2AMIA

Solution structure of the calcium-loaded n-terminal sensor domain of centrin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
RVGLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISEIDKDGSGTIDFEEFLTMMTAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal calcium sensor domain of centrin reveals the biochemical basis for domain-specific function.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Cell cycle
molecule keywords Caltractin
total genus 29
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2amiA00
1SYMA 4YGCB 3H4SE 4GFTA 3SIBA 1ALVA 1LXFC 1YX8A 1QVIY 3RM1A 1BF5A 2LE9B 5G08A 3AKAA 2Y5IA 1QS7A 1CMGA 1IH0A 3FWCA 5DKNA 3EK8A 1M46A 4BY5A 3SJSA 1SCMC 2MLFC 1WLZA 2LHLA 4C0JA 2NZ0A 2LP3A 2PALA 1LA0A 1OZOA 1TCFA 2WOSA 3BXKA 1F71A 4YGEB 2CXJA 4MRXA 1SW8A 3M0WA 1H4BA 1XK4C 1IWQA 3VRNA 1RFJA 5CSNA 1AHRA 2KHNA 2LMTA 2OTGC 4N5XA 1GGZA 1LA3A 3SG5A 1PK0D 4QJ4B 3BUWB 3I5IC 3D0YA 1E8AA 3EVVA 2K7BA 1IKUA 2JNFA 2M7LA 1KK8B 5I2QA 1QIVA 1NCYA 1KFXL 5AEQA 2LM5A 3A4UB 2KAVA 4I5NB 1SBJA 2D8NA 2JNXA 2LC5A 1XVJA 4ORAB 1F55A 4DIRA 4CFQA 1BR1B 2FCEA 3VRPA 1TN4A 5HKZA 4M2PA 4MLWA 2CCMA 3ICBA 5FYXA 5DKQA 4DUQA 1OZSA 2OS8C 3DVJA 5K89A 3IQOA 1XFXO 1CB1A 1S5GZ 3AKBA 4JWQA 3OHMB 5GQQC 4DRWA 5B8IB 2L51A 4N1GA 2ZKMX 1UHHA 3E3RA 3PLFB 3BOWA 1K93D 2K7OA 2LCPA 2JXCA 1J1DA 2A4JA 1NWDA 4OV2A 1AP4A 2JU0A 1PALA 1XA5A 1BG1A 4NQGA 4PE0A 4F0ZB 2K2FA 5DKRA 4QJ3B 1U5IB 3FWBA 3FIAA 1SCMB 4UPGA 3PM8A 1B8CA 2JQ6A 1KFXS 2KYFA 4MN0A 1G8IA 2K8MB 4I5KA 1N2DA 3CTNA 3IF7A 1ZUZA 1XFZO 1F54A 4PE7A 1FI6A 1EXRA 1S5GY 4JQ0D 1KQMB 1XFWO 3OB1B 2M29A 1NX1A 1QV0A 5I2OA 2OPOA 5HKWA 2KOTA 1DJWA 1XFUO 5IBWA 1LINA 1UUSA 1ZMZA 4QJ5B 3EK4A 4GGFA 1M63B 2KDHA 1ALWA 1NIWA 1Y0VH 5KU1A 2KI4C 1YURA 4P5OE 1L7ZA 1SPYA 2HF5A 2GV5A 2BCBA 2ZN9A 3HCMA 1BT6A 2BECA 4FTGA 1DJYA 3D10A 2KAYA 1CFFA 1PSBA 5HLVA 1K90D 3DF0B 1NYAA 3LL8B 5I2LA 5JOLA 4AQJA 1OQPA 2E30A 5J3XA 1BOCA 2K2AA 4M2QA 2LHIA 4AOMA 5D69A 1DF0B 1EG4A 2K61A 2ZRTA 3QRXA 1TRFA 1FI5A 2AUCA 3MSEB 1N65A 5CSFA 1CKKA 3IQQA 1C7WA 1CFPA 1IRJA 1KQMC 2O5GA 3HX4A 1PULA 1AJ4A 1S3PA 3BQ3A 5TNCA 4A4BA 2ZN8A 2FOTA 3EKJA 2KGRA 1B4CA 2ZNEA 3CR5X 3SG3A 1WRZA 4OCIA 2PVBA 2ZNDA 4USLA 3EK7A 3SG2A 2LAPA 1KFUS 1YTZC 1SNLA 1IQ3A 1KFUL 2I2RE 1YRUB 4I5JA 3GK2A 5I8NA 1DT7B 2BL0C 1YVHA 4I5LB 5HLOA 3ZWHA 2KFHA 3PN7B 5CPVA 2M1KB 2JTTA 2KI6D 1A75A 1XK4A 2M1UA 2KNEA 2LUXA 1KCYA 3NSKA 1WRLA 4PE1A 2FCDA 1EH2A 1J55A 3O2PA 1A2XA 3TUYB 1L2OC 1YR5A 2MHHA 1BR4B 1W7IB 5F6TA 1RJVA 4M2OA 3PALA 2F2OA 3VROA 2KAXA 2PMYA 3KHEA 4MVFA 4ZCUA 1UHJA 2HPSA 1H8BA 1FW4A 1M45A 1QXPA 1JFJA 2F3YA 1DJXA 1R2UA 2GGZA 2PSRA 3TS5C 4HRGA 4CLNA 1DMOA 1S26D 1SY9A 2ZFDA 4GPLB 4JPZB 1QX5B 4IL1A 2PRUA 1A75B 1NSHA 1SL8A 4GNKB 1KK7Z 2JZIA 2K0JA 1B9AA 1GJYA 4PE4A 2MAZA 2LV7A 2I18A 1LVCD 1S1EA 3BUXB 3I5IB 2V53A 1IGVA 1F4QA 4ORBB 2COLB 1XYDA 1TNPA 2BBMA 2NXQA 1FF1A 1AUIB 4OKHA 1K8UA 3AAJA 2LLSA 3CWGA 4WRIA 1DVIA 1YUTA 2JT8A 4DCKA 2H2KA 2L4IA 4OVNF 2WCBA 1XFYO 2KI6C 2M8UA 3BOWB 1PVAA 2LVKA 3I5FC 2ISDA 2M97A 3PN7C 1B7TY 4P2YB 1V1FA 1F4OA 1S6IA 1B1GA 1CLBA 1OE9B 1SCVA 1WDCB 1Y6WA 4A4CA 1HQVA 4PDZA 1MWNA 1KK7Y 1K94A 1U5IA 1SR6B 1JF0A 1DJZA 1Y1XA 2BKIB 2LP2A 3C1VA 1S36A 3O4YA 3GK1A 2F33A 3I5GB 2RGIA 4PHMA 3SG4A 1KK8C 1B7TZ 3LK0A 2DOQA 2L2EA 1ODBA 3LCPC 2MJWB 4GBAA 4MEWA 4MRYA 4OR9B 1UHKA 1MUXA 1CMFA 1F8HA 4E68A 2LMUA 1DJIA 5AFPA 1QLSA 2WORA 3CR4X 2JT0A 4R1EA 2M7NA 1K9UA 1BJFA 1RTP1 1QV1A 1W7JB 3OP0A 2MA2A 2Y1MA 5CSIA 1C07A 4MZKA 1J1EA 1TOPA 2F8PA 3VRQA 1YUSA 2G9BA 1IQ5A 3DF0A 1R6PA 2WCEA 1IG5A 2JT3A 4HSZA 5CSJA 1CDPA 1J7OA 4BY4A 4XJKA 3BUNB 1FBVA 1M39A 2WCFA 3I5HB 1JFKA 1RWYA 1TIZA 1DF0A 1QTXA 1DTLA 2JOJA 3NSOA 2KFGA 2H61A 4CIDA 4MBEA 1UWOA 4YBHB 1B47A 1KSOA 2WNDA 2EHBA 2KBIA 1WDCC 2AMIA 3BYAA 1NCXA 1EL4A 1OSAA 4PCWA 3EKHA 1SR6C 2M49B 3NXAA 1A29A 1NCZA 3CLNA 2LLUA 1BU3A 2Q4UA 2GGMA 1QX2A 4GUKA 2KBMA 1QX7A 1EJ3A 1ZACA 1CFDA 2Q91A 1MXEA 5AXIA 4PALA 2QPTA 2CNPA 1N0YA 4XJKB 2K7CA 2L5XB 3TDZA 2NLNA 1J7RA 1CDLA 1EG3A 3EVUA 3NSLA 2LUCA 3DD4A 5ER5A 1WRKA 2LVIA 3O6BA 4XYNA 1BMOA 2WC8A 3LLEA 1S6CA 1DGVA 1UURA 2M3WA 3KEVA 4WQ2A 1J7QA 3GK4X 1G4YR 1MQ1A 2G2BA 2BE6A 2KQ6A 3KO0A 4YI8A 1WY9A 1A03A 1CFCA 3NSIA 1TCOB 1NPQA 4HRHA 4AQIA 4YRUA 3OX5A 2HQWA 3TDUA 3I5HC 1NUBA 3FS7A 4GAOA 2CTNA 4U8DA 1KWOC 2Y1NA 4CPVA 1AK8A 2OS8B 2ZRSA 1CDNA 2JC2A 4Q04A 1YVLA 2JTZA 2QACA 3KF9A 4HREE 1BLQA 1DJGA 1PRWA 1NX3A 4N1FA 1MR8A 1B8RA 1SMGA 5JJGA 4PHJA 2BKHB 1BODA 1DJHA 1SKTA 2MBXA 5D7FA 3TS5B 2BE4A 1C7VA 1QASA 2AAOA 2F2PA 4MZLA 1QJTA 2Y4QA 1CNPA 1JBAA 4GGNA 5HYDA 3JVTC 2F3ZA 3F45A 3TUYC 1FPWA 3WXAA 1CDMA 2JULA 1J7PA 1RK9A 2M9GA 1K96A 3PATA 1GQMA 1QIWA 1LKJA 2KFFA 3JTDC 2LANA 2BCAA 1JF2A 3BUOB 5ER4X 1NP8A 4MSPA 1G33A 1TNWA 4ZCVA 1CLLA 4YGDB 4PHKA 3SG6A 2P6BB 1QATA 1JUOA 2VRGA 2EC6B 1ZOTB 2I7AA 1K2HA 2H61C 2LLTA 1F70A 1D1OA 1RROA 1CM4A 2MRDA 2LNKA 1XO5A 2KI4B 1QLKA 1JSAA 3SG7A 2BBNA 3CS1A 2MLEC 1OOJA 1WLMA 3O78A 1SL9A 1A4PA 3I5FB 2JWWA 2B1UA 3WHUB 4CFRA 1UHIA 3PFVA 2JXLA 1K9PA 2TN4A 3ZNIA 3CR2A 1KSMA 4NDBA 1AVSA 1MF8B 3GOFA 3VRRA 4L9MA 1OMVA 3K21A 1NX2A 1S6JA 2PASA 1KWOB 4YGAA 2KYCA 2SCPA 5KSZA 1DGUA 1IJ5A 3RLZA 1NX0A 2L98A 1OMRA 3DVMA 1MXLC 1V1GA 2LMVA 3EVRA 1B8LA 2L0PA 3WHTB 1AJ5A 3OB2B 2I94A 2K7DA 3LK1A 1KQVA 1VRKA 4YGBB 3A8RA 1JC2A 1SRAA 1K9KA 3TZ1A 2EC6C 3PSRA 4MZJA 5HKYA 3JVTB 1CLMA 1YX7A 1Y1UA 3I5GC 1TTXA 1PVBA 2CBLA 1OMDA 3SIAA 1X02A 5BPJA 3CGAA 1HT9A 3JTDB 2BL0B 1YUUA 1Y1AA 2R2IA 2NCOA 4NDCA 1IJ6A 2LVJA 4YI9A 2JRFA 1Q80A 2FJUB 1ZFSA 1CTRA 1TNQA 2IS9A 1CM1A 2L4HA 1UHNA 1XFVO 2HQ8A 3KPXA 4GGFC 4D1EA 5AANA 4ORCB 2SASA 2KSPA 3CZTX 2EGDA 4C0LA 4FQOA 4ETOA 2HETA 4DS7A 1UP5A 1TNXA 4WQ3A 2E6WA 3DVKA 2M0RA 1JWDA 5AERA 2LVVA 1SL7A 3VGOA 2O60A 1SK6D 4TNCA 1MHOA 3DVEA 4ICBA 1M31A 3OX6A 5PALA 2OTGB 2NCPA 1GGWA 2KGBC 4C0KA 1K95A 1PSRA 3TDIA 2BCXA 2JPTA 1QVIZ 2L50A 3WNXB 2CT9A 2KQYA 4PHNA 5KTYA 4NDDA 3AAKA 1RECA 1YRTB 3BUMB 1L2OB 3D0YB
chains in the Genus database with same CATH superfamily
1SYMA 3O4XA 4YGCB 3H4SE 2KPHA 4GFTA 3SIBA 1ALVA 1LXFC 1YX8A 3SS5A 1QVIY 3RM1A 1BF5A 2LE9B 4ORBB 5G08A 3AKAA 2Y5IA 2KLEA 1QS7A 1CMGA 1IH0A 3FWCA 3D73A 5DKNA 2K60A 3EK8A 3SS4A 1M46A 4BY5A 1LS8A 3SJSA 1SCMC 2MLFC 3L47A 1WLZA 2LHLA 3CZ2A 2NZ0A 2LP3A 2PALA 1LA0A 1OZOA 1TCFA 2WOSA 3BXKA 4PT1A 1F71A 4YGEB 2CXJA 4MRXA 1SW8A 3M0WA 4OZDA 1XK4C 4JKTA 1IWQA 1H4BA 3VRNA 1RFJA 5CSNA 1AHRA 2KHNA 2LMTA 2OTGC 4N5XA 1GGZA 1LA3A 3SG5A 3CZ0A 1FF1A 3R1OA 1PK0D 4QJ4B 3BUWB 3I5IC 3D0YA 1E8AA 3EVVA 2H8VA 4JD9A 2K7BA 1IKUA 2JNFA 2M7LA 1KK8B 5I2QA 1QIVA 1NCYA 1KFXL 5AEQA 2LM5A 3A4UB 2KAVA 4I5NB 1SBJA 2D8NA 2JNXA 2LC5A 1XVJA 4ORAB 1F55A 4DIRA 4CFQA 1BR1B 2FCEA 3VRPA 1TN4A 5HKZA 5I94A 4M2PA 3BFBA 4MLWA 2CCMA 3ICBA 5FYXA 5DKQA 4DUQA 5FI6A 1OZSA 2WCHA 2OS8C 3DVJA 5K89A 3FE8A 3IQOA 1XFXO 2ERBA 1S5GZ 1CB1A 3AKBA 2QDIA 4JWQA 3CYZA 3OHMB 5GQQC 4DRWA 1OOGA 5B8IB 2L51A 4N1GA 2ZKMX 1UHHA 3E3RA 3PLFB 3BOWA 1K93D 3IVTA 2K7OA 2LCPA 2JXCA 1J1DA 2WCLA 2A4JA 1NWDA 4OV2A 1SSEB 1AP4A 2JU0A 1PALA 1XA5A 1BG1A 4NQGA 4PE0A 4F0ZB 2K2FA 5DKRA 4QJ3B 1U5IB 3FWBA 3FIAA 1SCMB 4UPGA 1GM0A 3PM8A 3PJIA 1B8CA 2JQ6A 1KFXS 2KYFA 3DY9A 1G8IA 4MN0A 2K8MB 4I5KA 1N2DA 3CTNA 3IF7A 1ZUZA 1XFZO 1F54A 4PE7A 3N7HA 1FI6A 1EXRA 1S5GY 4JQ0D 1KQMB 1XFWO 3OB1B 2M29A 1NX1A 1QV0A 5I2OA 2OPOA 5HKWA 2KOTA 1DJWA 1XFUO 3R1PA 5IBWA 1LINA 1UUSA 1ZMZA 5DICA 4QJ5B 3EK4A 4GGFA 1M63B 2KDHA 2YGUA 1ALWA 1NIWA 1Y0VH 3NHTA 2KI4C 5KU1A 1YURA 4P5OE 1L7ZA 1SPYA 2HF5A 2GV5A 2BCBA 2PQLA 2ZN9A 3HCMA 1BT6A 2BECA 4FTGA 1DJYA 3D10A 2KAYA 3D75A 1CFFA 1PSBA 1DC1A 5HLVA 1K90D 3DF0B 1NYAA 3Q8IA 3LL8B 5I2LA 5JOLA 4AQJA 1OQPA 3B87A 2E30A 5J3XA 1BOCA 2K2AA 1P28A 4M2QA 1DEKA 2LHIA 4AOMA 5D69A 1DF0B 1EG4A 2K61A 2ZRTA 3D78A 1TRFA 3QRXA 1FI5A 2AUCA 3MSEB 1N65A 3CABA 5CSFA 1CKKA 3IQQA 1C7WA 1CFPA 1IRJA 1KQMC 2O5GA 3HX4A 1PULA 1AJ4A 1S3PA 3BQ3A 5TNCA 4A4BA 1Z2CB 2ZN8A 2FOTA 3EKJA 2KGRA 1B4CA 2ZNEA 3CR5X 3SG3A 1WRZA 4OCIA 2PVBA 2ZNDA 4USLA 3EK7A 3SG2A 2LAPA 1KFUS 1YTZC 3B6XA 1SNLA 1IQ3A 1KFUL 2I2RE 1YRUB 4I5JA 3GK2A 5I8NA 1DT7B 2BL0C 1YVHA 4I5LB 5HLOA 3ZWHA 2KFHA 3PN7B 5CPVA 2M1KB 2JTTA 2KI6D 1A75A 2QEVA 1XK4A 2M1UA 2KNEA 2GTEA 1DELA 2LUXA 1KCYA 3NSKA 1WRLA 4PE1A 2FCDA 1EH2A 1J55A 3O2PA 1A2XA 3K1EA 3TUYB 1L2OC 1YR5A 2MHHA 1BR4B 1W7IB 2WC5A 5F6TA 1RJVA 4M2OA 3PM2A 3D77A 3PALA 2F2OA 3VROA 3UNWA 2KAXA 2PMYA 3KHEA 4MVFA 4ZCUA 1UHJA 2HPSA 1H8BA 1FW4A 1M45A 1QXPA 1JFJA 2F3YA 1DJXA 1R2UA 1TUZA 2GGZA 2PSRA 3TS5C 4HRGA 4CLNA 1DMOA 1S26D 1SY9A 4KYNA 3DXLA 2ZFDA 5D3OA 3B7AA 4GPLB 3S0AA 4JPZB 1C3YA 1QX5B 4IL1A 2PRUA 3OBVA 1A75B 1NSHA 1SL8A 4GNKB 1KK7Z 5EL2A 2JZIA 2QEBA 2K0JA 1B9AA 3VB1A 1GJYA 4PE4A 2MAZA 2LV7A 1LVCD 1S1EA 2I18A 1OOIX 3BUXB 2BNXA 5FI2A 3I5IB 1OW4A 1IGVA 1F4QA 2V53A 2COLB 1XYDA 1TNPA 2BBMA 2NXQA 3CDNA 1AUIB 2FJYA 4F7FA 4OKHA 1K8UA 3AAJA 2LLSA 3CWGA 4WRIA 1DVIA 1YUTA 2JT8A 4DCKA 2H2KA 2L4IA 3OGNA 4OVNF 5HL1A 2WCBA 1XFYO 2KI6C 2M8UA 3BOWB 1PVAA 2LVKA 3EG5B 3I5FC 2ISDA 2WC6A 2M97A 3L4AA 1B7TY 3PN7C 1V1FA 1F4OA 1S6IA 4P2YB 1B1GA 1CLBA 1OE9B 1SCVA 1WDCB 1Y6WA 4A4CA 2P71A 1HQVA 4PDZA 1MWNA 1KK7Y 1IIOA 5FI7A 1K94A 1U5IA 1SR6B 1JF0A 1DJZA 1W9ZA 1Y1XA 2BKIB 2LP2A 1TUJA 1S36A 3C1VA 3O4YA 3GK1A 2F33A 3I5GB 2RGIA 4PHMA 3SG4A 1KK8C 1B7TZ 3LK0A 2DOQA 2L2EA 1ODBA 3LCPC 2MJWB 4GBAA 4MEWA 4MRYA 4OR9B 1ORGA 1UHKA 1MUXA 1CMFA 1F8HA 4E68A 4IJ7A 2LMUA 1DJIA 1TWOA 5AFPA 1QLSA 2WORA 3CR4X 2JT0A 4R1EA 2M7NA 1K9UA 3R1VA 1BJFA 1RTP1 1T14A 1QV1A 1W7JB 3OP0A 2MA2A 2Y1MA 5CSIA 1C07A 4MZKA 1J1EA 3SS3A 1TOPA 2F8PA 3VRQA 1YUSA 2G9BA 1IQ5A 3DF0A 2P70A 1R6PA 2WCEA 1IG5A 2JT3A 2WCJA 4HSZA 5CSJA 4INWA 1CDPA 1J7OA 4BY4A 4XJKA 3BUNB 1FBVA 1M39A 2WCFA 3I5HB 1JFKA 1RWYA 1TIZA 1DF0A 1QTXA 3S0FA 1C3ZA 1DTLA 2JOJA 3NSOA 2KFGA 2H61A 4CIDA 4MBEA 1UWOA 4YBHB 1B47A 1KSOA 2WNDA 3NHIA 2EHBA 2KBIA 1WDCC 2AMIA 3B88A 3FE9A 3BYAA 1NCXA 1EL4A 1OSAA 4PCWA 3EKHA 1SR6C 3BFHA 2M49B 3NXAA 1A29A 1NCZA 3CLNA 2LLUA 2QEOA 3CZ1A 1BU3A 2Q4UA 2GGMA 1QX2A 4GUKA 2KBMA 1QX7A 1EJ3A 1ZACA 1Z4HA 1CFDA 2Q91A 1MXEA 5AXIA 4PALA 2QPTA 2CNPA 1N0YA 4XJKB 2K7CA 2L5XB 3TDZA 2NLNA 3RZSA 1J7RA 1CDLA 1EG3A 3EVUA 3NSLA 3DYEA 2LUCA 3UO9A 3DD4A 5ER5A 3S0DA 1WRKA 2LVIA 3O6BA 4XYNA 3D74A 1BMOA 2WC8A 3LLEA 1S6CA 1DGVA 1UURA 2M3WA 3KEVA 4WQ2A 1J7QA 3GK4X 1G4YR 1MQ1A 2G2BA 2BE6A 2KQ6A 2WCMA 3KO0A 4YI8A 1WY9A 3V2LA 1A03A 1CFCA 3NSIA 1TCOB 1NPQA 4HRHA 4AQIA 4YRUA 3OX5A 3S0EA 2HQWA 3TDUA 3I5HC 1NUBA 3FS7A 4GAOA 2CTNA 4U8DA 1KWOC 2Y1NA 4CPVA 1AK8A 2OS8B 2ZRSA 1CDNA 2JC2A 4Q04A 1YVLA 2JTZA 2QACA 3KF9A 4HREE 1BLQA 1DJGA 3R72A 1PRWA 1NX3A 4N1FA 1MR8A 1B8RA 1SMGA 5JJGA 4PHJA 2BKHB 4INXA 1BODA 1DJHA 2WCKA 1SKTA 1QWVA 2PYQA 5D7FA 2MBXA 2BE4A 3TS5B 1QASA 2AAOA 2F2PA 1C7VA 4MZLA 1QJTA 2Y4QA 1CNPA 1JBAA 4GGNA 5HYDA 3JVTC 2F3ZA 3F45A 1XFRA 3TUYC 3WXAA 1CDMA 2JULA 1J7PA 1FPWA 1RK9A 2M9GA 1K96A 3PATA 1GQMA 1QIWA 1LKJA 2KFFA 3JTDC 2LANA 2BCAA 1JF2A 3BUOB 5ER4X 1NP8A 4MSPA 1G33A 1TNWA 2L5YA 4ZCVA 3L4LA 1CLLA 1OOHA 4PHKA 4YGDB 2P6BB 3SG6A 1QATA 1JUOA 2VRGA 2EC6B 1ZOTB 2I7AA 3BJHA 1K2HA 2H61C 2LLTA 1F70A 1D1OA 1RROA 1CM4A 2MRDA 2LNKA 1XO5A 2KI4B 1QLKA 1JSAA 3SG7A 2BBNA 2BAPA 3CS1A 2MLEC 1OOJA 1WLMA 3O78A 3BFAA 1SL9A 1A4PA 2JPOA 3I5FB 2JWWA 2B1UA 3WHUB 4CFRA 1UHIA 3PFVA 2JXLA 1K9PA 2TN4A 3ZNIA 3CR2A 1KSMA 4NDBA 1AVSA 1MF8B 3GOFA 3VRRA 4L9MA 1OMVA 3K21A 1NX2A 1S6JA 2PASA 1KWOB 4YGAA 2KYCA 2SCPA 5KSZA 1DGUA 1OOFA 1IJ5A 3RLZA 1NX0A 2L98A 3B86A 3FE6A 1OMRA 3DVMA 1MXLC 1V1GA 2LMVA 3EVRA 1B8LA 2L0PA 4FQTA 3WHTB 1AJ5A 3OB2B 2I94A 2K7DA 3LK1A 1KQVA 1VRKA 4YGBB 3A8RA 1JC2A 1SRAA 1K9KA 3TZ1A 2EC6C 3PSRA 4MZJA 5HKYA 3JVTB 1CLMA 1YX7A 3DZTA 1Y1UA 3I5GC 1TTXA 1PVBA 2CBLA 1OMDA 3SIAA 1X02A 5BPJA 3CGAA 1HT9A 3JTDB 2BL0B 3S0BA 1YUUA 1Y1AA 2R2IA 2NCOA 4NDCA 2L2CA 1IJ6A 2LVJA 4YI9A 2JRFA 2QEHA 3S0GA 1Q80A 2FJUB 1ZFSA 1CTRA 1TNQA 2IS9A 1CM1A 2L4HA 1UHNA 1XFVO 2HQ8A 3KPXA 4GGFC 4D1EA 5AANA 4ORCB 2SASA 2KSPA 3CZTX 2EGDA 4C0LA 4FQOA 4ETOA 2HETA 4DS7A 1UP5A 1TNXA 4WQ3A 3NGVA 2E6WA 3DVKA 2M0RA 1JWDA 5AERA 2LVVA 1SL7A 3QMEA 3VGOA 2O60A 1SK6D 4TNCA 1MHOA 3DVEA 4ICBA 1M31A 3OX6A 5PALA 2OTGB 2NCPA 1GGWA 2KGBC 4C0JA 4C0KA 1K95A 1PSRA 3TDIA 1DQEA 3D76A 2BCXA 2JPTA 2KLDA 1QVIZ 2L50A 3WNXB 2CT9A 2KQYA 4PHNA 5KTYA 4NDDA 3AAKA 1RECA 1YRTB 3BUMB 1L2OB 3D0YB
chains in the Genus database with same CATH topology
1SYMA 4YGCB 3H4SE 4GFTA 3SIBA 1ALVA 1LXFC 1YX8A 1QVIY 3RM1A 1BF5A 2LE9B 5G08A 3AKAA 2Y5IA 1QS7A 1CMGA 1IH0A 3FWCA 5DKNA 3EK8A 1M46A 4BY5A 3SJSA 1SCMC 2MLFC 1WLZA 2LHLA 4C0JA 2NZ0A 2LP3A 2PALA 1LA0A 1OZOA 1TCFA 2WOSA 3BXKA 1F71A 4YGEB 2CXJA 4MRXA 1SW8A 3M0WA 1H4BA 1XK4C 1IWQA 3VRNA 1RFJA 5CSNA 1AHRA 2KHNA 2LMTA 2OTGC 4N5XA 1GGZA 1LA3A 3SG5A 1PK0D 4QJ4B 3BUWB 3I5IC 3D0YA 1E8AA 3EVVA 2K7BA 1IKUA 2JNFA 2M7LA 1KK8B 5I2QA 1QIVA 1NCYA 1KFXL 5AEQA 2LM5A 3A4UB 2KAVA 4I5NB 1SBJA 2D8NA 2JNXA 2LC5A 1XVJA 4ORAB 1F55A 4DIRA 4CFQA 1BR1B 2FCEA 3VRPA 1TN4A 5HKZA 4M2PA 4MLWA 2CCMA 3ICBA 5FYXA 5DKQA 4DUQA 1OZSA 2OS8C 3DVJA 5K89A 3IQOA 1XFXO 1CB1A 1S5GZ 3AKBA 4JWQA 3OHMB 5GQQC 4DRWA 5B8IB 2L51A 4N1GA 2ZKMX 1UHHA 3E3RA 3PLFB 3BOWA 1K93D 2K7OA 2LCPA 2JXCA 1J1DA 2A4JA 1NWDA 4OV2A 1AP4A 2JU0A 1PALA 1XA5A 1BG1A 4NQGA 4PE0A 4F0ZB 2K2FA 5DKRA 4QJ3B 1U5IB 3FWBA 3FIAA 1SCMB 4UPGA 3PM8A 1B8CA 2JQ6A 1KFXS 2KYFA 4MN0A 1G8IA 2K8MB 4I5KA 1N2DA 3CTNA 3IF7A 1ZUZA 1XFZO 1F54A 4PE7A 1FI6A 1EXRA 1S5GY 4JQ0D 1KQMB 1XFWO 3OB1B 2M29A 1NX1A 1QV0A 5I2OA 2OPOA 5HKWA 2KOTA 1DJWA 1XFUO 5IBWA 1LINA 1UUSA 1ZMZA 4QJ5B 3EK4A 4GGFA 1M63B 2KDHA 1ALWA 1NIWA 1Y0VH 5KU1A 2KI4C 1YURA 4P5OE 1L7ZA 1SPYA 2HF5A 2GV5A 2BCBA 2ZN9A 3HCMA 1BT6A 2BECA 4FTGA 1DJYA 3D10A 2KAYA 1CFFA 1PSBA 5HLVA 1K90D 3DF0B 1NYAA 3LL8B 5I2LA 5JOLA 4AQJA 1OQPA 2E30A 5J3XA 1BOCA 2K2AA 4M2QA 2LHIA 4AOMA 5D69A 1DF0B 1EG4A 2K61A 2ZRTA 3QRXA 1TRFA 1FI5A 2AUCA 3MSEB 1N65A 5CSFA 1CKKA 3IQQA 1C7WA 1CFPA 1IRJA 1KQMC 2O5GA 3HX4A 1PULA 1AJ4A 1S3PA 3BQ3A 5TNCA 4A4BA 2ZN8A 2FOTA 3EKJA 2KGRA 1B4CA 2ZNEA 3CR5X 3SG3A 1WRZA 4OCIA 2PVBA 2ZNDA 4USLA 3EK7A 3SG2A 2LAPA 1KFUS 1YTZC 1SNLA 1IQ3A 1KFUL 2I2RE 1YRUB 4I5JA 3GK2A 5I8NA 1DT7B 2BL0C 1YVHA 4I5LB 5HLOA 3ZWHA 2KFHA 3PN7B 5CPVA 2M1KB 2JTTA 2KI6D 1A75A 1XK4A 2M1UA 2KNEA 2LUXA 1KCYA 3NSKA 1WRLA 4PE1A 2FCDA 1EH2A 1J55A 3O2PA 1A2XA 3TUYB 1L2OC 1YR5A 2MHHA 1BR4B 1W7IB 5F6TA 1RJVA 4M2OA 3PALA 2F2OA 3VROA 2KAXA 2PMYA 3KHEA 4MVFA 4ZCUA 1UHJA 2HPSA 1H8BA 1FW4A 1M45A 1QXPA 1JFJA 2F3YA 1DJXA 1R2UA 2GGZA 2PSRA 3TS5C 4HRGA 4CLNA 1DMOA 1S26D 1SY9A 2ZFDA 4GPLB 4JPZB 1QX5B 4IL1A 2PRUA 1A75B 1NSHA 1SL8A 4GNKB 1KK7Z 2JZIA 2K0JA 1B9AA 1GJYA 4PE4A 2MAZA 2LV7A 2I18A 1LVCD 1S1EA 3BUXB 3I5IB 2V53A 1IGVA 1F4QA 4ORBB 2COLB 1XYDA 1TNPA 2BBMA 2NXQA 1FF1A 1AUIB 4OKHA 1K8UA 3AAJA 2LLSA 3CWGA 4WRIA 1DVIA 1YUTA 2JT8A 4DCKA 2H2KA 2L4IA 4OVNF 2WCBA 1XFYO 2KI6C 2M8UA 3BOWB 1PVAA 2LVKA 3I5FC 2ISDA 2M97A 3PN7C 1B7TY 4P2YB 1V1FA 1F4OA 1S6IA 1B1GA 1CLBA 1OE9B 1SCVA 1WDCB 1Y6WA 4A4CA 1HQVA 4PDZA 1MWNA 1KK7Y 1K94A 1U5IA 1SR6B 1JF0A 1DJZA 1Y1XA 2BKIB 2LP2A 3C1VA 1S36A 3O4YA 3GK1A 2F33A 3I5GB 2RGIA 4PHMA 3SG4A 1KK8C 1B7TZ 3LK0A 2DOQA 2L2EA 1ODBA 3LCPC 2MJWB 4GBAA 4MEWA 4MRYA 4OR9B 1UHKA 1MUXA 1CMFA 1F8HA 4E68A 2LMUA 1DJIA 5AFPA 1QLSA 2WORA 3CR4X 2JT0A 4R1EA 2M7NA 1K9UA 1BJFA 1RTP1 1QV1A 1W7JB 3OP0A 2MA2A 2Y1MA 5CSIA 1C07A 4MZKA 1J1EA 1TOPA 2F8PA 3VRQA 1YUSA 2G9BA 1IQ5A 3DF0A 1R6PA 2WCEA 1IG5A 2JT3A 4HSZA 5CSJA 1CDPA 1J7OA 4BY4A 4XJKA 3BUNB 1FBVA 1M39A 2WCFA 3I5HB 1JFKA 1RWYA 1TIZA 1DF0A 1QTXA 1DTLA 2JOJA 3NSOA 2KFGA 2H61A 4CIDA 4MBEA 1UWOA 4YBHB 1B47A 1KSOA 2WNDA 2EHBA 2KBIA 1WDCC 2AMIA 3BYAA 1NCXA 1EL4A 1OSAA 4PCWA 3EKHA 1SR6C 2M49B 3NXAA 1A29A 1NCZA 3CLNA 2LLUA 1BU3A 2Q4UA 2GGMA 1QX2A 4GUKA 2KBMA 1QX7A 1EJ3A 1ZACA 1CFDA 2Q91A 1MXEA 5AXIA 4PALA 2QPTA 2CNPA 1N0YA 4XJKB 2K7CA 2L5XB 3TDZA 2NLNA 1J7RA 1CDLA 1EG3A 3EVUA 3NSLA 2LUCA 3DD4A 5ER5A 1WRKA 2LVIA 3O6BA 4XYNA 1BMOA 2WC8A 3LLEA 1S6CA 1DGVA 1UURA 2M3WA 3KEVA 4WQ2A 1J7QA 3GK4X 1G4YR 1MQ1A 2G2BA 2BE6A 2KQ6A 3KO0A 4YI8A 1WY9A 1A03A 1CFCA 3NSIA 1TCOB 1NPQA 4HRHA 4AQIA 4YRUA 3OX5A 2HQWA 3TDUA 3I5HC 1NUBA 3FS7A 4GAOA 2CTNA 4U8DA 1KWOC 2Y1NA 4CPVA 1AK8A 2OS8B 2ZRSA 1CDNA 2JC2A 4Q04A 1YVLA 2JTZA 2QACA 3KF9A 4HREE 1BLQA 1DJGA 1PRWA 1NX3A 4N1FA 1MR8A 1B8RA 1SMGA 5JJGA 4PHJA 2BKHB 1BODA 1DJHA 1SKTA 2MBXA 5D7FA 3TS5B 2BE4A 1C7VA 1QASA 2AAOA 2F2PA 4MZLA 1QJTA 2Y4QA 1CNPA 1JBAA 4GGNA 5HYDA 3JVTC 2F3ZA 3F45A 3TUYC 1FPWA 3WXAA 1CDMA 2JULA 1J7PA 1RK9A 2M9GA 1K96A 3PATA 1GQMA 1QIWA 1LKJA 2KFFA 3JTDC 2LANA 2BCAA 1JF2A 3BUOB 5ER4X 1NP8A 4MSPA 1G33A 1TNWA 4ZCVA 1CLLA 4YGDB 4PHKA 3SG6A 2P6BB 1QATA 1JUOA 2VRGA 2EC6B 1ZOTB 2I7AA 1K2HA 2H61C 2LLTA 1F70A 1D1OA 1RROA 1CM4A 2MRDA 2LNKA 1XO5A 2KI4B 1QLKA 1JSAA 3SG7A 2BBNA 3CS1A 2MLEC 1OOJA 1WLMA 3O78A 1SL9A 1A4PA 3I5FB 2JWWA 2B1UA 3WHUB 4CFRA 1UHIA 3PFVA 2JXLA 1K9PA 2TN4A 3ZNIA 3CR2A 1KSMA 4NDBA 1AVSA 1MF8B 3GOFA 3VRRA 4L9MA 1OMVA 3K21A 1NX2A 1S6JA 2PASA 1KWOB 4YGAA 2KYCA 2SCPA 5KSZA 1DGUA 1IJ5A 3RLZA 1NX0A 2L98A 1OMRA 3DVMA 1MXLC 1V1GA 2LMVA 3EVRA 1B8LA 2L0PA 3WHTB 1AJ5A 3OB2B 2I94A 2K7DA 3LK1A 1KQVA 1VRKA 4YGBB 3A8RA 1JC2A 1SRAA 1K9KA 3TZ1A 2EC6C 3PSRA 4MZJA 5HKYA 3JVTB 1CLMA 1YX7A 1Y1UA 3I5GC 1TTXA 1PVBA 2CBLA 1OMDA 3SIAA 1X02A 5BPJA 3CGAA 1HT9A 3JTDB 2BL0B 1YUUA 1Y1AA 2R2IA 2NCOA 4NDCA 1IJ6A 2LVJA 4YI9A 2JRFA 1Q80A 2FJUB 1ZFSA 1CTRA 1TNQA 2IS9A 1CM1A 2L4HA 1UHNA 1XFVO 2HQ8A 3KPXA 4GGFC 4D1EA 5AANA 4ORCB 2SASA 2KSPA 3CZTX 2EGDA 4C0LA 4FQOA 4ETOA 2HETA 4DS7A 1UP5A 1TNXA 4WQ3A 2E6WA 3DVKA 2M0RA 1JWDA 5AERA 2LVVA 1SL7A 3VGOA 2O60A 1SK6D 4TNCA 1MHOA 3DVEA 4ICBA 1M31A 3OX6A 5PALA 2OTGB 2NCPA 1GGWA 2KGBC 4C0KA 1K95A 1PSRA 3TDIA 2BCXA 2JPTA 1QVIZ 2L50A 3WNXB 2CT9A 2KQYA 4PHNA 5KTYA 4NDDA 3AAKA 1RECA 1YRTB 3BUMB 1L2OB 3D0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYM A;  4YGC B;  3H4S E;  4GFT A;  3SIB A;  1ALV A;  1LXF C;  1YX8 A;  1QVI Y;  3RM1 A;  1BF5 A;  2LE9 B;  5G08 A;  3AKA A;  2Y5I A;  1QS7 A;  1CMG A;  1IH0 A;  3FWC A;  5DKN A;  3EK8 A;  1M46 A;  4BY5 A;  3SJS A;  1SCM C;  2MLF C;  1WLZ A;  2LHL A;  4C0J A;  2NZ0 A;  2LP3 A;  2PAL A;  1LA0 A;  1OZO A;  1TCF A;  2WOS A;  3BXK A;  1F71 A;  4YGE B;  2CXJ A;  4MRX A;  1SW8 A;  3M0W A;  1H4B A;  1XK4 C;  1IWQ A;  3VRN A;  1RFJ A;  5CSN A;  1AHR A;  2KHN A;  2LMT A;  2OTG C;  4N5X A;  1GGZ A;  1LA3 A;  3SG5 A;  1PK0 D;  4QJ4 B;  3BUW B;  3I5I C;  3D0Y A;  1E8A A;  3EVV A;  2K7B A;  1IKU A;  2JNF A;  2M7L A;  1KK8 B;  5I2Q A;  1QIV A;  1NCY A;  1KFX L;  5AEQ A;  2LM5 A;  3A4U B;  2KAV A;  4I5N B;  1SBJ A;  2D8N A;  2JNX A;  2LC5 A;  1XVJ A;  4ORA B;  1F55 A;  4DIR A;  4CFQ A;  1BR1 B;  2FCE A;  3VRP A;  1TN4 A;  5HKZ A;  4M2P A;  4MLW A;  2CCM A;  3ICB A;  5FYX A;  5DKQ A;  4DUQ A;  1OZS A;  2OS8 C;  3DVJ A;  5K89 A;  3IQO A;  1XFX O;  1CB1 A;  1S5G Z;  3AKB A;  4JWQ A;  3OHM B;  5GQQ C;  4DRW A;  5B8I B;  2L51 A;  4N1G A;  2ZKM X;  1UHH A;  3E3R A;  3PLF B;  3BOW A;  1K93 D;  2K7O A;  2LCP A;  2JXC A;  1J1D A;  2A4J A;  1NWD A;  4OV2 A;  1AP4 A;  2JU0 A;  1PAL A;  1XA5 A;  1BG1 A;  4NQG A;  4PE0 A;  4F0Z B;  2K2F A;  5DKR A;  4QJ3 B;  1U5I B;  3FWB A;  3FIA A;  1SCM B;  4UPG A;  3PM8 A;  1B8C A;  2JQ6 A;  1KFX S;  2KYF A;  4MN0 A;  1G8I A;  2K8M B;  4I5K A;  1N2D A;  3CTN A;  3IF7 A;  1ZUZ A;  1XFZ O;  1F54 A;  4PE7 A;  1FI6 A;  1EXR A;  1S5G Y;  4JQ0 D;  1KQM B;  1XFW O;  3OB1 B;  2M29 A;  1NX1 A;  1QV0 A;  5I2O A;  2OPO A;  5HKW A;  2KOT A;  1DJW A;  1XFU O;  5IBW A;  1LIN A;  1UUS A;  1ZMZ A;  4QJ5 B;  3EK4 A;  4GGF A;  1M63 B;  2KDH A;  1ALW A;  1NIW A;  1Y0V H;  5KU1 A;  2KI4 C;  1YUR A;  4P5O E;  1L7Z A;  1SPY A;  2HF5 A;  2GV5 A;  2BCB A;  2ZN9 A;  3HCM A;  1BT6 A;  2BEC A;  4FTG A;  1DJY A;  3D10 A;  2KAY A;  1CFF A;  1PSB A;  5HLV A;  1K90 D;  3DF0 B;  1NYA A;  3LL8 B;  5I2L A;  5JOL A;  4AQJ A;  1OQP A;  2E30 A;  5J3X A;  1BOC A;  2K2A A;  4M2Q A;  2LHI A;  4AOM A;  5D69 A;  1DF0 B;  1EG4 A;  2K61 A;  2ZRT A;  3QRX A;  1TRF A;  1FI5 A;  2AUC A;  3MSE B;  1N65 A;  5CSF A;  1CKK A;  3IQQ A;  1C7W A;  1CFP A;  1IRJ A;  1KQM C;  2O5G A;  3HX4 A;  1PUL A;  1AJ4 A;  1S3P A;  3BQ3 A;  5TNC A;  4A4B A;  2ZN8 A;  2FOT A;  3EKJ A;  2KGR A;  1B4C A;  2ZNE A;  3CR5 X;  3SG3 A;  1WRZ A;  4OCI A;  2PVB A;  2ZND A;  4USL A;  3EK7 A;  3SG2 A;  2LAP A;  1KFU S;  1YTZ C;  1SNL A;  1IQ3 A;  1KFU L;  2I2R E;  1YRU B;  4I5J A;  3GK2 A;  5I8N A;  1DT7 B;  2BL0 C;  1YVH A;  4I5L B;  5HLO A;  3ZWH A;  2KFH A;  3PN7 B;  5CPV A;  2M1K B;  2JTT A;  2KI6 D;  1A75 A;  1XK4 A;  2M1U A;  2KNE A;  2LUX A;  1KCY A;  3NSK A;  1WRL A;  4PE1 A;  2FCD A;  1EH2 A;  1J55 A;  3O2P A;  1A2X A;  3TUY B;  1L2O C;  1YR5 A;  2MHH A;  1BR4 B;  1W7I B;  5F6T A;  1RJV A;  4M2O A;  3PAL A;  2F2O A;  3VRO A;  2KAX A;  2PMY A;  3KHE A;  4MVF A;  4ZCU A;  1UHJ A;  2HPS A;  1H8B A;  1FW4 A;  1M45 A;  1QXP A;  1JFJ A;  2F3Y A;  1DJX A;  1R2U A;  2GGZ A;  2PSR A;  3TS5 C;  4HRG A;  4CLN A;  1DMO A;  1S26 D;  1SY9 A;  2ZFD A;  4GPL B;  4JPZ B;  1QX5 B;  4IL1 A;  2PRU A;  1A75 B;  1NSH A;  1SL8 A;  4GNK B;  1KK7 Z;  2JZI A;  2K0J A;  1B9A A;  1GJY A;  4PE4 A;  2MAZ A;  2LV7 A;  2I18 A;  1LVC D;  1S1E A;  3BUX B;  3I5I B;  2V53 A;  1IGV A;  1F4Q A;  4ORB B;  2COL B;  1XYD A;  1TNP A;  2BBM A;  2NXQ A;  1FF1 A;  1AUI B;  4OKH A;  1K8U A;  3AAJ A;  2LLS A;  3CWG A;  4WRI A;  1DVI A;  1YUT A;  2JT8 A;  4DCK A;  2H2K A;  2L4I A;  4OVN F;  2WCB A;  1XFY O;  2KI6 C;  2M8U A;  3BOW B;  1PVA A;  2LVK A;  3I5F C;  2ISD A;  2M97 A;  3PN7 C;  1B7T Y;  4P2Y B;  1V1F A;  1F4O A;  1S6I A;  1B1G A;  1CLB A;  1OE9 B;  1SCV A;  1WDC B;  1Y6W A;  4A4C A;  1HQV A;  4PDZ A;  1MWN A;  1KK7 Y;  1K94 A;  1U5I A;  1SR6 B;  1JF0 A;  1DJZ A;  1Y1X A;  2BKI B;  2LP2 A;  3C1V A;  1S36 A;  3O4Y A;  3GK1 A;  2F33 A;  3I5G B;  2RGI A;  4PHM A;  3SG4 A;  1KK8 C;  1B7T Z;  3LK0 A;  2DOQ A;  2L2E A;  1ODB A;  3LCP C;  2MJW B;  4GBA A;  4MEW A;  4MRY A;  4OR9 B;  1UHK A;  1MUX A;  1CMF A;  1F8H A;  4E68 A;  2LMU A;  1DJI A;  5AFP A;  1QLS A;  2WOR A;  3CR4 X;  2JT0 A;  4R1E A;  2M7N A;  1K9U A;  1BJF A;  1RTP 1;  1QV1 A;  1W7J B;  3OP0 A;  2MA2 A;  2Y1M A;  5CSI A;  1C07 A;  4MZK A;  1J1E A;  1TOP A;  2F8P A;  3VRQ A;  1YUS A;  2G9B A;  1IQ5 A;  3DF0 A;  1R6P A;  2WCE A;  1IG5 A;  2JT3 A;  4HSZ A;  5CSJ A;  1CDP A;  1J7O A;  4BY4 A;  4XJK A;  3BUN B;  1FBV A;  1M39 A;  2WCF A;  3I5H B;  1JFK A;  1RWY A;  1TIZ A;  1DF0 A;  1QTX A;  1DTL A;  2JOJ A;  3NSO A;  2KFG A;  2H61 A;  4CID A;  4MBE A;  1UWO A;  4YBH B;  1B47 A;  1KSO A;  2WND A;  2EHB A;  2KBI A;  1WDC C;  2AMI A;  3BYA A;  1NCX A;  1EL4 A;  1OSA A;  4PCW A;  3EKH A;  1SR6 C;  2M49 B;  3NXA A;  1A29 A;  1NCZ A;  3CLN A;  2LLU A;  1BU3 A;  2Q4U A;  2GGM A;  1QX2 A;  4GUK A;  2KBM A;  1QX7 A;  1EJ3 A;  1ZAC A;  1CFD A;  2Q91 A;  1MXE A;  5AXI A;  4PAL A;  2QPT A;  2CNP A;  1N0Y A;  4XJK B;  2K7C A;  2L5X B;  3TDZ A;  2NLN A;  1J7R A;  1CDL A;  1EG3 A;  3EVU A;  3NSL A;  2LUC A;  3DD4 A;  5ER5 A;  1WRK A;  2LVI A;  3O6B A;  4XYN A;  1BMO A;  2WC8 A;  3LLE A;  1S6C A;  1DGV A;  1UUR A;  2M3W A;  3KEV A;  4WQ2 A;  1J7Q A;  3GK4 X;  1G4Y R;  1MQ1 A;  2G2B A;  2BE6 A;  2KQ6 A;  3KO0 A;  4YI8 A;  1WY9 A;  1A03 A;  1CFC A;  3NSI A;  1TCO B;  1NPQ A;  4HRH A;  4AQI A;  4YRU A;  3OX5 A;  2HQW A;  3TDU A;  3I5H C;  1NUB A;  3FS7 A;  4GAO A;  2CTN A;  4U8D A;  1KWO C;  2Y1N A;  4CPV A;  1AK8 A;  2OS8 B;  2ZRS A;  1CDN A;  2JC2 A;  4Q04 A;  1YVL A;  2JTZ A;  2QAC A;  3KF9 A;  4HRE E;  1BLQ A;  1DJG A;  1PRW A;  1NX3 A;  4N1F A;  1MR8 A;  1B8R A;  1SMG A;  5JJG A;  4PHJ A;  2BKH B;  1BOD A;  1DJH A;  1SKT A;  2MBX A;  5D7F A;  3TS5 B;  2BE4 A;  1C7V A;  1QAS A;  2AAO A;  2F2P A;  4MZL A;  1QJT A;  2Y4Q A;  1CNP A;  1JBA A;  4GGN A;  5HYD A;  3JVT C;  2F3Z A;  3F45 A;  3TUY C;  1FPW A;  3WXA A;  1CDM A;  2JUL A;  1J7P A;  1RK9 A;  2M9G A;  1K96 A;  3PAT A;  1GQM A;  1QIW A;  1LKJ A;  2KFF A;  3JTD C;  2LAN A;  2BCA A;  1JF2 A;  3BUO B;  5ER4 X;  1NP8 A;  4MSP A;  1G33 A;  1TNW A;  4ZCV A;  1CLL A;  4YGD B;  4PHK A;  3SG6 A;  2P6B B;  1QAT A;  1JUO A;  2VRG A;  2EC6 B;  1ZOT B;  2I7A A;  1K2H A;  2H61 C;  2LLT A;  1F70 A;  1D1O A;  1RRO A;  1CM4 A;  2MRD A;  2LNK A;  1XO5 A;  2KI4 B;  1QLK A;  1JSA A;  3SG7 A;  2BBN A;  3CS1 A;  2MLE C;  1OOJ A;  1WLM A;  3O78 A;  1SL9 A;  1A4P A;  3I5F B;  2JWW A;  2B1U A;  3WHU B;  4CFR A;  1UHI A;  3PFV A;  2JXL A;  1K9P A;  2TN4 A;  3ZNI A;  3CR2 A;  1KSM A;  4NDB A;  1AVS A;  1MF8 B;  3GOF A;  3VRR A;  4L9M A;  1OMV A;  3K21 A;  1NX2 A;  1S6J A;  2PAS A;  1KWO B;  4YGA A;  2KYC A;  2SCP A;  5KSZ A;  1DGU A;  1IJ5 A;  3RLZ A;  1NX0 A;  2L98 A;  1OMR A;  3DVM A;  1MXL C;  1V1G A;  2LMV A;  3EVR A;  1B8L A;  2L0P A;  3WHT B;  1AJ5 A;  3OB2 B;  2I94 A;  2K7D A;  3LK1 A;  1KQV A;  1VRK A;  4YGB B;  3A8R A;  1JC2 A;  1SRA A;  1K9K A;  3TZ1 A;  2EC6 C;  3PSR A;  4MZJ A;  5HKY A;  3JVT B;  1CLM A;  1YX7 A;  1Y1U A;  3I5G C;  1TTX A;  1PVB A;  2CBL A;  1OMD A;  3SIA A;  1X02 A;  5BPJ A;  3CGA A;  1HT9 A;  3JTD B;  2BL0 B;  1YUU A;  1Y1A A;  2R2I A;  2NCO A;  4NDC A;  1IJ6 A;  2LVJ A;  4YI9 A;  2JRF A;  1Q80 A;  2FJU B;  1ZFS A;  1CTR A;  1TNQ A;  2IS9 A;  1CM1 A;  2L4H A;  1UHN A;  1XFV O;  2HQ8 A;  3KPX A;  4GGF C;  4D1E A;  5AAN A;  4ORC B;  2SAS A;  2KSP A;  3CZT X;  2EGD A;  4C0L A;  4FQO A;  4ETO A;  2HET A;  4DS7 A;  1UP5 A;  1TNX A;  4WQ3 A;  2E6W A;  3DVK A;  2M0R A;  1JWD A;  5AER A;  2LVV A;  1SL7 A;  3VGO A;  2O60 A;  1SK6 D;  4TNC A;  1MHO A;  3DVE A;  4ICB A;  1M31 A;  3OX6 A;  5PAL A;  2OTG B;  2NCP A;  1GGW A;  2KGB C;  4C0K A;  1K95 A;  1PSR A;  3TDI A;  2BCX A;  2JPT A;  1QVI Z;  2L50 A;  3WNX B;  2CT9 A;  2KQY A;  4PHN A;  5KTY A;  4NDD A;  3AAK A;  1REC A;  1YRT B;  3BUM B;  1L2O B;  3D0Y B; 
#chains in the Genus database with same CATH topology
 1SYM A;  3O4X A;  4YGC B;  3H4S E;  2KPH A;  4GFT A;  3SIB A;  1ALV A;  1LXF C;  1YX8 A;  3SS5 A;  1QVI Y;  3RM1 A;  1BF5 A;  2LE9 B;  4ORB B;  5G08 A;  3AKA A;  2Y5I A;  2KLE A;  1QS7 A;  1CMG A;  1IH0 A;  3FWC A;  3D73 A;  5DKN A;  2K60 A;  3EK8 A;  3SS4 A;  1M46 A;  4BY5 A;  1LS8 A;  3SJS A;  1SCM C;  2MLF C;  3L47 A;  1WLZ A;  2LHL A;  3CZ2 A;  2NZ0 A;  2LP3 A;  2PAL A;  1LA0 A;  1OZO A;  1TCF A;  2WOS A;  3BXK A;  4PT1 A;  1F71 A;  4YGE B;  2CXJ A;  4MRX A;  1SW8 A;  3M0W A;  4OZD A;  1XK4 C;  4JKT A;  1IWQ A;  1H4B A;  3VRN A;  1RFJ A;  5CSN A;  1AHR A;  2KHN A;  2LMT A;  2OTG C;  4N5X A;  1GGZ A;  1LA3 A;  3SG5 A;  3CZ0 A;  1FF1 A;  3R1O A;  1PK0 D;  4QJ4 B;  3BUW B;  3I5I C;  3D0Y A;  1E8A A;  3EVV A;  2H8V A;  4JD9 A;  2K7B A;  1IKU A;  2JNF A;  2M7L A;  1KK8 B;  5I2Q A;  1QIV A;  1NCY A;  1KFX L;  5AEQ A;  2LM5 A;  3A4U B;  2KAV A;  4I5N B;  1SBJ A;  2D8N A;  2JNX A;  2LC5 A;  1XVJ A;  4ORA B;  1F55 A;  4DIR A;  4CFQ A;  1BR1 B;  2FCE A;  3VRP A;  1TN4 A;  5HKZ A;  5I94 A;  4M2P A;  3BFB A;  4MLW A;  2CCM A;  3ICB A;  5FYX A;  5DKQ A;  4DUQ A;  5FI6 A;  1OZS A;  2WCH A;  2OS8 C;  3DVJ A;  5K89 A;  3FE8 A;  3IQO A;  1XFX O;  2ERB A;  1S5G Z;  1CB1 A;  3AKB A;  2QDI A;  4JWQ A;  3CYZ A;  3OHM B;  5GQQ C;  4DRW A;  1OOG A;  5B8I B;  2L51 A;  4N1G A;  2ZKM X;  1UHH A;  3E3R A;  3PLF B;  3BOW A;  1K93 D;  3IVT A;  2K7O A;  2LCP A;  2JXC A;  1J1D A;  2WCL A;  2A4J A;  1NWD A;  4OV2 A;  1SSE B;  1AP4 A;  2JU0 A;  1PAL A;  1XA5 A;  1BG1 A;  4NQG A;  4PE0 A;  4F0Z B;  2K2F A;  5DKR A;  4QJ3 B;  1U5I B;  3FWB A;  3FIA A;  1SCM B;  4UPG A;  1GM0 A;  3PM8 A;  3PJI A;  1B8C A;  2JQ6 A;  1KFX S;  2KYF A;  3DY9 A;  1G8I A;  4MN0 A;  2K8M B;  4I5K A;  1N2D A;  3CTN A;  3IF7 A;  1ZUZ A;  1XFZ O;  1F54 A;  4PE7 A;  3N7H A;  1FI6 A;  1EXR A;  1S5G Y;  4JQ0 D;  1KQM B;  1XFW O;  3OB1 B;  2M29 A;  1NX1 A;  1QV0 A;  5I2O A;  2OPO A;  5HKW A;  2KOT A;  1DJW A;  1XFU O;  3R1P A;  5IBW A;  1LIN A;  1UUS A;  1ZMZ A;  5DIC A;  4QJ5 B;  3EK4 A;  4GGF A;  1M63 B;  2KDH A;  2YGU A;  1ALW A;  1NIW A;  1Y0V H;  3NHT A;  2KI4 C;  5KU1 A;  1YUR A;  4P5O E;  1L7Z A;  1SPY A;  2HF5 A;  2GV5 A;  2BCB A;  2PQL A;  2ZN9 A;  3HCM A;  1BT6 A;  2BEC A;  4FTG A;  1DJY A;  3D10 A;  2KAY A;  3D75 A;  1CFF A;  1PSB A;  1DC1 A;  5HLV A;  1K90 D;  3DF0 B;  1NYA A;  3Q8I A;  3LL8 B;  5I2L A;  5JOL A;  4AQJ A;  1OQP A;  3B87 A;  2E30 A;  5J3X A;  1BOC A;  2K2A A;  1P28 A;  4M2Q A;  1DEK A;  2LHI A;  4AOM A;  5D69 A;  1DF0 B;  1EG4 A;  2K61 A;  2ZRT A;  3D78 A;  1TRF A;  3QRX A;  1FI5 A;  2AUC A;  3MSE B;  1N65 A;  3CAB A;  5CSF A;  1CKK A;  3IQQ A;  1C7W A;  1CFP A;  1IRJ A;  1KQM C;  2O5G A;  3HX4 A;  1PUL A;  1AJ4 A;  1S3P A;  3BQ3 A;  5TNC A;  4A4B A;  1Z2C B;  2ZN8 A;  2FOT A;  3EKJ A;  2KGR A;  1B4C A;  2ZNE A;  3CR5 X;  3SG3 A;  1WRZ A;  4OCI A;  2PVB A;  2ZND A;  4USL A;  3EK7 A;  3SG2 A;  2LAP A;  1KFU S;  1YTZ C;  3B6X A;  1SNL A;  1IQ3 A;  1KFU L;  2I2R E;  1YRU B;  4I5J A;  3GK2 A;  5I8N A;  1DT7 B;  2BL0 C;  1YVH A;  4I5L B;  5HLO A;  3ZWH A;  2KFH A;  3PN7 B;  5CPV A;  2M1K B;  2JTT A;  2KI6 D;  1A75 A;  2QEV A;  1XK4 A;  2M1U A;  2KNE A;  2GTE A;  1DEL A;  2LUX A;  1KCY A;  3NSK A;  1WRL A;  4PE1 A;  2FCD A;  1EH2 A;  1J55 A;  3O2P A;  1A2X A;  3K1E A;  3TUY B;  1L2O C;  1YR5 A;  2MHH A;  1BR4 B;  1W7I B;  2WC5 A;  5F6T A;  1RJV A;  4M2O A;  3PM2 A;  3D77 A;  3PAL A;  2F2O A;  3VRO A;  3UNW A;  2KAX A;  2PMY A;  3KHE A;  4MVF A;  4ZCU A;  1UHJ A;  2HPS A;  1H8B A;  1FW4 A;  1M45 A;  1QXP A;  1JFJ A;  2F3Y A;  1DJX A;  1R2U A;  1TUZ A;  2GGZ A;  2PSR A;  3TS5 C;  4HRG A;  4CLN A;  1DMO A;  1S26 D;  1SY9 A;  4KYN A;  3DXL A;  2ZFD A;  5D3O A;  3B7A A;  4GPL B;  3S0A A;  4JPZ B;  1C3Y A;  1QX5 B;  4IL1 A;  2PRU A;  3OBV A;  1A75 B;  1NSH A;  1SL8 A;  4GNK B;  1KK7 Z;  5EL2 A;  2JZI A;  2QEB A;  2K0J A;  1B9A A;  3VB1 A;  1GJY A;  4PE4 A;  2MAZ A;  2LV7 A;  1LVC D;  1S1E A;  2I18 A;  1OOI X;  3BUX B;  2BNX A;  5FI2 A;  3I5I B;  1OW4 A;  1IGV A;  1F4Q A;  2V53 A;  2COL B;  1XYD A;  1TNP A;  2BBM A;  2NXQ A;  3CDN A;  1AUI B;  2FJY A;  4F7F A;  4OKH A;  1K8U A;  3AAJ A;  2LLS A;  3CWG A;  4WRI A;  1DVI A;  1YUT A;  2JT8 A;  4DCK A;  2H2K A;  2L4I A;  3OGN A;  4OVN F;  5HL1 A;  2WCB A;  1XFY O;  2KI6 C;  2M8U A;  3BOW B;  1PVA A;  2LVK A;  3EG5 B;  3I5F C;  2ISD A;  2WC6 A;  2M97 A;  3L4A A;  1B7T Y;  3PN7 C;  1V1F A;  1F4O A;  1S6I A;  4P2Y B;  1B1G A;  1CLB A;  1OE9 B;  1SCV A;  1WDC B;  1Y6W A;  4A4C A;  2P71 A;  1HQV A;  4PDZ A;  1MWN A;  1KK7 Y;  1IIO A;  5FI7 A;  1K94 A;  1U5I A;  1SR6 B;  1JF0 A;  1DJZ A;  1W9Z A;  1Y1X A;  2BKI B;  2LP2 A;  1TUJ A;  1S36 A;  3C1V A;  3O4Y A;  3GK1 A;  2F33 A;  3I5G B;  2RGI A;  4PHM A;  3SG4 A;  1KK8 C;  1B7T Z;  3LK0 A;  2DOQ A;  2L2E A;  1ODB A;  3LCP C;  2MJW B;  4GBA A;  4MEW A;  4MRY A;  4OR9 B;  1ORG A;  1UHK A;  1MUX A;  1CMF A;  1F8H A;  4E68 A;  4IJ7 A;  2LMU A;  1DJI A;  1TWO A;  5AFP A;  1QLS A;  2WOR A;  3CR4 X;  2JT0 A;  4R1E A;  2M7N A;  1K9U A;  3R1V A;  1BJF A;  1RTP 1;  1T14 A;  1QV1 A;  1W7J B;  3OP0 A;  2MA2 A;  2Y1M A;  5CSI A;  1C07 A;  4MZK A;  1J1E A;  3SS3 A;  1TOP A;  2F8P A;  3VRQ A;  1YUS A;  2G9B A;  1IQ5 A;  3DF0 A;  2P70 A;  1R6P A;  2WCE A;  1IG5 A;  2JT3 A;  2WCJ A;  4HSZ A;  5CSJ A;  4INW A;  1CDP A;  1J7O A;  4BY4 A;  4XJK A;  3BUN B;  1FBV A;  1M39 A;  2WCF A;  3I5H B;  1JFK A;  1RWY A;  1TIZ A;  1DF0 A;  1QTX A;  3S0F A;  1C3Z A;  1DTL A;  2JOJ A;  3NSO A;  2KFG A;  2H61 A;  4CID A;  4MBE A;  1UWO A;  4YBH B;  1B47 A;  1KSO A;  2WND A;  3NHI A;  2EHB A;  2KBI A;  1WDC C;  2AMI A;  3B88 A;  3FE9 A;  3BYA A;  1NCX A;  1EL4 A;  1OSA A;  4PCW A;  3EKH A;  1SR6 C;  3BFH A;  2M49 B;  3NXA A;  1A29 A;  1NCZ A;  3CLN A;  2LLU A;  2QEO A;  3CZ1 A;  1BU3 A;  2Q4U A;  2GGM A;  1QX2 A;  4GUK A;  2KBM A;  1QX7 A;  1EJ3 A;  1ZAC A;  1Z4H A;  1CFD A;  2Q91 A;  1MXE A;  5AXI A;  4PAL A;  2QPT A;  2CNP A;  1N0Y A;  4XJK B;  2K7C A;  2L5X B;  3TDZ A;  2NLN A;  3RZS A;  1J7R A;  1CDL A;  1EG3 A;  3EVU A;  3NSL A;  3DYE A;  2LUC A;  3UO9 A;  3DD4 A;  5ER5 A;  3S0D A;  1WRK A;  2LVI A;  3O6B A;  4XYN A;  3D74 A;  1BMO A;  2WC8 A;  3LLE A;  1S6C A;  1DGV A;  1UUR A;  2M3W A;  3KEV A;  4WQ2 A;  1J7Q A;  3GK4 X;  1G4Y R;  1MQ1 A;  2G2B A;  2BE6 A;  2KQ6 A;  2WCM A;  3KO0 A;  4YI8 A;  1WY9 A;  3V2L A;  1A03 A;  1CFC A;  3NSI A;  1TCO B;  1NPQ A;  4HRH A;  4AQI A;  4YRU A;  3OX5 A;  3S0E A;  2HQW A;  3TDU A;  3I5H C;  1NUB A;  3FS7 A;  4GAO A;  2CTN A;  4U8D A;  1KWO C;  2Y1N A;  4CPV A;  1AK8 A;  2OS8 B;  2ZRS A;  1CDN A;  2JC2 A;  4Q04 A;  1YVL A;  2JTZ A;  2QAC A;  3KF9 A;  4HRE E;  1BLQ A;  1DJG A;  3R72 A;  1PRW A;  1NX3 A;  4N1F A;  1MR8 A;  1B8R A;  1SMG A;  5JJG A;  4PHJ A;  2BKH B;  4INX A;  1BOD A;  1DJH A;  2WCK A;  1SKT A;  1QWV A;  2PYQ A;  5D7F A;  2MBX A;  2BE4 A;  3TS5 B;  1QAS A;  2AAO A;  2F2P A;  1C7V A;  4MZL A;  1QJT A;  2Y4Q A;  1CNP A;  1JBA A;  4GGN A;  5HYD A;  3JVT C;  2F3Z A;  3F45 A;  1XFR A;  3TUY C;  3WXA A;  1CDM A;  2JUL A;  1J7P A;  1FPW A;  1RK9 A;  2M9G A;  1K96 A;  3PAT A;  1GQM A;  1QIW A;  1LKJ A;  2KFF A;  3JTD C;  2LAN A;  2BCA A;  1JF2 A;  3BUO B;  5ER4 X;  1NP8 A;  4MSP A;  1G33 A;  1TNW A;  2L5Y A;  4ZCV A;  3L4L A;  1CLL A;  1OOH A;  4PHK A;  4YGD B;  2P6B B;  3SG6 A;  1QAT A;  1JUO A;  2VRG A;  2EC6 B;  1ZOT B;  2I7A A;  3BJH A;  1K2H A;  2H61 C;  2LLT A;  1F70 A;  1D1O A;  1RRO A;  1CM4 A;  2MRD A;  2LNK A;  1XO5 A;  2KI4 B;  1QLK A;  1JSA A;  3SG7 A;  2BBN A;  2BAP A;  3CS1 A;  2MLE C;  1OOJ A;  1WLM A;  3O78 A;  3BFA A;  1SL9 A;  1A4P A;  2JPO A;  3I5F B;  2JWW A;  2B1U A;  3WHU B;  4CFR A;  1UHI A;  3PFV A;  2JXL A;  1K9P A;  2TN4 A;  3ZNI A;  3CR2 A;  1KSM A;  4NDB A;  1AVS A;  1MF8 B;  3GOF A;  3VRR A;  4L9M A;  1OMV A;  3K21 A;  1NX2 A;  1S6J A;  2PAS A;  1KWO B;  4YGA A;  2KYC A;  2SCP A;  5KSZ A;  1DGU A;  1OOF A;  1IJ5 A;  3RLZ A;  1NX0 A;  2L98 A;  3B86 A;  3FE6 A;  1OMR A;  3DVM A;  1MXL C;  1V1G A;  2LMV A;  3EVR A;  1B8L A;  2L0P A;  4FQT A;  3WHT B;  1AJ5 A;  3OB2 B;  2I94 A;  2K7D A;  3LK1 A;  1KQV A;  1VRK A;  4YGB B;  3A8R A;  1JC2 A;  1SRA A;  1K9K A;  3TZ1 A;  2EC6 C;  3PSR A;  4MZJ A;  5HKY A;  3JVT B;  1CLM A;  1YX7 A;  3DZT A;  1Y1U A;  3I5G C;  1TTX A;  1PVB A;  2CBL A;  1OMD A;  3SIA A;  1X02 A;  5BPJ A;  3CGA A;  1HT9 A;  3JTD B;  2BL0 B;  3S0B A;  1YUU A;  1Y1A A;  2R2I A;  2NCO A;  4NDC A;  2L2C A;  1IJ6 A;  2LVJ A;  4YI9 A;  2JRF A;  2QEH A;  3S0G A;  1Q80 A;  2FJU B;  1ZFS A;  1CTR A;  1TNQ A;  2IS9 A;  1CM1 A;  2L4H A;  1UHN A;  1XFV O;  2HQ8 A;  3KPX A;  4GGF C;  4D1E A;  5AAN A;  4ORC B;  2SAS A;  2KSP A;  3CZT X;  2EGD A;  4C0L A;  4FQO A;  4ETO A;  2HET A;  4DS7 A;  1UP5 A;  1TNX A;  4WQ3 A;  3NGV A;  2E6W A;  3DVK A;  2M0R A;  1JWD A;  5AER A;  2LVV A;  1SL7 A;  3QME A;  3VGO A;  2O60 A;  1SK6 D;  4TNC A;  1MHO A;  3DVE A;  4ICB A;  1M31 A;  3OX6 A;  5PAL A;  2OTG B;  2NCP A;  1GGW A;  2KGB C;  4C0J A;  4C0K A;  1K95 A;  1PSR A;  3TDI A;  1DQE A;  3D76 A;  2BCX A;  2JPT A;  2KLD A;  1QVI Z;  2L50 A;  3WNX B;  2CT9 A;  2KQY A;  4PHN A;  5KTY A;  4NDD A;  3AAK A;  1REC A;  1YRT B;  3BUM B;  1L2O B;  3D0Y B; 
#chains in the Genus database with same CATH homology
 1SYM A;  4YGC B;  3H4S E;  4GFT A;  3SIB A;  1ALV A;  1LXF C;  1YX8 A;  1QVI Y;  3RM1 A;  1BF5 A;  2LE9 B;  5G08 A;  3AKA A;  2Y5I A;  1QS7 A;  1CMG A;  1IH0 A;  3FWC A;  5DKN A;  3EK8 A;  1M46 A;  4BY5 A;  3SJS A;  1SCM C;  2MLF C;  1WLZ A;  2LHL A;  4C0J A;  2NZ0 A;  2LP3 A;  2PAL A;  1LA0 A;  1OZO A;  1TCF A;  2WOS A;  3BXK A;  1F71 A;  4YGE B;  2CXJ A;  4MRX A;  1SW8 A;  3M0W A;  1H4B A;  1XK4 C;  1IWQ A;  3VRN A;  1RFJ A;  5CSN A;  1AHR A;  2KHN A;  2LMT A;  2OTG C;  4N5X A;  1GGZ A;  1LA3 A;  3SG5 A;  1PK0 D;  4QJ4 B;  3BUW B;  3I5I C;  3D0Y A;  1E8A A;  3EVV A;  2K7B A;  1IKU A;  2JNF A;  2M7L A;  1KK8 B;  5I2Q A;  1QIV A;  1NCY A;  1KFX L;  5AEQ A;  2LM5 A;  3A4U B;  2KAV A;  4I5N B;  1SBJ A;  2D8N A;  2JNX A;  2LC5 A;  1XVJ A;  4ORA B;  1F55 A;  4DIR A;  4CFQ A;  1BR1 B;  2FCE A;  3VRP A;  1TN4 A;  5HKZ A;  4M2P A;  4MLW A;  2CCM A;  3ICB A;  5FYX A;  5DKQ A;  4DUQ A;  1OZS A;  2OS8 C;  3DVJ A;  5K89 A;  3IQO A;  1XFX O;  1CB1 A;  1S5G Z;  3AKB A;  4JWQ A;  3OHM B;  5GQQ C;  4DRW A;  5B8I B;  2L51 A;  4N1G A;  2ZKM X;  1UHH A;  3E3R A;  3PLF B;  3BOW A;  1K93 D;  2K7O A;  2LCP A;  2JXC A;  1J1D A;  2A4J A;  1NWD A;  4OV2 A;  1AP4 A;  2JU0 A;  1PAL A;  1XA5 A;  1BG1 A;  4NQG A;  4PE0 A;  4F0Z B;  2K2F A;  5DKR A;  4QJ3 B;  1U5I B;  3FWB A;  3FIA A;  1SCM B;  4UPG A;  3PM8 A;  1B8C A;  2JQ6 A;  1KFX S;  2KYF A;  4MN0 A;  1G8I A;  2K8M B;  4I5K A;  1N2D A;  3CTN A;  3IF7 A;  1ZUZ A;  1XFZ O;  1F54 A;  4PE7 A;  1FI6 A;  1EXR A;  1S5G Y;  4JQ0 D;  1KQM B;  1XFW O;  3OB1 B;  2M29 A;  1NX1 A;  1QV0 A;  5I2O A;  2OPO A;  5HKW A;  2KOT A;  1DJW A;  1XFU O;  5IBW A;  1LIN A;  1UUS A;  1ZMZ A;  4QJ5 B;  3EK4 A;  4GGF A;  1M63 B;  2KDH A;  1ALW A;  1NIW A;  1Y0V H;  5KU1 A;  2KI4 C;  1YUR A;  4P5O E;  1L7Z A;  1SPY A;  2HF5 A;  2GV5 A;  2BCB A;  2ZN9 A;  3HCM A;  1BT6 A;  2BEC A;  4FTG A;  1DJY A;  3D10 A;  2KAY A;  1CFF A;  1PSB A;  5HLV A;  1K90 D;  3DF0 B;  1NYA A;  3LL8 B;  5I2L A;  5JOL A;  4AQJ A;  1OQP A;  2E30 A;  5J3X A;  1BOC A;  2K2A A;  4M2Q A;  2LHI A;  4AOM A;  5D69 A;  1DF0 B;  1EG4 A;  2K61 A;  2ZRT A;  3QRX A;  1TRF A;  1FI5 A;  2AUC A;  3MSE B;  1N65 A;  5CSF A;  1CKK A;  3IQQ A;  1C7W A;  1CFP A;  1IRJ A;  1KQM C;  2O5G A;  3HX4 A;  1PUL A;  1AJ4 A;  1S3P A;  3BQ3 A;  5TNC A;  4A4B A;  2ZN8 A;  2FOT A;  3EKJ A;  2KGR A;  1B4C A;  2ZNE A;  3CR5 X;  3SG3 A;  1WRZ A;  4OCI A;  2PVB A;  2ZND A;  4USL A;  3EK7 A;  3SG2 A;  2LAP A;  1KFU S;  1YTZ C;  1SNL A;  1IQ3 A;  1KFU L;  2I2R E;  1YRU B;  4I5J A;  3GK2 A;  5I8N A;  1DT7 B;  2BL0 C;  1YVH A;  4I5L B;  5HLO A;  3ZWH A;  2KFH A;  3PN7 B;  5CPV A;  2M1K B;  2JTT A;  2KI6 D;  1A75 A;  1XK4 A;  2M1U A;  2KNE A;  2LUX A;  1KCY A;  3NSK A;  1WRL A;  4PE1 A;  2FCD A;  1EH2 A;  1J55 A;  3O2P A;  1A2X A;  3TUY B;  1L2O C;  1YR5 A;  2MHH A;  1BR4 B;  1W7I B;  5F6T A;  1RJV A;  4M2O A;  3PAL A;  2F2O A;  3VRO A;  2KAX A;  2PMY A;  3KHE A;  4MVF A;  4ZCU A;  1UHJ A;  2HPS A;  1H8B A;  1FW4 A;  1M45 A;  1QXP A;  1JFJ A;  2F3Y A;  1DJX A;  1R2U A;  2GGZ A;  2PSR A;  3TS5 C;  4HRG A;  4CLN A;  1DMO A;  1S26 D;  1SY9 A;  2ZFD A;  4GPL B;  4JPZ B;  1QX5 B;  4IL1 A;  2PRU A;  1A75 B;  1NSH A;  1SL8 A;  4GNK B;  1KK7 Z;  2JZI A;  2K0J A;  1B9A A;  1GJY A;  4PE4 A;  2MAZ A;  2LV7 A;  2I18 A;  1LVC D;  1S1E A;  3BUX B;  3I5I B;  2V53 A;  1IGV A;  1F4Q A;  4ORB B;  2COL B;  1XYD A;  1TNP A;  2BBM A;  2NXQ A;  1FF1 A;  1AUI B;  4OKH A;  1K8U A;  3AAJ A;  2LLS A;  3CWG A;  4WRI A;  1DVI A;  1YUT A;  2JT8 A;  4DCK A;  2H2K A;  2L4I A;  4OVN F;  2WCB A;  1XFY O;  2KI6 C;  2M8U A;  3BOW B;  1PVA A;  2LVK A;  3I5F C;  2ISD A;  2M97 A;  3PN7 C;  1B7T Y;  4P2Y B;  1V1F A;  1F4O A;  1S6I A;  1B1G A;  1CLB A;  1OE9 B;  1SCV A;  1WDC B;  1Y6W A;  4A4C A;  1HQV A;  4PDZ A;  1MWN A;  1KK7 Y;  1K94 A;  1U5I A;  1SR6 B;  1JF0 A;  1DJZ A;  1Y1X A;  2BKI B;  2LP2 A;  3C1V A;  1S36 A;  3O4Y A;  3GK1 A;  2F33 A;  3I5G B;  2RGI A;  4PHM A;  3SG4 A;  1KK8 C;  1B7T Z;  3LK0 A;  2DOQ A;  2L2E A;  1ODB A;  3LCP C;  2MJW B;  4GBA A;  4MEW A;  4MRY A;  4OR9 B;  1UHK A;  1MUX A;  1CMF A;  1F8H A;  4E68 A;  2LMU A;  1DJI A;  5AFP A;  1QLS A;  2WOR A;  3CR4 X;  2JT0 A;  4R1E A;  2M7N A;  1K9U A;  1BJF A;  1RTP 1;  1QV1 A;  1W7J B;  3OP0 A;  2MA2 A;  2Y1M A;  5CSI A;  1C07 A;  4MZK A;  1J1E A;  1TOP A;  2F8P A;  3VRQ A;  1YUS A;  2G9B A;  1IQ5 A;  3DF0 A;  1R6P A;  2WCE A;  1IG5 A;  2JT3 A;  4HSZ A;  5CSJ A;  1CDP A;  1J7O A;  4BY4 A;  4XJK A;  3BUN B;  1FBV A;  1M39 A;  2WCF A;  3I5H B;  1JFK A;  1RWY A;  1TIZ A;  1DF0 A;  1QTX A;  1DTL A;  2JOJ A;  3NSO A;  2KFG A;  2H61 A;  4CID A;  4MBE A;  1UWO A;  4YBH B;  1B47 A;  1KSO A;  2WND A;  2EHB A;  2KBI A;  1WDC C;  2AMI A;  3BYA A;  1NCX A;  1EL4 A;  1OSA A;  4PCW A;  3EKH A;  1SR6 C;  2M49 B;  3NXA A;  1A29 A;  1NCZ A;  3CLN A;  2LLU A;  1BU3 A;  2Q4U A;  2GGM A;  1QX2 A;  4GUK A;  2KBM A;  1QX7 A;  1EJ3 A;  1ZAC A;  1CFD A;  2Q91 A;  1MXE A;  5AXI A;  4PAL A;  2QPT A;  2CNP A;  1N0Y A;  4XJK B;  2K7C A;  2L5X B;  3TDZ A;  2NLN A;  1J7R A;  1CDL A;  1EG3 A;  3EVU A;  3NSL A;  2LUC A;  3DD4 A;  5ER5 A;  1WRK A;  2LVI A;  3O6B A;  4XYN A;  1BMO A;  2WC8 A;  3LLE A;  1S6C A;  1DGV A;  1UUR A;  2M3W A;  3KEV A;  4WQ2 A;  1J7Q A;  3GK4 X;  1G4Y R;  1MQ1 A;  2G2B A;  2BE6 A;  2KQ6 A;  3KO0 A;  4YI8 A;  1WY9 A;  1A03 A;  1CFC A;  3NSI A;  1TCO B;  1NPQ A;  4HRH A;  4AQI A;  4YRU A;  3OX5 A;  2HQW A;  3TDU A;  3I5H C;  1NUB A;  3FS7 A;  4GAO A;  2CTN A;  4U8D A;  1KWO C;  2Y1N A;  4CPV A;  1AK8 A;  2OS8 B;  2ZRS A;  1CDN A;  2JC2 A;  4Q04 A;  1YVL A;  2JTZ A;  2QAC A;  3KF9 A;  4HRE E;  1BLQ A;  1DJG A;  1PRW A;  1NX3 A;  4N1F A;  1MR8 A;  1B8R A;  1SMG A;  5JJG A;  4PHJ A;  2BKH B;  1BOD A;  1DJH A;  1SKT A;  2MBX A;  5D7F A;  3TS5 B;  2BE4 A;  1C7V A;  1QAS A;  2AAO A;  2F2P A;  4MZL A;  1QJT A;  2Y4Q A;  1CNP A;  1JBA A;  4GGN A;  5HYD A;  3JVT C;  2F3Z A;  3F45 A;  3TUY C;  1FPW A;  3WXA A;  1CDM A;  2JUL A;  1J7P A;  1RK9 A;  2M9G A;  1K96 A;  3PAT A;  1GQM A;  1QIW A;  1LKJ A;  2KFF A;  3JTD C;  2LAN A;  2BCA A;  1JF2 A;  3BUO B;  5ER4 X;  1NP8 A;  4MSP A;  1G33 A;  1TNW A;  4ZCV A;  1CLL A;  4YGD B;  4PHK A;  3SG6 A;  2P6B B;  1QAT A;  1JUO A;  2VRG A;  2EC6 B;  1ZOT B;  2I7A A;  1K2H A;  2H61 C;  2LLT A;  1F70 A;  1D1O A;  1RRO A;  1CM4 A;  2MRD A;  2LNK A;  1XO5 A;  2KI4 B;  1QLK A;  1JSA A;  3SG7 A;  2BBN A;  3CS1 A;  2MLE C;  1OOJ A;  1WLM A;  3O78 A;  1SL9 A;  1A4P A;  3I5F B;  2JWW A;  2B1U A;  3WHU B;  4CFR A;  1UHI A;  3PFV A;  2JXL A;  1K9P A;  2TN4 A;  3ZNI A;  3CR2 A;  1KSM A;  4NDB A;  1AVS A;  1MF8 B;  3GOF A;  3VRR A;  4L9M A;  1OMV A;  3K21 A;  1NX2 A;  1S6J A;  2PAS A;  1KWO B;  4YGA A;  2KYC A;  2SCP A;  5KSZ A;  1DGU A;  1IJ5 A;  3RLZ A;  1NX0 A;  2L98 A;  1OMR A;  3DVM A;  1MXL C;  1V1G A;  2LMV A;  3EVR A;  1B8L A;  2L0P A;  3WHT B;  1AJ5 A;  3OB2 B;  2I94 A;  2K7D A;  3LK1 A;  1KQV A;  1VRK A;  4YGB B;  3A8R A;  1JC2 A;  1SRA A;  1K9K A;  3TZ1 A;  2EC6 C;  3PSR A;  4MZJ A;  5HKY A;  3JVT B;  1CLM A;  1YX7 A;  1Y1U A;  3I5G C;  1TTX A;  1PVB A;  2CBL A;  1OMD A;  3SIA A;  1X02 A;  5BPJ A;  3CGA A;  1HT9 A;  3JTD B;  2BL0 B;  1YUU A;  1Y1A A;  2R2I A;  2NCO A;  4NDC A;  1IJ6 A;  2LVJ A;  4YI9 A;  2JRF A;  1Q80 A;  2FJU B;  1ZFS A;  1CTR A;  1TNQ A;  2IS9 A;  1CM1 A;  2L4H A;  1UHN A;  1XFV O;  2HQ8 A;  3KPX A;  4GGF C;  4D1E A;  5AAN A;  4ORC B;  2SAS A;  2KSP A;  3CZT X;  2EGD A;  4C0L A;  4FQO A;  4ETO A;  2HET A;  4DS7 A;  1UP5 A;  1TNX A;  4WQ3 A;  2E6W A;  3DVK A;  2M0R A;  1JWD A;  5AER A;  2LVV A;  1SL7 A;  3VGO A;  2O60 A;  1SK6 D;  4TNC A;  1MHO A;  3DVE A;  4ICB A;  1M31 A;  3OX6 A;  5PAL A;  2OTG B;  2NCP A;  1GGW A;  2KGB C;  4C0K A;  1K95 A;  1PSR A;  3TDI A;  2BCX A;  2JPT A;  1QVI Z;  2L50 A;  3WNX B;  2CT9 A;  2KQY A;  4PHN A;  5KTY A;  4NDD A;  3AAK A;  1REC A;  1YRT B;  3BUM B;  1L2O B;  3D0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...