2AMIA

Solution structure of the calcium-loaded n-terminal sensor domain of centrin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
RVGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal calcium sensor domain of centrin reveals the biochemical basis for domain-specific function.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Cell cycle
molecule keywords Caltractin
total genus 29
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2amiA00
5ER5A 2JTZA 3I5GC 4OR9B 1C7VA 1QJTA 4WRIA 1QVIY 5ER4X 2O60A 4N5XA 2KNEA 4P5OE 1DJYA 2M9GA 2KSPA 1H4BA 4I5KA 3BOWA 1J55A 2HQWA 1ALVA 1XFWO 2PRUA 4M2OA 5I2LA 3KF9A 2JWWA 4AQJA 4CFQA 4C0LA 2PMYA 2EGDA 2ZNEA 1SCVA 1WY9A 2KOTA 3CLNA 1F70A 2LM5A 1MUXA 1RK9A 4MRYA 1KSOA 1G8IA 1GQMA 1RWYA 3PN7B 1CLMA 1BJFA 2G9BA 2KAYA 2MHHA 4NDBA 1CDMA 5HLOA 3RM1A 1QX5B 1SW8A 1Y1AA 4C0JA 3GOFA 2KGRA 2MA2A 1KFUS 3F45A 2Y5IA 4YBHB 1NSHA 1SY9A 1XFVO 3KEVA 2DOQA 2JT8A 3WHUB 3WNXB 1EG4A 2LLUA 2K7OA 1DJWA 5AFPA 4YGDB 1BLQA 1H8BA 1UP5A 1YVHA 1B8CA 1K96A 2K7DA 4PALA 4OKHA 1YUTA 3FIAA 1AK8A 2L4IA 1KWOB 1QXPA 5BPJA 4Q04A 1NCXA 1OSAA 2CCMA 4PE0A 5HKZA 1UWOA 2M7NA 4CFRA 2KFGA 2FJUB 1QTXA 3CZTX 1BR1B 2F2OA 1LA3A 1PRWA 2HQ8A 3DF0A 3NSIA 3EVRA 4CIDA 4PHJA 1CB1A 2JPTA 1KK8B 1F4QA 1UHKA 2R2IA 1KQVA 1AHRA 2ZNDA 4MVFA 3MSEB 1AJ4A 1WRKA 2PASA 1KFXS 2JXLA 2KYFA 2OTGB 3LK0A 1TNWA 3GK4X 1CDPA 1UHIA 2JT0A 2LMTA 4N1GA 3WHTB 2GV5A 4MRXA 1N2DA 1EG3A 1TCFA 1K9KA 3WXAA 3TDIA 4I5JA 3SG5A 1QX2A 5CSNA 4JQ0D 1OOJA 1PULA 2H61A 2LAPA 1C07A 2KBIA 3BYAA 2KI4C 3KPXA 3O6BA 5D7FA 2KI4B 1NP8A 1HT9A 4WQ2A 1UHNA 1L2OB 3ZWHA 1MWNA 1CDLA 1V1FA 1CTRA 1MQ1A 4GGFC 4JPZB 1IH0A 4GPLB 1N65A 1K9PA 1WRZA 1ODBA 1S1EA 2LC5A 2WCFA 4ORAB 3SG4A 1ALWA 1CLLA 1D1OA 2AAOA 1JC2A 1KK7Z 2OS8C 1OQPA 4BY5A 5KTYA 1ZACA 4A4CA 1K9UA 1BU3A 1SRAA 3BUNB 1J1EA 3TDZA 2I94A 3PATA 2M49B 4QJ3B 3CR5X 1J7OA 1IJ5A 3JVTC 2O5GA 4D1EA 4YGBB 1IQ5A 3QRXA 2MRDA 3OHMB 5KU1A 1S6CA 2LP3A 2KFFA 1F8HA 2M3WA 2L2EA 1KSMA 1JUOA 2WORA 2BKHB 1VRKA 4USLA 1BG1A 3TS5C 1B47A 3NSKA 2F33A 1CFFA 3SG7A 2GGZA 5CSIA 1ZFSA 2K61A 1AVSA 1B4CA 2ZN9A 4NDDA 2D8NA 2M7LA 1N0YA 3CR4X 5KSZA 1OMDA 2KAVA 3PALA 3PM8A 3OB2B 1MF8B 1DJHA 1UHJA 2LP2A 2LVVA 3OP0A 2B1UA 3SJSA 1NX1A 1KFUL 2KHNA 1PALA 1A2XA 4NDCA 4ICBA 1A75B 1NCZA 4N1FA 4YRUA 1SR6C 2NZ0A 1QX7A 5FYXA 1LA0A 1Q80A 1SR6B 1OMRA 4TNCA 4GGNA 1K95A 1X02A 3KO0A 4XJKB 1DJZA 1LKJA 5HKWA 2MBXA 1YUUA 3GK2A 1SKTA 1OZOA 4QJ5B 2WNDA 1XFUO 1PSRA 1DF0B 1K93D 2QPTA 1IGVA 1Y6WA 3C1VA 3VRNA 1S5GZ 1NPQA 3I5IB 1G33A 4NQGA 2BCXA 2ZRTA 3I5IC 5K89A 1A29A 4R1EA 5CPVA 2NLNA 1PK0D 2WOSA 2OTGC 1K94A 2F3ZA 1QATA 2NCPA 2JQ6A 1U5IB 2JRFA 3OB1B 1M46A 1NYAA 2KFHA 1B8LA 1SCMC 2CBLA 2CXJA 2MLEC 1DF0A 1TNXA 3D0YA 3O4YA 3CWGA 4DS7A 1QIVA 2HETA 2NCOA 1NX2A 3PN7C 4FTGA 4MLWA 1JFJA 1JWDA 2ZN8A 1S6IA 2L98A 2BKIB 3K21A 1S6JA 1G4YR 1XK4A 1QV0A 4GUKA 2PALA 3JVTB 1TNQA 2M29A 3TDUA 2RGIA 3OX5A 1QLSA 1AUIB 1FW4A 1DJGA 3EK4A 1KQMC 3BUMB 2GGMA 2LMUA 2JTTA 4MZJA 5J3XA 1BMOA 1B9AA 2LUCA 5JJGA 1M45A 1C7WA 1WRLA 1SK6D 2FCDA 1JF2A 5IBWA 1XYDA 1YURA 4MZLA 1DT7B 1WDCC 2L5XB 2Y1MA 1WDCB 5HKYA 2LUXA 1W7JB 1SYMA 2H2KA 2WC8A 4OCIA 5TNCA 2CTNA 2KDHA 2FOTA 4QJ4B 1TTXA 1EH2A 5DKQA 3BXKA 2BL0B 1B8RA 3D10A 2BCBA 2KQYA 2Q91A 3I5FB 2OPOA 4WQ3A 1YR5A 1XVJA 4YI9A 1MR8A 2LHLA 1MHOA 4PCWA 2V53A 3CGAA 4HSZA 4GNKB 1CNPA 2Y1NA 2M1KB 3TUYC 3AKBA 1TNPA 2K2AA 2OS8B 4ORBB 3VRQA 1A03A 3E3RA 1B7TZ 3DVEA 1WLZA 4PHMA 1GJYA 2HF5A 4IL1A 2MJWB 1UURA 3DVMA 3NXAA 4DRWA 1TN4A 5AERA 1FI5A 2NXQA 2CNPA 2KI6D 2LVKA 1M31A 2FCEA 2LVIA 1IKUA 2AMIA 1CM4A 2JU0A 3VGOA 3CTNA 1F55A 1YRUB 2LLTA 1SL8A 2MAZA 4GAOA 2LCPA 5CSFA 1CMGA 2JULA 3TZ1A 1XFZO 3VRRA 5AXIA 3EKJA 1CKKA 1KQMB 4GFTA 4JWQA 3I5HB 3EVUA 1SPYA 3DD4A 2M97A 4YGEB 2VRGA 3FWCA 2KBMA 3LLEA 2SCPA 1K8UA 2TN4A 1RJVA 2PVBA 3HCMA 1JSAA 5DKRA 1PVAA 1TOPA 4OVNF 1EJ3A 1SNLA 2BE4A 3DF0B 1E8AA 1KFXL 1QIWA 5GQQC 3I5GB 2M0RA 1KK8C 2F3YA 3O78A 1M39A 1L2OC 1SBJA 2BL0C 2F8PA 5G08A 1A4PA 5I2QA 1TCOB 2JNXA 3BQ3A 3CS1A 1DJXA 1YTZC 3KHEA 3O2PA 2L51A 4BY4A 4OV2A 5PALA 1J7RA 2P6BB 4ZCUA 1YUSA 1S3PA 3BUOB 4MZKA 4PE7A 1AJ5A 1QV1A 1KWOC 1UHHA 3IQOA 2QACA 4M2PA 4MN0A 4CLNA 1DGVA 2WCBA 1OMVA 1V1GA 3OX6A 4ETOA 4A4BA 1MXLC 3SG3A 1A75A 1KCYA 2L50A 4U8DA 2JNFA 4YGCB 3SIBA 5I8NA 1PSBA 4XJKA 3EKHA 1J7QA 3I5FC 1FBVA 3SG6A 3HX4A 2JOJA 4MEWA 2KAXA 1S5GY 3IQQA 1MXEA 4AOMA 2SASA 1Y1UA 1XA5A 2I7AA 4FQOA 2I2RE 3JTDC 1J7PA 4YGAA 1RFJA 2JZIA 1YX7A 3BUXB 1CFPA 2I18A 1K2HA 1ZUZA 2KYCA 2K8MB 1NIWA 5B8IB 2LANA 1DVIA 1ZOTB 2G2BA 4HRHA 1F4OA 2LVJA 4HREE 1DGUA 2L0PA 1NWDA 1IWQA 2A4JA 1UUSA 5DKNA 1NUBA 1RECA 2LLSA 1IRJA 2Q4UA 2WCEA 3FS7A 3ICBA 3LL8B 2K0JA 3SIAA 3AAJA 1JF0A 3AKAA 1YVLA 3BUWB 3RLZA 4PHKA 3TUYB 2IS9A 2KQ6A 4UPGA 1CLBA 2EC6C 3LK1A 1CFCA 3I5HC 1CFDA 2BBMA 1DJIA 2Y4QA 4ORCB 1B1GA 3SG2A 2AUCA 3EK8A 3PSRA 4PE1A 1NX3A 1GGWA 1SL9A 1Y1XA 1FPWA 1R2UA 2E30A 1OZSA 1F54A 4L9MA 3FWBA 1XFXO 1JFKA 2LNKA 1QLKA 1WLMA 1Y0VH 3BOWB 2F2PA 2M1UA 2MLFC 4MBEA 1DMOA 1XO5A 1R6PA 2ZFDA 1B7TY 1DTLA 1IG5A 4DIRA 2LHIA 3GK1A 1FI6A 3A4UB 4GGFA 1KK7Y 4YI8A 1ZMZA 1YX8A 1SL7A 2CT9A 2EC6B 4DCKA 3M0WA 1K90D 1BF5A 3A8RA 1J1DA 3LCPC 1JBAA 3DVJA 4HRGA 1XFYO 4PDZA 4C0KA 1AP4A 3NSOA 4E68A 1PVBA 2H61C 4I5LB 4DUQA 2ZRSA 1BT6A 1QS7A 3VRPA 2JXCA 1S36A 3AAKA 1YRTB 4AQIA 2PSRA 1M63B 2JC2A 3NSLA 4F0ZB 1FF1A 1TRFA 3IF7A 1QVIZ 1NCYA 1NX0A 2BECA 2JT3A 1EXRA 1U5IA 1XK4C 2BCAA 2KI6C 2K7CA 1OE9B 5HLVA 1SCMB 1CDNA 1QASA 2LE9B 2M8UA 1LXFC 3D0YB 3JTDB 3H4SE 2ISDA 1SMGA 1L7ZA 5AEQA 3EK7A 1EL4A 4PHNA 2K7BA 3TS5B 1CM1A 1F71A 1IJ6A 2ZKMX 5HYDA 2E6WA 3EVVA 3CR2A 3PFVA 2BBNA 4PE4A 2KGBC 4M2QA 2EHBA 1BOCA 2LV7A 2LMVA 2HPSA 1LINA 4XYNA 1S26D 3PLFB 4ZCVA 5I2OA 1RROA 3DVKA 1TIZA 4P2YB 4GBAA 2BE6A 5AANA 1BR4B 1IQ3A 1HQVA 3VROA 1GGZA 1LVCD 4I5NB 4MSPA 1BODA 3ZNIA 5JOLA 1W7IB 1CMFA 5F6TA 2L4HA 2COLB 2K2FA 5CSJA 1RTP1 4CPVA 5D69A
chains in the Genus database with same CATH superfamily
3L4AA 5ER5A 2JTZA 3DYEA 3I5GC 4OR9B 1SSEB 1C7VA 1QJTA 4WRIA 1QVIY 5ER4X 2O60A 3B6XA 2KNEA 4N5XA 4P5OE 1DJYA 2M9GA 2KSPA 1H4BA 3V2LA 4I5KA 3BOWA 1J55A 2HQWA 1ALVA 1XFWO 2PRUA 4M2OA 5I2LA 3KF9A 2P70A 2JWWA 4AQJA 4CFQA 4C0LA 2PMYA 2EGDA 2ZNEA 1SCVA 1WY9A 2KOTA 3CLNA 3R1OA 2LM5A 1F70A 1MUXA 1RK9A 4MRYA 1KSOA 1G8IA 1GQMA 1RWYA 3PN7B 1CLMA 1BJFA 1OOGA 2G9BA 2KAYA 2MHHA 4NDBA 1CDMA 5HLOA 3RM1A 1QX5B 1SW8A 1Y1AA 4C0JA 3BFHA 2KGRA 3GOFA 1P28A 2MA2A 4INWA 1KFUS 3F45A 2Y5IA 4YBHB 1NSHA 1SY9A 1XFVO 2WCJA 2DOQA 2JT8A 3KEVA 3WHUB 3WNXB 3S0GA 1EG4A 2LLUA 2K7OA 1DJWA 5AFPA 4YGDB 1BLQA 1H8BA 3UO9A 1UP5A 1YVHA 1C3YA 1B8CA 1K96A 2K7DA 3BFAA 4PALA 4OKHA 1YUTA 3FIAA 1AK8A 2L4IA 1KWOB 1QXPA 5BPJA 4Q04A 1NCXA 1OSAA 2CCMA 4PE0A 5HKZA 1UWOA 2M7NA 4CFRA 2KFGA 2FJUB 1QTXA 3CZTX 1BR1B 2F2OA 1LA3A 1PRWA 2HQ8A 3DF0A 3NSIA 3EVRA 4CIDA 4PHJA 1CB1A 2JPTA 3FE8A 1KK8B 1F4QA 1UHKA 2R2IA 1KQVA 1AHRA 2ZNDA 4MVFA 3MSEB 1AJ4A 1WRKA 2PASA 1KFXS 2JXLA 2KYFA 2OTGB 3LK0A 4KYNA 5I94A 1TNWA 3GK4X 3B88A 3CZ2A 1CDPA 1UHIA 2JT0A 2LMTA 2QEVA 4N1GA 2QEBA 3WHTB 2GV5A 4MRXA 1N2DA 1EG3A 1TCFA 1CFCA 1K9KA 3QMEA 3WXAA 3S0AA 3TDIA 4I5JA 3SG5A 1QX2A 5CSNA 4JQ0D 1OOJA 1PULA 2H61A 2LAPA 1C07A 2KBIA 3BYAA 2KI4C 3KPXA 3O6BA 5D7FA 2KI4B 1NP8A 1HT9A 4WQ2A 3K1EA 1UHNA 1L2OB 3ZWHA 1MWNA 1CDLA 1V1FA 1CTRA 1MQ1A 1Z2CB 3OGNA 4GGFC 4JPZB 4OZDA 1IH0A 3D74A 4GPLB 1Z4HA 1N65A 1K9PA 1WRZA 1ODBA 1S1EA 2LC5A 2WCFA 4ORAB 3SG4A 1ALWA 1CLLA 1D1OA 2AAOA 1JC2A 1KK7Z 2OS8C 1OQPA 4BY5A 5KTYA 1ZACA 4A4CA 1K9UA 1BU3A 1SRAA 3BUNB 1J1EA 3NHIA 5FI2A 3TDZA 2I94A 3PATA 2M49B 4QJ3B 1TUJA 3CR5X 1J7OA 1IJ5A 2FJYA 3JVTC 2O5GA 4D1EA 4YGBB 1IQ5A 3QRXA 2MRDA 3OHMB 2WC6A 5KU1A 1S6CA 1ORGA 2BAPA 2LP3A 3D78A 2KFFA 1F8HA 2M3WA 2L2EA 3R1PA 1C3ZA 3NGVA 3DY9A 3NHTA 3D73A 1KSMA 1JUOA 2WORA 2WCMA 2BKHB 1VRKA 4USLA 1BG1A 1QWVA 1B47A 3TS5C 3NSKA 2F33A 1CFFA 3SG7A 2GGZA 5CSIA 1ZFSA 2K61A 1AVSA 5FI7A 1B4CA 2ZN9A 4NDDA 2D8NA 2M7LA 1N0YA 3CR4X 5KSZA 1OMDA 2KAVA 3PALA 3PM8A 3OB2B 1MF8B 1DJHA 1UHJA 2LP2A 2LVVA 3OP0A 2B1UA 3SJSA 1NX1A 1KFUL 2KHNA 1PALA 1A2XA 4NDCA 4ICBA 1A75B 1NCZA 4N1FA 4YRUA 2H8VA 1SR6C 2NZ0A 1QX7A 5FYXA 3UNWA 1LA0A 1Q80A 1SR6B 1OMRA 4TNCA 4GGNA 1K95A 1X02A 3KO0A 4XJKB 1DJZA 1LKJA 5HKWA 2MBXA 1YUUA 2KPHA 3GK2A 1SKTA 1OZOA 4QJ5B 2WNDA 1XFUO 3CYZA 2QEHA 1PSRA 1DF0B 4F7FA 1K93D 2QPTA 1IGVA 1Y6WA 3C1VA 3VRNA 1S5GZ 1NPQA 3I5IB 1G33A 4NQGA 2BCXA 2ZRTA 3I5IC 5K89A 1A29A 4R1EA 5CPVA 2NLNA 1PK0D 2WOSA 2OTGC 1K94A 2F3ZA 1QATA 2NCPA 2JQ6A 1U5IB 2JRFA 3OB1B 1M46A 1NYAA 2KFHA 1B8LA 1SCMC 2CBLA 2CXJA 2MLEC 1DF0A 1TNXA 3D0YA 3O4YA 3CWGA 4DS7A 1QIVA 2HETA 2NCOA 1NX2A 3O4XA 3PN7C 4FTGA 4MLWA 1JFJA 2L2CA 1JWDA 2ZN8A 1S6IA 2L98A 3R1VA 3RZSA 2BKIB 2WCLA 3K21A 1S6JA 3L47A 1G4YR 1OOHA 1XK4A 2WC5A 1QV0A 4GUKA 2PALA 3JVTB 1TNQA 2M29A 3TDUA 1DC1A 2RGIA 3OX5A 1QLSA 1AUIB 1FW4A 1DJGA 3EK4A 3DXLA 3VB1A 1KQMC 2JPOA 3BUMB 2GGMA 2LMUA 2JTTA 4MZJA 5J3XA 1BMOA 1B9AA 2LUCA 5JJGA 1M45A 1C7WA 1WRLA 1SK6D 2FCDA 1JF2A 3CABA 2PQLA 5IBWA 1XYDA 1YURA 4MZLA 1OW4A 3BFBA 3S0BA 1DT7B 1WDCC 2L5XB 2Y1MA 3BJHA 1WDCB 5HKYA 2LUXA 1W7JB 1SYMA 2H2KA 2WC8A 4OCIA 5TNCA 2CTNA 2KDHA 2FOTA 3EG5B 1TTXA 4QJ4B 1EH2A 1DEKA 5DKQA 3BXKA 1OOFA 2BL0B 1B8RA 3D10A 2BCBA 2KQYA 2Q91A 3I5FB 2OPOA 4JKTA 1YR5A 1XVJA 4WQ3A 4PT1A 4YI9A 1MR8A 2LHLA 1MHOA 3B86A 3D77A 4IJ7A 2V53A 3CGAA 4PCWA 4HSZA 4GNKB 5HL1A 2Y1NA 1CNPA 2M1KB 3TUYC 3AKBA 1TNPA 2K2AA 2ERBA 3R72A 2OS8B 4ORBB 3VRQA 1A03A 2BNXA 3E3RA 1B7TZ 3DVEA 1WLZA 4PHMA 1GJYA 2HF5A 4IL1A 2MJWB 1UURA 3DVMA 3NXAA 1IIOA 4DRWA 1TN4A 5AERA 1FI5A 2NXQA 2CNPA 2KI6D 2LVKA 1M31A 2FCEA 2LVIA 2QDIA 1IKUA 2AMIA 1CM4A 2JU0A 3D76A 3VGOA 3CTNA 1F55A 1YRUB 2LLTA 1SL8A 2MAZA 4GAOA 4INXA 2LCPA 5CSFA 1CMGA 2JULA 3TZ1A 1XFZO 3VRRA 5AXIA 3EKJA 1CKKA 1KQMB 4GFTA 4JWQA 3I5HB 2KLEA 1SPYA 3DD4A 3EVUA 2M97A 4YGEB 2VRGA 3B7AA 3FWCA 2KBMA 3LLEA 5D3OA 2SCPA 1K8UA 2TN4A 1RJVA 2PVBA 3HCMA 1JSAA 5DKRA 1PVAA 1TOPA 3S0DA 1XFRA 4OVNF 1EJ3A 1SNLA 2BE4A 3DF0B 2WCHA 1E8AA 1KFXL 1QIWA 3PM2A 5GQQC 3I5GB 2M0RA 1KK8C 2F3YA 3O78A 1M39A 1L2OC 2BL0C 1SBJA 2F8PA 5G08A 1A4PA 5I2QA 1TCOB 2JNXA 3BQ3A 3CS1A 1DJXA 1YTZC 3KHEA 3O2PA 2L51A 4BY4A 4OV2A 3PJIA 3SS3A 5PALA 1J7RA 2P6BB 4ZCUA 2K60A 1YUSA 1TUZA 1S3PA 3BUOB 4MZKA 4PE7A 1AJ5A 1QV1A 1KWOC 1UHHA 1W9ZA 2QACA 3IQOA 4M2PA 4MN0A 4CLNA 1DGVA 3FE9A 2WCBA 1LS8A 1OMVA 1V1GA 3OX6A 2P71A 4A4BA 1MXLC 3SG3A 1DELA 4ETOA 3CDNA 1A75A 1KCYA 2L50A 4U8DA 2JNFA 3OBVA 4YGCB 3SIBA 5I8NA 1PSBA 4XJKA 2GTEA 3EKHA 1J7QA 3I5FC 1FBVA 5EL2A 3SG6A 3Q8IA 3HX4A 2JOJA 4MEWA 2KAXA 1S5GY 3IQQA 1MXEA 4AOMA 3B87A 2SASA 1Y1UA 1XA5A 2I7AA 4FQOA 2I2RE 3JTDC 3FE6A 1J7PA 4YGAA 1RFJA 1GM0A 2JZIA 1YX7A 1OOIX 3BUXB 1CFPA 2I18A 1K2HA 2KLDA 1ZUZA 2KYCA 2K8MB 1NIWA 5B8IB 3SS4A 2LANA 1DVIA 1ZOTB 2G2BA 4HRHA 1F4OA 2LVJA 4HREE 1DGUA 2L0PA 3N7HA 1NWDA 2WCKA 1IWQA 2A4JA 1UUSA 3L4LA 5DKNA 1NUBA 1RECA 2LLSA 1IRJA 2Q4UA 2WCEA 3FS7A 3ICBA 3LL8B 2K0JA 3SIAA 1T14A 3AAJA 1JF0A 3AKAA 1YVLA 3BUWB 3RLZA 4PHKA 3TUYB 1TWOA 2IS9A 2KQ6A 4UPGA 1CLBA 2EC6C 3LK1A 3IVTA 3D75A 1CFDA 2BBMA 1DJIA 2Y4QA 3I5HC 4ORCB 3SS5A 3SG2A 2AUCA 3EK8A 3PSRA 4PE1A 1NX3A 1GGWA 1SL9A 2YGUA 1Y1XA 1FPWA 1R2UA 2E30A 1OZSA 3CZ1A 4FQTA 1F54A 4L9MA 3FWBA 1XFXO 1JFKA 2LNKA 1QLKA 1WLMA 1Y0VH 3BOWB 2F2PA 2M1UA 2MLFC 4MBEA 1DMOA 1XO5A 1R6PA 2ZFDA 1B7TY 1DTLA 1IG5A 4DIRA 2LHIA 3GK1A 1FI6A 3A4UB 4GGFA 1KK7Y 4YI8A 1ZMZA 1YX8A 1SL7A 2CT9A 2EC6B 4DCKA 3M0WA 1K90D 1BF5A 3A8RA 1J1DA 3LCPC 1JBAA 3DVJA 4HRGA 1XFYO 4PDZA 4C0KA 1AP4A 1DQEA 3NSOA 4E68A 1PVBA 2H61C 4I5LB 4DUQA 2ZRSA 5DICA 1BT6A 1QS7A 3VRPA 2JXCA 1S36A 3AAKA 1YRTB 4AQIA 2PSRA 1M63B 2JC2A 3NSLA 4F0ZB 1FF1A 1TRFA 3IF7A 1QVIZ 1NCYA 1NX0A 2QEOA 2BECA 2JT3A 1EXRA 3S0FA 1U5IA 1XK4C 3S0EA 2BCAA 5FI6A 2KI6C 2K7CA 1OE9B 3CZ0A 5HLVA 1SCMB 1CDNA 1QASA 2LE9B 2M8UA 1LXFC 3D0YB 3JTDB 3H4SE 2ISDA 2L5YA 1SMGA 1L7ZA 5AEQA 3EK7A 1EL4A 4PHNA 2K7BA 3TS5B 1CM1A 1F71A 1IJ6A 2ZKMX 5HYDA 2E6WA 3EVVA 3CR2A 3PFVA 1B1GA 2BBNA 4PE4A 2KGBC 4M2QA 2EHBA 1BOCA 2LV7A 2LMVA 2HPSA 1LINA 4XYNA 2PYQA 1S26D 3PLFB 4ZCVA 5I2OA 1RROA 3DVKA 1TIZA 4P2YB 4GBAA 2BE6A 5AANA 1BR4B 1IQ3A 1HQVA 4JD9A 3VROA 1GGZA 1LVCD 4I5NB 4MSPA 1BODA 3DZTA 3ZNIA 5JOLA 1W7IB 1CMFA 5F6TA 2L4HA 2COLB 2K2FA 5CSJA 1RTP1 4CPVA 5D69A
chains in the Genus database with same CATH topology
5ER5A 2JTZA 3I5GC 4OR9B 1C7VA 1QJTA 4WRIA 1QVIY 5ER4X 2O60A 4N5XA 2KNEA 4P5OE 1DJYA 2M9GA 2KSPA 1H4BA 4I5KA 3BOWA 1J55A 2HQWA 1ALVA 1XFWO 2PRUA 4M2OA 5I2LA 3KF9A 2JWWA 4AQJA 4CFQA 4C0LA 2PMYA 2EGDA 2ZNEA 1SCVA 1WY9A 2KOTA 3CLNA 1F70A 2LM5A 1MUXA 1RK9A 4MRYA 1KSOA 1G8IA 1GQMA 1RWYA 3PN7B 1CLMA 1BJFA 2G9BA 2KAYA 2MHHA 4NDBA 1CDMA 5HLOA 3RM1A 1QX5B 1SW8A 1Y1AA 4C0JA 3GOFA 2KGRA 2MA2A 1KFUS 3F45A 2Y5IA 4YBHB 1NSHA 1SY9A 1XFVO 3KEVA 2DOQA 2JT8A 3WHUB 3WNXB 1EG4A 2LLUA 2K7OA 1DJWA 5AFPA 4YGDB 1BLQA 1H8BA 1UP5A 1YVHA 1B8CA 1K96A 2K7DA 4PALA 4OKHA 1YUTA 3FIAA 1AK8A 2L4IA 1KWOB 1QXPA 5BPJA 4Q04A 1NCXA 1OSAA 2CCMA 4PE0A 5HKZA 1UWOA 2M7NA 4CFRA 2KFGA 2FJUB 1QTXA 3CZTX 1BR1B 2F2OA 1LA3A 1PRWA 2HQ8A 3DF0A 3NSIA 3EVRA 4CIDA 4PHJA 1CB1A 2JPTA 1KK8B 1F4QA 1UHKA 2R2IA 1KQVA 1AHRA 2ZNDA 4MVFA 3MSEB 1AJ4A 1WRKA 2PASA 1KFXS 2JXLA 2KYFA 2OTGB 3LK0A 1TNWA 3GK4X 1CDPA 1UHIA 2JT0A 2LMTA 4N1GA 3WHTB 2GV5A 4MRXA 1N2DA 1EG3A 1TCFA 1K9KA 3WXAA 3TDIA 4I5JA 3SG5A 1QX2A 5CSNA 4JQ0D 1OOJA 1PULA 2H61A 2LAPA 1C07A 2KBIA 3BYAA 2KI4C 3KPXA 3O6BA 5D7FA 2KI4B 1NP8A 1HT9A 4WQ2A 1UHNA 1L2OB 3ZWHA 1MWNA 1CDLA 1V1FA 1CTRA 1MQ1A 4GGFC 4JPZB 1IH0A 4GPLB 1N65A 1K9PA 1WRZA 1ODBA 1S1EA 2LC5A 2WCFA 4ORAB 3SG4A 1ALWA 1CLLA 1D1OA 2AAOA 1JC2A 1KK7Z 2OS8C 1OQPA 4BY5A 5KTYA 1ZACA 4A4CA 1K9UA 1BU3A 1SRAA 3BUNB 1J1EA 3TDZA 2I94A 3PATA 2M49B 4QJ3B 3CR5X 1J7OA 1IJ5A 3JVTC 2O5GA 4D1EA 4YGBB 1IQ5A 3QRXA 2MRDA 3OHMB 5KU1A 1S6CA 2LP3A 2KFFA 1F8HA 2M3WA 2L2EA 1KSMA 1JUOA 2WORA 2BKHB 1VRKA 4USLA 1BG1A 3TS5C 1B47A 3NSKA 2F33A 1CFFA 3SG7A 2GGZA 5CSIA 1ZFSA 2K61A 1AVSA 1B4CA 2ZN9A 4NDDA 2D8NA 2M7LA 1N0YA 3CR4X 5KSZA 1OMDA 2KAVA 3PALA 3PM8A 3OB2B 1MF8B 1DJHA 1UHJA 2LP2A 2LVVA 3OP0A 2B1UA 3SJSA 1NX1A 1KFUL 2KHNA 1PALA 1A2XA 4NDCA 4ICBA 1A75B 1NCZA 4N1FA 4YRUA 1SR6C 2NZ0A 1QX7A 5FYXA 1LA0A 1Q80A 1SR6B 1OMRA 4TNCA 4GGNA 1K95A 1X02A 3KO0A 4XJKB 1DJZA 1LKJA 5HKWA 2MBXA 1YUUA 3GK2A 1SKTA 1OZOA 4QJ5B 2WNDA 1XFUO 1PSRA 1DF0B 1K93D 2QPTA 1IGVA 1Y6WA 3C1VA 3VRNA 1S5GZ 1NPQA 3I5IB 1G33A 4NQGA 2BCXA 2ZRTA 3I5IC 5K89A 1A29A 4R1EA 5CPVA 2NLNA 1PK0D 2WOSA 2OTGC 1K94A 2F3ZA 1QATA 2NCPA 2JQ6A 1U5IB 2JRFA 3OB1B 1M46A 1NYAA 2KFHA 1B8LA 1SCMC 2CBLA 2CXJA 2MLEC 1DF0A 1TNXA 3D0YA 3O4YA 3CWGA 4DS7A 1QIVA 2HETA 2NCOA 1NX2A 3PN7C 4FTGA 4MLWA 1JFJA 1JWDA 2ZN8A 1S6IA 2L98A 2BKIB 3K21A 1S6JA 1G4YR 1XK4A 1QV0A 4GUKA 2PALA 3JVTB 1TNQA 2M29A 3TDUA 2RGIA 3OX5A 1QLSA 1AUIB 1FW4A 1DJGA 3EK4A 1KQMC 3BUMB 2GGMA 2LMUA 2JTTA 4MZJA 5J3XA 1BMOA 1B9AA 2LUCA 5JJGA 1M45A 1C7WA 1WRLA 1SK6D 2FCDA 1JF2A 5IBWA 1XYDA 1YURA 4MZLA 1DT7B 1WDCC 2L5XB 2Y1MA 1WDCB 5HKYA 2LUXA 1W7JB 1SYMA 2H2KA 2WC8A 4OCIA 5TNCA 2CTNA 2KDHA 2FOTA 4QJ4B 1TTXA 1EH2A 5DKQA 3BXKA 2BL0B 1B8RA 3D10A 2BCBA 2KQYA 2Q91A 3I5FB 2OPOA 4WQ3A 1YR5A 1XVJA 4YI9A 1MR8A 2LHLA 1MHOA 4PCWA 2V53A 3CGAA 4HSZA 4GNKB 1CNPA 2Y1NA 2M1KB 3TUYC 3AKBA 1TNPA 2K2AA 2OS8B 4ORBB 3VRQA 1A03A 3E3RA 1B7TZ 3DVEA 1WLZA 4PHMA 1GJYA 2HF5A 4IL1A 2MJWB 1UURA 3DVMA 3NXAA 4DRWA 1TN4A 5AERA 1FI5A 2NXQA 2CNPA 2KI6D 2LVKA 1M31A 2FCEA 2LVIA 1IKUA 2AMIA 1CM4A 2JU0A 3VGOA 3CTNA 1F55A 1YRUB 2LLTA 1SL8A 2MAZA 4GAOA 2LCPA 5CSFA 1CMGA 2JULA 3TZ1A 1XFZO 3VRRA 5AXIA 3EKJA 1CKKA 1KQMB 4GFTA 4JWQA 3I5HB 3EVUA 1SPYA 3DD4A 2M97A 4YGEB 2VRGA 3FWCA 2KBMA 3LLEA 2SCPA 1K8UA 2TN4A 1RJVA 2PVBA 3HCMA 1JSAA 5DKRA 1PVAA 1TOPA 4OVNF 1EJ3A 1SNLA 2BE4A 3DF0B 1E8AA 1KFXL 1QIWA 5GQQC 3I5GB 2M0RA 1KK8C 2F3YA 3O78A 1M39A 1L2OC 1SBJA 2BL0C 2F8PA 5G08A 1A4PA 5I2QA 1TCOB 2JNXA 3BQ3A 3CS1A 1DJXA 1YTZC 3KHEA 3O2PA 2L51A 4BY4A 4OV2A 5PALA 1J7RA 2P6BB 4ZCUA 1YUSA 1S3PA 3BUOB 4MZKA 4PE7A 1AJ5A 1QV1A 1KWOC 1UHHA 3IQOA 2QACA 4M2PA 4MN0A 4CLNA 1DGVA 2WCBA 1OMVA 1V1GA 3OX6A 4ETOA 4A4BA 1MXLC 3SG3A 1A75A 1KCYA 2L50A 4U8DA 2JNFA 4YGCB 3SIBA 5I8NA 1PSBA 4XJKA 3EKHA 1J7QA 3I5FC 1FBVA 3SG6A 3HX4A 2JOJA 4MEWA 2KAXA 1S5GY 3IQQA 1MXEA 4AOMA 2SASA 1Y1UA 1XA5A 2I7AA 4FQOA 2I2RE 3JTDC 1J7PA 4YGAA 1RFJA 2JZIA 1YX7A 3BUXB 1CFPA 2I18A 1K2HA 1ZUZA 2KYCA 2K8MB 1NIWA 5B8IB 2LANA 1DVIA 1ZOTB 2G2BA 4HRHA 1F4OA 2LVJA 4HREE 1DGUA 2L0PA 1NWDA 1IWQA 2A4JA 1UUSA 5DKNA 1NUBA 1RECA 2LLSA 1IRJA 2Q4UA 2WCEA 3FS7A 3ICBA 3LL8B 2K0JA 3SIAA 3AAJA 1JF0A 3AKAA 1YVLA 3BUWB 3RLZA 4PHKA 3TUYB 2IS9A 2KQ6A 4UPGA 1CLBA 2EC6C 3LK1A 1CFCA 3I5HC 1CFDA 2BBMA 1DJIA 2Y4QA 4ORCB 1B1GA 3SG2A 2AUCA 3EK8A 3PSRA 4PE1A 1NX3A 1GGWA 1SL9A 1Y1XA 1FPWA 1R2UA 2E30A 1OZSA 1F54A 4L9MA 3FWBA 1XFXO 1JFKA 2LNKA 1QLKA 1WLMA 1Y0VH 3BOWB 2F2PA 2M1UA 2MLFC 4MBEA 1DMOA 1XO5A 1R6PA 2ZFDA 1B7TY 1DTLA 1IG5A 4DIRA 2LHIA 3GK1A 1FI6A 3A4UB 4GGFA 1KK7Y 4YI8A 1ZMZA 1YX8A 1SL7A 2CT9A 2EC6B 4DCKA 3M0WA 1K90D 1BF5A 3A8RA 1J1DA 3LCPC 1JBAA 3DVJA 4HRGA 1XFYO 4PDZA 4C0KA 1AP4A 3NSOA 4E68A 1PVBA 2H61C 4I5LB 4DUQA 2ZRSA 1BT6A 1QS7A 3VRPA 2JXCA 1S36A 3AAKA 1YRTB 4AQIA 2PSRA 1M63B 2JC2A 3NSLA 4F0ZB 1FF1A 1TRFA 3IF7A 1QVIZ 1NCYA 1NX0A 2BECA 2JT3A 1EXRA 1U5IA 1XK4C 2BCAA 2KI6C 2K7CA 1OE9B 5HLVA 1SCMB 1CDNA 1QASA 2LE9B 2M8UA 1LXFC 3D0YB 3JTDB 3H4SE 2ISDA 1SMGA 1L7ZA 5AEQA 3EK7A 1EL4A 4PHNA 2K7BA 3TS5B 1CM1A 1F71A 1IJ6A 2ZKMX 5HYDA 2E6WA 3EVVA 3CR2A 3PFVA 2BBNA 4PE4A 2KGBC 4M2QA 2EHBA 1BOCA 2LV7A 2LMVA 2HPSA 1LINA 4XYNA 1S26D 3PLFB 4ZCVA 5I2OA 1RROA 3DVKA 1TIZA 4P2YB 4GBAA 2BE6A 5AANA 1BR4B 1IQ3A 1HQVA 3VROA 1GGZA 1LVCD 4I5NB 4MSPA 1BODA 3ZNIA 5JOLA 1W7IB 1CMFA 5F6TA 2L4HA 2COLB 2K2FA 5CSJA 1RTP1 4CPVA 5D69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ER5 A;  2JTZ A;  3I5G C;  4OR9 B;  1C7V A;  1QJT A;  4WRI A;  1QVI Y;  5ER4 X;  2O60 A;  4N5X A;  2KNE A;  4P5O E;  1DJY A;  2M9G A;  2KSP A;  1H4B A;  4I5K A;  3BOW A;  1J55 A;  2HQW A;  1ALV A;  1XFW O;  2PRU A;  4M2O A;  5I2L A;  3KF9 A;  2JWW A;  4AQJ A;  4CFQ A;  4C0L A;  2PMY A;  2EGD A;  2ZNE A;  1SCV A;  1WY9 A;  2KOT A;  3CLN A;  1F70 A;  2LM5 A;  1MUX A;  1RK9 A;  4MRY A;  1KSO A;  1G8I A;  1GQM A;  1RWY A;  3PN7 B;  1CLM A;  1BJF A;  2G9B A;  2KAY A;  2MHH A;  4NDB A;  1CDM A;  5HLO A;  3RM1 A;  1QX5 B;  1SW8 A;  1Y1A A;  4C0J A;  3GOF A;  2KGR A;  2MA2 A;  1KFU S;  3F45 A;  2Y5I A;  4YBH B;  1NSH A;  1SY9 A;  1XFV O;  3KEV A;  2DOQ A;  2JT8 A;  3WHU B;  3WNX B;  1EG4 A;  2LLU A;  2K7O A;  1DJW A;  5AFP A;  4YGD B;  1BLQ A;  1H8B A;  1UP5 A;  1YVH A;  1B8C A;  1K96 A;  2K7D A;  4PAL A;  4OKH A;  1YUT A;  3FIA A;  1AK8 A;  2L4I A;  1KWO B;  1QXP A;  5BPJ A;  4Q04 A;  1NCX A;  1OSA A;  2CCM A;  4PE0 A;  5HKZ A;  1UWO A;  2M7N A;  4CFR A;  2KFG A;  2FJU B;  1QTX A;  3CZT X;  1BR1 B;  2F2O A;  1LA3 A;  1PRW A;  2HQ8 A;  3DF0 A;  3NSI A;  3EVR A;  4CID A;  4PHJ A;  1CB1 A;  2JPT A;  1KK8 B;  1F4Q A;  1UHK A;  2R2I A;  1KQV A;  1AHR A;  2ZND A;  4MVF A;  3MSE B;  1AJ4 A;  1WRK A;  2PAS A;  1KFX S;  2JXL A;  2KYF A;  2OTG B;  3LK0 A;  1TNW A;  3GK4 X;  1CDP A;  1UHI A;  2JT0 A;  2LMT A;  4N1G A;  3WHT B;  2GV5 A;  4MRX A;  1N2D A;  1EG3 A;  1TCF A;  1K9K A;  3WXA A;  3TDI A;  4I5J A;  3SG5 A;  1QX2 A;  5CSN A;  4JQ0 D;  1OOJ A;  1PUL A;  2H61 A;  2LAP A;  1C07 A;  2KBI A;  3BYA A;  2KI4 C;  3KPX A;  3O6B A;  5D7F A;  2KI4 B;  1NP8 A;  1HT9 A;  4WQ2 A;  1UHN A;  1L2O B;  3ZWH A;  1MWN A;  1CDL A;  1V1F A;  1CTR A;  1MQ1 A;  4GGF C;  4JPZ B;  1IH0 A;  4GPL B;  1N65 A;  1K9P A;  1WRZ A;  1ODB A;  1S1E A;  2LC5 A;  2WCF A;  4ORA B;  3SG4 A;  1ALW A;  1CLL A;  1D1O A;  2AAO A;  1JC2 A;  1KK7 Z;  2OS8 C;  1OQP A;  4BY5 A;  5KTY A;  1ZAC A;  4A4C A;  1K9U A;  1BU3 A;  1SRA A;  3BUN B;  1J1E A;  3TDZ A;  2I94 A;  3PAT A;  2M49 B;  4QJ3 B;  3CR5 X;  1J7O A;  1IJ5 A;  3JVT C;  2O5G A;  4D1E A;  4YGB B;  1IQ5 A;  3QRX A;  2MRD A;  3OHM B;  5KU1 A;  1S6C A;  2LP3 A;  2KFF A;  1F8H A;  2M3W A;  2L2E A;  1KSM A;  1JUO A;  2WOR A;  2BKH B;  1VRK A;  4USL A;  1BG1 A;  3TS5 C;  1B47 A;  3NSK A;  2F33 A;  1CFF A;  3SG7 A;  2GGZ A;  5CSI A;  1ZFS A;  2K61 A;  1AVS A;  1B4C A;  2ZN9 A;  4NDD A;  2D8N A;  2M7L A;  1N0Y A;  3CR4 X;  5KSZ A;  1OMD A;  2KAV A;  3PAL A;  3PM8 A;  3OB2 B;  1MF8 B;  1DJH A;  1UHJ A;  2LP2 A;  2LVV A;  3OP0 A;  2B1U A;  3SJS A;  1NX1 A;  1KFU L;  2KHN A;  1PAL A;  1A2X A;  4NDC A;  4ICB A;  1A75 B;  1NCZ A;  4N1F A;  4YRU A;  1SR6 C;  2NZ0 A;  1QX7 A;  5FYX A;  1LA0 A;  1Q80 A;  1SR6 B;  1OMR A;  4TNC A;  4GGN A;  1K95 A;  1X02 A;  3KO0 A;  4XJK B;  1DJZ A;  1LKJ A;  5HKW A;  2MBX A;  1YUU A;  3GK2 A;  1SKT A;  1OZO A;  4QJ5 B;  2WND A;  1XFU O;  1PSR A;  1DF0 B;  1K93 D;  2QPT A;  1IGV A;  1Y6W A;  3C1V A;  3VRN A;  1S5G Z;  1NPQ A;  3I5I B;  1G33 A;  4NQG A;  2BCX A;  2ZRT A;  3I5I C;  5K89 A;  1A29 A;  4R1E A;  5CPV A;  2NLN A;  1PK0 D;  2WOS A;  2OTG C;  1K94 A;  2F3Z A;  1QAT A;  2NCP A;  2JQ6 A;  1U5I B;  2JRF A;  3OB1 B;  1M46 A;  1NYA A;  2KFH A;  1B8L A;  1SCM C;  2CBL A;  2CXJ A;  2MLE C;  1DF0 A;  1TNX A;  3D0Y A;  3O4Y A;  3CWG A;  4DS7 A;  1QIV A;  2HET A;  2NCO A;  1NX2 A;  3PN7 C;  4FTG A;  4MLW A;  1JFJ A;  1JWD A;  2ZN8 A;  1S6I A;  2L98 A;  2BKI B;  3K21 A;  1S6J A;  1G4Y R;  1XK4 A;  1QV0 A;  4GUK A;  2PAL A;  3JVT B;  1TNQ A;  2M29 A;  3TDU A;  2RGI A;  3OX5 A;  1QLS A;  1AUI B;  1FW4 A;  1DJG A;  3EK4 A;  1KQM C;  3BUM B;  2GGM A;  2LMU A;  2JTT A;  4MZJ A;  5J3X A;  1BMO A;  1B9A A;  2LUC A;  5JJG A;  1M45 A;  1C7W A;  1WRL A;  1SK6 D;  2FCD A;  1JF2 A;  5IBW A;  1XYD A;  1YUR A;  4MZL A;  1DT7 B;  1WDC C;  2L5X B;  2Y1M A;  1WDC B;  5HKY A;  2LUX A;  1W7J B;  1SYM A;  2H2K A;  2WC8 A;  4OCI A;  5TNC A;  2CTN A;  2KDH A;  2FOT A;  4QJ4 B;  1TTX A;  1EH2 A;  5DKQ A;  3BXK A;  2BL0 B;  1B8R A;  3D10 A;  2BCB A;  2KQY A;  2Q91 A;  3I5F B;  2OPO A;  4WQ3 A;  1YR5 A;  1XVJ A;  4YI9 A;  1MR8 A;  2LHL A;  1MHO A;  4PCW A;  2V53 A;  3CGA A;  4HSZ A;  4GNK B;  1CNP A;  2Y1N A;  2M1K B;  3TUY C;  3AKB A;  1TNP A;  2K2A A;  2OS8 B;  4ORB B;  3VRQ A;  1A03 A;  3E3R A;  1B7T Z;  3DVE A;  1WLZ A;  4PHM A;  1GJY A;  2HF5 A;  4IL1 A;  2MJW B;  1UUR A;  3DVM A;  3NXA A;  4DRW A;  1TN4 A;  5AER A;  1FI5 A;  2NXQ A;  2CNP A;  2KI6 D;  2LVK A;  1M31 A;  2FCE A;  2LVI A;  1IKU A;  2AMI A;  1CM4 A;  2JU0 A;  3VGO A;  3CTN A;  1F55 A;  1YRU B;  2LLT A;  1SL8 A;  2MAZ A;  4GAO A;  2LCP A;  5CSF A;  1CMG A;  2JUL A;  3TZ1 A;  1XFZ O;  3VRR A;  5AXI A;  3EKJ A;  1CKK A;  1KQM B;  4GFT A;  4JWQ A;  3I5H B;  3EVU A;  1SPY A;  3DD4 A;  2M97 A;  4YGE B;  2VRG A;  3FWC A;  2KBM A;  3LLE A;  2SCP A;  1K8U A;  2TN4 A;  1RJV A;  2PVB A;  3HCM A;  1JSA A;  5DKR A;  1PVA A;  1TOP A;  4OVN F;  1EJ3 A;  1SNL A;  2BE4 A;  3DF0 B;  1E8A A;  1KFX L;  1QIW A;  5GQQ C;  3I5G B;  2M0R A;  1KK8 C;  2F3Y A;  3O78 A;  1M39 A;  1L2O C;  1SBJ A;  2BL0 C;  2F8P A;  5G08 A;  1A4P A;  5I2Q A;  1TCO B;  2JNX A;  3BQ3 A;  3CS1 A;  1DJX A;  1YTZ C;  3KHE A;  3O2P A;  2L51 A;  4BY4 A;  4OV2 A;  5PAL A;  1J7R A;  2P6B B;  4ZCU A;  1YUS A;  1S3P A;  3BUO B;  4MZK A;  4PE7 A;  1AJ5 A;  1QV1 A;  1KWO C;  1UHH A;  3IQO A;  2QAC A;  4M2P A;  4MN0 A;  4CLN A;  1DGV A;  2WCB A;  1OMV A;  1V1G A;  3OX6 A;  4ETO A;  4A4B A;  1MXL C;  3SG3 A;  1A75 A;  1KCY A;  2L50 A;  4U8D A;  2JNF A;  4YGC B;  3SIB A;  5I8N A;  1PSB A;  4XJK A;  3EKH A;  1J7Q A;  3I5F C;  1FBV A;  3SG6 A;  3HX4 A;  2JOJ A;  4MEW A;  2KAX A;  1S5G Y;  3IQQ A;  1MXE A;  4AOM A;  2SAS A;  1Y1U A;  1XA5 A;  2I7A A;  4FQO A;  2I2R E;  3JTD C;  1J7P A;  4YGA A;  1RFJ A;  2JZI A;  1YX7 A;  3BUX B;  1CFP A;  2I18 A;  1K2H A;  1ZUZ A;  2KYC A;  2K8M B;  1NIW A;  5B8I B;  2LAN A;  1DVI A;  1ZOT B;  2G2B A;  4HRH A;  1F4O A;  2LVJ A;  4HRE E;  1DGU A;  2L0P A;  1NWD A;  1IWQ A;  2A4J A;  1UUS A;  5DKN A;  1NUB A;  1REC A;  2LLS A;  1IRJ A;  2Q4U A;  2WCE A;  3FS7 A;  3ICB A;  3LL8 B;  2K0J A;  3SIA A;  3AAJ A;  1JF0 A;  3AKA A;  1YVL A;  3BUW B;  3RLZ A;  4PHK A;  3TUY B;  2IS9 A;  2KQ6 A;  4UPG A;  1CLB A;  2EC6 C;  3LK1 A;  1CFC A;  3I5H C;  1CFD A;  2BBM A;  1DJI A;  2Y4Q A;  4ORC B;  1B1G A;  3SG2 A;  2AUC A;  3EK8 A;  3PSR A;  4PE1 A;  1NX3 A;  1GGW A;  1SL9 A;  1Y1X A;  1FPW A;  1R2U A;  2E30 A;  1OZS A;  1F54 A;  4L9M A;  3FWB A;  1XFX O;  1JFK A;  2LNK A;  1QLK A;  1WLM A;  1Y0V H;  3BOW B;  2F2P A;  2M1U A;  2MLF C;  4MBE A;  1DMO A;  1XO5 A;  1R6P A;  2ZFD A;  1B7T Y;  1DTL A;  1IG5 A;  4DIR A;  2LHI A;  3GK1 A;  1FI6 A;  3A4U B;  4GGF A;  1KK7 Y;  4YI8 A;  1ZMZ A;  1YX8 A;  1SL7 A;  2CT9 A;  2EC6 B;  4DCK A;  3M0W A;  1K90 D;  1BF5 A;  3A8R A;  1J1D A;  3LCP C;  1JBA A;  3DVJ A;  4HRG A;  1XFY O;  4PDZ A;  4C0K A;  1AP4 A;  3NSO A;  4E68 A;  1PVB A;  2H61 C;  4I5L B;  4DUQ A;  2ZRS A;  1BT6 A;  1QS7 A;  3VRP A;  2JXC A;  1S36 A;  3AAK A;  1YRT B;  4AQI A;  2PSR A;  1M63 B;  2JC2 A;  3NSL A;  4F0Z B;  1FF1 A;  1TRF A;  3IF7 A;  1QVI Z;  1NCY A;  1NX0 A;  2BEC A;  2JT3 A;  1EXR A;  1U5I A;  1XK4 C;  2BCA A;  2KI6 C;  2K7C A;  1OE9 B;  5HLV A;  1SCM B;  1CDN A;  1QAS A;  2LE9 B;  2M8U A;  1LXF C;  3D0Y B;  3JTD B;  3H4S E;  2ISD A;  1SMG A;  1L7Z A;  5AEQ A;  3EK7 A;  1EL4 A;  4PHN A;  2K7B A;  3TS5 B;  1CM1 A;  1F71 A;  1IJ6 A;  2ZKM X;  5HYD A;  2E6W A;  3EVV A;  3CR2 A;  3PFV A;  2BBN A;  4PE4 A;  2KGB C;  4M2Q A;  2EHB A;  1BOC A;  2LV7 A;  2LMV A;  2HPS A;  1LIN A;  4XYN A;  1S26 D;  3PLF B;  4ZCV A;  5I2O A;  1RRO A;  3DVK A;  1TIZ A;  4P2Y B;  4GBA A;  2BE6 A;  5AAN A;  1BR4 B;  1IQ3 A;  1HQV A;  3VRO A;  1GGZ A;  1LVC D;  4I5N B;  4MSP A;  1BOD A;  3ZNI A;  5JOL A;  1W7I B;  1CMF A;  5F6T A;  2L4H A;  2COL B;  2K2F A;  5CSJ A;  1RTP 1;  4CPV A;  5D69 A; 
#chains in the Genus database with same CATH topology
 3L4A A;  5ER5 A;  2JTZ A;  3DYE A;  3I5G C;  4OR9 B;  1SSE B;  1C7V A;  1QJT A;  4WRI A;  1QVI Y;  5ER4 X;  2O60 A;  3B6X A;  2KNE A;  4N5X A;  4P5O E;  1DJY A;  2M9G A;  2KSP A;  1H4B A;  3V2L A;  4I5K A;  3BOW A;  1J55 A;  2HQW A;  1ALV A;  1XFW O;  2PRU A;  4M2O A;  5I2L A;  3KF9 A;  2P70 A;  2JWW A;  4AQJ A;  4CFQ A;  4C0L A;  2PMY A;  2EGD A;  2ZNE A;  1SCV A;  1WY9 A;  2KOT A;  3CLN A;  3R1O A;  2LM5 A;  1F70 A;  1MUX A;  1RK9 A;  4MRY A;  1KSO A;  1G8I A;  1GQM A;  1RWY A;  3PN7 B;  1CLM A;  1BJF A;  1OOG A;  2G9B A;  2KAY A;  2MHH A;  4NDB A;  1CDM A;  5HLO A;  3RM1 A;  1QX5 B;  1SW8 A;  1Y1A A;  4C0J A;  3BFH A;  2KGR A;  3GOF A;  1P28 A;  2MA2 A;  4INW A;  1KFU S;  3F45 A;  2Y5I A;  4YBH B;  1NSH A;  1SY9 A;  1XFV O;  2WCJ A;  2DOQ A;  2JT8 A;  3KEV A;  3WHU B;  3WNX B;  3S0G A;  1EG4 A;  2LLU A;  2K7O A;  1DJW A;  5AFP A;  4YGD B;  1BLQ A;  1H8B A;  3UO9 A;  1UP5 A;  1YVH A;  1C3Y A;  1B8C A;  1K96 A;  2K7D A;  3BFA A;  4PAL A;  4OKH A;  1YUT A;  3FIA A;  1AK8 A;  2L4I A;  1KWO B;  1QXP A;  5BPJ A;  4Q04 A;  1NCX A;  1OSA A;  2CCM A;  4PE0 A;  5HKZ A;  1UWO A;  2M7N A;  4CFR A;  2KFG A;  2FJU B;  1QTX A;  3CZT X;  1BR1 B;  2F2O A;  1LA3 A;  1PRW A;  2HQ8 A;  3DF0 A;  3NSI A;  3EVR A;  4CID A;  4PHJ A;  1CB1 A;  2JPT A;  3FE8 A;  1KK8 B;  1F4Q A;  1UHK A;  2R2I A;  1KQV A;  1AHR A;  2ZND A;  4MVF A;  3MSE B;  1AJ4 A;  1WRK A;  2PAS A;  1KFX S;  2JXL A;  2KYF A;  2OTG B;  3LK0 A;  4KYN A;  5I94 A;  1TNW A;  3GK4 X;  3B88 A;  3CZ2 A;  1CDP A;  1UHI A;  2JT0 A;  2LMT A;  2QEV A;  4N1G A;  2QEB A;  3WHT B;  2GV5 A;  4MRX A;  1N2D A;  1EG3 A;  1TCF A;  1CFC A;  1K9K A;  3QME A;  3WXA A;  3S0A A;  3TDI A;  4I5J A;  3SG5 A;  1QX2 A;  5CSN A;  4JQ0 D;  1OOJ A;  1PUL A;  2H61 A;  2LAP A;  1C07 A;  2KBI A;  3BYA A;  2KI4 C;  3KPX A;  3O6B A;  5D7F A;  2KI4 B;  1NP8 A;  1HT9 A;  4WQ2 A;  3K1E A;  1UHN A;  1L2O B;  3ZWH A;  1MWN A;  1CDL A;  1V1F A;  1CTR A;  1MQ1 A;  1Z2C B;  3OGN A;  4GGF C;  4JPZ B;  4OZD A;  1IH0 A;  3D74 A;  4GPL B;  1Z4H A;  1N65 A;  1K9P A;  1WRZ A;  1ODB A;  1S1E A;  2LC5 A;  2WCF A;  4ORA B;  3SG4 A;  1ALW A;  1CLL A;  1D1O A;  2AAO A;  1JC2 A;  1KK7 Z;  2OS8 C;  1OQP A;  4BY5 A;  5KTY A;  1ZAC A;  4A4C A;  1K9U A;  1BU3 A;  1SRA A;  3BUN B;  1J1E A;  3NHI A;  5FI2 A;  3TDZ A;  2I94 A;  3PAT A;  2M49 B;  4QJ3 B;  1TUJ A;  3CR5 X;  1J7O A;  1IJ5 A;  2FJY A;  3JVT C;  2O5G A;  4D1E A;  4YGB B;  1IQ5 A;  3QRX A;  2MRD A;  3OHM B;  2WC6 A;  5KU1 A;  1S6C A;  1ORG A;  2BAP A;  2LP3 A;  3D78 A;  2KFF A;  1F8H A;  2M3W A;  2L2E A;  3R1P A;  1C3Z A;  3NGV A;  3DY9 A;  3NHT A;  3D73 A;  1KSM A;  1JUO A;  2WOR A;  2WCM A;  2BKH B;  1VRK A;  4USL A;  1BG1 A;  1QWV A;  1B47 A;  3TS5 C;  3NSK A;  2F33 A;  1CFF A;  3SG7 A;  2GGZ A;  5CSI A;  1ZFS A;  2K61 A;  1AVS A;  5FI7 A;  1B4C A;  2ZN9 A;  4NDD A;  2D8N A;  2M7L A;  1N0Y A;  3CR4 X;  5KSZ A;  1OMD A;  2KAV A;  3PAL A;  3PM8 A;  3OB2 B;  1MF8 B;  1DJH A;  1UHJ A;  2LP2 A;  2LVV A;  3OP0 A;  2B1U A;  3SJS A;  1NX1 A;  1KFU L;  2KHN A;  1PAL A;  1A2X A;  4NDC A;  4ICB A;  1A75 B;  1NCZ A;  4N1F A;  4YRU A;  2H8V A;  1SR6 C;  2NZ0 A;  1QX7 A;  5FYX A;  3UNW A;  1LA0 A;  1Q80 A;  1SR6 B;  1OMR A;  4TNC A;  4GGN A;  1K95 A;  1X02 A;  3KO0 A;  4XJK B;  1DJZ A;  1LKJ A;  5HKW A;  2MBX A;  1YUU A;  2KPH A;  3GK2 A;  1SKT A;  1OZO A;  4QJ5 B;  2WND A;  1XFU O;  3CYZ A;  2QEH A;  1PSR A;  1DF0 B;  4F7F A;  1K93 D;  2QPT A;  1IGV A;  1Y6W A;  3C1V A;  3VRN A;  1S5G Z;  1NPQ A;  3I5I B;  1G33 A;  4NQG A;  2BCX A;  2ZRT A;  3I5I C;  5K89 A;  1A29 A;  4R1E A;  5CPV A;  2NLN A;  1PK0 D;  2WOS A;  2OTG C;  1K94 A;  2F3Z A;  1QAT A;  2NCP A;  2JQ6 A;  1U5I B;  2JRF A;  3OB1 B;  1M46 A;  1NYA A;  2KFH A;  1B8L A;  1SCM C;  2CBL A;  2CXJ A;  2MLE C;  1DF0 A;  1TNX A;  3D0Y A;  3O4Y A;  3CWG A;  4DS7 A;  1QIV A;  2HET A;  2NCO A;  1NX2 A;  3O4X A;  3PN7 C;  4FTG A;  4MLW A;  1JFJ A;  2L2C A;  1JWD A;  2ZN8 A;  1S6I A;  2L98 A;  3R1V A;  3RZS A;  2BKI B;  2WCL A;  3K21 A;  1S6J A;  3L47 A;  1G4Y R;  1OOH A;  1XK4 A;  2WC5 A;  1QV0 A;  4GUK A;  2PAL A;  3JVT B;  1TNQ A;  2M29 A;  3TDU A;  1DC1 A;  2RGI A;  3OX5 A;  1QLS A;  1AUI B;  1FW4 A;  1DJG A;  3EK4 A;  3DXL A;  3VB1 A;  1KQM C;  2JPO A;  3BUM B;  2GGM A;  2LMU A;  2JTT A;  4MZJ A;  5J3X A;  1BMO A;  1B9A A;  2LUC A;  5JJG A;  1M45 A;  1C7W A;  1WRL A;  1SK6 D;  2FCD A;  1JF2 A;  3CAB A;  2PQL A;  5IBW A;  1XYD A;  1YUR A;  4MZL A;  1OW4 A;  3BFB A;  3S0B A;  1DT7 B;  1WDC C;  2L5X B;  2Y1M A;  3BJH A;  1WDC B;  5HKY A;  2LUX A;  1W7J B;  1SYM A;  2H2K A;  2WC8 A;  4OCI A;  5TNC A;  2CTN A;  2KDH A;  2FOT A;  3EG5 B;  1TTX A;  4QJ4 B;  1EH2 A;  1DEK A;  5DKQ A;  3BXK A;  1OOF A;  2BL0 B;  1B8R A;  3D10 A;  2BCB A;  2KQY A;  2Q91 A;  3I5F B;  2OPO A;  4JKT A;  1YR5 A;  1XVJ A;  4WQ3 A;  4PT1 A;  4YI9 A;  1MR8 A;  2LHL A;  1MHO A;  3B86 A;  3D77 A;  4IJ7 A;  2V53 A;  3CGA A;  4PCW A;  4HSZ A;  4GNK B;  5HL1 A;  2Y1N A;  1CNP A;  2M1K B;  3TUY C;  3AKB A;  1TNP A;  2K2A A;  2ERB A;  3R72 A;  2OS8 B;  4ORB B;  3VRQ A;  1A03 A;  2BNX A;  3E3R A;  1B7T Z;  3DVE A;  1WLZ A;  4PHM A;  1GJY A;  2HF5 A;  4IL1 A;  2MJW B;  1UUR A;  3DVM A;  3NXA A;  1IIO A;  4DRW A;  1TN4 A;  5AER A;  1FI5 A;  2NXQ A;  2CNP A;  2KI6 D;  2LVK A;  1M31 A;  2FCE A;  2LVI A;  2QDI A;  1IKU A;  2AMI A;  1CM4 A;  2JU0 A;  3D76 A;  3VGO A;  3CTN A;  1F55 A;  1YRU B;  2LLT A;  1SL8 A;  2MAZ A;  4GAO A;  4INX A;  2LCP A;  5CSF A;  1CMG A;  2JUL A;  3TZ1 A;  1XFZ O;  3VRR A;  5AXI A;  3EKJ A;  1CKK A;  1KQM B;  4GFT A;  4JWQ A;  3I5H B;  2KLE A;  1SPY A;  3DD4 A;  3EVU A;  2M97 A;  4YGE B;  2VRG A;  3B7A A;  3FWC A;  2KBM A;  3LLE A;  5D3O A;  2SCP A;  1K8U A;  2TN4 A;  1RJV A;  2PVB A;  3HCM A;  1JSA A;  5DKR A;  1PVA A;  1TOP A;  3S0D A;  1XFR A;  4OVN F;  1EJ3 A;  1SNL A;  2BE4 A;  3DF0 B;  2WCH A;  1E8A A;  1KFX L;  1QIW A;  3PM2 A;  5GQQ C;  3I5G B;  2M0R A;  1KK8 C;  2F3Y A;  3O78 A;  1M39 A;  1L2O C;  2BL0 C;  1SBJ A;  2F8P A;  5G08 A;  1A4P A;  5I2Q A;  1TCO B;  2JNX A;  3BQ3 A;  3CS1 A;  1DJX A;  1YTZ C;  3KHE A;  3O2P A;  2L51 A;  4BY4 A;  4OV2 A;  3PJI A;  3SS3 A;  5PAL A;  1J7R A;  2P6B B;  4ZCU A;  2K60 A;  1YUS A;  1TUZ A;  1S3P A;  3BUO B;  4MZK A;  4PE7 A;  1AJ5 A;  1QV1 A;  1KWO C;  1UHH A;  1W9Z A;  2QAC A;  3IQO A;  4M2P A;  4MN0 A;  4CLN A;  1DGV A;  3FE9 A;  2WCB A;  1LS8 A;  1OMV A;  1V1G A;  3OX6 A;  2P71 A;  4A4B A;  1MXL C;  3SG3 A;  1DEL A;  4ETO A;  3CDN A;  1A75 A;  1KCY A;  2L50 A;  4U8D A;  2JNF A;  3OBV A;  4YGC B;  3SIB A;  5I8N A;  1PSB A;  4XJK A;  2GTE A;  3EKH A;  1J7Q A;  3I5F C;  1FBV A;  5EL2 A;  3SG6 A;  3Q8I A;  3HX4 A;  2JOJ A;  4MEW A;  2KAX A;  1S5G Y;  3IQQ A;  1MXE A;  4AOM A;  3B87 A;  2SAS A;  1Y1U A;  1XA5 A;  2I7A A;  4FQO A;  2I2R E;  3JTD C;  3FE6 A;  1J7P A;  4YGA A;  1RFJ A;  1GM0 A;  2JZI A;  1YX7 A;  1OOI X;  3BUX B;  1CFP A;  2I18 A;  1K2H A;  2KLD A;  1ZUZ A;  2KYC A;  2K8M B;  1NIW A;  5B8I B;  3SS4 A;  2LAN A;  1DVI A;  1ZOT B;  2G2B A;  4HRH A;  1F4O A;  2LVJ A;  4HRE E;  1DGU A;  2L0P A;  3N7H A;  1NWD A;  2WCK A;  1IWQ A;  2A4J A;  1UUS A;  3L4L A;  5DKN A;  1NUB A;  1REC A;  2LLS A;  1IRJ A;  2Q4U A;  2WCE A;  3FS7 A;  3ICB A;  3LL8 B;  2K0J A;  3SIA A;  1T14 A;  3AAJ A;  1JF0 A;  3AKA A;  1YVL A;  3BUW B;  3RLZ A;  4PHK A;  3TUY B;  1TWO A;  2IS9 A;  2KQ6 A;  4UPG A;  1CLB A;  2EC6 C;  3LK1 A;  3IVT A;  3D75 A;  1CFD A;  2BBM A;  1DJI A;  2Y4Q A;  3I5H C;  4ORC B;  3SS5 A;  3SG2 A;  2AUC A;  3EK8 A;  3PSR A;  4PE1 A;  1NX3 A;  1GGW A;  1SL9 A;  2YGU A;  1Y1X A;  1FPW A;  1R2U A;  2E30 A;  1OZS A;  3CZ1 A;  4FQT A;  1F54 A;  4L9M A;  3FWB A;  1XFX O;  1JFK A;  2LNK A;  1QLK A;  1WLM A;  1Y0V H;  3BOW B;  2F2P A;  2M1U A;  2MLF C;  4MBE A;  1DMO A;  1XO5 A;  1R6P A;  2ZFD A;  1B7T Y;  1DTL A;  1IG5 A;  4DIR A;  2LHI A;  3GK1 A;  1FI6 A;  3A4U B;  4GGF A;  1KK7 Y;  4YI8 A;  1ZMZ A;  1YX8 A;  1SL7 A;  2CT9 A;  2EC6 B;  4DCK A;  3M0W A;  1K90 D;  1BF5 A;  3A8R A;  1J1D A;  3LCP C;  1JBA A;  3DVJ A;  4HRG A;  1XFY O;  4PDZ A;  4C0K A;  1AP4 A;  1DQE A;  3NSO A;  4E68 A;  1PVB A;  2H61 C;  4I5L B;  4DUQ A;  2ZRS A;  5DIC A;  1BT6 A;  1QS7 A;  3VRP A;  2JXC A;  1S36 A;  3AAK A;  1YRT B;  4AQI A;  2PSR A;  1M63 B;  2JC2 A;  3NSL A;  4F0Z B;  1FF1 A;  1TRF A;  3IF7 A;  1QVI Z;  1NCY A;  1NX0 A;  2QEO A;  2BEC A;  2JT3 A;  1EXR A;  3S0F A;  1U5I A;  1XK4 C;  3S0E A;  2BCA A;  5FI6 A;  2KI6 C;  2K7C A;  1OE9 B;  3CZ0 A;  5HLV A;  1SCM B;  1CDN A;  1QAS A;  2LE9 B;  2M8U A;  1LXF C;  3D0Y B;  3JTD B;  3H4S E;  2ISD A;  2L5Y A;  1SMG A;  1L7Z A;  5AEQ A;  3EK7 A;  1EL4 A;  4PHN A;  2K7B A;  3TS5 B;  1CM1 A;  1F71 A;  1IJ6 A;  2ZKM X;  5HYD A;  2E6W A;  3EVV A;  3CR2 A;  3PFV A;  1B1G A;  2BBN A;  4PE4 A;  2KGB C;  4M2Q A;  2EHB A;  1BOC A;  2LV7 A;  2LMV A;  2HPS A;  1LIN A;  4XYN A;  2PYQ A;  1S26 D;  3PLF B;  4ZCV A;  5I2O A;  1RRO A;  3DVK A;  1TIZ A;  4P2Y B;  4GBA A;  2BE6 A;  5AAN A;  1BR4 B;  1IQ3 A;  1HQV A;  4JD9 A;  3VRO A;  1GGZ A;  1LVC D;  4I5N B;  4MSP A;  1BOD A;  3DZT A;  3ZNI A;  5JOL A;  1W7I B;  1CMF A;  5F6T A;  2L4H A;  2COL B;  2K2F A;  5CSJ A;  1RTP 1;  4CPV A;  5D69 A; 
#chains in the Genus database with same CATH homology
 5ER5 A;  2JTZ A;  3I5G C;  4OR9 B;  1C7V A;  1QJT A;  4WRI A;  1QVI Y;  5ER4 X;  2O60 A;  4N5X A;  2KNE A;  4P5O E;  1DJY A;  2M9G A;  2KSP A;  1H4B A;  4I5K A;  3BOW A;  1J55 A;  2HQW A;  1ALV A;  1XFW O;  2PRU A;  4M2O A;  5I2L A;  3KF9 A;  2JWW A;  4AQJ A;  4CFQ A;  4C0L A;  2PMY A;  2EGD A;  2ZNE A;  1SCV A;  1WY9 A;  2KOT A;  3CLN A;  1F70 A;  2LM5 A;  1MUX A;  1RK9 A;  4MRY A;  1KSO A;  1G8I A;  1GQM A;  1RWY A;  3PN7 B;  1CLM A;  1BJF A;  2G9B A;  2KAY A;  2MHH A;  4NDB A;  1CDM A;  5HLO A;  3RM1 A;  1QX5 B;  1SW8 A;  1Y1A A;  4C0J A;  3GOF A;  2KGR A;  2MA2 A;  1KFU S;  3F45 A;  2Y5I A;  4YBH B;  1NSH A;  1SY9 A;  1XFV O;  3KEV A;  2DOQ A;  2JT8 A;  3WHU B;  3WNX B;  1EG4 A;  2LLU A;  2K7O A;  1DJW A;  5AFP A;  4YGD B;  1BLQ A;  1H8B A;  1UP5 A;  1YVH A;  1B8C A;  1K96 A;  2K7D A;  4PAL A;  4OKH A;  1YUT A;  3FIA A;  1AK8 A;  2L4I A;  1KWO B;  1QXP A;  5BPJ A;  4Q04 A;  1NCX A;  1OSA A;  2CCM A;  4PE0 A;  5HKZ A;  1UWO A;  2M7N A;  4CFR A;  2KFG A;  2FJU B;  1QTX A;  3CZT X;  1BR1 B;  2F2O A;  1LA3 A;  1PRW A;  2HQ8 A;  3DF0 A;  3NSI A;  3EVR A;  4CID A;  4PHJ A;  1CB1 A;  2JPT A;  1KK8 B;  1F4Q A;  1UHK A;  2R2I A;  1KQV A;  1AHR A;  2ZND A;  4MVF A;  3MSE B;  1AJ4 A;  1WRK A;  2PAS A;  1KFX S;  2JXL A;  2KYF A;  2OTG B;  3LK0 A;  1TNW A;  3GK4 X;  1CDP A;  1UHI A;  2JT0 A;  2LMT A;  4N1G A;  3WHT B;  2GV5 A;  4MRX A;  1N2D A;  1EG3 A;  1TCF A;  1K9K A;  3WXA A;  3TDI A;  4I5J A;  3SG5 A;  1QX2 A;  5CSN A;  4JQ0 D;  1OOJ A;  1PUL A;  2H61 A;  2LAP A;  1C07 A;  2KBI A;  3BYA A;  2KI4 C;  3KPX A;  3O6B A;  5D7F A;  2KI4 B;  1NP8 A;  1HT9 A;  4WQ2 A;  1UHN A;  1L2O B;  3ZWH A;  1MWN A;  1CDL A;  1V1F A;  1CTR A;  1MQ1 A;  4GGF C;  4JPZ B;  1IH0 A;  4GPL B;  1N65 A;  1K9P A;  1WRZ A;  1ODB A;  1S1E A;  2LC5 A;  2WCF A;  4ORA B;  3SG4 A;  1ALW A;  1CLL A;  1D1O A;  2AAO A;  1JC2 A;  1KK7 Z;  2OS8 C;  1OQP A;  4BY5 A;  5KTY A;  1ZAC A;  4A4C A;  1K9U A;  1BU3 A;  1SRA A;  3BUN B;  1J1E A;  3TDZ A;  2I94 A;  3PAT A;  2M49 B;  4QJ3 B;  3CR5 X;  1J7O A;  1IJ5 A;  3JVT C;  2O5G A;  4D1E A;  4YGB B;  1IQ5 A;  3QRX A;  2MRD A;  3OHM B;  5KU1 A;  1S6C A;  2LP3 A;  2KFF A;  1F8H A;  2M3W A;  2L2E A;  1KSM A;  1JUO A;  2WOR A;  2BKH B;  1VRK A;  4USL A;  1BG1 A;  3TS5 C;  1B47 A;  3NSK A;  2F33 A;  1CFF A;  3SG7 A;  2GGZ A;  5CSI A;  1ZFS A;  2K61 A;  1AVS A;  1B4C A;  2ZN9 A;  4NDD A;  2D8N A;  2M7L A;  1N0Y A;  3CR4 X;  5KSZ A;  1OMD A;  2KAV A;  3PAL A;  3PM8 A;  3OB2 B;  1MF8 B;  1DJH A;  1UHJ A;  2LP2 A;  2LVV A;  3OP0 A;  2B1U A;  3SJS A;  1NX1 A;  1KFU L;  2KHN A;  1PAL A;  1A2X A;  4NDC A;  4ICB A;  1A75 B;  1NCZ A;  4N1F A;  4YRU A;  1SR6 C;  2NZ0 A;  1QX7 A;  5FYX A;  1LA0 A;  1Q80 A;  1SR6 B;  1OMR A;  4TNC A;  4GGN A;  1K95 A;  1X02 A;  3KO0 A;  4XJK B;  1DJZ A;  1LKJ A;  5HKW A;  2MBX A;  1YUU A;  3GK2 A;  1SKT A;  1OZO A;  4QJ5 B;  2WND A;  1XFU O;  1PSR A;  1DF0 B;  1K93 D;  2QPT A;  1IGV A;  1Y6W A;  3C1V A;  3VRN A;  1S5G Z;  1NPQ A;  3I5I B;  1G33 A;  4NQG A;  2BCX A;  2ZRT A;  3I5I C;  5K89 A;  1A29 A;  4R1E A;  5CPV A;  2NLN A;  1PK0 D;  2WOS A;  2OTG C;  1K94 A;  2F3Z A;  1QAT A;  2NCP A;  2JQ6 A;  1U5I B;  2JRF A;  3OB1 B;  1M46 A;  1NYA A;  2KFH A;  1B8L A;  1SCM C;  2CBL A;  2CXJ A;  2MLE C;  1DF0 A;  1TNX A;  3D0Y A;  3O4Y A;  3CWG A;  4DS7 A;  1QIV A;  2HET A;  2NCO A;  1NX2 A;  3PN7 C;  4FTG A;  4MLW A;  1JFJ A;  1JWD A;  2ZN8 A;  1S6I A;  2L98 A;  2BKI B;  3K21 A;  1S6J A;  1G4Y R;  1XK4 A;  1QV0 A;  4GUK A;  2PAL A;  3JVT B;  1TNQ A;  2M29 A;  3TDU A;  2RGI A;  3OX5 A;  1QLS A;  1AUI B;  1FW4 A;  1DJG A;  3EK4 A;  1KQM C;  3BUM B;  2GGM A;  2LMU A;  2JTT A;  4MZJ A;  5J3X A;  1BMO A;  1B9A A;  2LUC A;  5JJG A;  1M45 A;  1C7W A;  1WRL A;  1SK6 D;  2FCD A;  1JF2 A;  5IBW A;  1XYD A;  1YUR A;  4MZL A;  1DT7 B;  1WDC C;  2L5X B;  2Y1M A;  1WDC B;  5HKY A;  2LUX A;  1W7J B;  1SYM A;  2H2K A;  2WC8 A;  4OCI A;  5TNC A;  2CTN A;  2KDH A;  2FOT A;  4QJ4 B;  1TTX A;  1EH2 A;  5DKQ A;  3BXK A;  2BL0 B;  1B8R A;  3D10 A;  2BCB A;  2KQY A;  2Q91 A;  3I5F B;  2OPO A;  4WQ3 A;  1YR5 A;  1XVJ A;  4YI9 A;  1MR8 A;  2LHL A;  1MHO A;  4PCW A;  2V53 A;  3CGA A;  4HSZ A;  4GNK B;  1CNP A;  2Y1N A;  2M1K B;  3TUY C;  3AKB A;  1TNP A;  2K2A A;  2OS8 B;  4ORB B;  3VRQ A;  1A03 A;  3E3R A;  1B7T Z;  3DVE A;  1WLZ A;  4PHM A;  1GJY A;  2HF5 A;  4IL1 A;  2MJW B;  1UUR A;  3DVM A;  3NXA A;  4DRW A;  1TN4 A;  5AER A;  1FI5 A;  2NXQ A;  2CNP A;  2KI6 D;  2LVK A;  1M31 A;  2FCE A;  2LVI A;  1IKU A;  2AMI A;  1CM4 A;  2JU0 A;  3VGO A;  3CTN A;  1F55 A;  1YRU B;  2LLT A;  1SL8 A;  2MAZ A;  4GAO A;  2LCP A;  5CSF A;  1CMG A;  2JUL A;  3TZ1 A;  1XFZ O;  3VRR A;  5AXI A;  3EKJ A;  1CKK A;  1KQM B;  4GFT A;  4JWQ A;  3I5H B;  3EVU A;  1SPY A;  3DD4 A;  2M97 A;  4YGE B;  2VRG A;  3FWC A;  2KBM A;  3LLE A;  2SCP A;  1K8U A;  2TN4 A;  1RJV A;  2PVB A;  3HCM A;  1JSA A;  5DKR A;  1PVA A;  1TOP A;  4OVN F;  1EJ3 A;  1SNL A;  2BE4 A;  3DF0 B;  1E8A A;  1KFX L;  1QIW A;  5GQQ C;  3I5G B;  2M0R A;  1KK8 C;  2F3Y A;  3O78 A;  1M39 A;  1L2O C;  1SBJ A;  2BL0 C;  2F8P A;  5G08 A;  1A4P A;  5I2Q A;  1TCO B;  2JNX A;  3BQ3 A;  3CS1 A;  1DJX A;  1YTZ C;  3KHE A;  3O2P A;  2L51 A;  4BY4 A;  4OV2 A;  5PAL A;  1J7R A;  2P6B B;  4ZCU A;  1YUS A;  1S3P A;  3BUO B;  4MZK A;  4PE7 A;  1AJ5 A;  1QV1 A;  1KWO C;  1UHH A;  3IQO A;  2QAC A;  4M2P A;  4MN0 A;  4CLN A;  1DGV A;  2WCB A;  1OMV A;  1V1G A;  3OX6 A;  4ETO A;  4A4B A;  1MXL C;  3SG3 A;  1A75 A;  1KCY A;  2L50 A;  4U8D A;  2JNF A;  4YGC B;  3SIB A;  5I8N A;  1PSB A;  4XJK A;  3EKH A;  1J7Q A;  3I5F C;  1FBV A;  3SG6 A;  3HX4 A;  2JOJ A;  4MEW A;  2KAX A;  1S5G Y;  3IQQ A;  1MXE A;  4AOM A;  2SAS A;  1Y1U A;  1XA5 A;  2I7A A;  4FQO A;  2I2R E;  3JTD C;  1J7P A;  4YGA A;  1RFJ A;  2JZI A;  1YX7 A;  3BUX B;  1CFP A;  2I18 A;  1K2H A;  1ZUZ A;  2KYC A;  2K8M B;  1NIW A;  5B8I B;  2LAN A;  1DVI A;  1ZOT B;  2G2B A;  4HRH A;  1F4O A;  2LVJ A;  4HRE E;  1DGU A;  2L0P A;  1NWD A;  1IWQ A;  2A4J A;  1UUS A;  5DKN A;  1NUB A;  1REC A;  2LLS A;  1IRJ A;  2Q4U A;  2WCE A;  3FS7 A;  3ICB A;  3LL8 B;  2K0J A;  3SIA A;  3AAJ A;  1JF0 A;  3AKA A;  1YVL A;  3BUW B;  3RLZ A;  4PHK A;  3TUY B;  2IS9 A;  2KQ6 A;  4UPG A;  1CLB A;  2EC6 C;  3LK1 A;  1CFC A;  3I5H C;  1CFD A;  2BBM A;  1DJI A;  2Y4Q A;  4ORC B;  1B1G A;  3SG2 A;  2AUC A;  3EK8 A;  3PSR A;  4PE1 A;  1NX3 A;  1GGW A;  1SL9 A;  1Y1X A;  1FPW A;  1R2U A;  2E30 A;  1OZS A;  1F54 A;  4L9M A;  3FWB A;  1XFX O;  1JFK A;  2LNK A;  1QLK A;  1WLM A;  1Y0V H;  3BOW B;  2F2P A;  2M1U A;  2MLF C;  4MBE A;  1DMO A;  1XO5 A;  1R6P A;  2ZFD A;  1B7T Y;  1DTL A;  1IG5 A;  4DIR A;  2LHI A;  3GK1 A;  1FI6 A;  3A4U B;  4GGF A;  1KK7 Y;  4YI8 A;  1ZMZ A;  1YX8 A;  1SL7 A;  2CT9 A;  2EC6 B;  4DCK A;  3M0W A;  1K90 D;  1BF5 A;  3A8R A;  1J1D A;  3LCP C;  1JBA A;  3DVJ A;  4HRG A;  1XFY O;  4PDZ A;  4C0K A;  1AP4 A;  3NSO A;  4E68 A;  1PVB A;  2H61 C;  4I5L B;  4DUQ A;  2ZRS A;  1BT6 A;  1QS7 A;  3VRP A;  2JXC A;  1S36 A;  3AAK A;  1YRT B;  4AQI A;  2PSR A;  1M63 B;  2JC2 A;  3NSL A;  4F0Z B;  1FF1 A;  1TRF A;  3IF7 A;  1QVI Z;  1NCY A;  1NX0 A;  2BEC A;  2JT3 A;  1EXR A;  1U5I A;  1XK4 C;  2BCA A;  2KI6 C;  2K7C A;  1OE9 B;  5HLV A;  1SCM B;  1CDN A;  1QAS A;  2LE9 B;  2M8U A;  1LXF C;  3D0Y B;  3JTD B;  3H4S E;  2ISD A;  1SMG A;  1L7Z A;  5AEQ A;  3EK7 A;  1EL4 A;  4PHN A;  2K7B A;  3TS5 B;  1CM1 A;  1F71 A;  1IJ6 A;  2ZKM X;  5HYD A;  2E6W A;  3EVV A;  3CR2 A;  3PFV A;  2BBN A;  4PE4 A;  2KGB C;  4M2Q A;  2EHB A;  1BOC A;  2LV7 A;  2LMV A;  2HPS A;  1LIN A;  4XYN A;  1S26 D;  3PLF B;  4ZCV A;  5I2O A;  1RRO A;  3DVK A;  1TIZ A;  4P2Y B;  4GBA A;  2BE6 A;  5AAN A;  1BR4 B;  1IQ3 A;  1HQV A;  3VRO A;  1GGZ A;  1LVC D;  4I5N B;  4MSP A;  1BOD A;  3ZNI A;  5JOL A;  1W7I B;  1CMF A;  5F6T A;  2L4H A;  2COL B;  2K2F A;  5CSJ A;  1RTP 1;  4CPV A;  5D69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...