2AMIA

Solution structure of the calcium-loaded n-terminal sensor domain of centrin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
RVGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caltractin
publication title Structure of the N-terminal calcium sensor domain of centrin reveals the biochemical basis for domain-specific function.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Cell cycle
total genus 29
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2amiA00
1SCMC 3OX6A 3JVTC 3LK1A 1ZFSA 5J3XA 2GGZA 2JT3A 5HLOA 1OZSA 2CXJA 1BG1A 2LE9B 3AKAA 1KWOC 4OV2A 1YR5A 1C07A 5D7FA 5I2OA 5K89A 1OSAA 1HQVA 1XK4A 4WRIA 1TCOB 4NQGA 4U8DA 3F45A 2AUCA 3PN7C 1MXLC 3BUXB 1J7OA 1TOPA 1SCMB 3JVTB 1XA5A 2RGIA 1ZACA 1UHIA 5CSFA 3GOFA 5DKQA 1KWOB 2HF5A 2HQ8A 2I94A 4YGEB 1NSHA 2LUCA 4DUQA 1R2UA 4OCIA 1N2DA 3LLEA 3WNXB 1A4PA 2L0PA 2HPSA 1SL9A 3EK4A 2MBXA 3CGAA 4CPVA 5JJGA 1CMGA 2M8UA 2JULA 3PN7B 4PHNA 1MR8A 2JXLA 2LCPA 2VRGA 2M1KB 1S6IA 2CNPA 1S5GY 2F3ZA 2JNXA 2KI4C 1B1GA 1OMRA 3EKJA 4ETOA 1M46A 1F4QA 1IJ6A 2WC8A 4PE7A 5HKZA 2BE6A 1K8UA 1UHHA 2BKIB 1LA0A 2HETA 3WHTB 4M2PA 4CFQA 1BODA 1S1EA 3LK0A 2L4IA 3SG5A 4MRXA 1TNWA 1RJVA 1V1FA 3EKHA 1QTXA 3IQOA 3OB1B 4MRYA 1YX8A 1Q80A 2COLB 2WCEA 2LAPA 3TDZA 2EHBA 2KFGA 2KI4B 4NDCA 2KOTA 1FPWA 2SASA 4NDDA 4ORBB 1KFXS 1L2OC 1SNLA 1IRJA 3LCPC 4A4BA 4TNCA 5CSJA 5ER4X 5KTYA 2BCAA 1S5GZ 1WRLA 2I2RE 3BUWB 4PE4A 1QASA 1AK8A 2NZ0A 1M31A 3CTNA 1H4BA 3A8RA 2SCPA 1PVAA 1QX5B 5KSZA 4F0ZB 1Y1AA 2DOQA 1FI5A 1GJYA 4GAOA 1PRWA 3NSOA 1SW8A 3PATA 1SYMA 3TZ1A 3CWGA 4ICBA 3NSLA 1DJHA 3SG6A 3IF7A 1K90D 5F6TA 1TN4A 1NX3A 2KNEA 2WOSA 1W7IB 3BUNB 3SG7A 4YRUA 1CLBA 1LA3A 1VRKA 2LUXA 2JTZA 1L2OB 3JTDC 1QS7A 3FS7A 2KDHA 3O4YA 5PALA 2LLTA 2KFFA 1N0YA 2E30A 4YI8A 1R6PA 1U5IB 4GGFC 1QX7A 2LV7A 3M0WA 1QJTA 2LHLA 1CDNA 2F3YA 4MEWA 4Q04A 1KQMC 2JOJA 1QXPA 2ZKMX 3RM1A 1SL8A 2H61A 1Y1XA 1UWOA 3I5GB 4A4CA 2K7BA 2K61A 1F55A 2M1UA 1RFJA 1UHJA 1IG5A 1J7QA 1OMVA 1YUTA 2KQ6A 4AOMA 3DVMA 2M49B 3SIAA 2KBIA 1CFCA 5I2LA 3PLFB 4WQ3A 4YGAA 1OOJA 3BUOB 4I5LB 1FBVA 1N65A 1S36A 3CS1A 5B8IB 5JOLA 4DIRA 2KYFA 2KGBC 4PHJA 1NCZA 1SMGA 1KQMB 2BKHB 1OZOA 4JWQA 1ZOTB 1TTXA 5AFPA 3VRPA 2BCXA 2LM5A 4R1EA 2F2PA 1DGVA 2WNDA 1RWYA 2KAYA 1WRZA 1JF2A 1GQMA 4HRHA 4ZCUA 3C1VA 1CB1A 4CIDA 2LC5A 2K8MB 1MHOA 1AVSA 5TNCA 4USLA 2EC6C 1V1GA 5BPJA 1CDLA 1DGUA 2ZRSA 2Q4UA 1B9AA 1SRAA 1JFJA 2OS8B 1FI6A 1QATA 1NWDA 1DJZA 3NXAA 2LVKA 2BBMA 3SJSA 4FQOA 1F70A 1SBJA 4N1GA 2KGRA 1UP5A 4GFTA 1K94A 4MZLA 1S26D 1SK6D 1YUUA 4HRGA 3AAKA 4GBAA 1CFDA 2PMYA 1KFUS 1IQ5A 2I18A 2LVJA 1SR6C 3I5IC 1G8IA 1WLMA 5AEQA 3I5HC 1TCFA 1IGVA 2AMIA 1YRTB 3VROA 2PVBA 1K93D 2CT9A 3BQ3A 3SG2A 1X02A 1J7RA 4XJKB 3I5FC 2D8NA 2M7LA 2NXQA 4ZCVA 1TNQA 2JXCA 4P2YB 1G4YR 1QVIY 2FCEA 2L98A 1UUSA 3E3RA 4E68A 1WRKA 4QJ5B 1U5IA 1HT9A 2M7NA 1DF0B 1KK7Y 1A75B 2TN4A 2V53A 3I5HB 3OX5A 1MUXA 1QLKA 1LXFC 1JWDA 1MXEA 4C0KA 3CR5X 3ICBA 1TRFA 2O60A 2JQ6A 2M9GA 1W7JB 3I5FB 4YGBB 4QJ3B 2WORA 1AJ4A 4XYNA 1JSAA 2G2BA 2R2IA 3DVJA 1AP4A 2L50A 1KK8C 1RECA 1CM4A 1TIZA 1XFXO 2BE4A 4I5JA 1LINA 4GGFA 1DT7B 2JNFA 2JTTA 1PSRA 2JT8A 3QRXA 1B7TY 1KFXL 5CSNA 1F4OA 1CNPA 2KBMA 1YURA 1KK7Z 1LKJA 2MRDA 5AXIA 2MHHA 4GGNA 1KCYA 3EK8A 1S3PA 1EG4A 2PASA 4I5NB 1CDMA 1SPYA 2ZN9A 4OR9B 1JBAA 4AQJA 1LVCD 2F33A 2LVIA 2MAZA 3GK4X 1YTZC 1KK8B 3EVUA 3K21A 1L7ZA 2JC2A 4UPGA 1DJXA 3VGOA 2KFHA 1NYAA 3GK2A 3FWBA 2JWWA 4GUKA 1F54A 5D69A 5AERA 5IBWA 1AJ5A 2MJWB 4N1FA 2K7DA 3CZTX 3VRNA 1K96A 4FTGA 1JC2A 2M3WA 3WHUB 2EGDA 2OTGC 2JU0A 1JFKA 3JTDB 3PM8A 2H2KA 2JRFA 1B47A 3D0YB 3WXAA 2LHIA 1YUSA 2KAXA 1IJ5A 1CKKA 3DVEA 1QIWA 1YVHA 2KAVA 2A4JA 2P6BB 4ORAB 2B1UA 4PHMA 1DMOA 1JUOA 1JF0A 2ZN8A 2BECA 3A4UB 3TDUA 1XFZO 2MA2A 1BU3A 1K9UA 1UHKA 1XFUO 3HCMA 1SKTA 1IWQA 1WDCC 4DRWA 2OTGB 5GQQC 4N5XA 2FJUB 2PSRA 3O78A 1BR1B 4DS7A 2ZNEA 1S6CA 2WCBA 1MWNA 1D1OA 4XJKA 2ISDA 2LMTA 1DTLA 5HKYA 1XFYO 1RK9A 2MLEC 4MLWA 2FOTA 1BMOA 2BL0C 1B8CA 2GGMA 1F71A 1PALA 3VRRA 3BUMB 1DF0A 2KI6C 3DF0A 1A75A 1AUIB 2KI6D 2K7CA 1ZUZA 1BOCA 2JT0A 2FCDA 4OVNF 2KQYA 3OP0A 2O5GA 1XO5A 1K9PA 3O2PA 1NP8A 1PULA 1IKUA 1CDPA 2KSPA 2CTNA 2LP3A 3HX4A 3EVVA 4OKHA 4I5KA 1PK0D 3DD4A 1ZMZA 1YX7A 4YI9A 3D10A 2BL0B 3EVRA 1C7VA 2AAOA 2QACA 2EC6B 2Y1NA 1MQ1A 1OMDA 1AHRA 3ZNIA 1J1DA 5DKNA 1G33A 1SY9A 1CFPA 1B4CA 2LP2A 3KEVA 5DKRA 1M63B 3PFVA 2BBNA 1DJWA 4AQIA 1PVBA 2PALA 1XYDA 2KYCA 3IQQA 2LLSA 1SCVA 1NX2A 5CSIA 1NPQA 1KFUL 2NCOA 1EH2A 1QV0A 1ALWA 1KSOA 1M39A 2WCFA 3AAJA 1WLZA 2MLFC 2G9BA 4PHKA 2LANA 3KHEA 1A03A 4MZKA 3O6BA 2F2OA 1SR6B 3I5IB 1XK4C 2L5XB 1RROA 3DF0B 2LLUA 3LL8B 3BOWB 2BCBA 2HQWA 4IL1A 3CR4X 1XFVO 4L9MA 5I8NA 1IQ3A 1NX1A 2I7AA 4PDZA 1ODBA 3CLNA 2QPTA 1EL4A 1PSBA 1A2XA 1K95A 1M45A 4JPZB 3TDIA 1A29A 1BLQA 1NX0A 1ALVA 2NLNA 1J1EA 1TNXA 3TS5C 5HYDA 1UURA 1NCYA 1RTP1 4PE0A 3D0YA 2L51A 3TUYC 2JPTA 4JQ0D 4GNKB 2CBLA 1WY9A 1YVLA 4MSPA 5AANA 1QVIZ 1YRUB 4ORCB 5HKWA 1GGWA 3KO0A 1DJGA 3BXKA 3MSEB 1CTRA 4P5OE 5I2QA 1Y6WA 3TS5B 4C0JA 1NUBA 1FF1A 3RLZA 1OQPA 1B8LA 5HLVA 1UHNA 3TUYB 2K0JA 4GPLB 1S6JA 1DJIA 2LVVA 1DJYA 1EXRA 4YBHB 1H8BA 4C0LA 2K2FA 1QX2A 2L2EA 1KSMA 4HSZA 3H4SE 1BJFA 1FW4A 4HREE 2M29A 1K2HA 2JZIA 2PRUA 1Y0VH 1SL7A 4MBEA 4WQ2A 1F8HA 1J55A 3KPXA 2GV5A 5FYXA 4CLNA 4M2QA 1B7TZ 1DVIA 2LNKA 5G08A 1BF5A 1C7WA 3I5GC 4BY4A 3SG4A 2ZNDA 1IH0A 3CR2A 5KU1A 4PE1A 5CPVA 5ER5A 3SG3A 1NIWA 3KF9A 3EK7A 1QV1A 1MF8B 4PCWA 2LMUA 2OPOA 2ZFDA 2M0RA 3AKBA 2KHNA 2F8PA 4YGCB 2E6WA 4MN0A 1K9KA 3PSRA 1E8AA 3DVKA 2M97A 1GGZA 2L4HA 2Q91A 2Y1MA 3NSKA 3OB2B 1EG3A 1TNPA 3FWCA 4YGDB 2Y4QA 2K7OA 1J7PA 1EJ3A 2IS9A 4D1EA 1QIVA 4MVFA 2ZRTA 4PALA 1NCXA 1CMFA 4M2OA 1QLSA 4NDBA 1OE9B 4BY5A 1Y1UA 2LMVA 3NSIA 4DCKA 3SIBA 1CLMA 3VRQA 2CCMA 3GK1A 1XVJA 1CFFA 3OHMB 1KQVA 2Y5IA 4MZJA 1CLLA 3BYAA 4CFRA 1BT6A 3BOWA 4QJ4B 1B8RA 2NCPA 1XFWO 1WDCB 3PALA 2OS8C 2H61C 3ZWHA 1CM1A 2K2AA 3FIAA 1BR4B
chains in the Genus database with same CATH superfamily
1SCMC 3OX6A 3JVTC 3LK1A 1ZFSA 5J3XA 2GGZA 2JT3A 5HLOA 1OZSA 2CXJA 1BG1A 2WCKA 2LE9B 3AKAA 1KWOC 4OV2A 1YR5A 1C07A 2KPHA 5D7FA 5I2OA 3DZTA 5K89A 1OSAA 1HQVA 1XK4A 4WRIA 2K60A 1TCOB 4OZDA 3S0DA 4NQGA 4U8DA 3F45A 2AUCA 3PN7C 1MXLC 3SS3A 3BUXB 1J7OA 1TOPA 1SCMB 2WCJA 3JVTB 1XA5A 2RGIA 5EL2A 1ZACA 1UHIA 5CSFA 3GOFA 5DKQA 1KWOB 2HF5A 2HQ8A 2I94A 1DC1A 4YGEB 1NSHA 2LUCA 4DUQA 1R2UA 4OCIA 1N2DA 3LLEA 3WNXB 1A4PA 2L0PA 2HPSA 1SL9A 3EK4A 2MBXA 3CGAA 4CPVA 5JJGA 1CMGA 2M8UA 2JULA 3PN7B 4PHNA 1DQEA 1MR8A 2JXLA 2LCPA 2VRGA 1Z4HA 2M1KB 1S6IA 2CNPA 1S5GY 2F3ZA 2JNXA 2KI4C 1B1GA 1OMRA 3EKJA 4ETOA 1M46A 1F4QA 1IJ6A 2WC8A 4PE7A 5HKZA 2BE6A 1K8UA 1UHHA 2BKIB 1LA0A 2HETA 3WHTB 4M2PA 4CFQA 3EG5B 2YGUA 1BODA 1S1EA 3LK0A 2L4IA 3SG5A 3S0FA 4MRXA 1TNWA 1RJVA 1V1FA 3EKHA 1QTXA 3IQOA 3OB1B 4MRYA 1YX8A 1Q80A 2COLB 2WCEA 2LAPA 3TDZA 5D3OA 2EHBA 2KFGA 2KI4B 5I94A 4NDCA 2KOTA 1FPWA 2SASA 4NDDA 4ORBB 1KFXS 3CZ0A 1L2OC 1SNLA 1IRJA 3LCPC 4A4BA 4TNCA 5CSJA 5ER4X 5KTYA 2BCAA 1S5GZ 1WRLA 1SSEB 2I2RE 3BUWB 4PE4A 1QASA 1AK8A 2NZ0A 1M31A 3CTNA 1H4BA 3A8RA 2SCPA 1PVAA 1QX5B 5KSZA 4F0ZB 1Y1AA 2DOQA 1FI5A 3IVTA 2QEOA 3DXLA 1GJYA 4GAOA 1PRWA 3NSOA 1SW8A 3PATA 1SYMA 3TZ1A 3CWGA 4ICBA 3NSLA 1DJHA 3SG6A 3IF7A 1K90D 5F6TA 1TN4A 1NX3A 2KNEA 1XFRA 1W7IB 2P70A 2WOSA 3BUNB 3SG7A 4YRUA 1LA3A 1VRKA 2LUXA 1CLBA 2JTZA 1L2OB 3JTDC 2JPOA 1QS7A 3FS7A 2KDHA 3O4YA 5PALA 2LLTA 2KFFA 1N0YA 2E30A 4YI8A 1R6PA 1U5IB 3S0BA 4GGFC 1QX7A 3PM2A 2LV7A 3S0AA 3M0WA 1QJTA 2LHLA 1CDNA 5FI6A 2F3YA 2QEVA 4MEWA 4Q04A 1DEKA 1KQMC 2JOJA 1QXPA 2ZKMX 3RM1A 1SL8A 2H61A 1Y1XA 1UWOA 3I5GB 4A4CA 2K7BA 2K61A 1F55A 2M1UA 1RFJA 1UHJA 1IG5A 3NHTA 1J7QA 1OMVA 1YUTA 2BAPA 2KQ6A 4AOMA 3DVMA 2M49B 3SIAA 2KBIA 1CFCA 5I2LA 3PLFB 4WQ3A 4YGAA 1OOJA 3BUOB 4I5LB 1FBVA 1N65A 1S36A 3CS1A 5B8IB 5JOLA 4DIRA 2KYFA 2KGBC 4PHJA 1NCZA 1SMGA 1KQMB 4KYNA 2WC5A 2BKHB 1OZOA 2KLDA 1ZOTB 1TTXA 4JWQA 5AFPA 3VRPA 1C3YA 2BCXA 2LM5A 4R1EA 2F2PA 1DGVA 2WNDA 1RWYA 2KAYA 1WRZA 1JF2A 1GQMA 4HRHA 4ZCUA 3C1VA 1CB1A 4CIDA 2LC5A 2K8MB 1MHOA 1AVSA 5TNCA 4USLA 2EC6C 1V1GA 3CABA 5BPJA 1CDLA 1DGUA 2ZRSA 1TUZA 1B9AA 1SRAA 2Q4UA 1JFJA 2OS8B 3O4XA 1FI6A 1QATA 3SS5A 1NWDA 1DJZA 3CZ1A 3NXAA 4INWA 2LVKA 2BBMA 4F7FA 3SJSA 4FQOA 1F70A 1SBJA 4N1GA 2KGRA 1UP5A 4GFTA 2ERBA 1K94A 4MZLA 3NGVA 1S26D 1SK6D 1YUUA 3CZ2A 4HRGA 3AAKA 4GBAA 1CFDA 2PMYA 3RZSA 1KFUS 1IQ5A 2I18A 2LVJA 1SR6C 3I5IC 1G8IA 1WLMA 5AEQA 3BFHA 3I5HC 3FE6A 3K1EA 1TCFA 1IGVA 2AMIA 1YRTB 3VROA 2PVBA 1K93D 2CT9A 3BQ3A 3B7AA 3SG2A 1X02A 3B87A 1J7RA 1P28A 4XJKB 3I5FC 2D8NA 2M7LA 5DICA 3CYZA 2NXQA 4ZCVA 1TNQA 2JXCA 4P2YB 1G4YR 1QVIY 2FCEA 2L98A 1UUSA 3E3RA 4E68A 1WRKA 4QJ5B 4FQTA 1U5IA 1HT9A 2M7NA 2FJYA 1DF0B 1KK7Y 1A75B 2TN4A 2V53A 3I5HB 2L5YA 3OX5A 1MUXA 1QLKA 1LXFC 1JWDA 1MXEA 4C0KA 3CR5X 3ICBA 1TRFA 2O60A 2JQ6A 3FE9A 2M9GA 1W7JB 3I5FB 4YGBB 2QEHA 4QJ3B 2WORA 1AJ4A 4XYNA 1JSAA 2G2BA 2WCLA 2R2IA 3D78A 3DVJA 1AP4A 2L50A 1KK8C 1RECA 1CM4A 1TIZA 1OW4A 1XFXO 2BE4A 4I5JA 1LINA 1LS8A 4GGFA 1DT7B 2JNFA 2JTTA 1PSRA 2JT8A 3QRXA 1B7TY 3S0EA 1KFXL 5CSNA 1F4OA 1CNPA 2KBMA 1YURA 2QDIA 1KK7Z 1LKJA 2MRDA 5AXIA 2MHHA 4GGNA 1KCYA 3EK8A 2WC6A 1S3PA 1EG4A 2PASA 4I5NB 1CDMA 1SPYA 2ZN9A 4OR9B 1JBAA 4AQJA 1LVCD 1W9ZA 2F33A 2LVIA 2MAZA 3GK4X 1YTZC 1KK8B 3EVUA 3K21A 1DELA 1L7ZA 2JC2A 2PQLA 1DJXA 4UPGA 3VGOA 2KFHA 1NYAA 3GK2A 3FWBA 3UNWA 2JWWA 4GUKA 1F54A 3B86A 5D69A 5AERA 5FI2A 1AJ5A 2KLEA 5IBWA 2MJWB 4N1FA 2K7DA 3CZTX 3VRNA 1K96A 4FTGA 1JC2A 2BNXA 2M3WA 3WHUB 2EGDA 2OTGC 3VB1A 3R1OA 4PT1A 2JU0A 1JFKA 3JTDB 3PM8A 2H2KA 2JRFA 1B47A 3R1VA 3D0YB 3WXAA 2LHIA 1YUSA 2P71A 2KAXA 1IJ5A 1CKKA 3DVEA 1QIWA 1YVHA 2KAVA 2A4JA 2P6BB 4ORAB 2B1UA 4PHMA 1DMOA 1JUOA 1JF0A 2ZN8A 2BECA 3A4UB 3TDUA 1XFZO 2MA2A 1BU3A 1K9UA 1UHKA 1XFUO 3HCMA 1SKTA 1IWQA 1WDCC 4DRWA 2OTGB 5GQQC 4N5XA 2FJUB 2PSRA 3O78A 1BR1B 4DS7A 2ZNEA 1S6CA 3B6XA 2WCBA 1MWNA 1D1OA 4XJKA 1ORGA 5FI7A 2ISDA 2LMTA 1DTLA 5HKYA 3N7HA 1XFYO 4IJ7A 1RK9A 2MLEC 3Q8IA 4MLWA 2FOTA 1BMOA 2BL0C 1B8CA 2GGMA 1F71A 1PALA 3VRRA 3D77A 3BUMB 1DF0A 2KI6C 3D73A 1A75A 1AUIB 3DF0A 2KI6D 2K7CA 3BFAA 1ZUZA 1BOCA 2JT0A 2FCDA 1OOGA 4OVNF 2KQYA 3OP0A 2O5GA 1XO5A 1K9PA 3O2PA 1NP8A 1PULA 1IKUA 1CDPA 2KSPA 2CTNA 2LP3A 3HX4A 3EVVA 4OKHA 4I5KA 1PK0D 3DD4A 1ZMZA 1YX7A 4YI9A 3D10A 2BL0B 3EVRA 1C7VA 2AAOA 3R72A 2QACA 2EC6B 2Y1NA 1MQ1A 1OMDA 1AHRA 3D75A 3ZNIA 1J1DA 3D76A 5DKNA 1G33A 3CDNA 1SY9A 1CFPA 1B4CA 2LP2A 3KEVA 3UO9A 5DKRA 1M63B 3PFVA 2BBNA 1DJWA 4AQIA 1PVBA 2PALA 1XYDA 2KYCA 3IQQA 2LLSA 1SCVA 1NX2A 5CSIA 1NPQA 1KFUL 2NCOA 3NHIA 1EH2A 1QWVA 1QV0A 1ALWA 1KSOA 1M39A 2QEBA 2WCFA 2L2CA 1OOFA 3AAJA 1WLZA 2MLFC 2G9BA 4PHKA 2LANA 3KHEA 1A03A 4MZKA 3O6BA 2F2OA 1SR6B 3I5IB 1XK4C 2L5XB 1RROA 3DF0B 3QMEA 2LLUA 3LL8B 3BOWB 2BCBA 2HQWA 4IL1A 3CR4X 1XFVO 4L9MA 5I8NA 1IQ3A 1NX1A 2I7AA 4PDZA 1ODBA 3CLNA 2QPTA 1EL4A 1PSBA 1A2XA 1K95A 1M45A 3PJIA 4JPZB 3TDIA 1A29A 1BLQA 1NX0A 4JKTA 1ALVA 2NLNA 1J1EA 1TNXA 3TS5C 5HYDA 1UURA 1OOHA 1NCYA 1RTP1 3DY9A 4PE0A 3D0YA 2L51A 3SS4A 3TUYC 2JPTA 1OOIX 4JQ0D 4GNKB 2CBLA 1WY9A 1YVLA 4MSPA 5AANA 3L4LA 1QVIZ 1YRUB 4ORCB 3BFBA 5HKWA 1GGWA 3KO0A 1DJGA 3BXKA 3MSEB 3B88A 1CTRA 4P5OE 3L47A 5I2QA 3D74A 4JD9A 2WCHA 1Y6WA 3TS5B 4C0JA 1NUBA 1FF1A 3RLZA 1OQPA 1B8LA 5HLVA 1UHNA 3V2LA 3TUYB 2K0JA 4GPLB 1S6JA 1DJIA 2LVVA 5HL1A 1DJYA 1EXRA 2PYQA 4YBHB 1TWOA 1H8BA 4C0LA 2K2FA 1QX2A 2L2EA 1KSMA 4HSZA 3H4SE 1BJFA 1FW4A 2H8VA 4HREE 1C3ZA 2M29A 1K2HA 2JZIA 2PRUA 1Y0VH 1SL7A 4MBEA 4WQ2A 1F8HA 1J55A 3KPXA 2GV5A 5FYXA 4CLNA 4M2QA 1B7TZ 1DVIA 2LNKA 3BJHA 5G08A 1BF5A 1C7WA 3I5GC 4BY4A 3SG4A 2ZNDA 1IH0A 3CR2A 5KU1A 4PE1A 5CPVA 5ER5A 3OGNA 1NIWA 1T14A 3KF9A 3DYEA 3SG3A 1GM0A 3EK7A 1QV1A 1MF8B 4PCWA 2LMUA 2OPOA 2ZFDA 2M0RA 3AKBA 2KHNA 2F8PA 4YGCB 2E6WA 4MN0A 1K9KA 3PSRA 1E8AA 3DVKA 2M97A 3R1PA 1GGZA 2L4HA 2Q91A 2Y1MA 3NSKA 3OB2B 1EG3A 1TNPA 3FWCA 4YGDB 2Y4QA 2K7OA 3FE8A 1J7PA 1EJ3A 2IS9A 3OBVA 4D1EA 1QIVA 4MVFA 2ZRTA 4PALA 1NCXA 1TUJA 2WCMA 1CMFA 4M2OA 1QLSA 4NDBA 1OE9B 4BY5A 1Y1UA 2LMVA 3NSIA 4INXA 1Z2CB 4DCKA 3SIBA 2GTEA 1CLMA 3VRQA 2CCMA 3GK1A 1XVJA 1CFFA 3OHMB 1KQVA 2Y5IA 4MZJA 1CLLA 3BYAA 1IIOA 4CFRA 1BT6A 3BOWA 4QJ4B 1B8RA 2NCPA 1XFWO 1WDCB 3S0GA 3PALA 2OS8C 2H61C 3ZWHA 3L4AA 1CM1A 2K2AA 3FIAA 1BR4B
chains in the Genus database with same CATH topology
1SCMC 3OX6A 3JVTC 3LK1A 1ZFSA 5J3XA 2GGZA 2JT3A 5HLOA 1OZSA 2CXJA 1BG1A 2LE9B 3AKAA 1KWOC 4OV2A 1YR5A 1C07A 5D7FA 5I2OA 5K89A 1OSAA 1HQVA 1XK4A 4WRIA 1TCOB 4NQGA 4U8DA 3F45A 2AUCA 3PN7C 1MXLC 3BUXB 1J7OA 1TOPA 1SCMB 3JVTB 1XA5A 2RGIA 1ZACA 1UHIA 5CSFA 3GOFA 5DKQA 1KWOB 2HF5A 2HQ8A 2I94A 4YGEB 1NSHA 2LUCA 4DUQA 1R2UA 4OCIA 1N2DA 3LLEA 3WNXB 1A4PA 2L0PA 2HPSA 1SL9A 3EK4A 2MBXA 3CGAA 4CPVA 5JJGA 1CMGA 2M8UA 2JULA 3PN7B 4PHNA 1MR8A 2JXLA 2LCPA 2VRGA 2M1KB 1S6IA 2CNPA 1S5GY 2F3ZA 2JNXA 2KI4C 1B1GA 1OMRA 3EKJA 4ETOA 1M46A 1F4QA 1IJ6A 2WC8A 4PE7A 5HKZA 2BE6A 1K8UA 1UHHA 2BKIB 1LA0A 2HETA 3WHTB 4M2PA 4CFQA 1BODA 1S1EA 3LK0A 2L4IA 3SG5A 4MRXA 1TNWA 1RJVA 1V1FA 3EKHA 1QTXA 3IQOA 3OB1B 4MRYA 1YX8A 1Q80A 2COLB 2WCEA 2LAPA 3TDZA 2EHBA 2KFGA 2KI4B 4NDCA 2KOTA 1FPWA 2SASA 4NDDA 4ORBB 1KFXS 1L2OC 1SNLA 1IRJA 3LCPC 4A4BA 4TNCA 5CSJA 5ER4X 5KTYA 2BCAA 1S5GZ 1WRLA 2I2RE 3BUWB 4PE4A 1QASA 1AK8A 2NZ0A 1M31A 3CTNA 1H4BA 3A8RA 2SCPA 1PVAA 1QX5B 5KSZA 4F0ZB 1Y1AA 2DOQA 1FI5A 1GJYA 4GAOA 1PRWA 3NSOA 1SW8A 3PATA 1SYMA 3TZ1A 3CWGA 4ICBA 3NSLA 1DJHA 3SG6A 3IF7A 1K90D 5F6TA 1TN4A 1NX3A 2KNEA 2WOSA 1W7IB 3BUNB 3SG7A 4YRUA 1CLBA 1LA3A 1VRKA 2LUXA 2JTZA 1L2OB 3JTDC 1QS7A 3FS7A 2KDHA 3O4YA 5PALA 2LLTA 2KFFA 1N0YA 2E30A 4YI8A 1R6PA 1U5IB 4GGFC 1QX7A 2LV7A 3M0WA 1QJTA 2LHLA 1CDNA 2F3YA 4MEWA 4Q04A 1KQMC 2JOJA 1QXPA 2ZKMX 3RM1A 1SL8A 2H61A 1Y1XA 1UWOA 3I5GB 4A4CA 2K7BA 2K61A 1F55A 2M1UA 1RFJA 1UHJA 1IG5A 1J7QA 1OMVA 1YUTA 2KQ6A 4AOMA 3DVMA 2M49B 3SIAA 2KBIA 1CFCA 5I2LA 3PLFB 4WQ3A 4YGAA 1OOJA 3BUOB 4I5LB 1FBVA 1N65A 1S36A 3CS1A 5B8IB 5JOLA 4DIRA 2KYFA 2KGBC 4PHJA 1NCZA 1SMGA 1KQMB 2BKHB 1OZOA 4JWQA 1ZOTB 1TTXA 5AFPA 3VRPA 2BCXA 2LM5A 4R1EA 2F2PA 1DGVA 2WNDA 1RWYA 2KAYA 1WRZA 1JF2A 1GQMA 4HRHA 4ZCUA 3C1VA 1CB1A 4CIDA 2LC5A 2K8MB 1MHOA 1AVSA 5TNCA 4USLA 2EC6C 1V1GA 5BPJA 1CDLA 1DGUA 2ZRSA 2Q4UA 1B9AA 1SRAA 1JFJA 2OS8B 1FI6A 1QATA 1NWDA 1DJZA 3NXAA 2LVKA 2BBMA 3SJSA 4FQOA 1F70A 1SBJA 4N1GA 2KGRA 1UP5A 4GFTA 1K94A 4MZLA 1S26D 1SK6D 1YUUA 4HRGA 3AAKA 4GBAA 1CFDA 2PMYA 1KFUS 1IQ5A 2I18A 2LVJA 1SR6C 3I5IC 1G8IA 1WLMA 5AEQA 3I5HC 1TCFA 1IGVA 2AMIA 1YRTB 3VROA 2PVBA 1K93D 2CT9A 3BQ3A 3SG2A 1X02A 1J7RA 4XJKB 3I5FC 2D8NA 2M7LA 2NXQA 4ZCVA 1TNQA 2JXCA 4P2YB 1G4YR 1QVIY 2FCEA 2L98A 1UUSA 3E3RA 4E68A 1WRKA 4QJ5B 1U5IA 1HT9A 2M7NA 1DF0B 1KK7Y 1A75B 2TN4A 2V53A 3I5HB 3OX5A 1MUXA 1QLKA 1LXFC 1JWDA 1MXEA 4C0KA 3CR5X 3ICBA 1TRFA 2O60A 2JQ6A 2M9GA 1W7JB 3I5FB 4YGBB 4QJ3B 2WORA 1AJ4A 4XYNA 1JSAA 2G2BA 2R2IA 3DVJA 1AP4A 2L50A 1KK8C 1RECA 1CM4A 1TIZA 1XFXO 2BE4A 4I5JA 1LINA 4GGFA 1DT7B 2JNFA 2JTTA 1PSRA 2JT8A 3QRXA 1B7TY 1KFXL 5CSNA 1F4OA 1CNPA 2KBMA 1YURA 1KK7Z 1LKJA 2MRDA 5AXIA 2MHHA 4GGNA 1KCYA 3EK8A 1S3PA 1EG4A 2PASA 4I5NB 1CDMA 1SPYA 2ZN9A 4OR9B 1JBAA 4AQJA 1LVCD 2F33A 2LVIA 2MAZA 3GK4X 1YTZC 1KK8B 3EVUA 3K21A 1L7ZA 2JC2A 4UPGA 1DJXA 3VGOA 2KFHA 1NYAA 3GK2A 3FWBA 2JWWA 4GUKA 1F54A 5D69A 5AERA 5IBWA 1AJ5A 2MJWB 4N1FA 2K7DA 3CZTX 3VRNA 1K96A 4FTGA 1JC2A 2M3WA 3WHUB 2EGDA 2OTGC 2JU0A 1JFKA 3JTDB 3PM8A 2H2KA 2JRFA 1B47A 3D0YB 3WXAA 2LHIA 1YUSA 2KAXA 1IJ5A 1CKKA 3DVEA 1QIWA 1YVHA 2KAVA 2A4JA 2P6BB 4ORAB 2B1UA 4PHMA 1DMOA 1JUOA 1JF0A 2ZN8A 2BECA 3A4UB 3TDUA 1XFZO 2MA2A 1BU3A 1K9UA 1UHKA 1XFUO 3HCMA 1SKTA 1IWQA 1WDCC 4DRWA 2OTGB 5GQQC 4N5XA 2FJUB 2PSRA 3O78A 1BR1B 4DS7A 2ZNEA 1S6CA 2WCBA 1MWNA 1D1OA 4XJKA 2ISDA 2LMTA 1DTLA 5HKYA 1XFYO 1RK9A 2MLEC 4MLWA 2FOTA 1BMOA 2BL0C 1B8CA 2GGMA 1F71A 1PALA 3VRRA 3BUMB 1DF0A 2KI6C 3DF0A 1A75A 1AUIB 2KI6D 2K7CA 1ZUZA 1BOCA 2JT0A 2FCDA 4OVNF 2KQYA 3OP0A 2O5GA 1XO5A 1K9PA 3O2PA 1NP8A 1PULA 1IKUA 1CDPA 2KSPA 2CTNA 2LP3A 3HX4A 3EVVA 4OKHA 4I5KA 1PK0D 3DD4A 1ZMZA 1YX7A 4YI9A 3D10A 2BL0B 3EVRA 1C7VA 2AAOA 2QACA 2EC6B 2Y1NA 1MQ1A 1OMDA 1AHRA 3ZNIA 1J1DA 5DKNA 1G33A 1SY9A 1CFPA 1B4CA 2LP2A 3KEVA 5DKRA 1M63B 3PFVA 2BBNA 1DJWA 4AQIA 1PVBA 2PALA 1XYDA 2KYCA 3IQQA 2LLSA 1SCVA 1NX2A 5CSIA 1NPQA 1KFUL 2NCOA 1EH2A 1QV0A 1ALWA 1KSOA 1M39A 2WCFA 3AAJA 1WLZA 2MLFC 2G9BA 4PHKA 2LANA 3KHEA 1A03A 4MZKA 3O6BA 2F2OA 1SR6B 3I5IB 1XK4C 2L5XB 1RROA 3DF0B 2LLUA 3LL8B 3BOWB 2BCBA 2HQWA 4IL1A 3CR4X 1XFVO 4L9MA 5I8NA 1IQ3A 1NX1A 2I7AA 4PDZA 1ODBA 3CLNA 2QPTA 1EL4A 1PSBA 1A2XA 1K95A 1M45A 4JPZB 3TDIA 1A29A 1BLQA 1NX0A 1ALVA 2NLNA 1J1EA 1TNXA 3TS5C 5HYDA 1UURA 1NCYA 1RTP1 4PE0A 3D0YA 2L51A 3TUYC 2JPTA 4JQ0D 4GNKB 2CBLA 1WY9A 1YVLA 4MSPA 5AANA 1QVIZ 1YRUB 4ORCB 5HKWA 1GGWA 3KO0A 1DJGA 3BXKA 3MSEB 1CTRA 4P5OE 5I2QA 1Y6WA 3TS5B 4C0JA 1NUBA 1FF1A 3RLZA 1OQPA 1B8LA 5HLVA 1UHNA 3TUYB 2K0JA 4GPLB 1S6JA 1DJIA 2LVVA 1DJYA 1EXRA 4YBHB 1H8BA 4C0LA 2K2FA 1QX2A 2L2EA 1KSMA 4HSZA 3H4SE 1BJFA 1FW4A 4HREE 2M29A 1K2HA 2JZIA 2PRUA 1Y0VH 1SL7A 4MBEA 4WQ2A 1F8HA 1J55A 3KPXA 2GV5A 5FYXA 4CLNA 4M2QA 1B7TZ 1DVIA 2LNKA 5G08A 1BF5A 1C7WA 3I5GC 4BY4A 3SG4A 2ZNDA 1IH0A 3CR2A 5KU1A 4PE1A 5CPVA 5ER5A 3SG3A 1NIWA 3KF9A 3EK7A 1QV1A 1MF8B 4PCWA 2LMUA 2OPOA 2ZFDA 2M0RA 3AKBA 2KHNA 2F8PA 4YGCB 2E6WA 4MN0A 1K9KA 3PSRA 1E8AA 3DVKA 2M97A 1GGZA 2L4HA 2Q91A 2Y1MA 3NSKA 3OB2B 1EG3A 1TNPA 3FWCA 4YGDB 2Y4QA 2K7OA 1J7PA 1EJ3A 2IS9A 4D1EA 1QIVA 4MVFA 2ZRTA 4PALA 1NCXA 1CMFA 4M2OA 1QLSA 4NDBA 1OE9B 4BY5A 1Y1UA 2LMVA 3NSIA 4DCKA 3SIBA 1CLMA 3VRQA 2CCMA 3GK1A 1XVJA 1CFFA 3OHMB 1KQVA 2Y5IA 4MZJA 1CLLA 3BYAA 4CFRA 1BT6A 3BOWA 4QJ4B 1B8RA 2NCPA 1XFWO 1WDCB 3PALA 2OS8C 2H61C 3ZWHA 1CM1A 2K2AA 3FIAA 1BR4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SCM C;  3OX6 A;  3JVT C;  3LK1 A;  1ZFS A;  5J3X A;  2GGZ A;  2JT3 A;  5HLO A;  1OZS A;  2CXJ A;  1BG1 A;  2LE9 B;  3AKA A;  1KWO C;  4OV2 A;  1YR5 A;  1C07 A;  5D7F A;  5I2O A;  5K89 A;  1OSA A;  1HQV A;  1XK4 A;  4WRI A;  1TCO B;  4NQG A;  4U8D A;  3F45 A;  2AUC A;  3PN7 C;  1MXL C;  3BUX B;  1J7O A;  1TOP A;  1SCM B;  3JVT B;  1XA5 A;  2RGI A;  1ZAC A;  1UHI A;  5CSF A;  3GOF A;  5DKQ A;  1KWO B;  2HF5 A;  2HQ8 A;  2I94 A;  4YGE B;  1NSH A;  2LUC A;  4DUQ A;  1R2U A;  4OCI A;  1N2D A;  3LLE A;  3WNX B;  1A4P A;  2L0P A;  2HPS A;  1SL9 A;  3EK4 A;  2MBX A;  3CGA A;  4CPV A;  5JJG A;  1CMG A;  2M8U A;  2JUL A;  3PN7 B;  4PHN A;  1MR8 A;  2JXL A;  2LCP A;  2VRG A;  2M1K B;  1S6I A;  2CNP A;  1S5G Y;  2F3Z A;  2JNX A;  2KI4 C;  1B1G A;  1OMR A;  3EKJ A;  4ETO A;  1M46 A;  1F4Q A;  1IJ6 A;  2WC8 A;  4PE7 A;  5HKZ A;  2BE6 A;  1K8U A;  1UHH A;  2BKI B;  1LA0 A;  2HET A;  3WHT B;  4M2P A;  4CFQ A;  1BOD A;  1S1E A;  3LK0 A;  2L4I A;  3SG5 A;  4MRX A;  1TNW A;  1RJV A;  1V1F A;  3EKH A;  1QTX A;  3IQO A;  3OB1 B;  4MRY A;  1YX8 A;  1Q80 A;  2COL B;  2WCE A;  2LAP A;  3TDZ A;  2EHB A;  2KFG A;  2KI4 B;  4NDC A;  2KOT A;  1FPW A;  2SAS A;  4NDD A;  4ORB B;  1KFX S;  1L2O C;  1SNL A;  1IRJ A;  3LCP C;  4A4B A;  4TNC A;  5CSJ A;  5ER4 X;  5KTY A;  2BCA A;  1S5G Z;  1WRL A;  2I2R E;  3BUW B;  4PE4 A;  1QAS A;  1AK8 A;  2NZ0 A;  1M31 A;  3CTN A;  1H4B A;  3A8R A;  2SCP A;  1PVA A;  1QX5 B;  5KSZ A;  4F0Z B;  1Y1A A;  2DOQ A;  1FI5 A;  1GJY A;  4GAO A;  1PRW A;  3NSO A;  1SW8 A;  3PAT A;  1SYM A;  3TZ1 A;  3CWG A;  4ICB A;  3NSL A;  1DJH A;  3SG6 A;  3IF7 A;  1K90 D;  5F6T A;  1TN4 A;  1NX3 A;  2KNE A;  2WOS A;  1W7I B;  3BUN B;  3SG7 A;  4YRU A;  1CLB A;  1LA3 A;  1VRK A;  2LUX A;  2JTZ A;  1L2O B;  3JTD C;  1QS7 A;  3FS7 A;  2KDH A;  3O4Y A;  5PAL A;  2LLT A;  2KFF A;  1N0Y A;  2E30 A;  4YI8 A;  1R6P A;  1U5I B;  4GGF C;  1QX7 A;  2LV7 A;  3M0W A;  1QJT A;  2LHL A;  1CDN A;  2F3Y A;  4MEW A;  4Q04 A;  1KQM C;  2JOJ A;  1QXP A;  2ZKM X;  3RM1 A;  1SL8 A;  2H61 A;  1Y1X A;  1UWO A;  3I5G B;  4A4C A;  2K7B A;  2K61 A;  1F55 A;  2M1U A;  1RFJ A;  1UHJ A;  1IG5 A;  1J7Q A;  1OMV A;  1YUT A;  2KQ6 A;  4AOM A;  3DVM A;  2M49 B;  3SIA A;  2KBI A;  1CFC A;  5I2L A;  3PLF B;  4WQ3 A;  4YGA A;  1OOJ A;  3BUO B;  4I5L B;  1FBV A;  1N65 A;  1S36 A;  3CS1 A;  5B8I B;  5JOL A;  4DIR A;  2KYF A;  2KGB C;  4PHJ A;  1NCZ A;  1SMG A;  1KQM B;  2BKH B;  1OZO A;  4JWQ A;  1ZOT B;  1TTX A;  5AFP A;  3VRP A;  2BCX A;  2LM5 A;  4R1E A;  2F2P A;  1DGV A;  2WND A;  1RWY A;  2KAY A;  1WRZ A;  1JF2 A;  1GQM A;  4HRH A;  4ZCU A;  3C1V A;  1CB1 A;  4CID A;  2LC5 A;  2K8M B;  1MHO A;  1AVS A;  5TNC A;  4USL A;  2EC6 C;  1V1G A;  5BPJ A;  1CDL A;  1DGU A;  2ZRS A;  2Q4U A;  1B9A A;  1SRA A;  1JFJ A;  2OS8 B;  1FI6 A;  1QAT A;  1NWD A;  1DJZ A;  3NXA A;  2LVK A;  2BBM A;  3SJS A;  4FQO A;  1F70 A;  1SBJ A;  4N1G A;  2KGR A;  1UP5 A;  4GFT A;  1K94 A;  4MZL A;  1S26 D;  1SK6 D;  1YUU A;  4HRG A;  3AAK A;  4GBA A;  1CFD A;  2PMY A;  1KFU S;  1IQ5 A;  2I18 A;  2LVJ A;  1SR6 C;  3I5I C;  1G8I A;  1WLM A;  5AEQ A;  3I5H C;  1TCF A;  1IGV A;  2AMI A;  1YRT B;  3VRO A;  2PVB A;  1K93 D;  2CT9 A;  3BQ3 A;  3SG2 A;  1X02 A;  1J7R A;  4XJK B;  3I5F C;  2D8N A;  2M7L A;  2NXQ A;  4ZCV A;  1TNQ A;  2JXC A;  4P2Y B;  1G4Y R;  1QVI Y;  2FCE A;  2L98 A;  1UUS A;  3E3R A;  4E68 A;  1WRK A;  4QJ5 B;  1U5I A;  1HT9 A;  2M7N A;  1DF0 B;  1KK7 Y;  1A75 B;  2TN4 A;  2V53 A;  3I5H B;  3OX5 A;  1MUX A;  1QLK A;  1LXF C;  1JWD A;  1MXE A;  4C0K A;  3CR5 X;  3ICB A;  1TRF A;  2O60 A;  2JQ6 A;  2M9G A;  1W7J B;  3I5F B;  4YGB B;  4QJ3 B;  2WOR A;  1AJ4 A;  4XYN A;  1JSA A;  2G2B A;  2R2I A;  3DVJ A;  1AP4 A;  2L50 A;  1KK8 C;  1REC A;  1CM4 A;  1TIZ A;  1XFX O;  2BE4 A;  4I5J A;  1LIN A;  4GGF A;  1DT7 B;  2JNF A;  2JTT A;  1PSR A;  2JT8 A;  3QRX A;  1B7T Y;  1KFX L;  5CSN A;  1F4O A;  1CNP A;  2KBM A;  1YUR A;  1KK7 Z;  1LKJ A;  2MRD A;  5AXI A;  2MHH A;  4GGN A;  1KCY A;  3EK8 A;  1S3P A;  1EG4 A;  2PAS A;  4I5N B;  1CDM A;  1SPY A;  2ZN9 A;  4OR9 B;  1JBA A;  4AQJ A;  1LVC D;  2F33 A;  2LVI A;  2MAZ A;  3GK4 X;  1YTZ C;  1KK8 B;  3EVU A;  3K21 A;  1L7Z A;  2JC2 A;  4UPG A;  1DJX A;  3VGO A;  2KFH A;  1NYA A;  3GK2 A;  3FWB A;  2JWW A;  4GUK A;  1F54 A;  5D69 A;  5AER A;  5IBW A;  1AJ5 A;  2MJW B;  4N1F A;  2K7D A;  3CZT X;  3VRN A;  1K96 A;  4FTG A;  1JC2 A;  2M3W A;  3WHU B;  2EGD A;  2OTG C;  2JU0 A;  1JFK A;  3JTD B;  3PM8 A;  2H2K A;  2JRF A;  1B47 A;  3D0Y B;  3WXA A;  2LHI A;  1YUS A;  2KAX A;  1IJ5 A;  1CKK A;  3DVE A;  1QIW A;  1YVH A;  2KAV A;  2A4J A;  2P6B B;  4ORA B;  2B1U A;  4PHM A;  1DMO A;  1JUO A;  1JF0 A;  2ZN8 A;  2BEC A;  3A4U B;  3TDU A;  1XFZ O;  2MA2 A;  1BU3 A;  1K9U A;  1UHK A;  1XFU O;  3HCM A;  1SKT A;  1IWQ A;  1WDC C;  4DRW A;  2OTG B;  5GQQ C;  4N5X A;  2FJU B;  2PSR A;  3O78 A;  1BR1 B;  4DS7 A;  2ZNE A;  1S6C A;  2WCB A;  1MWN A;  1D1O A;  4XJK A;  2ISD A;  2LMT A;  1DTL A;  5HKY A;  1XFY O;  1RK9 A;  2MLE C;  4MLW A;  2FOT A;  1BMO A;  2BL0 C;  1B8C A;  2GGM A;  1F71 A;  1PAL A;  3VRR A;  3BUM B;  1DF0 A;  2KI6 C;  3DF0 A;  1A75 A;  1AUI B;  2KI6 D;  2K7C A;  1ZUZ A;  1BOC A;  2JT0 A;  2FCD A;  4OVN F;  2KQY A;  3OP0 A;  2O5G A;  1XO5 A;  1K9P A;  3O2P A;  1NP8 A;  1PUL A;  1IKU A;  1CDP A;  2KSP A;  2CTN A;  2LP3 A;  3HX4 A;  3EVV A;  4OKH A;  4I5K A;  1PK0 D;  3DD4 A;  1ZMZ A;  1YX7 A;  4YI9 A;  3D10 A;  2BL0 B;  3EVR A;  1C7V A;  2AAO A;  2QAC A;  2EC6 B;  2Y1N A;  1MQ1 A;  1OMD A;  1AHR A;  3ZNI A;  1J1D A;  5DKN A;  1G33 A;  1SY9 A;  1CFP A;  1B4C A;  2LP2 A;  3KEV A;  5DKR A;  1M63 B;  3PFV A;  2BBN A;  1DJW A;  4AQI A;  1PVB A;  2PAL A;  1XYD A;  2KYC A;  3IQQ A;  2LLS A;  1SCV A;  1NX2 A;  5CSI A;  1NPQ A;  1KFU L;  2NCO A;  1EH2 A;  1QV0 A;  1ALW A;  1KSO A;  1M39 A;  2WCF A;  3AAJ A;  1WLZ A;  2MLF C;  2G9B A;  4PHK A;  2LAN A;  3KHE A;  1A03 A;  4MZK A;  3O6B A;  2F2O A;  1SR6 B;  3I5I B;  1XK4 C;  2L5X B;  1RRO A;  3DF0 B;  2LLU A;  3LL8 B;  3BOW B;  2BCB A;  2HQW A;  4IL1 A;  3CR4 X;  1XFV O;  4L9M A;  5I8N A;  1IQ3 A;  1NX1 A;  2I7A A;  4PDZ A;  1ODB A;  3CLN A;  2QPT A;  1EL4 A;  1PSB A;  1A2X A;  1K95 A;  1M45 A;  4JPZ B;  3TDI A;  1A29 A;  1BLQ A;  1NX0 A;  1ALV A;  2NLN A;  1J1E A;  1TNX A;  3TS5 C;  5HYD A;  1UUR A;  1NCY A;  1RTP 1;  4PE0 A;  3D0Y A;  2L51 A;  3TUY C;  2JPT A;  4JQ0 D;  4GNK B;  2CBL A;  1WY9 A;  1YVL A;  4MSP A;  5AAN A;  1QVI Z;  1YRU B;  4ORC B;  5HKW A;  1GGW A;  3KO0 A;  1DJG A;  3BXK A;  3MSE B;  1CTR A;  4P5O E;  5I2Q A;  1Y6W A;  3TS5 B;  4C0J A;  1NUB A;  1FF1 A;  3RLZ A;  1OQP A;  1B8L A;  5HLV A;  1UHN A;  3TUY B;  2K0J A;  4GPL B;  1S6J A;  1DJI A;  2LVV A;  1DJY A;  1EXR A;  4YBH B;  1H8B A;  4C0L A;  2K2F A;  1QX2 A;  2L2E A;  1KSM A;  4HSZ A;  3H4S E;  1BJF A;  1FW4 A;  4HRE E;  2M29 A;  1K2H A;  2JZI A;  2PRU A;  1Y0V H;  1SL7 A;  4MBE A;  4WQ2 A;  1F8H A;  1J55 A;  3KPX A;  2GV5 A;  5FYX A;  4CLN A;  4M2Q A;  1B7T Z;  1DVI A;  2LNK A;  5G08 A;  1BF5 A;  1C7W A;  3I5G C;  4BY4 A;  3SG4 A;  2ZND A;  1IH0 A;  3CR2 A;  5KU1 A;  4PE1 A;  5CPV A;  5ER5 A;  3SG3 A;  1NIW A;  3KF9 A;  3EK7 A;  1QV1 A;  1MF8 B;  4PCW A;  2LMU A;  2OPO A;  2ZFD A;  2M0R A;  3AKB A;  2KHN A;  2F8P A;  4YGC B;  2E6W A;  4MN0 A;  1K9K A;  3PSR A;  1E8A A;  3DVK A;  2M97 A;  1GGZ A;  2L4H A;  2Q91 A;  2Y1M A;  3NSK A;  3OB2 B;  1EG3 A;  1TNP A;  3FWC A;  4YGD B;  2Y4Q A;  2K7O A;  1J7P A;  1EJ3 A;  2IS9 A;  4D1E A;  1QIV A;  4MVF A;  2ZRT A;  4PAL A;  1NCX A;  1CMF A;  4M2O A;  1QLS A;  4NDB A;  1OE9 B;  4BY5 A;  1Y1U A;  2LMV A;  3NSI A;  4DCK A;  3SIB A;  1CLM A;  3VRQ A;  2CCM A;  3GK1 A;  1XVJ A;  1CFF A;  3OHM B;  1KQV A;  2Y5I A;  4MZJ A;  1CLL A;  3BYA A;  4CFR A;  1BT6 A;  3BOW A;  4QJ4 B;  1B8R A;  2NCP A;  1XFW O;  1WDC B;  3PAL A;  2OS8 C;  2H61 C;  3ZWH A;  1CM1 A;  2K2A A;  3FIA A;  1BR4 B; 
#chains in the Genus database with same CATH topology
 1SCM C;  3OX6 A;  3JVT C;  3LK1 A;  1ZFS A;  5J3X A;  2GGZ A;  2JT3 A;  5HLO A;  1OZS A;  2CXJ A;  1BG1 A;  2WCK A;  2LE9 B;  3AKA A;  1KWO C;  4OV2 A;  1YR5 A;  1C07 A;  2KPH A;  5D7F A;  5I2O A;  3DZT A;  5K89 A;  1OSA A;  1HQV A;  1XK4 A;  4WRI A;  2K60 A;  1TCO B;  4OZD A;  3S0D A;  4NQG A;  4U8D A;  3F45 A;  2AUC A;  3PN7 C;  1MXL C;  3SS3 A;  3BUX B;  1J7O A;  1TOP A;  1SCM B;  2WCJ A;  3JVT B;  1XA5 A;  2RGI A;  5EL2 A;  1ZAC A;  1UHI A;  5CSF A;  3GOF A;  5DKQ A;  1KWO B;  2HF5 A;  2HQ8 A;  2I94 A;  1DC1 A;  4YGE B;  1NSH A;  2LUC A;  4DUQ A;  1R2U A;  4OCI A;  1N2D A;  3LLE A;  3WNX B;  1A4P A;  2L0P A;  2HPS A;  1SL9 A;  3EK4 A;  2MBX A;  3CGA A;  4CPV A;  5JJG A;  1CMG A;  2M8U A;  2JUL A;  3PN7 B;  4PHN A;  1DQE A;  1MR8 A;  2JXL A;  2LCP A;  2VRG A;  1Z4H A;  2M1K B;  1S6I A;  2CNP A;  1S5G Y;  2F3Z A;  2JNX A;  2KI4 C;  1B1G A;  1OMR A;  3EKJ A;  4ETO A;  1M46 A;  1F4Q A;  1IJ6 A;  2WC8 A;  4PE7 A;  5HKZ A;  2BE6 A;  1K8U A;  1UHH A;  2BKI B;  1LA0 A;  2HET A;  3WHT B;  4M2P A;  4CFQ A;  3EG5 B;  2YGU A;  1BOD A;  1S1E A;  3LK0 A;  2L4I A;  3SG5 A;  3S0F A;  4MRX A;  1TNW A;  1RJV A;  1V1F A;  3EKH A;  1QTX A;  3IQO A;  3OB1 B;  4MRY A;  1YX8 A;  1Q80 A;  2COL B;  2WCE A;  2LAP A;  3TDZ A;  5D3O A;  2EHB A;  2KFG A;  2KI4 B;  5I94 A;  4NDC A;  2KOT A;  1FPW A;  2SAS A;  4NDD A;  4ORB B;  1KFX S;  3CZ0 A;  1L2O C;  1SNL A;  1IRJ A;  3LCP C;  4A4B A;  4TNC A;  5CSJ A;  5ER4 X;  5KTY A;  2BCA A;  1S5G Z;  1WRL A;  1SSE B;  2I2R E;  3BUW B;  4PE4 A;  1QAS A;  1AK8 A;  2NZ0 A;  1M31 A;  3CTN A;  1H4B A;  3A8R A;  2SCP A;  1PVA A;  1QX5 B;  5KSZ A;  4F0Z B;  1Y1A A;  2DOQ A;  1FI5 A;  3IVT A;  2QEO A;  3DXL A;  1GJY A;  4GAO A;  1PRW A;  3NSO A;  1SW8 A;  3PAT A;  1SYM A;  3TZ1 A;  3CWG A;  4ICB A;  3NSL A;  1DJH A;  3SG6 A;  3IF7 A;  1K90 D;  5F6T A;  1TN4 A;  1NX3 A;  2KNE A;  1XFR A;  1W7I B;  2P70 A;  2WOS A;  3BUN B;  3SG7 A;  4YRU A;  1LA3 A;  1VRK A;  2LUX A;  1CLB A;  2JTZ A;  1L2O B;  3JTD C;  2JPO A;  1QS7 A;  3FS7 A;  2KDH A;  3O4Y A;  5PAL A;  2LLT A;  2KFF A;  1N0Y A;  2E30 A;  4YI8 A;  1R6P A;  1U5I B;  3S0B A;  4GGF C;  1QX7 A;  3PM2 A;  2LV7 A;  3S0A A;  3M0W A;  1QJT A;  2LHL A;  1CDN A;  5FI6 A;  2F3Y A;  2QEV A;  4MEW A;  4Q04 A;  1DEK A;  1KQM C;  2JOJ A;  1QXP A;  2ZKM X;  3RM1 A;  1SL8 A;  2H61 A;  1Y1X A;  1UWO A;  3I5G B;  4A4C A;  2K7B A;  2K61 A;  1F55 A;  2M1U A;  1RFJ A;  1UHJ A;  1IG5 A;  3NHT A;  1J7Q A;  1OMV A;  1YUT A;  2BAP A;  2KQ6 A;  4AOM A;  3DVM A;  2M49 B;  3SIA A;  2KBI A;  1CFC A;  5I2L A;  3PLF B;  4WQ3 A;  4YGA A;  1OOJ A;  3BUO B;  4I5L B;  1FBV A;  1N65 A;  1S36 A;  3CS1 A;  5B8I B;  5JOL A;  4DIR A;  2KYF A;  2KGB C;  4PHJ A;  1NCZ A;  1SMG A;  1KQM B;  4KYN A;  2WC5 A;  2BKH B;  1OZO A;  2KLD A;  1ZOT B;  1TTX A;  4JWQ A;  5AFP A;  3VRP A;  1C3Y A;  2BCX A;  2LM5 A;  4R1E A;  2F2P A;  1DGV A;  2WND A;  1RWY A;  2KAY A;  1WRZ A;  1JF2 A;  1GQM A;  4HRH A;  4ZCU A;  3C1V A;  1CB1 A;  4CID A;  2LC5 A;  2K8M B;  1MHO A;  1AVS A;  5TNC A;  4USL A;  2EC6 C;  1V1G A;  3CAB A;  5BPJ A;  1CDL A;  1DGU A;  2ZRS A;  1TUZ A;  1B9A A;  1SRA A;  2Q4U A;  1JFJ A;  2OS8 B;  3O4X A;  1FI6 A;  1QAT A;  3SS5 A;  1NWD A;  1DJZ A;  3CZ1 A;  3NXA A;  4INW A;  2LVK A;  2BBM A;  4F7F A;  3SJS A;  4FQO A;  1F70 A;  1SBJ A;  4N1G A;  2KGR A;  1UP5 A;  4GFT A;  2ERB A;  1K94 A;  4MZL A;  3NGV A;  1S26 D;  1SK6 D;  1YUU A;  3CZ2 A;  4HRG A;  3AAK A;  4GBA A;  1CFD A;  2PMY A;  3RZS A;  1KFU S;  1IQ5 A;  2I18 A;  2LVJ A;  1SR6 C;  3I5I C;  1G8I A;  1WLM A;  5AEQ A;  3BFH A;  3I5H C;  3FE6 A;  3K1E A;  1TCF A;  1IGV A;  2AMI A;  1YRT B;  3VRO A;  2PVB A;  1K93 D;  2CT9 A;  3BQ3 A;  3B7A A;  3SG2 A;  1X02 A;  3B87 A;  1J7R A;  1P28 A;  4XJK B;  3I5F C;  2D8N A;  2M7L A;  5DIC A;  3CYZ A;  2NXQ A;  4ZCV A;  1TNQ A;  2JXC A;  4P2Y B;  1G4Y R;  1QVI Y;  2FCE A;  2L98 A;  1UUS A;  3E3R A;  4E68 A;  1WRK A;  4QJ5 B;  4FQT A;  1U5I A;  1HT9 A;  2M7N A;  2FJY A;  1DF0 B;  1KK7 Y;  1A75 B;  2TN4 A;  2V53 A;  3I5H B;  2L5Y A;  3OX5 A;  1MUX A;  1QLK A;  1LXF C;  1JWD A;  1MXE A;  4C0K A;  3CR5 X;  3ICB A;  1TRF A;  2O60 A;  2JQ6 A;  3FE9 A;  2M9G A;  1W7J B;  3I5F B;  4YGB B;  2QEH A;  4QJ3 B;  2WOR A;  1AJ4 A;  4XYN A;  1JSA A;  2G2B A;  2WCL A;  2R2I A;  3D78 A;  3DVJ A;  1AP4 A;  2L50 A;  1KK8 C;  1REC A;  1CM4 A;  1TIZ A;  1OW4 A;  1XFX O;  2BE4 A;  4I5J A;  1LIN A;  1LS8 A;  4GGF A;  1DT7 B;  2JNF A;  2JTT A;  1PSR A;  2JT8 A;  3QRX A;  1B7T Y;  3S0E A;  1KFX L;  5CSN A;  1F4O A;  1CNP A;  2KBM A;  1YUR A;  2QDI A;  1KK7 Z;  1LKJ A;  2MRD A;  5AXI A;  2MHH A;  4GGN A;  1KCY A;  3EK8 A;  2WC6 A;  1S3P A;  1EG4 A;  2PAS A;  4I5N B;  1CDM A;  1SPY A;  2ZN9 A;  4OR9 B;  1JBA A;  4AQJ A;  1LVC D;  1W9Z A;  2F33 A;  2LVI A;  2MAZ A;  3GK4 X;  1YTZ C;  1KK8 B;  3EVU A;  3K21 A;  1DEL A;  1L7Z A;  2JC2 A;  2PQL A;  1DJX A;  4UPG A;  3VGO A;  2KFH A;  1NYA A;  3GK2 A;  3FWB A;  3UNW A;  2JWW A;  4GUK A;  1F54 A;  3B86 A;  5D69 A;  5AER A;  5FI2 A;  1AJ5 A;  2KLE A;  5IBW A;  2MJW B;  4N1F A;  2K7D A;  3CZT X;  3VRN A;  1K96 A;  4FTG A;  1JC2 A;  2BNX A;  2M3W A;  3WHU B;  2EGD A;  2OTG C;  3VB1 A;  3R1O A;  4PT1 A;  2JU0 A;  1JFK A;  3JTD B;  3PM8 A;  2H2K A;  2JRF A;  1B47 A;  3R1V A;  3D0Y B;  3WXA A;  2LHI A;  1YUS A;  2P71 A;  2KAX A;  1IJ5 A;  1CKK A;  3DVE A;  1QIW A;  1YVH A;  2KAV A;  2A4J A;  2P6B B;  4ORA B;  2B1U A;  4PHM A;  1DMO A;  1JUO A;  1JF0 A;  2ZN8 A;  2BEC A;  3A4U B;  3TDU A;  1XFZ O;  2MA2 A;  1BU3 A;  1K9U A;  1UHK A;  1XFU O;  3HCM A;  1SKT A;  1IWQ A;  1WDC C;  4DRW A;  2OTG B;  5GQQ C;  4N5X A;  2FJU B;  2PSR A;  3O78 A;  1BR1 B;  4DS7 A;  2ZNE A;  1S6C A;  3B6X A;  2WCB A;  1MWN A;  1D1O A;  4XJK A;  1ORG A;  5FI7 A;  2ISD A;  2LMT A;  1DTL A;  5HKY A;  3N7H A;  1XFY O;  4IJ7 A;  1RK9 A;  2MLE C;  3Q8I A;  4MLW A;  2FOT A;  1BMO A;  2BL0 C;  1B8C A;  2GGM A;  1F71 A;  1PAL A;  3VRR A;  3D77 A;  3BUM B;  1DF0 A;  2KI6 C;  3D73 A;  1A75 A;  1AUI B;  3DF0 A;  2KI6 D;  2K7C A;  3BFA A;  1ZUZ A;  1BOC A;  2JT0 A;  2FCD A;  1OOG A;  4OVN F;  2KQY A;  3OP0 A;  2O5G A;  1XO5 A;  1K9P A;  3O2P A;  1NP8 A;  1PUL A;  1IKU A;  1CDP A;  2KSP A;  2CTN A;  2LP3 A;  3HX4 A;  3EVV A;  4OKH A;  4I5K A;  1PK0 D;  3DD4 A;  1ZMZ A;  1YX7 A;  4YI9 A;  3D10 A;  2BL0 B;  3EVR A;  1C7V A;  2AAO A;  3R72 A;  2QAC A;  2EC6 B;  2Y1N A;  1MQ1 A;  1OMD A;  1AHR A;  3D75 A;  3ZNI A;  1J1D A;  3D76 A;  5DKN A;  1G33 A;  3CDN A;  1SY9 A;  1CFP A;  1B4C A;  2LP2 A;  3KEV A;  3UO9 A;  5DKR A;  1M63 B;  3PFV A;  2BBN A;  1DJW A;  4AQI A;  1PVB A;  2PAL A;  1XYD A;  2KYC A;  3IQQ A;  2LLS A;  1SCV A;  1NX2 A;  5CSI A;  1NPQ A;  1KFU L;  2NCO A;  3NHI A;  1EH2 A;  1QWV A;  1QV0 A;  1ALW A;  1KSO A;  1M39 A;  2QEB A;  2WCF A;  2L2C A;  1OOF A;  3AAJ A;  1WLZ A;  2MLF C;  2G9B A;  4PHK A;  2LAN A;  3KHE A;  1A03 A;  4MZK A;  3O6B A;  2F2O A;  1SR6 B;  3I5I B;  1XK4 C;  2L5X B;  1RRO A;  3DF0 B;  3QME A;  2LLU A;  3LL8 B;  3BOW B;  2BCB A;  2HQW A;  4IL1 A;  3CR4 X;  1XFV O;  4L9M A;  5I8N A;  1IQ3 A;  1NX1 A;  2I7A A;  4PDZ A;  1ODB A;  3CLN A;  2QPT A;  1EL4 A;  1PSB A;  1A2X A;  1K95 A;  1M45 A;  3PJI A;  4JPZ B;  3TDI A;  1A29 A;  1BLQ A;  1NX0 A;  4JKT A;  1ALV A;  2NLN A;  1J1E A;  1TNX A;  3TS5 C;  5HYD A;  1UUR A;  1OOH A;  1NCY A;  1RTP 1;  3DY9 A;  4PE0 A;  3D0Y A;  2L51 A;  3SS4 A;  3TUY C;  2JPT A;  1OOI X;  4JQ0 D;  4GNK B;  2CBL A;  1WY9 A;  1YVL A;  4MSP A;  5AAN A;  3L4L A;  1QVI Z;  1YRU B;  4ORC B;  3BFB A;  5HKW A;  1GGW A;  3KO0 A;  1DJG A;  3BXK A;  3MSE B;  3B88 A;  1CTR A;  4P5O E;  3L47 A;  5I2Q A;  3D74 A;  4JD9 A;  2WCH A;  1Y6W A;  3TS5 B;  4C0J A;  1NUB A;  1FF1 A;  3RLZ A;  1OQP A;  1B8L A;  5HLV A;  1UHN A;  3V2L A;  3TUY B;  2K0J A;  4GPL B;  1S6J A;  1DJI A;  2LVV A;  5HL1 A;  1DJY A;  1EXR A;  2PYQ A;  4YBH B;  1TWO A;  1H8B A;  4C0L A;  2K2F A;  1QX2 A;  2L2E A;  1KSM A;  4HSZ A;  3H4S E;  1BJF A;  1FW4 A;  2H8V A;  4HRE E;  1C3Z A;  2M29 A;  1K2H A;  2JZI A;  2PRU A;  1Y0V H;  1SL7 A;  4MBE A;  4WQ2 A;  1F8H A;  1J55 A;  3KPX A;  2GV5 A;  5FYX A;  4CLN A;  4M2Q A;  1B7T Z;  1DVI A;  2LNK A;  3BJH A;  5G08 A;  1BF5 A;  1C7W A;  3I5G C;  4BY4 A;  3SG4 A;  2ZND A;  1IH0 A;  3CR2 A;  5KU1 A;  4PE1 A;  5CPV A;  5ER5 A;  3OGN A;  1NIW A;  1T14 A;  3KF9 A;  3DYE A;  3SG3 A;  1GM0 A;  3EK7 A;  1QV1 A;  1MF8 B;  4PCW A;  2LMU A;  2OPO A;  2ZFD A;  2M0R A;  3AKB A;  2KHN A;  2F8P A;  4YGC B;  2E6W A;  4MN0 A;  1K9K A;  3PSR A;  1E8A A;  3DVK A;  2M97 A;  3R1P A;  1GGZ A;  2L4H A;  2Q91 A;  2Y1M A;  3NSK A;  3OB2 B;  1EG3 A;  1TNP A;  3FWC A;  4YGD B;  2Y4Q A;  2K7O A;  3FE8 A;  1J7P A;  1EJ3 A;  2IS9 A;  3OBV A;  4D1E A;  1QIV A;  4MVF A;  2ZRT A;  4PAL A;  1NCX A;  1TUJ A;  2WCM A;  1CMF A;  4M2O A;  1QLS A;  4NDB A;  1OE9 B;  4BY5 A;  1Y1U A;  2LMV A;  3NSI A;  4INX A;  1Z2C B;  4DCK A;  3SIB A;  2GTE A;  1CLM A;  3VRQ A;  2CCM A;  3GK1 A;  1XVJ A;  1CFF A;  3OHM B;  1KQV A;  2Y5I A;  4MZJ A;  1CLL A;  3BYA A;  1IIO A;  4CFR A;  1BT6 A;  3BOW A;  4QJ4 B;  1B8R A;  2NCP A;  1XFW O;  1WDC B;  3S0G A;  3PAL A;  2OS8 C;  2H61 C;  3ZWH A;  3L4A A;  1CM1 A;  2K2A A;  3FIA A;  1BR4 B; 
#chains in the Genus database with same CATH homology
 1SCM C;  3OX6 A;  3JVT C;  3LK1 A;  1ZFS A;  5J3X A;  2GGZ A;  2JT3 A;  5HLO A;  1OZS A;  2CXJ A;  1BG1 A;  2LE9 B;  3AKA A;  1KWO C;  4OV2 A;  1YR5 A;  1C07 A;  5D7F A;  5I2O A;  5K89 A;  1OSA A;  1HQV A;  1XK4 A;  4WRI A;  1TCO B;  4NQG A;  4U8D A;  3F45 A;  2AUC A;  3PN7 C;  1MXL C;  3BUX B;  1J7O A;  1TOP A;  1SCM B;  3JVT B;  1XA5 A;  2RGI A;  1ZAC A;  1UHI A;  5CSF A;  3GOF A;  5DKQ A;  1KWO B;  2HF5 A;  2HQ8 A;  2I94 A;  4YGE B;  1NSH A;  2LUC A;  4DUQ A;  1R2U A;  4OCI A;  1N2D A;  3LLE A;  3WNX B;  1A4P A;  2L0P A;  2HPS A;  1SL9 A;  3EK4 A;  2MBX A;  3CGA A;  4CPV A;  5JJG A;  1CMG A;  2M8U A;  2JUL A;  3PN7 B;  4PHN A;  1MR8 A;  2JXL A;  2LCP A;  2VRG A;  2M1K B;  1S6I A;  2CNP A;  1S5G Y;  2F3Z A;  2JNX A;  2KI4 C;  1B1G A;  1OMR A;  3EKJ A;  4ETO A;  1M46 A;  1F4Q A;  1IJ6 A;  2WC8 A;  4PE7 A;  5HKZ A;  2BE6 A;  1K8U A;  1UHH A;  2BKI B;  1LA0 A;  2HET A;  3WHT B;  4M2P A;  4CFQ A;  1BOD A;  1S1E A;  3LK0 A;  2L4I A;  3SG5 A;  4MRX A;  1TNW A;  1RJV A;  1V1F A;  3EKH A;  1QTX A;  3IQO A;  3OB1 B;  4MRY A;  1YX8 A;  1Q80 A;  2COL B;  2WCE A;  2LAP A;  3TDZ A;  2EHB A;  2KFG A;  2KI4 B;  4NDC A;  2KOT A;  1FPW A;  2SAS A;  4NDD A;  4ORB B;  1KFX S;  1L2O C;  1SNL A;  1IRJ A;  3LCP C;  4A4B A;  4TNC A;  5CSJ A;  5ER4 X;  5KTY A;  2BCA A;  1S5G Z;  1WRL A;  2I2R E;  3BUW B;  4PE4 A;  1QAS A;  1AK8 A;  2NZ0 A;  1M31 A;  3CTN A;  1H4B A;  3A8R A;  2SCP A;  1PVA A;  1QX5 B;  5KSZ A;  4F0Z B;  1Y1A A;  2DOQ A;  1FI5 A;  1GJY A;  4GAO A;  1PRW A;  3NSO A;  1SW8 A;  3PAT A;  1SYM A;  3TZ1 A;  3CWG A;  4ICB A;  3NSL A;  1DJH A;  3SG6 A;  3IF7 A;  1K90 D;  5F6T A;  1TN4 A;  1NX3 A;  2KNE A;  2WOS A;  1W7I B;  3BUN B;  3SG7 A;  4YRU A;  1CLB A;  1LA3 A;  1VRK A;  2LUX A;  2JTZ A;  1L2O B;  3JTD C;  1QS7 A;  3FS7 A;  2KDH A;  3O4Y A;  5PAL A;  2LLT A;  2KFF A;  1N0Y A;  2E30 A;  4YI8 A;  1R6P A;  1U5I B;  4GGF C;  1QX7 A;  2LV7 A;  3M0W A;  1QJT A;  2LHL A;  1CDN A;  2F3Y A;  4MEW A;  4Q04 A;  1KQM C;  2JOJ A;  1QXP A;  2ZKM X;  3RM1 A;  1SL8 A;  2H61 A;  1Y1X A;  1UWO A;  3I5G B;  4A4C A;  2K7B A;  2K61 A;  1F55 A;  2M1U A;  1RFJ A;  1UHJ A;  1IG5 A;  1J7Q A;  1OMV A;  1YUT A;  2KQ6 A;  4AOM A;  3DVM A;  2M49 B;  3SIA A;  2KBI A;  1CFC A;  5I2L A;  3PLF B;  4WQ3 A;  4YGA A;  1OOJ A;  3BUO B;  4I5L B;  1FBV A;  1N65 A;  1S36 A;  3CS1 A;  5B8I B;  5JOL A;  4DIR A;  2KYF A;  2KGB C;  4PHJ A;  1NCZ A;  1SMG A;  1KQM B;  2BKH B;  1OZO A;  4JWQ A;  1ZOT B;  1TTX A;  5AFP A;  3VRP A;  2BCX A;  2LM5 A;  4R1E A;  2F2P A;  1DGV A;  2WND A;  1RWY A;  2KAY A;  1WRZ A;  1JF2 A;  1GQM A;  4HRH A;  4ZCU A;  3C1V A;  1CB1 A;  4CID A;  2LC5 A;  2K8M B;  1MHO A;  1AVS A;  5TNC A;  4USL A;  2EC6 C;  1V1G A;  5BPJ A;  1CDL A;  1DGU A;  2ZRS A;  2Q4U A;  1B9A A;  1SRA A;  1JFJ A;  2OS8 B;  1FI6 A;  1QAT A;  1NWD A;  1DJZ A;  3NXA A;  2LVK A;  2BBM A;  3SJS A;  4FQO A;  1F70 A;  1SBJ A;  4N1G A;  2KGR A;  1UP5 A;  4GFT A;  1K94 A;  4MZL A;  1S26 D;  1SK6 D;  1YUU A;  4HRG A;  3AAK A;  4GBA A;  1CFD A;  2PMY A;  1KFU S;  1IQ5 A;  2I18 A;  2LVJ A;  1SR6 C;  3I5I C;  1G8I A;  1WLM A;  5AEQ A;  3I5H C;  1TCF A;  1IGV A;  2AMI A;  1YRT B;  3VRO A;  2PVB A;  1K93 D;  2CT9 A;  3BQ3 A;  3SG2 A;  1X02 A;  1J7R A;  4XJK B;  3I5F C;  2D8N A;  2M7L A;  2NXQ A;  4ZCV A;  1TNQ A;  2JXC A;  4P2Y B;  1G4Y R;  1QVI Y;  2FCE A;  2L98 A;  1UUS A;  3E3R A;  4E68 A;  1WRK A;  4QJ5 B;  1U5I A;  1HT9 A;  2M7N A;  1DF0 B;  1KK7 Y;  1A75 B;  2TN4 A;  2V53 A;  3I5H B;  3OX5 A;  1MUX A;  1QLK A;  1LXF C;  1JWD A;  1MXE A;  4C0K A;  3CR5 X;  3ICB A;  1TRF A;  2O60 A;  2JQ6 A;  2M9G A;  1W7J B;  3I5F B;  4YGB B;  4QJ3 B;  2WOR A;  1AJ4 A;  4XYN A;  1JSA A;  2G2B A;  2R2I A;  3DVJ A;  1AP4 A;  2L50 A;  1KK8 C;  1REC A;  1CM4 A;  1TIZ A;  1XFX O;  2BE4 A;  4I5J A;  1LIN A;  4GGF A;  1DT7 B;  2JNF A;  2JTT A;  1PSR A;  2JT8 A;  3QRX A;  1B7T Y;  1KFX L;  5CSN A;  1F4O A;  1CNP A;  2KBM A;  1YUR A;  1KK7 Z;  1LKJ A;  2MRD A;  5AXI A;  2MHH A;  4GGN A;  1KCY A;  3EK8 A;  1S3P A;  1EG4 A;  2PAS A;  4I5N B;  1CDM A;  1SPY A;  2ZN9 A;  4OR9 B;  1JBA A;  4AQJ A;  1LVC D;  2F33 A;  2LVI A;  2MAZ A;  3GK4 X;  1YTZ C;  1KK8 B;  3EVU A;  3K21 A;  1L7Z A;  2JC2 A;  4UPG A;  1DJX A;  3VGO A;  2KFH A;  1NYA A;  3GK2 A;  3FWB A;  2JWW A;  4GUK A;  1F54 A;  5D69 A;  5AER A;  5IBW A;  1AJ5 A;  2MJW B;  4N1F A;  2K7D A;  3CZT X;  3VRN A;  1K96 A;  4FTG A;  1JC2 A;  2M3W A;  3WHU B;  2EGD A;  2OTG C;  2JU0 A;  1JFK A;  3JTD B;  3PM8 A;  2H2K A;  2JRF A;  1B47 A;  3D0Y B;  3WXA A;  2LHI A;  1YUS A;  2KAX A;  1IJ5 A;  1CKK A;  3DVE A;  1QIW A;  1YVH A;  2KAV A;  2A4J A;  2P6B B;  4ORA B;  2B1U A;  4PHM A;  1DMO A;  1JUO A;  1JF0 A;  2ZN8 A;  2BEC A;  3A4U B;  3TDU A;  1XFZ O;  2MA2 A;  1BU3 A;  1K9U A;  1UHK A;  1XFU O;  3HCM A;  1SKT A;  1IWQ A;  1WDC C;  4DRW A;  2OTG B;  5GQQ C;  4N5X A;  2FJU B;  2PSR A;  3O78 A;  1BR1 B;  4DS7 A;  2ZNE A;  1S6C A;  2WCB A;  1MWN A;  1D1O A;  4XJK A;  2ISD A;  2LMT A;  1DTL A;  5HKY A;  1XFY O;  1RK9 A;  2MLE C;  4MLW A;  2FOT A;  1BMO A;  2BL0 C;  1B8C A;  2GGM A;  1F71 A;  1PAL A;  3VRR A;  3BUM B;  1DF0 A;  2KI6 C;  3DF0 A;  1A75 A;  1AUI B;  2KI6 D;  2K7C A;  1ZUZ A;  1BOC A;  2JT0 A;  2FCD A;  4OVN F;  2KQY A;  3OP0 A;  2O5G A;  1XO5 A;  1K9P A;  3O2P A;  1NP8 A;  1PUL A;  1IKU A;  1CDP A;  2KSP A;  2CTN A;  2LP3 A;  3HX4 A;  3EVV A;  4OKH A;  4I5K A;  1PK0 D;  3DD4 A;  1ZMZ A;  1YX7 A;  4YI9 A;  3D10 A;  2BL0 B;  3EVR A;  1C7V A;  2AAO A;  2QAC A;  2EC6 B;  2Y1N A;  1MQ1 A;  1OMD A;  1AHR A;  3ZNI A;  1J1D A;  5DKN A;  1G33 A;  1SY9 A;  1CFP A;  1B4C A;  2LP2 A;  3KEV A;  5DKR A;  1M63 B;  3PFV A;  2BBN A;  1DJW A;  4AQI A;  1PVB A;  2PAL A;  1XYD A;  2KYC A;  3IQQ A;  2LLS A;  1SCV A;  1NX2 A;  5CSI A;  1NPQ A;  1KFU L;  2NCO A;  1EH2 A;  1QV0 A;  1ALW A;  1KSO A;  1M39 A;  2WCF A;  3AAJ A;  1WLZ A;  2MLF C;  2G9B A;  4PHK A;  2LAN A;  3KHE A;  1A03 A;  4MZK A;  3O6B A;  2F2O A;  1SR6 B;  3I5I B;  1XK4 C;  2L5X B;  1RRO A;  3DF0 B;  2LLU A;  3LL8 B;  3BOW B;  2BCB A;  2HQW A;  4IL1 A;  3CR4 X;  1XFV O;  4L9M A;  5I8N A;  1IQ3 A;  1NX1 A;  2I7A A;  4PDZ A;  1ODB A;  3CLN A;  2QPT A;  1EL4 A;  1PSB A;  1A2X A;  1K95 A;  1M45 A;  4JPZ B;  3TDI A;  1A29 A;  1BLQ A;  1NX0 A;  1ALV A;  2NLN A;  1J1E A;  1TNX A;  3TS5 C;  5HYD A;  1UUR A;  1NCY A;  1RTP 1;  4PE0 A;  3D0Y A;  2L51 A;  3TUY C;  2JPT A;  4JQ0 D;  4GNK B;  2CBL A;  1WY9 A;  1YVL A;  4MSP A;  5AAN A;  1QVI Z;  1YRU B;  4ORC B;  5HKW A;  1GGW A;  3KO0 A;  1DJG A;  3BXK A;  3MSE B;  1CTR A;  4P5O E;  5I2Q A;  1Y6W A;  3TS5 B;  4C0J A;  1NUB A;  1FF1 A;  3RLZ A;  1OQP A;  1B8L A;  5HLV A;  1UHN A;  3TUY B;  2K0J A;  4GPL B;  1S6J A;  1DJI A;  2LVV A;  1DJY A;  1EXR A;  4YBH B;  1H8B A;  4C0L A;  2K2F A;  1QX2 A;  2L2E A;  1KSM A;  4HSZ A;  3H4S E;  1BJF A;  1FW4 A;  4HRE E;  2M29 A;  1K2H A;  2JZI A;  2PRU A;  1Y0V H;  1SL7 A;  4MBE A;  4WQ2 A;  1F8H A;  1J55 A;  3KPX A;  2GV5 A;  5FYX A;  4CLN A;  4M2Q A;  1B7T Z;  1DVI A;  2LNK A;  5G08 A;  1BF5 A;  1C7W A;  3I5G C;  4BY4 A;  3SG4 A;  2ZND A;  1IH0 A;  3CR2 A;  5KU1 A;  4PE1 A;  5CPV A;  5ER5 A;  3SG3 A;  1NIW A;  3KF9 A;  3EK7 A;  1QV1 A;  1MF8 B;  4PCW A;  2LMU A;  2OPO A;  2ZFD A;  2M0R A;  3AKB A;  2KHN A;  2F8P A;  4YGC B;  2E6W A;  4MN0 A;  1K9K A;  3PSR A;  1E8A A;  3DVK A;  2M97 A;  1GGZ A;  2L4H A;  2Q91 A;  2Y1M A;  3NSK A;  3OB2 B;  1EG3 A;  1TNP A;  3FWC A;  4YGD B;  2Y4Q A;  2K7O A;  1J7P A;  1EJ3 A;  2IS9 A;  4D1E A;  1QIV A;  4MVF A;  2ZRT A;  4PAL A;  1NCX A;  1CMF A;  4M2O A;  1QLS A;  4NDB A;  1OE9 B;  4BY5 A;  1Y1U A;  2LMV A;  3NSI A;  4DCK A;  3SIB A;  1CLM A;  3VRQ A;  2CCM A;  3GK1 A;  1XVJ A;  1CFF A;  3OHM B;  1KQV A;  2Y5I A;  4MZJ A;  1CLL A;  3BYA A;  4CFR A;  1BT6 A;  3BOW A;  4QJ4 B;  1B8R A;  2NCP A;  1XFW O;  1WDC B;  3PAL A;  2OS8 C;  2H61 C;  3ZWH A;  1CM1 A;  2K2A A;  3FIA A;  1BR4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...