2AMIA

Solution structure of the calcium-loaded n-terminal sensor domain of centrin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
RVGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caltractin
publication title Structure of the N-terminal calcium sensor domain of centrin reveals the biochemical basis for domain-specific function.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Cell cycle
total genus 29
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2amiA00
1YVLA 1VRKA 1UP5A 2KBIA 1W7IB 1S5GY 2Y1MA 1QV0A 1XK4A 1RWYA 2HETA 3KO0A 1UHIA 3EK4A 1KCYA 2ZN9A 2ZNEA 1M46A 3CGAA 4YI9A 3WNXB 3HX4A 1MUXA 4MZKA 1LVCD 4I5NB 1YX7A 3SG3A 2KDHA 4YBHB 3BQ3A 1KK8C 1KFUL 1NCYA 1DTLA 2BBMA 1YR5A 2AAOA 1PVBA 5AEQA 1QVIZ 1RFJA 2Y4QA 3O78A 2RGIA 1DF0B 3EVUA 1B9AA 3IF7A 4I5LB 5HLVA 4ORCB 1L7ZA 1LKJA 4GNKB 1XFZO 1MXEA 1XFYO 2JNFA 4N5XA 1U5IA 2L50A 2ZN8A 2QPTA 2JU0A 1BG1A 2MJWB 1CFDA 1KFXL 3F45A 3LK0A 4HSZA 1UHNA 1DJZA 2JTZA 1A75A 2LP3A 3A8RA 2KI6D 1MQ1A 4C0JA 1SKTA 1CDPA 5CSIA 4CIDA 4PCWA 2JT3A 2PRUA 1B7TZ 2JTTA 1J7RA 1TNQA 2MHHA 3GOFA 1F55A 4USLA 1NP8A 2KGBC 2LUCA 3FWBA 3I5GB 2JWWA 1XVJA 1JF0A 3GK2A 1SCMC 3LLEA 1DJXA 3O2PA 4CLNA 1H4BA 2L4HA 2M1UA 2LMUA 1M39A 2MLEC 1Y0VH 4WQ2A 4XYNA 3OHMB 1WLZA 4ORAB 1V1FA 1G33A 1K95A 1FPWA 1OZOA 3GK1A 4NDCA 1UHJA 2BCBA 1FBVA 4GBAA 2L4IA 2G9BA 5JOLA 1KQMC 4OKHA 1XO5A 2QACA 1QX2A 3RM1A 1X02A 1TTXA 2EGDA 5CSFA 5BPJA 4ORBB 2KAYA 1GGWA 2ZRSA 2MAZA 5D69A 2HQ8A 3BUWB 1Y6WA 2Q91A 3JVTC 4BY4A 2I2RE 1CDNA 2PSRA 1PVAA 3OB1B 1AP4A 1IQ3A 2JXLA 1NCZA 4WQ3A 3CWGA 2L0PA 1M31A 1SL8A 2Y5IA 2KQ6A 2KBMA 4AOMA 2M97A 2OS8B 3MSEB 2M1KB 4OR9B 3VRQA 1WDCB 1MWNA 3I5FC 2LAPA 2Y1NA 3EKJA 3AAJA 1C7VA 1F4OA 1JF2A 1IH0A 2L98A 1KQVA 1IWQA 3I5HC 3OB2B 3PM8A 1JC2A 5I2QA 3TDIA 3IQQA 4PHKA 2LMTA 1OE9B 2WOSA 1J7QA 1F54A 1BJFA 1XFUO 3FWCA 1K93D 2GV5A 3I5IC 1KFUS 1TIZA 1CMFA 1TRFA 1QIWA 3VROA 1Y1XA 1WRLA 2LNKA 4GAOA 4JQ0D 1B1GA 5I8NA 2BECA 1SW8A 2ISDA 1QS7A 3PSRA 4MLWA 1NX2A 3VGOA 5F6TA 2H61A 1LA3A 3EVRA 1WY9A 1YX8A 1S6CA 2M9GA 4F0ZB 1KFXS 2WC8A 3SG5A 3HCMA 4YRUA 2V53A 1F70A 1L2OB 1XYDA 1K8UA 1KSOA 1ZUZA 2Q4UA 3BUMB 4TNCA 2F2PA 3TS5C 2HPSA 2L2EA 1IG5A 4GGNA 1RJVA 1B8RA 2FCDA 2OTGB 1KK7Z 2JC2A 1JFKA 1OMVA 1PSBA 3CZTX 1IJ5A 2LCPA 1CTRA 2ZNDA 2CCMA 4I5KA 3NSIA 5HKWA 2WNDA 1HT9A 4QJ3B 5AANA 1MHOA 1UHKA 2K0JA 4MRYA 1MF8B 1K2HA 3OX5A 2EC6C 1PK0D 2A4JA 1UUSA 3JTDB 3PN7C 1AUIB 4IL1A 1SK6D 4Q04A 1DJHA 4E68A 3AAKA 3WHTB 2LUXA 4ICBA 4PALA 2I7AA 2M49B 2L51A 2I18A 1F4QA 3OP0A 2NCOA 4MBEA 2VRGA 1QLSA 1YURA 1Y1UA 2KFGA 1R6PA 1TNWA 2JNXA 2WCEA 2F3YA 4M2PA 1CLBA 1DJYA 1K94A 2JT0A 1SRAA 3A4UB 1KK8B 3BOWA 1U5IB 4AQJA 1AK8A 1XFXO 1V1GA 3KHEA 1IRJA 3BOWB 4P5OE 1ALWA 1A75B 4L9MA 1FF1A 2O60A 1QV1A 2JOJA 1JUOA 1J1EA 2K7BA 4XJKA 5JJGA 5I2LA 1K90D 5I2OA 3BUNB 1DJGA 3BYAA 5HLOA 1RTP1 1UHHA 1XA5A 1RECA 1WLMA 2D8NA 5ER4X 1J7PA 4XJKB 1BR1B 1SL7A 1ZACA 4OVNF 4YI8A 2FOTA 5CPVA 1TCFA 5D7FA 1TN4A 2NXQA 3LK1A 1KWOC 1TNPA 3FS7A 2K7CA 2MRDA 4MSPA 2AMIA 1K9KA 4WRIA 4DRWA 1BR4B 1QVIY 1IKUA 1PRWA 1G4YR 2M7LA 3D0YA 1GGZA 4DUQA 4ZCVA 3D10A 2G2BA 4DCKA 2M0RA 4ETOA 1OMDA 3CR2A 1JWDA 3D0YB 2CT9A 2K8MB 2JQ6A 1SNLA 1CM4A 3TZ1A 3CS1A 3O4YA 1CFCA 1CB1A 1OZSA 2BL0C 1CFPA 1AJ5A 2KI4C 1YVHA 1YRTB 5DKQA 3TDUA 2DOQA 2LVIA 1QX5B 3DD4A 4MEWA 1CKKA 2K2FA 1B47A 3EVVA 3FIAA 2SASA 1QTXA 1XFWO 4GFTA 1KQMB 1BOCA 1B7TY 2ZFDA 5K89A 1S26D 3EK8A 1A4PA 4MVFA 4CFRA 1A2XA 1QXPA 2KYCA 1ZOTB 5J3XA 1EJ3A 2M8UA 4R1EA 3CR5X 3KEVA 5CSJA 4CPVA 1XFVO 1UWOA 3SJSA 1CLLA 3DVMA 2KFFA 2LVVA 4A4BA 4M2OA 3VRPA 2PVBA 2LE9B 3JVTB 4DS7A 3SIAA 2IS9A 4GUKA 2BCXA 3K21A 1IJ6A 1JBAA 3C1VA 1F71A 2KI6C 1YUSA 1N0YA 2CNPA 2E30A 1A29A 1PSRA 3SG6A 3SG2A 4JPZB 1S3PA 4QJ5B 5AFPA 1WRZA 5KU1A 2KHNA 2LLUA 3I5FB 5HKZA 4UPGA 1D1OA 1LXFC 2LVKA 2LV7A 4PHJA 5FYXA 4A4CA 2CBLA 3IQOA 3I5HB 2HF5A 1M63B 1S5GZ 1EL4A 1NX1A 1SL9A 2JRFA 4I5JA 4N1GA 1PULA 1M45A 3VRRA 3QRXA 3I5IB 3WXAA 2KQYA 1BODA 1TNXA 2JT8A 1J55A 2ZKMX 1B8CA 3ICBA 1S1EA 3BXKA 1A03A 1SR6C 2B1UA 2KSPA 1WRKA 1K9PA 2H2KA 4BY5A 5GQQC 2M29A 1BMOA 2KAVA 2FCEA 2BKHB 1QJTA 1BU3A 2MA2A 2K2AA 3M0WA 1JSAA 1B8LA 1ZMZA 1DJWA 3AKBA 1E8AA 3TUYB 4PDZA 1YUTA 1SCVA 1CDMA 1NCXA 5HKYA 3BUOB 4YGAA 1F8HA 2F33A 5CSNA 1DMOA 3CLNA 1DGUA 2LMVA 3DF0A 4PHNA 3O6BA 1EG4A 4DIRA 1BLQA 2KFHA 2LHLA 3SG7A 3SG4A 3DF0B 1AHRA 2R2IA 3TS5B 1H8BA 1IGVA 1CMGA 1DGVA 1S36A 2E6WA 3RLZA 2LLTA 2O5GA 1EXRA 3VRNA 2LP2A 5AXIA 1OQPA 4MRXA 4P2YB 1CDLA 1EG3A 1YRUB 2ZRTA 2EC6B 1YTZC 3PN7B 4FTGA 4NDDA 2GGZA 2LHIA 4NQGA 1CM1A 1PALA 2LLSA 3E3RA 3SIBA 3NSLA 5PALA 4PHMA 1DF0A 1QX7A 2MBXA 1KK7Y 1C7WA 1J1DA 1UURA 1OOJA 1MXLC 3WHUB 4D1EA 4MN0A 4FQOA 3I5GC 3EK7A 3NSOA 2JPTA 2JULA 4CFQA 1Q80A 3OX6A 2LM5A 1YUUA 2PMYA 4ZCUA 2JZIA 2WCBA 2L5XB 2MLFC 4PE4A 2SCPA 2P6BB 1FW4A 2KOTA 1SMGA 3ZNIA 1NIWA 3ZWHA 5AERA 4PE1A 2KGRA 4YGBB 1SCMB 3KPXA 1NUBA 1LA0A 1OMRA 2F8PA 1QATA 1SYMA 1TOPA 2GGMA 2K7OA 2KAXA 2KNEA 2KYFA 4NDBA 4U8DA 1RROA 3KF9A 4JWQA 1DJIA 5HYDA 1KWOB 1NYAA 2JXCA 3DVKA 2M7NA 1NX3A 1AVSA 5TNCA 1ALVA 1R2UA 1N2DA 1RK9A 2LC5A 2F2OA 2K7DA 1IQ5A 2BKIB 3H4SE 1DVIA 1GQMA 2OS8C 4OCIA 2BL0B 4HRGA 1G8IA 1WDCC 2LVJA 4PE7A 1NX0A 2KI4B 4PE0A 1S6JA 4YGEB 1B4CA 2AUCA 1EH2A 2LANA 1FI6A 3BUXB 3PALA 1AJ4A 4N1FA 2CXJA 2NLNA 1CNPA 3PATA 1JFJA 4HREE 4C0LA 1C07A 3GK4X 1Y1AA 4GPLB 5ER5A 1LINA 2PASA 1S6IA 1J7OA 3DVJA 3EKHA 1BT6A 1QIVA 2HQWA 1NPQA 3LCPC 5B8IB 5IBWA 1ZFSA 2BCAA 1OSAA 4GGFC 3CR4X 4MZJA 2EHBA 1QLKA 4AQIA 1BF5A 4HRHA 4OV2A 2NCPA 2H61C 2OPOA 2BBNA 2WORA 3TDZA 2WCFA 1CFFA 5KSZA 1CLMA 3NXAA 1DT7B 2M3WA 1TCOB 2BE6A 3PFVA 1L2OC 1K96A 1SY9A 2K61A 2TN4A 3CTNA 4GGFA 1MR8A 3PLFB 4QJ4B 1SPYA 5DKRA 4YGDB 1GJYA 2OTGC 1FI5A 3NSKA 2FJUB 4M2QA 1SBJA 2CTNA 2I94A 5DKNA 2PALA 1N65A 5G08A 4C0KA 3TUYC 1NSHA 1K9UA 1NWDA 1ODBA 3AKAA 3LL8B 2BE4A 1XK4C 1QASA 2NZ0A 4MZLA 1KSMA 1W7JB 2F3ZA 3JTDC 1SR6B 4YGCB 1HQVA 2COLB 5KTYA 3DVEA
chains in the Genus database with same CATH superfamily
1YVLA 3IVTA 1VRKA 2ERBA 1UP5A 2KBIA 1W7IB 1S5GY 2Y1MA 3S0FA 1QV0A 1XK4A 1RWYA 2HETA 3KO0A 1UHIA 3EK4A 1KCYA 2ZN9A 1W9ZA 2ZNEA 1M46A 3CGAA 4YI9A 3WNXB 3HX4A 1MUXA 4MZKA 1LVCD 4I5NB 1YX7A 5FI2A 2KDHA 3SG3A 4YBHB 3BQ3A 1KK8C 1KFUL 1NCYA 1DTLA 1OW4A 2BAPA 2BBMA 3R1OA 1YR5A 5EL2A 2AAOA 1PVBA 5FI7A 1QVIZ 1RFJA 2Y4QA 5AEQA 3O78A 3S0GA 2RGIA 1DF0B 3EVUA 1B9AA 3IF7A 4I5LB 5HLVA 1TUZA 4ORCB 1L7ZA 1LKJA 4GNKB 1XFZO 1MXEA 1XFYO 2JNFA 4N5XA 1U5IA 2L50A 2ZN8A 2QPTA 2JU0A 1BG1A 5I94A 3RZSA 2MJWB 1CFDA 1KFXL 3F45A 3LK0A 4HSZA 1UHNA 1DJZA 2JTZA 1A75A 2LP3A 3A8RA 2KI6D 1MQ1A 4C0JA 1SKTA 1CDPA 5CSIA 4CIDA 1Z2CB 4PCWA 2JT3A 3B7AA 2PRUA 1B7TZ 2JTTA 1J7RA 1TNQA 2MHHA 3GOFA 1F55A 4USLA 1NP8A 2KGBC 2LUCA 3FWBA 3I5GB 2JWWA 1XVJA 1JF0A 3GK2A 1SCMC 3LLEA 1DJXA 3O2PA 4CLNA 1H4BA 2L4HA 2M1UA 2LMUA 1M39A 2MLEC 1Y0VH 2QDIA 4WQ2A 4XYNA 3OHMB 1WLZA 4ORAB 1V1FA 1G33A 1K95A 1FPWA 1OZOA 3GK1A 4NDCA 1UHJA 2BCBA 1FBVA 4GBAA 2L4IA 2G9BA 5JOLA 1KQMC 2WCJA 4OKHA 1XO5A 1C3ZA 2QACA 3D77A 1QX2A 3RM1A 1X02A 1TTXA 2EGDA 5CSFA 3CZ0A 5BPJA 4ORBB 2KAYA 4FQTA 2ZRSA 4GGNA 2MAZA 1GGWA 5D69A 3V2LA 2HQ8A 2WCMA 3BUWB 3D75A 3UNWA 1Y6WA 2Q91A 3JVTC 4BY4A 4JD9A 2I2RE 1CDNA 2PSRA 1PVAA 3OB1B 1AP4A 1IQ3A 2JXLA 1NCZA 1OOHA 3CWGA 4WQ3A 2L0PA 1M31A 1SL8A 2Y5IA 2KQ6A 3D74A 2KBMA 4AOMA 2M97A 2OS8B 3PM2A 3MSEB 2M1KB 4OR9B 3VRQA 1WDCB 1MWNA 3I5FC 2LAPA 2Y1NA 3EKJA 2KLDA 3AAJA 1C7VA 1F4OA 1Z4HA 1P28A 1JF2A 1IH0A 2L98A 1KQVA 1IWQA 3DYEA 3I5HC 3OB2B 3PM8A 1JC2A 5I2QA 2P71A 3TDIA 3IQQA 4PHKA 2LMTA 1OE9B 2WOSA 1J7QA 1F54A 3SS4A 1TWOA 1BJFA 1XFUO 3FWCA 1K93D 2GV5A 3BJHA 3I5IC 1KFUS 1TIZA 1CMFA 1TRFA 1QIWA 3VROA 1Y1XA 1WRLA 2LNKA 4GAOA 4JQ0D 1B1GA 5I8NA 2BECA 1SW8A 2ISDA 1QS7A 1C3YA 3PSRA 4MLWA 1NX2A 3VGOA 5F6TA 5D3OA 2BNXA 2H61A 1LA3A 3EVRA 1WY9A 1YX8A 1S6CA 2M9GA 4F0ZB 1KFXS 2WC8A 3SG5A 3HCMA 4YRUA 2V53A 1F70A 3CABA 1L2OB 1XYDA 1K8UA 1KSOA 1ZUZA 2Q4UA 3BUMB 4TNCA 2F2PA 3TS5C 2HPSA 2L2EA 1IG5A 3B86A 1RJVA 1B8RA 2FCDA 2OTGB 1KK7Z 2JC2A 1JFKA 1OMVA 1PSBA 3CZTX 1IJ5A 2KLEA 2LCPA 1CTRA 2ZNDA 2CCMA 4I5KA 3NSIA 5HKWA 2WNDA 1HT9A 1ORGA 4QJ3B 4F7FA 5AANA 1MHOA 1UHKA 2K0JA 4MRYA 1MF8B 1K2HA 3OX5A 2EC6C 1PK0D 2A4JA 1UUSA 2H8VA 3JTDB 3OBVA 3QMEA 1DEKA 3PN7C 1AUIB 4IL1A 1SK6D 4Q04A 3NHTA 1DJHA 3Q8IA 4E68A 3AAKA 3WHTB 2LUXA 4ICBA 4PALA 2I7AA 2M49B 2L51A 2I18A 1F4QA 2WC6A 3OP0A 2NCOA 4MBEA 2VRGA 1QLSA 1YURA 1Y1UA 2KFGA 1R6PA 1TNWA 2JNXA 2WCEA 2F3YA 4M2PA 1CLBA 1DJYA 1K94A 2JT0A 1SRAA 3A4UB 1KK8B 3BOWA 1U5IB 4AQJA 1AK8A 1XFXO 1V1GA 3KHEA 3DY9A 2QEBA 1IRJA 3BOWB 4P5OE 1ALWA 1A75B 2KPHA 1QWVA 4L9MA 2O60A 1QV1A 2JOJA 1JUOA 1J1EA 2WCLA 1FF1A 2K7BA 4XJKA 5JJGA 5I2LA 1K90D 5I2OA 3BUNB 1DJGA 3BYAA 5HLOA 1RTP1 1UHHA 1XA5A 1RECA 1WLMA 2D8NA 2L5YA 5ER4X 3VB1A 1J7PA 4XJKB 1BR1B 1SL7A 1ZACA 4OVNF 1OOIX 4YI8A 2FOTA 5CPVA 1TCFA 3DXLA 5D7FA 4JKTA 1TN4A 3NGVA 2NXQA 3LK1A 1KWOC 1TNPA 3FS7A 1OOGA 2K7CA 2MRDA 2AMIA 1K9KA 2WC5A 1SSEB 3FE6A 4MSPA 1BR4B 4WRIA 4DRWA 1QVIY 1IKUA 1PRWA 1G4YR 2M7LA 3D0YA 1GGZA 4DUQA 4ZCVA 3D10A 2G2BA 3CZ1A 2M0RA 4DCKA 4ETOA 3BFHA 1OMDA 3CR2A 1JWDA 2FJYA 3D0YB 2CT9A 2JPOA 2K8MB 2JQ6A 1SNLA 1CM4A 3TZ1A 3CS1A 3O4YA 2QEVA 1CFCA 1CB1A 1OZSA 2BL0C 1CFPA 1AJ5A 2KI4C 1YVHA 1YRTB 5DKQA 4PT1A 3TDUA 2DOQA 2LVIA 1QX5B 3DD4A 4MEWA 1TUJA 1CKKA 2K2FA 1B47A 3EVVA 3FIAA 2SASA 1QTXA 1XFWO 4GFTA 1KQMB 4INWA 1BOCA 1B7TY 2ZFDA 5K89A 1S26D 3EK8A 1A4PA 1LS8A 3D76A 4MVFA 4CFRA 1A2XA 4IJ7A 1QXPA 2KYCA 1ZOTB 5J3XA 1EJ3A 2M8UA 4R1EA 3CR5X 3KEVA 5CSJA 3S0DA 4CPVA 2P70A 1XFVO 1UWOA 3SJSA 3CYZA 1CLLA 3DVMA 2KFFA 2LVVA 4A4BA 4M2OA 3VRPA 2PVBA 2LE9B 3JVTB 3D78A 4DS7A 3SIAA 2IS9A 4GUKA 2BCXA 3K21A 1IJ6A 1JBAA 3C1VA 1F71A 2KI6C 1YUSA 1N0YA 2CNPA 2E30A 1A29A 1PSRA 3SG6A 3R1PA 4JPZB 1S3PA 3SG2A 4QJ5B 1WRZA 5AFPA 5KU1A 2KHNA 2LLUA 3FE8A 3L4LA 1IIOA 2L2CA 3I5FB 5HKZA 4UPGA 1D1OA 1LXFC 2LVKA 2LV7A 4PHJA 5FYXA 3D73A 3NHIA 4A4CA 2CBLA 5FI6A 3IQOA 3I5HB 2HF5A 1M63B 1S5GZ 1EL4A 1NX1A 1SL9A 2JRFA 4I5JA 2QEHA 4N1GA 1PULA 1M45A 3VRRA 3UO9A 3QRXA 3I5IB 3WXAA 2KQYA 1BODA 1TNXA 2JT8A 1J55A 2ZKMX 1B8CA 3ICBA 1S1EA 3BXKA 1A03A 1SR6C 2B1UA 2KSPA 1WRKA 1K9PA 2H2KA 4BY5A 5GQQC 2M29A 1DC1A 1BMOA 2KAVA 2FCEA 2BKHB 1QJTA 1BU3A 2MA2A 2K2AA 3M0WA 1JSAA 1B8LA 1ZMZA 1DJWA 3AKBA 1E8AA 3TUYB 4PDZA 1YUTA 1SCVA 1CDMA 1NCXA 5HKYA 3BUOB 4YGAA 1F8HA 2F33A 5CSNA 3SS5A 1DMOA 3L4AA 3CLNA 1DGUA 2LMVA 3DF0A 4PHNA 3O6BA 1EG4A 4DIRA 1BLQA 2KFHA 2LHLA 3SG7A 3SG4A 3DF0B 2GTEA 1AHRA 2R2IA 3TS5B 1H8BA 1IGVA 3OGNA 1CMGA 1DGVA 1S36A 2E6WA 3RLZA 2LLTA 2O5GA 1EXRA 2QEOA 3VRNA 2LP2A 5AXIA 1OQPA 4MRXA 4P2YB 1CDLA 1EG3A 3EG5B 1DELA 1YRUB 2ZRTA 2EC6B 1YTZC 3PN7B 4FTGA 4NDDA 1GM0A 2GGZA 2LHIA 4NQGA 1CM1A 1PALA 2LLSA 3E3RA 3SIBA 3NSLA 5PALA 4PHMA 1DF0A 1QX7A 2MBXA 1KK7Y 1C7WA 1J1DA 1UURA 1OOJA 1MXLC 3DZTA 3WHUB 4D1EA 4MN0A 4FQOA 3I5GC 3EK7A 3NSOA 2JPTA 3O4XA 2JULA 4CFQA 1Q80A 3OX6A 2LM5A 3K1EA 1YUUA 2PMYA 4ZCUA 3B6XA 2JZIA 5HL1A 3S0AA 2WCBA 2L5XB 2MLFC 4PE4A 2SCPA 2P6BB 3B87A 1FW4A 2KOTA 1SMGA 3N7HA 3ZNIA 1NIWA 3ZWHA 5AERA 4PE1A 2KGRA 4YGBB 1SCMB 3KPXA 1NUBA 1LA0A 1OMRA 2F8PA 1QATA 1SYMA 1TOPA 2GGMA 2K7OA 2KAXA 2KNEA 2KYFA 4NDBA 4U8DA 3S0EA 2WCKA 1RROA 3KF9A 4JWQA 5DICA 4INXA 1DJIA 5HYDA 1KWOB 1NYAA 2JXCA 3DVKA 2M7NA 1NX3A 1AVSA 5TNCA 1ALVA 1R2UA 1N2DA 1RK9A 2YGUA 2LC5A 2F2OA 2WCHA 2K7DA 1IQ5A 2BKIB 3H4SE 3L47A 1DVIA 1GQMA 2OS8C 4OCIA 2BL0B 4HRGA 1G8IA 1WDCC 2LVJA 4PE7A 1NX0A 2KI4B 4PE0A 1S6JA 4YGEB 3B88A 1B4CA 2AUCA 1T14A 1EH2A 2LANA 1FI6A 3BUXB 3PALA 1AJ4A 4N1FA 2CXJA 2NLNA 1CNPA 3PATA 1JFJA 4HREE 4KYNA 4C0LA 1OOFA 1C07A 3GK4X 1Y1AA 4GPLB 5ER5A 1LINA 2PASA 1S6IA 1J7OA 3DVJA 3EKHA 3R1VA 3R72A 2PQLA 1BT6A 1QIVA 2HQWA 1NPQA 3PJIA 3LCPC 5B8IB 5IBWA 1ZFSA 2BCAA 1OSAA 4GGFC 3CR4X 4MZJA 2EHBA 1QLKA 4AQIA 1BF5A 4HRHA 4OV2A 4OZDA 2NCPA 2H61C 2OPOA 2BBNA 2WORA 3TDZA 2WCFA 1CFFA 5KSZA 1CLMA 3NXAA 2K60A 1DT7B 2M3WA 1TCOB 2BE6A 3PFVA 1L2OC 1K96A 1SY9A 2K61A 2TN4A 3CTNA 4GGFA 1MR8A 3PLFB 1XFRA 4QJ4B 1SPYA 5DKRA 4YGDB 1GJYA 2OTGC 1FI5A 3NSKA 2FJUB 4M2QA 1SBJA 2CTNA 2I94A 5DKNA 2PALA 1N65A 3FE9A 5G08A 3CZ2A 4C0KA 3TUYC 1NSHA 1K9UA 1NWDA 1ODBA 3AKAA 3LL8B 2BE4A 1XK4C 1DQEA 1QASA 2NZ0A 4MZLA 1KSMA 3SS3A 1W7JB 2F3ZA 3JTDC 1SR6B 3CDNA 4YGCB 3S0BA 2PYQA 1HQVA 3BFBA 2COLB 3BFAA 5KTYA 3DVEA
chains in the Genus database with same CATH topology
1YVLA 1VRKA 1UP5A 2KBIA 1W7IB 1S5GY 2Y1MA 1QV0A 1XK4A 1RWYA 2HETA 3KO0A 1UHIA 3EK4A 1KCYA 2ZN9A 2ZNEA 1M46A 3CGAA 4YI9A 3WNXB 3HX4A 1MUXA 4MZKA 1LVCD 4I5NB 1YX7A 3SG3A 2KDHA 4YBHB 3BQ3A 1KK8C 1KFUL 1NCYA 1DTLA 2BBMA 1YR5A 2AAOA 1PVBA 5AEQA 1QVIZ 1RFJA 2Y4QA 3O78A 2RGIA 1DF0B 3EVUA 1B9AA 3IF7A 4I5LB 5HLVA 4ORCB 1L7ZA 1LKJA 4GNKB 1XFZO 1MXEA 1XFYO 2JNFA 4N5XA 1U5IA 2L50A 2ZN8A 2QPTA 2JU0A 1BG1A 2MJWB 1CFDA 1KFXL 3F45A 3LK0A 4HSZA 1UHNA 1DJZA 2JTZA 1A75A 2LP3A 3A8RA 2KI6D 1MQ1A 4C0JA 1SKTA 1CDPA 5CSIA 4CIDA 4PCWA 2JT3A 2PRUA 1B7TZ 2JTTA 1J7RA 1TNQA 2MHHA 3GOFA 1F55A 4USLA 1NP8A 2KGBC 2LUCA 3FWBA 3I5GB 2JWWA 1XVJA 1JF0A 3GK2A 1SCMC 3LLEA 1DJXA 3O2PA 4CLNA 1H4BA 2L4HA 2M1UA 2LMUA 1M39A 2MLEC 1Y0VH 4WQ2A 4XYNA 3OHMB 1WLZA 4ORAB 1V1FA 1G33A 1K95A 1FPWA 1OZOA 3GK1A 4NDCA 1UHJA 2BCBA 1FBVA 4GBAA 2L4IA 2G9BA 5JOLA 1KQMC 4OKHA 1XO5A 2QACA 1QX2A 3RM1A 1X02A 1TTXA 2EGDA 5CSFA 5BPJA 4ORBB 2KAYA 1GGWA 2ZRSA 2MAZA 5D69A 2HQ8A 3BUWB 1Y6WA 2Q91A 3JVTC 4BY4A 2I2RE 1CDNA 2PSRA 1PVAA 3OB1B 1AP4A 1IQ3A 2JXLA 1NCZA 4WQ3A 3CWGA 2L0PA 1M31A 1SL8A 2Y5IA 2KQ6A 2KBMA 4AOMA 2M97A 2OS8B 3MSEB 2M1KB 4OR9B 3VRQA 1WDCB 1MWNA 3I5FC 2LAPA 2Y1NA 3EKJA 3AAJA 1C7VA 1F4OA 1JF2A 1IH0A 2L98A 1KQVA 1IWQA 3I5HC 3OB2B 3PM8A 1JC2A 5I2QA 3TDIA 3IQQA 4PHKA 2LMTA 1OE9B 2WOSA 1J7QA 1F54A 1BJFA 1XFUO 3FWCA 1K93D 2GV5A 3I5IC 1KFUS 1TIZA 1CMFA 1TRFA 1QIWA 3VROA 1Y1XA 1WRLA 2LNKA 4GAOA 4JQ0D 1B1GA 5I8NA 2BECA 1SW8A 2ISDA 1QS7A 3PSRA 4MLWA 1NX2A 3VGOA 5F6TA 2H61A 1LA3A 3EVRA 1WY9A 1YX8A 1S6CA 2M9GA 4F0ZB 1KFXS 2WC8A 3SG5A 3HCMA 4YRUA 2V53A 1F70A 1L2OB 1XYDA 1K8UA 1KSOA 1ZUZA 2Q4UA 3BUMB 4TNCA 2F2PA 3TS5C 2HPSA 2L2EA 1IG5A 4GGNA 1RJVA 1B8RA 2FCDA 2OTGB 1KK7Z 2JC2A 1JFKA 1OMVA 1PSBA 3CZTX 1IJ5A 2LCPA 1CTRA 2ZNDA 2CCMA 4I5KA 3NSIA 5HKWA 2WNDA 1HT9A 4QJ3B 5AANA 1MHOA 1UHKA 2K0JA 4MRYA 1MF8B 1K2HA 3OX5A 2EC6C 1PK0D 2A4JA 1UUSA 3JTDB 3PN7C 1AUIB 4IL1A 1SK6D 4Q04A 1DJHA 4E68A 3AAKA 3WHTB 2LUXA 4ICBA 4PALA 2I7AA 2M49B 2L51A 2I18A 1F4QA 3OP0A 2NCOA 4MBEA 2VRGA 1QLSA 1YURA 1Y1UA 2KFGA 1R6PA 1TNWA 2JNXA 2WCEA 2F3YA 4M2PA 1CLBA 1DJYA 1K94A 2JT0A 1SRAA 3A4UB 1KK8B 3BOWA 1U5IB 4AQJA 1AK8A 1XFXO 1V1GA 3KHEA 1IRJA 3BOWB 4P5OE 1ALWA 1A75B 4L9MA 1FF1A 2O60A 1QV1A 2JOJA 1JUOA 1J1EA 2K7BA 4XJKA 5JJGA 5I2LA 1K90D 5I2OA 3BUNB 1DJGA 3BYAA 5HLOA 1RTP1 1UHHA 1XA5A 1RECA 1WLMA 2D8NA 5ER4X 1J7PA 4XJKB 1BR1B 1SL7A 1ZACA 4OVNF 4YI8A 2FOTA 5CPVA 1TCFA 5D7FA 1TN4A 2NXQA 3LK1A 1KWOC 1TNPA 3FS7A 2K7CA 2MRDA 4MSPA 2AMIA 1K9KA 4WRIA 4DRWA 1BR4B 1QVIY 1IKUA 1PRWA 1G4YR 2M7LA 3D0YA 1GGZA 4DUQA 4ZCVA 3D10A 2G2BA 4DCKA 2M0RA 4ETOA 1OMDA 3CR2A 1JWDA 3D0YB 2CT9A 2K8MB 2JQ6A 1SNLA 1CM4A 3TZ1A 3CS1A 3O4YA 1CFCA 1CB1A 1OZSA 2BL0C 1CFPA 1AJ5A 2KI4C 1YVHA 1YRTB 5DKQA 3TDUA 2DOQA 2LVIA 1QX5B 3DD4A 4MEWA 1CKKA 2K2FA 1B47A 3EVVA 3FIAA 2SASA 1QTXA 1XFWO 4GFTA 1KQMB 1BOCA 1B7TY 2ZFDA 5K89A 1S26D 3EK8A 1A4PA 4MVFA 4CFRA 1A2XA 1QXPA 2KYCA 1ZOTB 5J3XA 1EJ3A 2M8UA 4R1EA 3CR5X 3KEVA 5CSJA 4CPVA 1XFVO 1UWOA 3SJSA 1CLLA 3DVMA 2KFFA 2LVVA 4A4BA 4M2OA 3VRPA 2PVBA 2LE9B 3JVTB 4DS7A 3SIAA 2IS9A 4GUKA 2BCXA 3K21A 1IJ6A 1JBAA 3C1VA 1F71A 2KI6C 1YUSA 1N0YA 2CNPA 2E30A 1A29A 1PSRA 3SG6A 3SG2A 4JPZB 1S3PA 4QJ5B 5AFPA 1WRZA 5KU1A 2KHNA 2LLUA 3I5FB 5HKZA 4UPGA 1D1OA 1LXFC 2LVKA 2LV7A 4PHJA 5FYXA 4A4CA 2CBLA 3IQOA 3I5HB 2HF5A 1M63B 1S5GZ 1EL4A 1NX1A 1SL9A 2JRFA 4I5JA 4N1GA 1PULA 1M45A 3VRRA 3QRXA 3I5IB 3WXAA 2KQYA 1BODA 1TNXA 2JT8A 1J55A 2ZKMX 1B8CA 3ICBA 1S1EA 3BXKA 1A03A 1SR6C 2B1UA 2KSPA 1WRKA 1K9PA 2H2KA 4BY5A 5GQQC 2M29A 1BMOA 2KAVA 2FCEA 2BKHB 1QJTA 1BU3A 2MA2A 2K2AA 3M0WA 1JSAA 1B8LA 1ZMZA 1DJWA 3AKBA 1E8AA 3TUYB 4PDZA 1YUTA 1SCVA 1CDMA 1NCXA 5HKYA 3BUOB 4YGAA 1F8HA 2F33A 5CSNA 1DMOA 3CLNA 1DGUA 2LMVA 3DF0A 4PHNA 3O6BA 1EG4A 4DIRA 1BLQA 2KFHA 2LHLA 3SG7A 3SG4A 3DF0B 1AHRA 2R2IA 3TS5B 1H8BA 1IGVA 1CMGA 1DGVA 1S36A 2E6WA 3RLZA 2LLTA 2O5GA 1EXRA 3VRNA 2LP2A 5AXIA 1OQPA 4MRXA 4P2YB 1CDLA 1EG3A 1YRUB 2ZRTA 2EC6B 1YTZC 3PN7B 4FTGA 4NDDA 2GGZA 2LHIA 4NQGA 1CM1A 1PALA 2LLSA 3E3RA 3SIBA 3NSLA 5PALA 4PHMA 1DF0A 1QX7A 2MBXA 1KK7Y 1C7WA 1J1DA 1UURA 1OOJA 1MXLC 3WHUB 4D1EA 4MN0A 4FQOA 3I5GC 3EK7A 3NSOA 2JPTA 2JULA 4CFQA 1Q80A 3OX6A 2LM5A 1YUUA 2PMYA 4ZCUA 2JZIA 2WCBA 2L5XB 2MLFC 4PE4A 2SCPA 2P6BB 1FW4A 2KOTA 1SMGA 3ZNIA 1NIWA 3ZWHA 5AERA 4PE1A 2KGRA 4YGBB 1SCMB 3KPXA 1NUBA 1LA0A 1OMRA 2F8PA 1QATA 1SYMA 1TOPA 2GGMA 2K7OA 2KAXA 2KNEA 2KYFA 4NDBA 4U8DA 1RROA 3KF9A 4JWQA 1DJIA 5HYDA 1KWOB 1NYAA 2JXCA 3DVKA 2M7NA 1NX3A 1AVSA 5TNCA 1ALVA 1R2UA 1N2DA 1RK9A 2LC5A 2F2OA 2K7DA 1IQ5A 2BKIB 3H4SE 1DVIA 1GQMA 2OS8C 4OCIA 2BL0B 4HRGA 1G8IA 1WDCC 2LVJA 4PE7A 1NX0A 2KI4B 4PE0A 1S6JA 4YGEB 1B4CA 2AUCA 1EH2A 2LANA 1FI6A 3BUXB 3PALA 1AJ4A 4N1FA 2CXJA 2NLNA 1CNPA 3PATA 1JFJA 4HREE 4C0LA 1C07A 3GK4X 1Y1AA 4GPLB 5ER5A 1LINA 2PASA 1S6IA 1J7OA 3DVJA 3EKHA 1BT6A 1QIVA 2HQWA 1NPQA 3LCPC 5B8IB 5IBWA 1ZFSA 2BCAA 1OSAA 4GGFC 3CR4X 4MZJA 2EHBA 1QLKA 4AQIA 1BF5A 4HRHA 4OV2A 2NCPA 2H61C 2OPOA 2BBNA 2WORA 3TDZA 2WCFA 1CFFA 5KSZA 1CLMA 3NXAA 1DT7B 2M3WA 1TCOB 2BE6A 3PFVA 1L2OC 1K96A 1SY9A 2K61A 2TN4A 3CTNA 4GGFA 1MR8A 3PLFB 4QJ4B 1SPYA 5DKRA 4YGDB 1GJYA 2OTGC 1FI5A 3NSKA 2FJUB 4M2QA 1SBJA 2CTNA 2I94A 5DKNA 2PALA 1N65A 5G08A 4C0KA 3TUYC 1NSHA 1K9UA 1NWDA 1ODBA 3AKAA 3LL8B 2BE4A 1XK4C 1QASA 2NZ0A 4MZLA 1KSMA 1W7JB 2F3ZA 3JTDC 1SR6B 4YGCB 1HQVA 2COLB 5KTYA 3DVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVL A;  1VRK A;  1UP5 A;  2KBI A;  1W7I B;  1S5G Y;  2Y1M A;  1QV0 A;  1XK4 A;  1RWY A;  2HET A;  3KO0 A;  1UHI A;  3EK4 A;  1KCY A;  2ZN9 A;  2ZNE A;  1M46 A;  3CGA A;  4YI9 A;  3WNX B;  3HX4 A;  1MUX A;  4MZK A;  1LVC D;  4I5N B;  1YX7 A;  3SG3 A;  2KDH A;  4YBH B;  3BQ3 A;  1KK8 C;  1KFU L;  1NCY A;  1DTL A;  2BBM A;  1YR5 A;  2AAO A;  1PVB A;  5AEQ A;  1QVI Z;  1RFJ A;  2Y4Q A;  3O78 A;  2RGI A;  1DF0 B;  3EVU A;  1B9A A;  3IF7 A;  4I5L B;  5HLV A;  4ORC B;  1L7Z A;  1LKJ A;  4GNK B;  1XFZ O;  1MXE A;  1XFY O;  2JNF A;  4N5X A;  1U5I A;  2L50 A;  2ZN8 A;  2QPT A;  2JU0 A;  1BG1 A;  2MJW B;  1CFD A;  1KFX L;  3F45 A;  3LK0 A;  4HSZ A;  1UHN A;  1DJZ A;  2JTZ A;  1A75 A;  2LP3 A;  3A8R A;  2KI6 D;  1MQ1 A;  4C0J A;  1SKT A;  1CDP A;  5CSI A;  4CID A;  4PCW A;  2JT3 A;  2PRU A;  1B7T Z;  2JTT A;  1J7R A;  1TNQ A;  2MHH A;  3GOF A;  1F55 A;  4USL A;  1NP8 A;  2KGB C;  2LUC A;  3FWB A;  3I5G B;  2JWW A;  1XVJ A;  1JF0 A;  3GK2 A;  1SCM C;  3LLE A;  1DJX A;  3O2P A;  4CLN A;  1H4B A;  2L4H A;  2M1U A;  2LMU A;  1M39 A;  2MLE C;  1Y0V H;  4WQ2 A;  4XYN A;  3OHM B;  1WLZ A;  4ORA B;  1V1F A;  1G33 A;  1K95 A;  1FPW A;  1OZO A;  3GK1 A;  4NDC A;  1UHJ A;  2BCB A;  1FBV A;  4GBA A;  2L4I A;  2G9B A;  5JOL A;  1KQM C;  4OKH A;  1XO5 A;  2QAC A;  1QX2 A;  3RM1 A;  1X02 A;  1TTX A;  2EGD A;  5CSF A;  5BPJ A;  4ORB B;  2KAY A;  1GGW A;  2ZRS A;  2MAZ A;  5D69 A;  2HQ8 A;  3BUW B;  1Y6W A;  2Q91 A;  3JVT C;  4BY4 A;  2I2R E;  1CDN A;  2PSR A;  1PVA A;  3OB1 B;  1AP4 A;  1IQ3 A;  2JXL A;  1NCZ A;  4WQ3 A;  3CWG A;  2L0P A;  1M31 A;  1SL8 A;  2Y5I A;  2KQ6 A;  2KBM A;  4AOM A;  2M97 A;  2OS8 B;  3MSE B;  2M1K B;  4OR9 B;  3VRQ A;  1WDC B;  1MWN A;  3I5F C;  2LAP A;  2Y1N A;  3EKJ A;  3AAJ A;  1C7V A;  1F4O A;  1JF2 A;  1IH0 A;  2L98 A;  1KQV A;  1IWQ A;  3I5H C;  3OB2 B;  3PM8 A;  1JC2 A;  5I2Q A;  3TDI A;  3IQQ A;  4PHK A;  2LMT A;  1OE9 B;  2WOS A;  1J7Q A;  1F54 A;  1BJF A;  1XFU O;  3FWC A;  1K93 D;  2GV5 A;  3I5I C;  1KFU S;  1TIZ A;  1CMF A;  1TRF A;  1QIW A;  3VRO A;  1Y1X A;  1WRL A;  2LNK A;  4GAO A;  4JQ0 D;  1B1G A;  5I8N A;  2BEC A;  1SW8 A;  2ISD A;  1QS7 A;  3PSR A;  4MLW A;  1NX2 A;  3VGO A;  5F6T A;  2H61 A;  1LA3 A;  3EVR A;  1WY9 A;  1YX8 A;  1S6C A;  2M9G A;  4F0Z B;  1KFX S;  2WC8 A;  3SG5 A;  3HCM A;  4YRU A;  2V53 A;  1F70 A;  1L2O B;  1XYD A;  1K8U A;  1KSO A;  1ZUZ A;  2Q4U A;  3BUM B;  4TNC A;  2F2P A;  3TS5 C;  2HPS A;  2L2E A;  1IG5 A;  4GGN A;  1RJV A;  1B8R A;  2FCD A;  2OTG B;  1KK7 Z;  2JC2 A;  1JFK A;  1OMV A;  1PSB A;  3CZT X;  1IJ5 A;  2LCP A;  1CTR A;  2ZND A;  2CCM A;  4I5K A;  3NSI A;  5HKW A;  2WND A;  1HT9 A;  4QJ3 B;  5AAN A;  1MHO A;  1UHK A;  2K0J A;  4MRY A;  1MF8 B;  1K2H A;  3OX5 A;  2EC6 C;  1PK0 D;  2A4J A;  1UUS A;  3JTD B;  3PN7 C;  1AUI B;  4IL1 A;  1SK6 D;  4Q04 A;  1DJH A;  4E68 A;  3AAK A;  3WHT B;  2LUX A;  4ICB A;  4PAL A;  2I7A A;  2M49 B;  2L51 A;  2I18 A;  1F4Q A;  3OP0 A;  2NCO A;  4MBE A;  2VRG A;  1QLS A;  1YUR A;  1Y1U A;  2KFG A;  1R6P A;  1TNW A;  2JNX A;  2WCE A;  2F3Y A;  4M2P A;  1CLB A;  1DJY A;  1K94 A;  2JT0 A;  1SRA A;  3A4U B;  1KK8 B;  3BOW A;  1U5I B;  4AQJ A;  1AK8 A;  1XFX O;  1V1G A;  3KHE A;  1IRJ A;  3BOW B;  4P5O E;  1ALW A;  1A75 B;  4L9M A;  1FF1 A;  2O60 A;  1QV1 A;  2JOJ A;  1JUO A;  1J1E A;  2K7B A;  4XJK A;  5JJG A;  5I2L A;  1K90 D;  5I2O A;  3BUN B;  1DJG A;  3BYA A;  5HLO A;  1RTP 1;  1UHH A;  1XA5 A;  1REC A;  1WLM A;  2D8N A;  5ER4 X;  1J7P A;  4XJK B;  1BR1 B;  1SL7 A;  1ZAC A;  4OVN F;  4YI8 A;  2FOT A;  5CPV A;  1TCF A;  5D7F A;  1TN4 A;  2NXQ A;  3LK1 A;  1KWO C;  1TNP A;  3FS7 A;  2K7C A;  2MRD A;  4MSP A;  2AMI A;  1K9K A;  4WRI A;  4DRW A;  1BR4 B;  1QVI Y;  1IKU A;  1PRW A;  1G4Y R;  2M7L A;  3D0Y A;  1GGZ A;  4DUQ A;  4ZCV A;  3D10 A;  2G2B A;  4DCK A;  2M0R A;  4ETO A;  1OMD A;  3CR2 A;  1JWD A;  3D0Y B;  2CT9 A;  2K8M B;  2JQ6 A;  1SNL A;  1CM4 A;  3TZ1 A;  3CS1 A;  3O4Y A;  1CFC A;  1CB1 A;  1OZS A;  2BL0 C;  1CFP A;  1AJ5 A;  2KI4 C;  1YVH A;  1YRT B;  5DKQ A;  3TDU A;  2DOQ A;  2LVI A;  1QX5 B;  3DD4 A;  4MEW A;  1CKK A;  2K2F A;  1B47 A;  3EVV A;  3FIA A;  2SAS A;  1QTX A;  1XFW O;  4GFT A;  1KQM B;  1BOC A;  1B7T Y;  2ZFD A;  5K89 A;  1S26 D;  3EK8 A;  1A4P A;  4MVF A;  4CFR A;  1A2X A;  1QXP A;  2KYC A;  1ZOT B;  5J3X A;  1EJ3 A;  2M8U A;  4R1E A;  3CR5 X;  3KEV A;  5CSJ A;  4CPV A;  1XFV O;  1UWO A;  3SJS A;  1CLL A;  3DVM A;  2KFF A;  2LVV A;  4A4B A;  4M2O A;  3VRP A;  2PVB A;  2LE9 B;  3JVT B;  4DS7 A;  3SIA A;  2IS9 A;  4GUK A;  2BCX A;  3K21 A;  1IJ6 A;  1JBA A;  3C1V A;  1F71 A;  2KI6 C;  1YUS A;  1N0Y A;  2CNP A;  2E30 A;  1A29 A;  1PSR A;  3SG6 A;  3SG2 A;  4JPZ B;  1S3P A;  4QJ5 B;  5AFP A;  1WRZ A;  5KU1 A;  2KHN A;  2LLU A;  3I5F B;  5HKZ A;  4UPG A;  1D1O A;  1LXF C;  2LVK A;  2LV7 A;  4PHJ A;  5FYX A;  4A4C A;  2CBL A;  3IQO A;  3I5H B;  2HF5 A;  1M63 B;  1S5G Z;  1EL4 A;  1NX1 A;  1SL9 A;  2JRF A;  4I5J A;  4N1G A;  1PUL A;  1M45 A;  3VRR A;  3QRX A;  3I5I B;  3WXA A;  2KQY A;  1BOD A;  1TNX A;  2JT8 A;  1J55 A;  2ZKM X;  1B8C A;  3ICB A;  1S1E A;  3BXK A;  1A03 A;  1SR6 C;  2B1U A;  2KSP A;  1WRK A;  1K9P A;  2H2K A;  4BY5 A;  5GQQ C;  2M29 A;  1BMO A;  2KAV A;  2FCE A;  2BKH B;  1QJT A;  1BU3 A;  2MA2 A;  2K2A A;  3M0W A;  1JSA A;  1B8L A;  1ZMZ A;  1DJW A;  3AKB A;  1E8A A;  3TUY B;  4PDZ A;  1YUT A;  1SCV A;  1CDM A;  1NCX A;  5HKY A;  3BUO B;  4YGA A;  1F8H A;  2F33 A;  5CSN A;  1DMO A;  3CLN A;  1DGU A;  2LMV A;  3DF0 A;  4PHN A;  3O6B A;  1EG4 A;  4DIR A;  1BLQ A;  2KFH A;  2LHL A;  3SG7 A;  3SG4 A;  3DF0 B;  1AHR A;  2R2I A;  3TS5 B;  1H8B A;  1IGV A;  1CMG A;  1DGV A;  1S36 A;  2E6W A;  3RLZ A;  2LLT A;  2O5G A;  1EXR A;  3VRN A;  2LP2 A;  5AXI A;  1OQP A;  4MRX A;  4P2Y B;  1CDL A;  1EG3 A;  1YRU B;  2ZRT A;  2EC6 B;  1YTZ C;  3PN7 B;  4FTG A;  4NDD A;  2GGZ A;  2LHI A;  4NQG A;  1CM1 A;  1PAL A;  2LLS A;  3E3R A;  3SIB A;  3NSL A;  5PAL A;  4PHM A;  1DF0 A;  1QX7 A;  2MBX A;  1KK7 Y;  1C7W A;  1J1D A;  1UUR A;  1OOJ A;  1MXL C;  3WHU B;  4D1E A;  4MN0 A;  4FQO A;  3I5G C;  3EK7 A;  3NSO A;  2JPT A;  2JUL A;  4CFQ A;  1Q80 A;  3OX6 A;  2LM5 A;  1YUU A;  2PMY A;  4ZCU A;  2JZI A;  2WCB A;  2L5X B;  2MLF C;  4PE4 A;  2SCP A;  2P6B B;  1FW4 A;  2KOT A;  1SMG A;  3ZNI A;  1NIW A;  3ZWH A;  5AER A;  4PE1 A;  2KGR A;  4YGB B;  1SCM B;  3KPX A;  1NUB A;  1LA0 A;  1OMR A;  2F8P A;  1QAT A;  1SYM A;  1TOP A;  2GGM A;  2K7O A;  2KAX A;  2KNE A;  2KYF A;  4NDB A;  4U8D A;  1RRO A;  3KF9 A;  4JWQ A;  1DJI A;  5HYD A;  1KWO B;  1NYA A;  2JXC A;  3DVK A;  2M7N A;  1NX3 A;  1AVS A;  5TNC A;  1ALV A;  1R2U A;  1N2D A;  1RK9 A;  2LC5 A;  2F2O A;  2K7D A;  1IQ5 A;  2BKI B;  3H4S E;  1DVI A;  1GQM A;  2OS8 C;  4OCI A;  2BL0 B;  4HRG A;  1G8I A;  1WDC C;  2LVJ A;  4PE7 A;  1NX0 A;  2KI4 B;  4PE0 A;  1S6J A;  4YGE B;  1B4C A;  2AUC A;  1EH2 A;  2LAN A;  1FI6 A;  3BUX B;  3PAL A;  1AJ4 A;  4N1F A;  2CXJ A;  2NLN A;  1CNP A;  3PAT A;  1JFJ A;  4HRE E;  4C0L A;  1C07 A;  3GK4 X;  1Y1A A;  4GPL B;  5ER5 A;  1LIN A;  2PAS A;  1S6I A;  1J7O A;  3DVJ A;  3EKH A;  1BT6 A;  1QIV A;  2HQW A;  1NPQ A;  3LCP C;  5B8I B;  5IBW A;  1ZFS A;  2BCA A;  1OSA A;  4GGF C;  3CR4 X;  4MZJ A;  2EHB A;  1QLK A;  4AQI A;  1BF5 A;  4HRH A;  4OV2 A;  2NCP A;  2H61 C;  2OPO A;  2BBN A;  2WOR A;  3TDZ A;  2WCF A;  1CFF A;  5KSZ A;  1CLM A;  3NXA A;  1DT7 B;  2M3W A;  1TCO B;  2BE6 A;  3PFV A;  1L2O C;  1K96 A;  1SY9 A;  2K61 A;  2TN4 A;  3CTN A;  4GGF A;  1MR8 A;  3PLF B;  4QJ4 B;  1SPY A;  5DKR A;  4YGD B;  1GJY A;  2OTG C;  1FI5 A;  3NSK A;  2FJU B;  4M2Q A;  1SBJ A;  2CTN A;  2I94 A;  5DKN A;  2PAL A;  1N65 A;  5G08 A;  4C0K A;  3TUY C;  1NSH A;  1K9U A;  1NWD A;  1ODB A;  3AKA A;  3LL8 B;  2BE4 A;  1XK4 C;  1QAS A;  2NZ0 A;  4MZL A;  1KSM A;  1W7J B;  2F3Z A;  3JTD C;  1SR6 B;  4YGC B;  1HQV A;  2COL B;  5KTY A;  3DVE A; 
#chains in the Genus database with same CATH topology
 1YVL A;  3IVT A;  1VRK A;  2ERB A;  1UP5 A;  2KBI A;  1W7I B;  1S5G Y;  2Y1M A;  3S0F A;  1QV0 A;  1XK4 A;  1RWY A;  2HET A;  3KO0 A;  1UHI A;  3EK4 A;  1KCY A;  2ZN9 A;  1W9Z A;  2ZNE A;  1M46 A;  3CGA A;  4YI9 A;  3WNX B;  3HX4 A;  1MUX A;  4MZK A;  1LVC D;  4I5N B;  1YX7 A;  5FI2 A;  2KDH A;  3SG3 A;  4YBH B;  3BQ3 A;  1KK8 C;  1KFU L;  1NCY A;  1DTL A;  1OW4 A;  2BAP A;  2BBM A;  3R1O A;  1YR5 A;  5EL2 A;  2AAO A;  1PVB A;  5FI7 A;  1QVI Z;  1RFJ A;  2Y4Q A;  5AEQ A;  3O78 A;  3S0G A;  2RGI A;  1DF0 B;  3EVU A;  1B9A A;  3IF7 A;  4I5L B;  5HLV A;  1TUZ A;  4ORC B;  1L7Z A;  1LKJ A;  4GNK B;  1XFZ O;  1MXE A;  1XFY O;  2JNF A;  4N5X A;  1U5I A;  2L50 A;  2ZN8 A;  2QPT A;  2JU0 A;  1BG1 A;  5I94 A;  3RZS A;  2MJW B;  1CFD A;  1KFX L;  3F45 A;  3LK0 A;  4HSZ A;  1UHN A;  1DJZ A;  2JTZ A;  1A75 A;  2LP3 A;  3A8R A;  2KI6 D;  1MQ1 A;  4C0J A;  1SKT A;  1CDP A;  5CSI A;  4CID A;  1Z2C B;  4PCW A;  2JT3 A;  3B7A A;  2PRU A;  1B7T Z;  2JTT A;  1J7R A;  1TNQ A;  2MHH A;  3GOF A;  1F55 A;  4USL A;  1NP8 A;  2KGB C;  2LUC A;  3FWB A;  3I5G B;  2JWW A;  1XVJ A;  1JF0 A;  3GK2 A;  1SCM C;  3LLE A;  1DJX A;  3O2P A;  4CLN A;  1H4B A;  2L4H A;  2M1U A;  2LMU A;  1M39 A;  2MLE C;  1Y0V H;  2QDI A;  4WQ2 A;  4XYN A;  3OHM B;  1WLZ A;  4ORA B;  1V1F A;  1G33 A;  1K95 A;  1FPW A;  1OZO A;  3GK1 A;  4NDC A;  1UHJ A;  2BCB A;  1FBV A;  4GBA A;  2L4I A;  2G9B A;  5JOL A;  1KQM C;  2WCJ A;  4OKH A;  1XO5 A;  1C3Z A;  2QAC A;  3D77 A;  1QX2 A;  3RM1 A;  1X02 A;  1TTX A;  2EGD A;  5CSF A;  3CZ0 A;  5BPJ A;  4ORB B;  2KAY A;  4FQT A;  2ZRS A;  4GGN A;  2MAZ A;  1GGW A;  5D69 A;  3V2L A;  2HQ8 A;  2WCM A;  3BUW B;  3D75 A;  3UNW A;  1Y6W A;  2Q91 A;  3JVT C;  4BY4 A;  4JD9 A;  2I2R E;  1CDN A;  2PSR A;  1PVA A;  3OB1 B;  1AP4 A;  1IQ3 A;  2JXL A;  1NCZ A;  1OOH A;  3CWG A;  4WQ3 A;  2L0P A;  1M31 A;  1SL8 A;  2Y5I A;  2KQ6 A;  3D74 A;  2KBM A;  4AOM A;  2M97 A;  2OS8 B;  3PM2 A;  3MSE B;  2M1K B;  4OR9 B;  3VRQ A;  1WDC B;  1MWN A;  3I5F C;  2LAP A;  2Y1N A;  3EKJ A;  2KLD A;  3AAJ A;  1C7V A;  1F4O A;  1Z4H A;  1P28 A;  1JF2 A;  1IH0 A;  2L98 A;  1KQV A;  1IWQ A;  3DYE A;  3I5H C;  3OB2 B;  3PM8 A;  1JC2 A;  5I2Q A;  2P71 A;  3TDI A;  3IQQ A;  4PHK A;  2LMT A;  1OE9 B;  2WOS A;  1J7Q A;  1F54 A;  3SS4 A;  1TWO A;  1BJF A;  1XFU O;  3FWC A;  1K93 D;  2GV5 A;  3BJH A;  3I5I C;  1KFU S;  1TIZ A;  1CMF A;  1TRF A;  1QIW A;  3VRO A;  1Y1X A;  1WRL A;  2LNK A;  4GAO A;  4JQ0 D;  1B1G A;  5I8N A;  2BEC A;  1SW8 A;  2ISD A;  1QS7 A;  1C3Y A;  3PSR A;  4MLW A;  1NX2 A;  3VGO A;  5F6T A;  5D3O A;  2BNX A;  2H61 A;  1LA3 A;  3EVR A;  1WY9 A;  1YX8 A;  1S6C A;  2M9G A;  4F0Z B;  1KFX S;  2WC8 A;  3SG5 A;  3HCM A;  4YRU A;  2V53 A;  1F70 A;  3CAB A;  1L2O B;  1XYD A;  1K8U A;  1KSO A;  1ZUZ A;  2Q4U A;  3BUM B;  4TNC A;  2F2P A;  3TS5 C;  2HPS A;  2L2E A;  1IG5 A;  3B86 A;  1RJV A;  1B8R A;  2FCD A;  2OTG B;  1KK7 Z;  2JC2 A;  1JFK A;  1OMV A;  1PSB A;  3CZT X;  1IJ5 A;  2KLE A;  2LCP A;  1CTR A;  2ZND A;  2CCM A;  4I5K A;  3NSI A;  5HKW A;  2WND A;  1HT9 A;  1ORG A;  4QJ3 B;  4F7F A;  5AAN A;  1MHO A;  1UHK A;  2K0J A;  4MRY A;  1MF8 B;  1K2H A;  3OX5 A;  2EC6 C;  1PK0 D;  2A4J A;  1UUS A;  2H8V A;  3JTD B;  3OBV A;  3QME A;  1DEK A;  3PN7 C;  1AUI B;  4IL1 A;  1SK6 D;  4Q04 A;  3NHT A;  1DJH A;  3Q8I A;  4E68 A;  3AAK A;  3WHT B;  2LUX A;  4ICB A;  4PAL A;  2I7A A;  2M49 B;  2L51 A;  2I18 A;  1F4Q A;  2WC6 A;  3OP0 A;  2NCO A;  4MBE A;  2VRG A;  1QLS A;  1YUR A;  1Y1U A;  2KFG A;  1R6P A;  1TNW A;  2JNX A;  2WCE A;  2F3Y A;  4M2P A;  1CLB A;  1DJY A;  1K94 A;  2JT0 A;  1SRA A;  3A4U B;  1KK8 B;  3BOW A;  1U5I B;  4AQJ A;  1AK8 A;  1XFX O;  1V1G A;  3KHE A;  3DY9 A;  2QEB A;  1IRJ A;  3BOW B;  4P5O E;  1ALW A;  1A75 B;  2KPH A;  1QWV A;  4L9M A;  2O60 A;  1QV1 A;  2JOJ A;  1JUO A;  1J1E A;  2WCL A;  1FF1 A;  2K7B A;  4XJK A;  5JJG A;  5I2L A;  1K90 D;  5I2O A;  3BUN B;  1DJG A;  3BYA A;  5HLO A;  1RTP 1;  1UHH A;  1XA5 A;  1REC A;  1WLM A;  2D8N A;  2L5Y A;  5ER4 X;  3VB1 A;  1J7P A;  4XJK B;  1BR1 B;  1SL7 A;  1ZAC A;  4OVN F;  1OOI X;  4YI8 A;  2FOT A;  5CPV A;  1TCF A;  3DXL A;  5D7F A;  4JKT A;  1TN4 A;  3NGV A;  2NXQ A;  3LK1 A;  1KWO C;  1TNP A;  3FS7 A;  1OOG A;  2K7C A;  2MRD A;  2AMI A;  1K9K A;  2WC5 A;  1SSE B;  3FE6 A;  4MSP A;  1BR4 B;  4WRI A;  4DRW A;  1QVI Y;  1IKU A;  1PRW A;  1G4Y R;  2M7L A;  3D0Y A;  1GGZ A;  4DUQ A;  4ZCV A;  3D10 A;  2G2B A;  3CZ1 A;  2M0R A;  4DCK A;  4ETO A;  3BFH A;  1OMD A;  3CR2 A;  1JWD A;  2FJY A;  3D0Y B;  2CT9 A;  2JPO A;  2K8M B;  2JQ6 A;  1SNL A;  1CM4 A;  3TZ1 A;  3CS1 A;  3O4Y A;  2QEV A;  1CFC A;  1CB1 A;  1OZS A;  2BL0 C;  1CFP A;  1AJ5 A;  2KI4 C;  1YVH A;  1YRT B;  5DKQ A;  4PT1 A;  3TDU A;  2DOQ A;  2LVI A;  1QX5 B;  3DD4 A;  4MEW A;  1TUJ A;  1CKK A;  2K2F A;  1B47 A;  3EVV A;  3FIA A;  2SAS A;  1QTX A;  1XFW O;  4GFT A;  1KQM B;  4INW A;  1BOC A;  1B7T Y;  2ZFD A;  5K89 A;  1S26 D;  3EK8 A;  1A4P A;  1LS8 A;  3D76 A;  4MVF A;  4CFR A;  1A2X A;  4IJ7 A;  1QXP A;  2KYC A;  1ZOT B;  5J3X A;  1EJ3 A;  2M8U A;  4R1E A;  3CR5 X;  3KEV A;  5CSJ A;  3S0D A;  4CPV A;  2P70 A;  1XFV O;  1UWO A;  3SJS A;  3CYZ A;  1CLL A;  3DVM A;  2KFF A;  2LVV A;  4A4B A;  4M2O A;  3VRP A;  2PVB A;  2LE9 B;  3JVT B;  3D78 A;  4DS7 A;  3SIA A;  2IS9 A;  4GUK A;  2BCX A;  3K21 A;  1IJ6 A;  1JBA A;  3C1V A;  1F71 A;  2KI6 C;  1YUS A;  1N0Y A;  2CNP A;  2E30 A;  1A29 A;  1PSR A;  3SG6 A;  3R1P A;  4JPZ B;  1S3P A;  3SG2 A;  4QJ5 B;  1WRZ A;  5AFP A;  5KU1 A;  2KHN A;  2LLU A;  3FE8 A;  3L4L A;  1IIO A;  2L2C A;  3I5F B;  5HKZ A;  4UPG A;  1D1O A;  1LXF C;  2LVK A;  2LV7 A;  4PHJ A;  5FYX A;  3D73 A;  3NHI A;  4A4C A;  2CBL A;  5FI6 A;  3IQO A;  3I5H B;  2HF5 A;  1M63 B;  1S5G Z;  1EL4 A;  1NX1 A;  1SL9 A;  2JRF A;  4I5J A;  2QEH A;  4N1G A;  1PUL A;  1M45 A;  3VRR A;  3UO9 A;  3QRX A;  3I5I B;  3WXA A;  2KQY A;  1BOD A;  1TNX A;  2JT8 A;  1J55 A;  2ZKM X;  1B8C A;  3ICB A;  1S1E A;  3BXK A;  1A03 A;  1SR6 C;  2B1U A;  2KSP A;  1WRK A;  1K9P A;  2H2K A;  4BY5 A;  5GQQ C;  2M29 A;  1DC1 A;  1BMO A;  2KAV A;  2FCE A;  2BKH B;  1QJT A;  1BU3 A;  2MA2 A;  2K2A A;  3M0W A;  1JSA A;  1B8L A;  1ZMZ A;  1DJW A;  3AKB A;  1E8A A;  3TUY B;  4PDZ A;  1YUT A;  1SCV A;  1CDM A;  1NCX A;  5HKY A;  3BUO B;  4YGA A;  1F8H A;  2F33 A;  5CSN A;  3SS5 A;  1DMO A;  3L4A A;  3CLN A;  1DGU A;  2LMV A;  3DF0 A;  4PHN A;  3O6B A;  1EG4 A;  4DIR A;  1BLQ A;  2KFH A;  2LHL A;  3SG7 A;  3SG4 A;  3DF0 B;  2GTE A;  1AHR A;  2R2I A;  3TS5 B;  1H8B A;  1IGV A;  3OGN A;  1CMG A;  1DGV A;  1S36 A;  2E6W A;  3RLZ A;  2LLT A;  2O5G A;  1EXR A;  2QEO A;  3VRN A;  2LP2 A;  5AXI A;  1OQP A;  4MRX A;  4P2Y B;  1CDL A;  1EG3 A;  3EG5 B;  1DEL A;  1YRU B;  2ZRT A;  2EC6 B;  1YTZ C;  3PN7 B;  4FTG A;  4NDD A;  1GM0 A;  2GGZ A;  2LHI A;  4NQG A;  1CM1 A;  1PAL A;  2LLS A;  3E3R A;  3SIB A;  3NSL A;  5PAL A;  4PHM A;  1DF0 A;  1QX7 A;  2MBX A;  1KK7 Y;  1C7W A;  1J1D A;  1UUR A;  1OOJ A;  1MXL C;  3DZT A;  3WHU B;  4D1E A;  4MN0 A;  4FQO A;  3I5G C;  3EK7 A;  3NSO A;  2JPT A;  3O4X A;  2JUL A;  4CFQ A;  1Q80 A;  3OX6 A;  2LM5 A;  3K1E A;  1YUU A;  2PMY A;  4ZCU A;  3B6X A;  2JZI A;  5HL1 A;  3S0A A;  2WCB A;  2L5X B;  2MLF C;  4PE4 A;  2SCP A;  2P6B B;  3B87 A;  1FW4 A;  2KOT A;  1SMG A;  3N7H A;  3ZNI A;  1NIW A;  3ZWH A;  5AER A;  4PE1 A;  2KGR A;  4YGB B;  1SCM B;  3KPX A;  1NUB A;  1LA0 A;  1OMR A;  2F8P A;  1QAT A;  1SYM A;  1TOP A;  2GGM A;  2K7O A;  2KAX A;  2KNE A;  2KYF A;  4NDB A;  4U8D A;  3S0E A;  2WCK A;  1RRO A;  3KF9 A;  4JWQ A;  5DIC A;  4INX A;  1DJI A;  5HYD A;  1KWO B;  1NYA A;  2JXC A;  3DVK A;  2M7N A;  1NX3 A;  1AVS A;  5TNC A;  1ALV A;  1R2U A;  1N2D A;  1RK9 A;  2YGU A;  2LC5 A;  2F2O A;  2WCH A;  2K7D A;  1IQ5 A;  2BKI B;  3H4S E;  3L47 A;  1DVI A;  1GQM A;  2OS8 C;  4OCI A;  2BL0 B;  4HRG A;  1G8I A;  1WDC C;  2LVJ A;  4PE7 A;  1NX0 A;  2KI4 B;  4PE0 A;  1S6J A;  4YGE B;  3B88 A;  1B4C A;  2AUC A;  1T14 A;  1EH2 A;  2LAN A;  1FI6 A;  3BUX B;  3PAL A;  1AJ4 A;  4N1F A;  2CXJ A;  2NLN A;  1CNP A;  3PAT A;  1JFJ A;  4HRE E;  4KYN A;  4C0L A;  1OOF A;  1C07 A;  3GK4 X;  1Y1A A;  4GPL B;  5ER5 A;  1LIN A;  2PAS A;  1S6I A;  1J7O A;  3DVJ A;  3EKH A;  3R1V A;  3R72 A;  2PQL A;  1BT6 A;  1QIV A;  2HQW A;  1NPQ A;  3PJI A;  3LCP C;  5B8I B;  5IBW A;  1ZFS A;  2BCA A;  1OSA A;  4GGF C;  3CR4 X;  4MZJ A;  2EHB A;  1QLK A;  4AQI A;  1BF5 A;  4HRH A;  4OV2 A;  4OZD A;  2NCP A;  2H61 C;  2OPO A;  2BBN A;  2WOR A;  3TDZ A;  2WCF A;  1CFF A;  5KSZ A;  1CLM A;  3NXA A;  2K60 A;  1DT7 B;  2M3W A;  1TCO B;  2BE6 A;  3PFV A;  1L2O C;  1K96 A;  1SY9 A;  2K61 A;  2TN4 A;  3CTN A;  4GGF A;  1MR8 A;  3PLF B;  1XFR A;  4QJ4 B;  1SPY A;  5DKR A;  4YGD B;  1GJY A;  2OTG C;  1FI5 A;  3NSK A;  2FJU B;  4M2Q A;  1SBJ A;  2CTN A;  2I94 A;  5DKN A;  2PAL A;  1N65 A;  3FE9 A;  5G08 A;  3CZ2 A;  4C0K A;  3TUY C;  1NSH A;  1K9U A;  1NWD A;  1ODB A;  3AKA A;  3LL8 B;  2BE4 A;  1XK4 C;  1DQE A;  1QAS A;  2NZ0 A;  4MZL A;  1KSM A;  3SS3 A;  1W7J B;  2F3Z A;  3JTD C;  1SR6 B;  3CDN A;  4YGC B;  3S0B A;  2PYQ A;  1HQV A;  3BFB A;  2COL B;  3BFA A;  5KTY A;  3DVE A; 
#chains in the Genus database with same CATH homology
 1YVL A;  1VRK A;  1UP5 A;  2KBI A;  1W7I B;  1S5G Y;  2Y1M A;  1QV0 A;  1XK4 A;  1RWY A;  2HET A;  3KO0 A;  1UHI A;  3EK4 A;  1KCY A;  2ZN9 A;  2ZNE A;  1M46 A;  3CGA A;  4YI9 A;  3WNX B;  3HX4 A;  1MUX A;  4MZK A;  1LVC D;  4I5N B;  1YX7 A;  3SG3 A;  2KDH A;  4YBH B;  3BQ3 A;  1KK8 C;  1KFU L;  1NCY A;  1DTL A;  2BBM A;  1YR5 A;  2AAO A;  1PVB A;  5AEQ A;  1QVI Z;  1RFJ A;  2Y4Q A;  3O78 A;  2RGI A;  1DF0 B;  3EVU A;  1B9A A;  3IF7 A;  4I5L B;  5HLV A;  4ORC B;  1L7Z A;  1LKJ A;  4GNK B;  1XFZ O;  1MXE A;  1XFY O;  2JNF A;  4N5X A;  1U5I A;  2L50 A;  2ZN8 A;  2QPT A;  2JU0 A;  1BG1 A;  2MJW B;  1CFD A;  1KFX L;  3F45 A;  3LK0 A;  4HSZ A;  1UHN A;  1DJZ A;  2JTZ A;  1A75 A;  2LP3 A;  3A8R A;  2KI6 D;  1MQ1 A;  4C0J A;  1SKT A;  1CDP A;  5CSI A;  4CID A;  4PCW A;  2JT3 A;  2PRU A;  1B7T Z;  2JTT A;  1J7R A;  1TNQ A;  2MHH A;  3GOF A;  1F55 A;  4USL A;  1NP8 A;  2KGB C;  2LUC A;  3FWB A;  3I5G B;  2JWW A;  1XVJ A;  1JF0 A;  3GK2 A;  1SCM C;  3LLE A;  1DJX A;  3O2P A;  4CLN A;  1H4B A;  2L4H A;  2M1U A;  2LMU A;  1M39 A;  2MLE C;  1Y0V H;  4WQ2 A;  4XYN A;  3OHM B;  1WLZ A;  4ORA B;  1V1F A;  1G33 A;  1K95 A;  1FPW A;  1OZO A;  3GK1 A;  4NDC A;  1UHJ A;  2BCB A;  1FBV A;  4GBA A;  2L4I A;  2G9B A;  5JOL A;  1KQM C;  4OKH A;  1XO5 A;  2QAC A;  1QX2 A;  3RM1 A;  1X02 A;  1TTX A;  2EGD A;  5CSF A;  5BPJ A;  4ORB B;  2KAY A;  1GGW A;  2ZRS A;  2MAZ A;  5D69 A;  2HQ8 A;  3BUW B;  1Y6W A;  2Q91 A;  3JVT C;  4BY4 A;  2I2R E;  1CDN A;  2PSR A;  1PVA A;  3OB1 B;  1AP4 A;  1IQ3 A;  2JXL A;  1NCZ A;  4WQ3 A;  3CWG A;  2L0P A;  1M31 A;  1SL8 A;  2Y5I A;  2KQ6 A;  2KBM A;  4AOM A;  2M97 A;  2OS8 B;  3MSE B;  2M1K B;  4OR9 B;  3VRQ A;  1WDC B;  1MWN A;  3I5F C;  2LAP A;  2Y1N A;  3EKJ A;  3AAJ A;  1C7V A;  1F4O A;  1JF2 A;  1IH0 A;  2L98 A;  1KQV A;  1IWQ A;  3I5H C;  3OB2 B;  3PM8 A;  1JC2 A;  5I2Q A;  3TDI A;  3IQQ A;  4PHK A;  2LMT A;  1OE9 B;  2WOS A;  1J7Q A;  1F54 A;  1BJF A;  1XFU O;  3FWC A;  1K93 D;  2GV5 A;  3I5I C;  1KFU S;  1TIZ A;  1CMF A;  1TRF A;  1QIW A;  3VRO A;  1Y1X A;  1WRL A;  2LNK A;  4GAO A;  4JQ0 D;  1B1G A;  5I8N A;  2BEC A;  1SW8 A;  2ISD A;  1QS7 A;  3PSR A;  4MLW A;  1NX2 A;  3VGO A;  5F6T A;  2H61 A;  1LA3 A;  3EVR A;  1WY9 A;  1YX8 A;  1S6C A;  2M9G A;  4F0Z B;  1KFX S;  2WC8 A;  3SG5 A;  3HCM A;  4YRU A;  2V53 A;  1F70 A;  1L2O B;  1XYD A;  1K8U A;  1KSO A;  1ZUZ A;  2Q4U A;  3BUM B;  4TNC A;  2F2P A;  3TS5 C;  2HPS A;  2L2E A;  1IG5 A;  4GGN A;  1RJV A;  1B8R A;  2FCD A;  2OTG B;  1KK7 Z;  2JC2 A;  1JFK A;  1OMV A;  1PSB A;  3CZT X;  1IJ5 A;  2LCP A;  1CTR A;  2ZND A;  2CCM A;  4I5K A;  3NSI A;  5HKW A;  2WND A;  1HT9 A;  4QJ3 B;  5AAN A;  1MHO A;  1UHK A;  2K0J A;  4MRY A;  1MF8 B;  1K2H A;  3OX5 A;  2EC6 C;  1PK0 D;  2A4J A;  1UUS A;  3JTD B;  3PN7 C;  1AUI B;  4IL1 A;  1SK6 D;  4Q04 A;  1DJH A;  4E68 A;  3AAK A;  3WHT B;  2LUX A;  4ICB A;  4PAL A;  2I7A A;  2M49 B;  2L51 A;  2I18 A;  1F4Q A;  3OP0 A;  2NCO A;  4MBE A;  2VRG A;  1QLS A;  1YUR A;  1Y1U A;  2KFG A;  1R6P A;  1TNW A;  2JNX A;  2WCE A;  2F3Y A;  4M2P A;  1CLB A;  1DJY A;  1K94 A;  2JT0 A;  1SRA A;  3A4U B;  1KK8 B;  3BOW A;  1U5I B;  4AQJ A;  1AK8 A;  1XFX O;  1V1G A;  3KHE A;  1IRJ A;  3BOW B;  4P5O E;  1ALW A;  1A75 B;  4L9M A;  1FF1 A;  2O60 A;  1QV1 A;  2JOJ A;  1JUO A;  1J1E A;  2K7B A;  4XJK A;  5JJG A;  5I2L A;  1K90 D;  5I2O A;  3BUN B;  1DJG A;  3BYA A;  5HLO A;  1RTP 1;  1UHH A;  1XA5 A;  1REC A;  1WLM A;  2D8N A;  5ER4 X;  1J7P A;  4XJK B;  1BR1 B;  1SL7 A;  1ZAC A;  4OVN F;  4YI8 A;  2FOT A;  5CPV A;  1TCF A;  5D7F A;  1TN4 A;  2NXQ A;  3LK1 A;  1KWO C;  1TNP A;  3FS7 A;  2K7C A;  2MRD A;  4MSP A;  2AMI A;  1K9K A;  4WRI A;  4DRW A;  1BR4 B;  1QVI Y;  1IKU A;  1PRW A;  1G4Y R;  2M7L A;  3D0Y A;  1GGZ A;  4DUQ A;  4ZCV A;  3D10 A;  2G2B A;  4DCK A;  2M0R A;  4ETO A;  1OMD A;  3CR2 A;  1JWD A;  3D0Y B;  2CT9 A;  2K8M B;  2JQ6 A;  1SNL A;  1CM4 A;  3TZ1 A;  3CS1 A;  3O4Y A;  1CFC A;  1CB1 A;  1OZS A;  2BL0 C;  1CFP A;  1AJ5 A;  2KI4 C;  1YVH A;  1YRT B;  5DKQ A;  3TDU A;  2DOQ A;  2LVI A;  1QX5 B;  3DD4 A;  4MEW A;  1CKK A;  2K2F A;  1B47 A;  3EVV A;  3FIA A;  2SAS A;  1QTX A;  1XFW O;  4GFT A;  1KQM B;  1BOC A;  1B7T Y;  2ZFD A;  5K89 A;  1S26 D;  3EK8 A;  1A4P A;  4MVF A;  4CFR A;  1A2X A;  1QXP A;  2KYC A;  1ZOT B;  5J3X A;  1EJ3 A;  2M8U A;  4R1E A;  3CR5 X;  3KEV A;  5CSJ A;  4CPV A;  1XFV O;  1UWO A;  3SJS A;  1CLL A;  3DVM A;  2KFF A;  2LVV A;  4A4B A;  4M2O A;  3VRP A;  2PVB A;  2LE9 B;  3JVT B;  4DS7 A;  3SIA A;  2IS9 A;  4GUK A;  2BCX A;  3K21 A;  1IJ6 A;  1JBA A;  3C1V A;  1F71 A;  2KI6 C;  1YUS A;  1N0Y A;  2CNP A;  2E30 A;  1A29 A;  1PSR A;  3SG6 A;  3SG2 A;  4JPZ B;  1S3P A;  4QJ5 B;  5AFP A;  1WRZ A;  5KU1 A;  2KHN A;  2LLU A;  3I5F B;  5HKZ A;  4UPG A;  1D1O A;  1LXF C;  2LVK A;  2LV7 A;  4PHJ A;  5FYX A;  4A4C A;  2CBL A;  3IQO A;  3I5H B;  2HF5 A;  1M63 B;  1S5G Z;  1EL4 A;  1NX1 A;  1SL9 A;  2JRF A;  4I5J A;  4N1G A;  1PUL A;  1M45 A;  3VRR A;  3QRX A;  3I5I B;  3WXA A;  2KQY A;  1BOD A;  1TNX A;  2JT8 A;  1J55 A;  2ZKM X;  1B8C A;  3ICB A;  1S1E A;  3BXK A;  1A03 A;  1SR6 C;  2B1U A;  2KSP A;  1WRK A;  1K9P A;  2H2K A;  4BY5 A;  5GQQ C;  2M29 A;  1BMO A;  2KAV A;  2FCE A;  2BKH B;  1QJT A;  1BU3 A;  2MA2 A;  2K2A A;  3M0W A;  1JSA A;  1B8L A;  1ZMZ A;  1DJW A;  3AKB A;  1E8A A;  3TUY B;  4PDZ A;  1YUT A;  1SCV A;  1CDM A;  1NCX A;  5HKY A;  3BUO B;  4YGA A;  1F8H A;  2F33 A;  5CSN A;  1DMO A;  3CLN A;  1DGU A;  2LMV A;  3DF0 A;  4PHN A;  3O6B A;  1EG4 A;  4DIR A;  1BLQ A;  2KFH A;  2LHL A;  3SG7 A;  3SG4 A;  3DF0 B;  1AHR A;  2R2I A;  3TS5 B;  1H8B A;  1IGV A;  1CMG A;  1DGV A;  1S36 A;  2E6W A;  3RLZ A;  2LLT A;  2O5G A;  1EXR A;  3VRN A;  2LP2 A;  5AXI A;  1OQP A;  4MRX A;  4P2Y B;  1CDL A;  1EG3 A;  1YRU B;  2ZRT A;  2EC6 B;  1YTZ C;  3PN7 B;  4FTG A;  4NDD A;  2GGZ A;  2LHI A;  4NQG A;  1CM1 A;  1PAL A;  2LLS A;  3E3R A;  3SIB A;  3NSL A;  5PAL A;  4PHM A;  1DF0 A;  1QX7 A;  2MBX A;  1KK7 Y;  1C7W A;  1J1D A;  1UUR A;  1OOJ A;  1MXL C;  3WHU B;  4D1E A;  4MN0 A;  4FQO A;  3I5G C;  3EK7 A;  3NSO A;  2JPT A;  2JUL A;  4CFQ A;  1Q80 A;  3OX6 A;  2LM5 A;  1YUU A;  2PMY A;  4ZCU A;  2JZI A;  2WCB A;  2L5X B;  2MLF C;  4PE4 A;  2SCP A;  2P6B B;  1FW4 A;  2KOT A;  1SMG A;  3ZNI A;  1NIW A;  3ZWH A;  5AER A;  4PE1 A;  2KGR A;  4YGB B;  1SCM B;  3KPX A;  1NUB A;  1LA0 A;  1OMR A;  2F8P A;  1QAT A;  1SYM A;  1TOP A;  2GGM A;  2K7O A;  2KAX A;  2KNE A;  2KYF A;  4NDB A;  4U8D A;  1RRO A;  3KF9 A;  4JWQ A;  1DJI A;  5HYD A;  1KWO B;  1NYA A;  2JXC A;  3DVK A;  2M7N A;  1NX3 A;  1AVS A;  5TNC A;  1ALV A;  1R2U A;  1N2D A;  1RK9 A;  2LC5 A;  2F2O A;  2K7D A;  1IQ5 A;  2BKI B;  3H4S E;  1DVI A;  1GQM A;  2OS8 C;  4OCI A;  2BL0 B;  4HRG A;  1G8I A;  1WDC C;  2LVJ A;  4PE7 A;  1NX0 A;  2KI4 B;  4PE0 A;  1S6J A;  4YGE B;  1B4C A;  2AUC A;  1EH2 A;  2LAN A;  1FI6 A;  3BUX B;  3PAL A;  1AJ4 A;  4N1F A;  2CXJ A;  2NLN A;  1CNP A;  3PAT A;  1JFJ A;  4HRE E;  4C0L A;  1C07 A;  3GK4 X;  1Y1A A;  4GPL B;  5ER5 A;  1LIN A;  2PAS A;  1S6I A;  1J7O A;  3DVJ A;  3EKH A;  1BT6 A;  1QIV A;  2HQW A;  1NPQ A;  3LCP C;  5B8I B;  5IBW A;  1ZFS A;  2BCA A;  1OSA A;  4GGF C;  3CR4 X;  4MZJ A;  2EHB A;  1QLK A;  4AQI A;  1BF5 A;  4HRH A;  4OV2 A;  2NCP A;  2H61 C;  2OPO A;  2BBN A;  2WOR A;  3TDZ A;  2WCF A;  1CFF A;  5KSZ A;  1CLM A;  3NXA A;  1DT7 B;  2M3W A;  1TCO B;  2BE6 A;  3PFV A;  1L2O C;  1K96 A;  1SY9 A;  2K61 A;  2TN4 A;  3CTN A;  4GGF A;  1MR8 A;  3PLF B;  4QJ4 B;  1SPY A;  5DKR A;  4YGD B;  1GJY A;  2OTG C;  1FI5 A;  3NSK A;  2FJU B;  4M2Q A;  1SBJ A;  2CTN A;  2I94 A;  5DKN A;  2PAL A;  1N65 A;  5G08 A;  4C0K A;  3TUY C;  1NSH A;  1K9U A;  1NWD A;  1ODB A;  3AKA A;  3LL8 B;  2BE4 A;  1XK4 C;  1QAS A;  2NZ0 A;  4MZL A;  1KSM A;  1W7J B;  2F3Z A;  3JTD C;  1SR6 B;  4YGC B;  1HQV A;  2COL B;  5KTY A;  3DVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...