;  4MVF A;  1XK4 C;  5CSJ A;  3SG5 A;  1F71 A;  1SNL A;  2CCM A;  1KQV A;  2KDH A;  1DJX A;  5I2O A;  2WCB A;  1KK8 C;  2JWW A;  4HRG A;  4ICB A;  2K2A A;  1NSH A;  1BLQ A;  1N65 A;  5HKW A;  3LK0 A;  1RRO A;  2LUC A;  4WQ2 A;  4BY5 A;  1DF0 B;  1K2H A;  1ZOT B;  1H8B A;  5AFP A;  1EXR A;  5DKN A;  3RLZ A;  1S26 D;  5FYX A;  2NLN A;  1NPQ A;  3SJS A;  1KSM A;  1J7O A;  2K7B A;  1NX1 A;  2BCB A;  4BY4 A;  1IGV A;  2M9G A;  1M46 A;  1Y1A A;  3FS7 A;  3BOW A;  1K9U A;  1JF2 A;  3CGA A;  3E3R A;  2HF5 A;  1DMO A;  4YGD B;  2KQ6 A;  2K61 A;  1AHR A;  1KK7 Y;  1F54 A;  1LVC D;  1AJ5 A;  2M7L A;  2O60 A;  3VRP A;  4N5X A;  2AMI A;  1KFU L;  1IQ3 A;  1AUI B;  1F8H A;  5CSN A;  2LP2 A;  2KAY A;  2ISD A;  2M7N A;  1DGU A;  4YGB B;  2MLE C;  2F3Y A;  3DVJ A;  3FWB A;  4MZL A;  1WDC C;  1QLS A;  1RTP 1;  1XA5 A;  2PMY A;  4C0J A;  3JTD C;  3WXA A;  2MJW B;  2M0R A;  2VRG A;  1C7W A;  4F0Z B;  3I5I C;  2L2E A;  2MRD A;  4UPG A;  4QJ5 B;  1CMG A;  3O2P A;  1K94 A;  1SL7 A;  3CWG A;  2GGM A;  5DKR A;  2JXL A;  2KNE A;  5I2Q A;  1EJ3 A;  1XK4 A;  2OTG C;  3FIA A;  1KFX S;  1L2O B;  1IWQ A;  1WLZ A;  2ZRT A;  2PAL A;  1CLB A;  1GGZ A;  4M2Q A;  2ZND A;  3DF0 A;  1KWO C;  4NDD A;  3BQ3 A;  4OV2 A;  3SG7 A;  3PAT A;  1BR4 B;  2JT0 A;  1PSB A;  3NSK A;  3BXK A;  5HLO A;  1CDL A;  1SL8 A;  2H2K A;  3PM8 A;  2QPT A;  4C0L A;  1B8C A;  1PSR A;  1YUU A;  3DVE A;  3I5G B;  2OS8 C;  3KPX A;  1CLM A;  3VRQ A;  1B4C A;  2L5X B;  2Y5I A;  1IQ5 A;  1BF5 A;  2K0J A;  1SCV A;  1F4O A;  2COL B;  3A4U B;  1SPY A;  2NCO A;  4D1E A;  1YR5 A;  2LC5 A;  1FI6 A;  4GPL B;  1A4P A;  3JVT C;  1CB1 A;  1DJW A;  4CFQ A;  4ETO A;  1PK0 D;  1DJH A;  4E68 A;  5KSZ A;  1HQV A;  4PCW A;  1ODB A;  4CFR A;  1CFD A;  1MF8 B;  4PHK A;  1WRZ A;  3D0Y A;  1OZO A;  1W7I B;  4DCK A;  1QTX A;  3AKB A;  1TTX A;  2B1U A;  1SW8 A;  1BT6 A;  1UHK A;  4AOM A;  5ER4 X;  1WRK A;  2LV7 A;  2JUL A;  3MSE B;  1PVB A;  3OX5 A;  1S6I A;  3TS5 C;  4I5J A;  1A75 A;  2EC6 B;  3OB2 B;  4MRY A;  3GK1 A;  2KYF A;  2M97 A;  2LLS A;  1D1O A;  1R6P A;  4HRH A;  1S6C A;  1JF0 A;  3EVV A;  1B7T Z;  1QLK A;  2G2B A;  1KFX L;  1BOC A;  4XJK B;  5I8N A;  2SAS A;  1QVI Z;  1SMG A;  1YUT A;  2BCA A;  3KO0 A;  1M63 B;  4CPV A;  1PAL A;  2FOT A;  1TNQ A;  2QAC A;  1CM4 A;  3OP0 A;  1CNP A;  1PVA A;  1JC2 A;  2LVK A;  2KBI A;  2RGI A;  1KSO A;  1REC A;  1XYD A;  4DUQ A;  1W7J B;  3TDU A;  2JT3 A;  2LP3 A;  1N2D A;  3HX4 A;  1OMD A;  2FCD A;  2CXJ A;  2KFF A;  1FF1 A;  1S5G Z;  3VRR A;  1DJG A;  2LMU A;  2MLF C;  4NDC A;  1CMF A;  4JQ0 D;  3I5F B;  1J7Q A;  2Q91 A;  2K2F A;  2FCE A;  2KSP A;  4DIR A;  3IQQ A;  1ZFS A;  4N1G A;  1MWN A;  3HCM A;  4OR9 B;  1Q80 A;  2R2I A;  1C07 A;  3LL8 B;  4PHM A;  2V53 A;  4CID A;  1QAS A;  1ZUZ A;  1FBV A;  2BE4 A;  1B1G A;  2KYC A;  2L0P A;  4HRE E;  1R2U A;  2EHB A;  2ZN8 A;  1OE9 B;  1IRJ A;  3GK4 X;  2BL0 B;  1YUS A;  5AAN A;  2BCX A;  4I5L B;  2M49 B;  4GGF A;  2G9B A;  2JQ6 A;  3IQO A;  1G8I A;  3OB1 B;  4YGA A;  3ZWH A;  2GGZ A;  3AKA A;  2E30 A;  3SIA A;  2CT9 A;  1IJ5 A;  3O4Y A;  3TZ1 A;  2O5G A;  3H4S E;  4MZK A;  1A29 A;  2OPO A;  4AQJ A;  1K9P A;  1AVS A;  1YRT B;  2KI6 D;  2M1K B;  4R1E A;  2BBM A;  3K21 A;  4WQ3 A;  2E6W A;  4NDB A;  4QJ3 B;  4YGE B;  1UUR A;  1L2O C;  2JC2 A;  2LLT A;  2LMT A;  2LM5 A;  3IF7 A;  2ZNE A;  5KU1 A;  1UP5 A;  2CBL A;  1TNP A;  1FI5 A;  2GV5 A;  2I2R E;  1XFW O;  2KGB C;  2MHH A;  5B8I B;  2LVJ A;  3C1V A;  4C0K A;  3ICB A;  2JRF A;  3BUM B;  4I5K A;  2NZ0 A;  3EVU A;  3BYA A;  1Y1X A;  3I5H B;  3SG6 A;  1JUO A;  3I5G C;  1GJY A;  1SL9 A;  2K7O A;  4PDZ A;  3CS1 A;  1L7Z A;  1SCM C;  2LE9 B;  4DS7 A;  2WCF A;  1YX8 A;  3DF0 B;  4PE1 A;  3TDI A;  4A4B A;  1JFJ A;  3LK1 A;  4MSP A;  4MN0 A;  1B8R A;  1XFU O;  1B7T Y;  2LUX A;  2PAS A;  2KQY A;  1G4Y R;  2L98 A;  2P6B B;  1S3P A;  1QVI Y;  2WND A;  1EG4 A;  2JZI A;  1PRW A;  1UHH A;  1YUR A;  1DT7 B;  1FW4 A;  1JFK A;  5IBW A;  3FWC A;  2EGD A;  5HLV A;  1EL4 A;  4YI8 A;  1TNX A;  5TNC A;  3WHU B;  2EC6 C;  1LXF C;  1DJY A;  1LIN A;  5F6T A;  2M3W A;  1M31 A;  1S5G Y;  1V1F A;  1YVL A;  3SIB A;  4YBH B;  1YTZ C;  4GAO A;  1MXL C;  1F70 A;  4Q04 A;  1K90 D;  1DGV A;  2WC8 A;  1B9A A;  1UHN A;  5AEQ A;  2LVI A;  5CSF A;  2F3Z A;  3EKH A;  1NWD A;  4M2P A;  5J3X A;  4FTG A;  1A2X A;  3EK8 A;  3F45 A;  5D7F A;  5HYD A;  3AAK A;  1G33 A;  1RK9 A;  1WRL A;  2M29 A;  2L50 A;  4MLW A;  4PHN A;  1YX7 A;  2HPS A;  4OKH A;  5CSI A;  2KFH A;  2KAV A;  4PE0 A;  2JNF A;  1DJZ A;  2K8M B;  1HT9 A;  1XFV O;  3I5F C;  4PE4 A;  2H61 C;  4AQI A;  1XVJ A;  5K89 A;  1ZMZ A;  1S36 A;  1ALV A;  3CR4 X;  1TIZ A;  1IJ6 A;  2MA2 A;  2JTZ A;  2BEC A;  3CTN A;  3CLN A;  5HKY A;  2I18 A;  3QRX A;  3O6B A;  2I7A A;  1QX7 A;  1AP4 A;  1TCO B;  3BUO B;  2BL0 C;  1MR8 A;  1A03 A;  1SRA A;  1XFY O;  2DOQ A;  2JPT A;  3GK2 A;  1LA0 A;  4GUK A;  2SCP A;  3VGO A;  4HSZ A;  1CDM A;  3NSI A;  4ZCV A;  1TNW A;  3CR5 X;  3WHT B;  1NP8 A;  1NCZ A;  1JWD A;  1LA3 A;  2KBM A;  4GBA A;  2LVV A;  1SKT A;  4OCI A;  1YRU B;  1N0Y A;  3SG3 A;  1NIW A;  4ORB B;  2LHI A;  3ZNI A;  1CTR A;  1QV1 A;  4YRU A;  1E8A A;  2JU0 A;  3CZT X;  3VRO A;  1CDN A;  2AAO A;  2HQ8 A;  3BOW B;  3NSO A;  3OHM B;  1U5I A;  1NX2 A;  3I5H C;  2NCP A;  2CNP A;  3PN7 B;  5JJG A;  4ORA B;  1JBA A;  1S1E A;  4CLN A;  1OMV A;  4A4C A;  1B8L A;  3EKJ A;  2KHN A;  5DKQ A;  4MRX A;  2M1U A;  1MXE A;  2ZRS A;  1KQM B;  1MQ1 A;  1OQP A;  1RJV A;  1SR6 B;  4MEW A;  2PRU A;  2H61 A;  5AXI A;  2F33 A;  1NUB A;  2Y4Q A;  3A8R A;  2WOR A;  4MZJ A;  1MHO A;  3TUY B;  1XO5 A;  2PSR A;  2FJU B;  2BE6 A;  2JT8 A;  2ZN9 A;  1FPW A;  2Q4U A;  1NCY A;  1J1E A;  4NQG A;  4IL1 A;  1SYM A;  3D10 A;  1DF0 A;  1BOD A;  1CKK A;  2BKI B;  1QIV A;  2KI4 B;  4P5O E;  2LAP A;  3PAL A;  1QIW A;  1NCX A;  2NXQ A;  1QV0 A;  1Y6W A;  2AUC A;  2PVB A;  1EG3 A;  3KF9 A;  1NX3 A;  5G08 A;  1SBJ A;  4OVN F;  2M8U A;  2KOT A;  1KK8 B;  2D8N A;  1AJ4 A;  2LNK A;  1BJF A;  1UHJ A;  2L4H A;  4I5N B;  3WNX B;  3PLF B;  1OSA A;  1CFF A;  2LHL A;  1GGW A;  5GQQ C;  1TCF A;  4JWQ A;  4N1F A;  3TDZ A;  2JNX A;  1BR1 B;  2BBN A;  4PHJ A;  1MUX A;  1BU3 A;  5CPV A;  1C7V A;  3VRN A;  4P2Y B;  4GFT A;  1J1D A;  1DTL A;  1NX0 A;  1Y1U A;  5PAL A;  1OMR A;  1QX5 B;  2KGR A;  1IH0 A;  2LAN A;  2MBX A;  1JSA A;  4PE7 A;  1RWY A;  1YVH A;  4L9M A;  1XFZ O;  1UUS A;  1ALW A;  1K9K A;  4WRI A;  3SG2 A;  3RM1 A;  1F4Q A;  1QX2 A;  1CLL A;  2JXC A;  1Y0V H;  2L51 A;  4DRW A;  3D0Y B;  1B47 A;  1GQM A;  4U8D A;  3M0W A;  1DJI A;  1WDC B;  1TRF A;  3EK7 A;  1ZAC A;  1J55 A;  3BUN B;  2F2P A;  3JTD B;  2CTN A;  4YI9 A;  1F55 A;  1QS7 A;  4TNC A;  1A75 B;  1OZS A;  2TN4 A;  1CFP A;  3I5I B;  3KHE A;  3NXA A;  1CDP A;  1BMO A;  1KK7 Z;  2LLU A;  3KEV A;  1IG5 A;  2KI6 C;  2Y1M A;  5AER A;  1SCM B;  1SY9 A;  2KAX A;  2MAZ A;  4M2O A;  1TOP A;  4YGC B;  4ZCU A;  1LKJ A;  1SK6 D;  2OTG B;  3CR2 A;  4FQO A;  2Y1N A;  1K93 D;  3NSL A;  1WLM A;  4PAL A;  3OX6 A;  2HET A;  1KWO B;  5HKZ A;  3BUX B;  1S6J A;  4GGF C;  1J7P A;  2BKH B;  4ORC B;  1K95 A;  3EVR A;  1H4B A;  1AK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...