1KFXS

Crystal structure of human m-calpain form i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
176
Chain Sequence
b'NESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords M-CALPAIN LARGE SUBUNIT
publication title The crystal structure of calcium-free human m-calpain suggests an electrostatic switch mechanism for activation by calcium.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2001-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kfxS00
1QX7A 1EG4A 4MZLA 2M7LA 1CKKA 2LANA 1NPQA 2JXLA 2M97A 2BCXA 1TOPA 2M29A 1RJVA 4MVFA 1SYMA 1SL8A 1NWDA 1SW8A 2KGRA 1JFKA 1HQVA 3OB1B 3CR2A 5JOLA 4OVNF 5I8NA 1FI6A 1LXFC 3BOWB 4MSPA 1LINA 1SL7A 5JJGA 2F3ZA 2V53A 4GGFA 2F2OA 4YGCB 1RTP1 1XK4C 2O5GA 1CM1A 1DJZA 1TNQA 2Q91A 4HREE 1DF0B 4DIRA 5CSNA 1F71A 1QJTA 1OQPA 1XFVO 3GK4X 4N1GA 3O2PA 2KYCA 4MZKA 1DJGA 1RFJA 3KF9A 2FCDA 2AMIA 3KHEA 1EXRA 1X02A 3BUNB 5KTYA 1UURA 3O6BA 1TNPA 1CLMA 1WY9A 2Y4QA 3A8RA 3RLZA 1YRUB 4PHNA 1CMGA 4ORAB 2KOTA 2WC8A 2E30A 1KFXS 1M46A 2FCEA 1UHHA 1KK7Y 2O60A 2JNXA 1KQMB 5CSFA 2EHBA 1J1DA 1KFXL 2MRDA 4L9MA 4DS7A 5TNCA 2JTTA 3PN7B 2JQ6A 1NCYA 1ALVA 2JZIA 1ZMZA 2A4JA 5FYXA 2M49B 1HT9A 2ZNDA 3I5IB 4PE4A 2NZ0A 3JVTC 2H61A 1MHOA 2KI6D 3DVEA 3I5HC 2Y5IA 2KYFA 2VRGA 4XJKA 1Q80A 2KNEA 1N2DA 1YRTB 5K89A 1BT6A 1K94A 1W7JB 3PALA 2TN4A 2PASA 4YGEB 5ER5A 1QATA 3VROA 4GUKA 1CFPA 2BCAA 2JULA 1PSRA 3CWGA 4OV2A 1K90D 4YI8A 2FJUB 1QIVA 1PVAA 1TCOB 2ZRTA 3F45A 3SG3A 4N5XA 1CNPA 1WRKA 5DKQA 1PRWA 3BQ3A 3LCPC 1TN4A 4N1FA 1C7VA 4CFQA 1DGUA 1B9AA 2WCBA 1AHRA 1SCMC 1VRKA 4JPZB 3E3RA 1K96A 2K7DA 1RK9A 3ZWHA 5AFPA 1DTLA 1H4BA 1IWQA 1K95A 2LE9B 1CDMA 2M1KB 3NSIA 4PALA 3VRQA 3VRRA 3D10A 2LVIA 3TDIA 2MLFC 1PULA 2G9BA 3AAKA 2KAVA 4NDBA 1QASA 1CTRA 4HRGA 1S6IA 4I5KA 4ETOA 1SPYA 3C1VA 1U5IA 1PK0D 3DD4A 2B1UA 1S5GZ 4NQGA 5CSJA 4M2OA 3WHTB 1NX2A 1UHNA 2I94A 3DVJA 1BF5A 4OR9B 1DF0A 3O4YA 2KBIA 4U8DA 2F3YA 3NSLA 3JVTB 1SBJA 2GGZA 2PSRA 2K0JA 5F6TA 1CFCA 2M7NA 1YVLA 3LLEA 4YGBB 2CT9A 1ZOTB 4F0ZB 3SG5A 2CTNA 3CTNA 3PN7C 4NDDA 1JF2A 2HPSA 3I5GC 2R2IA 3FWCA 1JWDA 1S26D 1DT7B 2NXQA 3I5IC 1OZOA 4PHJA 3FIAA 4C0KA 1G8IA 1S3PA 2BKHB 2JT3A 2K8MB 4IL1A 4Q04A 4CPVA 5I2QA 1QLKA 1SY9A 2JPTA 2JNFA 2KQ6A 1M39A 1S1EA 2AUCA 2Y1MA 1SCMB 2MAZA 1K9KA 3K21A 3CR5X 4NDCA 2WOSA 1BJFA 4D1EA 2L4HA 2WORA 4ZCUA 1YR5A 2LVKA 2BE6A 2LLUA 5CSIA 1IQ3A 2KSPA 4M2QA 1GGZA 2CCMA 3IQQA 2Q4UA 4ICBA 4YGAA 4YBHB 1GGWA 3EK4A 2L4IA 2OS8C 4WQ3A 1H8BA 1B7TZ 3AKBA 1JBAA 4WRIA 1FF1A 2HETA 1N0YA 1NX0A 1MXLC 1A75B 3BUXB 3SIAA 1J7RA 1LVCD 3PSRA 1XFZO 2MHHA 1XK4A 4P2YB 1XFXO 3GOFA 1UUSA 4I5NB 1XFUO 1XA5A 3CS1A 3DF0B 3HX4A 1SR6B 1OOJA 4XYNA 4PCWA 1QVIZ 1BG1A 1QV0A 2LUXA 3KO0A 5J3XA 2I2RE 2LMTA 3BYAA 2CNPA 1YURA 2GV5A 2LNKA 3KPXA 5HKYA 3GK1A 1F4QA 1OE9B 1KK7Z 2D8NA 1IKUA 3I5GB 4R1EA 2K2AA 2M0RA 2G2BA 1AVSA 3PATA 4PE0A 1XFWO 2LLSA 2JT8A 1IGVA 1BR1B 3H4SE 3BUOB 5D69A 1AK8A 2BECA 1UHKA 4GPLB 4I5LB 2BBNA 3TS5C 5I2OA 1MR8A 3PM8A 1QIWA 1ODBA 2CBLA 1FW4A 3CGAA 1A2XA 4HSZA 1KCYA 2BCBA 3WNXB 1RECA 3SJSA 1CDPA 2LC5A 5PALA 1PSBA 4QJ4B 1R2UA 3VRPA 3OB2B 3NSKA 4PHKA 4A4CA 2E6WA 1TNWA 1KSOA 1EJ3A 3I5FC 1PVBA 2LUCA 1UWOA 2KBMA 4QJ5B 1CMFA 3EK8A 4USLA 5AANA 1B8CA 4GGNA 2OS8B 4JWQA 1S36A 4M2PA 2ZNEA 1QLSA 2JTZA 1A4PA 2KAYA 3DVMA 1DJHA 3QRXA 3FWBA 4MRYA 3LK1A 1KWOB 4ORCB 1LA0A 1ZUZA 1YUSA 2LV7A 2QACA 5AEQA 3ZNIA 3TUYC 1XYDA 1KQVA 1K8UA 3D0YB 5HKWA 3SIBA 1KSMA 5AERA 1NIWA 1DJIA 1A03A 1JSAA 1S6CA 1YX7A 2FOTA 3NXAA 2BBMA 1OMDA 3LL8B 1CFDA 2K61A 2CXJA 1QX5B 1UHJA 3BOWA 1M45A 5B8IB 1JFJA 3SG6A 1AJ5A 2KFGA 2M1UA 4AQJA 2F8PA 5ER4X 4C0LA 4YRUA 1N65A 4GAOA 4P5OE 1K9PA 1NUBA 4JQ0D 1IH0A 2COLB 1SR6C 3EVVA 2QPTA 4PE7A 3EKJA 4DUQA 3TS5B 1FBVA 3EK7A 3LK0A 1S5GY 2M9GA 5AXIA 1A29A 2KAXA 1DJXA 1MXEA 1B4CA 1M63B 4MRXA 2MBXA 3VGOA 1ALWA 4DCKA 4TNCA 4CLNA 2OPOA 1QS7A 2BKIB 1SRAA 2L51A 5IBWA 1QX2A 2LM5A 4CIDA 2LVVA 3I5FB 3SG2A 2LMUA 4ORBB 1L7ZA 1F70A 1TRFA 4YI9A 5KSZA 1MWNA 3KEVA 4I5JA 3HCMA 1DVIA 2BL0B 2GGMA 1Y1AA 1F8HA 3AKAA 3WXAA 4FTGA 4AQIA 2K7BA 2L2EA 1L2OC 3NSOA 3GK2A 1LA3A 4GGFC 1LKJA 1SL9A 1YUTA 2LHLA 2LVJA 1UHIA 1IJ5A 1CB1A 3TUYB 1YTZC 1DJWA 2L50A 1WLZA 1NP8A 1CM4A 1NX1A 2HQWA 2KI4B 1XFYO 3TDZA 3TDUA 2PRUA 1DJYA 1B1GA 2JT0A 1E8AA 2K7CA 2EGDA 1F55A 2JRFA 1CDLA 1MUXA 1U5IB 1QV1A 1RWYA 3M0WA 3PFVA 1J7OA 2NLNA 2KFHA 1KWOC 3OHMB 2MLEC 2I18A 1B7TY 3CR4X 1EH2A 1K2HA 1NCZA 1NSHA 1S6JA 2HQ8A 1YUUA 2LMVA 4DRWA 1JF0A 2M8UA 4MN0A 1CDNA 2KFFA 2LHIA 1XO5A 1RROA 4C0JA 1W7IB 4MZJA 3PLFB 1NCXA 4CFRA 1Y1UA 1KK8C 1EG3A 1K93D 3EVUA 1OSAA 1QVIY 4PDZA 1WRZA 4MLWA 1GQMA 3FS7A 4WQ2A 2ZKMX 3D0YA 4YGDB 1SMGA 4E68A 1J7QA 5GQQC 2JC2A 2OTGB 2H61C 3JTDB 1R6PA 3OP0A 3VRNA 1JC2A 1BR4B 4OKHA 2LLTA 5HLVA 5BPJA 4PHMA 1ZACA 2RGIA 1QTXA 4ZCVA 4BY5A 3SG4A 1KFUS 2ZRSA 1WRLA 3OX6A 1DGVA 5DKNA 1GJYA 3O78A 1MF8B 2EC6B 3IQOA 1MQ1A 4MBEA 1J1EA 2LP2A 1WDCB 1L2OB 3WHUB 1EL4A 1BMOA 2KGBC 1KFUL 1NYAA 1IJ6A 1FPWA 2L98A 2HF5A 3CZTX 1YX8A 1D1OA 1Y0VH 3MSEB 1G33A 2BL0C 1DMOA 2ZN9A 5HKZA 1WLMA 1IG5A 2PVBA 3TZ1A 1CFFA 2BE4A 2MJWB 1XVJA 2KHNA 3SG7A 1ZFSA 2KI6C 1AUIB 1M31A 2I7AA 2JWWA 1Y1XA 5G08A 2LP3A 4MEWA 1BODA 4A4BA 1F54A 1SKTA 4GFTA 2L0PA 2KDHA 1SNLA 2KI4C 2WCEA 1NX3A 2AAOA 2PMYA 4QJ3B 2ISDA 5HYDA 3CLNA 3OX5A 1CLBA 4BY4A 3EVRA 5DKRA 1J7PA 1CLLA 3RM1A 2JU0A 1OMRA 2DOQA 1B47A 1KK8B 1V1FA 2SCPA 2ZN8A 4FQOA 4HRHA 5D7FA 1AP4A 2SASA 1QXPA 1AJ4A 1IQ5A 3BUWB 2F2PA 1B8RA 1BOCA 4GBAA 3A4UB 1B8LA 2Y1NA 3ICBA 3IF7A 1J55A 1JUOA 1V1GA 1TTXA 1A75A 1FI5A 2KQYA 2IS9A 2ZFDA 1TCFA 4XJKB 2L5XB 3DVKA 1UP5A 4PE1A 2M3WA 1BLQA 1SCVA 1TIZA 2P6BB 5HLOA 2K2FA 2PALA 2WCFA 1G4YR 3DF0A 3AAJA 5KU1A 2OTGC 3JTDC 1Y6WA 4AOMA 1K9UA 1BU3A 1OMVA 1OZSA 2NCPA 2WNDA 4GNKB 3I5HB 1KQMC 1SK6D 4OCIA 1PALA 3EKHA 2LCPA 2JXCA 1F4OA 2EC6C 3BUMB 2NCOA 2JOJA 1YVHA 1WDCC 2H2KA 5I2LA 2F33A 1C07A 2MA2A 2LAPA 3BXKA 2K7OA 5CPVA 1TNXA 4UPGA 1C7WA 1IRJA
chains in the Genus database with same CATH superfamily
1QX7A 1EG4A 4MZLA 2M7LA 1CKKA 2LANA 1NPQA 2JXLA 2M97A 2BCXA 1TOPA 2M29A 1RJVA 4MVFA 1SYMA 3B7AA 1SL8A 1NWDA 1SW8A 2KGRA 1JFKA 1HQVA 3OB1B 4INXA 3CR2A 5JOLA 4OVNF 3CZ2A 5I8NA 1DQEA 1FI6A 1LXFC 3BOWB 4MSPA 1LINA 1SL7A 2JPOA 2F3ZA 2V53A 4GGFA 2F2OA 4OZDA 5JJGA 4YGCB 1RTP1 1XK4C 2O5GA 1CM1A 4FQTA 1DJZA 1TNQA 2Q91A 4HREE 1DF0B 3CYZA 4DIRA 5CSNA 1F71A 1QJTA 1OQPA 1XFVO 3GK4X 4N1GA 3O2PA 2KYCA 3D77A 1DJGA 3FE9A 4MZKA 1RFJA 3KF9A 3D76A 2FCDA 2AMIA 3KHEA 1EXRA 1X02A 3BUNB 5KTYA 1UURA 3O6BA 1TNPA 1CLMA 1WY9A 2Y4QA 3EG5B 3A8RA 3RLZA 1YRUB 4PHNA 1CMGA 4ORAB 2KOTA 2WC8A 2E30A 1KFXS 1M46A 2FCEA 1UHHA 1KK7Y 2O60A 2JNXA 1KQMB 5CSFA 5EL2A 2EHBA 1J1DA 1KFXL 2MRDA 4L9MA 5FI2A 4DS7A 5TNCA 2JTTA 3PN7B 2JQ6A 1NCYA 1ALVA 2JZIA 1ZMZA 1OW4A 2A4JA 5FYXA 2M49B 1HT9A 1OOHA 2ZNDA 3I5IB 4PE4A 2NZ0A 3JVTC 2H61A 1MHOA 2KI6D 3DVEA 3BFAA 3I5HC 2Y5IA 2KYFA 2VRGA 4INWA 4XJKA 1Q80A 2KNEA 1Z4HA 1N2DA 3Q8IA 1YRTB 5K89A 1QWVA 1BT6A 3CZ0A 1K94A 1W7JB 3PALA 2TN4A 2PASA 4YGEB 5ER5A 1QATA 3VROA 4GUKA 1CFPA 2BCAA 2H8VA 1PSRA 1TUZA 2JULA 3CWGA 4OV2A 3IVTA 1K90D 4YI8A 2FJUB 3S0GA 3OGNA 1QIVA 1PVAA 1TCOB 2ZRTA 3F45A 3SG3A 4N5XA 1CNPA 1WRKA 5DKQA 1PRWA 3BQ3A 3LCPC 1TN4A 4N1FA 1C7VA 3S0EA 1TUJA 4CFQA 1DGUA 1B9AA 2WCBA 1AHRA 4KYNA 3S0AA 1SCMC 1VRKA 4JPZB 3E3RA 1K96A 2K7DA 1RK9A 3ZWHA 5AFPA 2QEOA 4JD9A 1DTLA 1H4BA 1IWQA 1K95A 2LE9B 1CDMA 2M1KB 3NSIA 3PJIA 4PALA 3VRQA 3VRRA 3D10A 4JKTA 2LVIA 3TDIA 2MLFC 1PULA 2G9BA 3AAKA 2KAVA 3DYEA 1DEKA 4NDBA 1QASA 1CTRA 4HRGA 1S6IA 4I5KA 4ETOA 1SPYA 3C1VA 1U5IA 1PK0D 3DD4A 2B1UA 1S5GZ 4NQGA 3NGVA 5CSJA 4M2OA 3WHTB 1NX2A 1UHNA 2I94A 3DVJA 1BF5A 4OR9B 1DF0A 3O4YA 2KBIA 4U8DA 2F3YA 3SS3A 3NSLA 3JVTB 1SBJA 2GGZA 2PSRA 2K0JA 5F6TA 1CFCA 2M7NA 1YVLA 3LLEA 4YGBB 2FJYA 2CT9A 1ZOTB 4F0ZB 3SG5A 2CTNA 3CTNA 3PN7C 3UNWA 4NDDA 1JF2A 2HPSA 3I5GC 2R2IA 3FWCA 3DZTA 1JWDA 1S26D 1DT7B 2NXQA 3I5IC 5HL1A 1OZOA 4PHJA 3FIAA 4C0KA 3BJHA 1G8IA 1S3PA 2BKHB 2JT3A 2K8MB 4IL1A 4Q04A 3SS4A 4CPVA 5I2QA 1QLKA 1SY9A 2JPTA 2JNFA 2KQ6A 5D3OA 1M39A 1S1EA 2AUCA 2Y1MA 1SCMB 2MAZA 1K9KA 3K21A 3CR5X 4NDCA 2WOSA 1BJFA 2YGUA 2L4HA 2WORA 4ZCUA 4D1EA 1YR5A 2LVKA 2BE6A 2LLUA 5CSIA 1IQ3A 2KSPA 4M2QA 1DELA 3CZ1A 1GGZA 2CCMA 3IQQA 2Q4UA 4ICBA 4YGAA 3BFHA 4YBHB 1GGWA 3EK4A 2L4IA 2OS8C 4WQ3A 1H8BA 1B7TZ 2K60A 3AKBA 2BNXA 4WRIA 1JBAA 1FF1A 2HETA 1N0YA 1NX0A 1MXLC 1A75B 3BUXB 3SIAA 1J7RA 3N7HA 1LVCD 3PSRA 1XFZO 2MHHA 1XK4A 4P2YB 1XFXO 3GOFA 1UUSA 4I5NB 3OBVA 1XFUO 1XA5A 3CS1A 3V2LA 3DF0B 3HX4A 1SR6B 3CABA 1OOJA 3R1PA 4PCWA 1QVIZ 4XYNA 1BG1A 1QV0A 2LUXA 3KO0A 5J3XA 2I2RE 2LMTA 2KLEA 2CNPA 3BYAA 1OOFA 1YURA 2GV5A 2LNKA 3R1VA 1W9ZA 3KPXA 5HKYA 3GK1A 4PT1A 1F4QA 1OE9B 3FE8A 1KK7Z 2D8NA 1IKUA 2GTEA 3I5GB 4R1EA 2K2AA 2M0RA 2G2BA 1AVSA 3PATA 4PE0A 1XFWO 2LLSA 2JT8A 1IGVA 1BR1B 3H4SE 3BUOB 5D69A 1AK8A 1UHKA 2BECA 4GPLB 4I5LB 2BBNA 2WCMA 3TS5C 5I2OA 1MR8A 3PM8A 1QIWA 1SSEB 1ODBA 5FI7A 2CBLA 1FW4A 3CGAA 1A2XA 4HSZA 1KCYA 2BCBA 3WNXB 1RECA 3SJSA 1CDPA 2LC5A 5PALA 1PSBA 4QJ4B 1R2UA 3VRPA 3OB2B 3NSKA 4PHKA 4A4CA 2E6WA 2WCHA 1TNWA 1KSOA 1EJ3A 3I5FC 1PVBA 3B86A 2LUCA 1UWOA 2KBMA 1Z2CB 2WCKA 3K1EA 4QJ5B 1CMFA 3EK8A 4USLA 5AANA 3D73A 1B8CA 4GGNA 2OS8B 4JWQA 1S36A 4M2PA 2ZNEA 1QLSA 2JTZA 1A4PA 3D75A 2KAYA 3DVMA 1DJHA 3QRXA 3FWBA 4MRYA 3LK1A 3B88A 1KWOB 4ORCB 1LA0A 1ZUZA 1YUSA 2LV7A 2QACA 5AEQA 3ZNIA 3R72A 1XYDA 2WCLA 3TUYC 1K8UA 5DICA 1KQVA 3D0YB 5HKWA 3SIBA 1KSMA 5AERA 1NIWA 1DJIA 1A03A 1JSAA 1S6CA 1YX7A 2FOTA 3NXAA 2BBMA 1OMDA 3LL8B 1CFDA 2K61A 2CXJA 1QX5B 1UHJA 3BOWA 1M45A 5B8IB 1JFJA 3SG6A 1AJ5A 2KFGA 2M1UA 4AQJA 2F8PA 5ER4X 4C0LA 4YRUA 1N65A 3QMEA 4GAOA 4P5OE 1K9PA 1NUBA 4JQ0D 1IH0A 2COLB 1SR6C 3EVVA 2QPTA 4PE7A 3EKJA 4DUQA 4F7FA 2KPHA 3TS5B 1FBVA 3EK7A 3LK0A 1S5GY 2M9GA 5AXIA 1A29A 1C3ZA 2KAXA 1DJXA 1MXEA 1B4CA 1M63B 3L4LA 4MRXA 2MBXA 1ALWA 3VGOA 4DCKA 4TNCA 4CLNA 2OPOA 3NHIA 1QS7A 2BKIB 1SRAA 2L51A 5IBWA 1QX2A 2LM5A 2ERBA 4CIDA 2LVVA 1IIOA 3I5FB 3SG2A 2LMUA 4ORBB 1L7ZA 1F70A 1TRFA 4YI9A 3UO9A 5KSZA 2QEBA 1MWNA 3KEVA 4I5JA 3HCMA 1DVIA 2BL0B 3B6XA 2GGMA 1Y1AA 1F8HA 2KLDA 3AKAA 3WXAA 4FTGA 4AQIA 3BFBA 2K7BA 2L2EA 1L2OC 3NSOA 3GK2A 2L5YA 1LA3A 4GGFC 1LKJA 1SL9A 1YUTA 2LHLA 2LVJA 1UHIA 1IJ5A 1CB1A 3TUYB 1YTZC 1DJWA 2L50A 1GM0A 1WLZA 1NP8A 1CM4A 1NX1A 2HQWA 2KI4B 1XFYO 3TDZA 2QDIA 3TDUA 2PRUA 1DJYA 1B1GA 2JT0A 1E8AA 2K7CA 2EGDA 3R1OA 1F55A 2JRFA 1CDLA 1MUXA 1U5IB 1QV1A 1RWYA 3M0WA 3PFVA 1J7OA 2NLNA 2KFHA 1KWOC 1OOIX 3OHMB 2MLEC 2I18A 1B7TY 3CR4X 1EH2A 1K2HA 1NCZA 1NSHA 1S6JA 2HQ8A 1YUUA 3FE6A 2LMVA 1P28A 4DRWA 1JF0A 2M8UA 2BAPA 4MN0A 1C3YA 1CDNA 2KFFA 2LHIA 1XO5A 1RROA 4C0JA 1W7IB 4MZJA 3PLFB 1NCXA 4CFRA 1Y1UA 1KK8C 1EG3A 1K93D 3EVUA 1OSAA 1QVIY 3L47A 4PDZA 1WRZA 4MLWA 1GQMA 3FS7A 3L4AA 2ZKMX 3D0YA 4WQ2A 1SMGA 2P70A 4YGDB 4E68A 1J7QA 5GQQC 2JC2A 2OTGB 2H61C 3JTDB 1R6PA 3OP0A 3VRNA 1JC2A 1BR4B 4OKHA 2LLTA 5HLVA 5BPJA 4PHMA 1ZACA 2RGIA 1QTXA 1XFRA 4ZCVA 4BY5A 3SG4A 1KFUS 2ZRSA 1WRLA 3OX6A 1DGVA 5DKNA 1GJYA 3O78A 1MF8B 2EC6B 3IQOA 1MQ1A 4MBEA 1J1EA 2LP2A 1WDCB 1L2OB 3WHUB 1EL4A 1BMOA 2KGBC 1KFUL 1NYAA 1IJ6A 1FPWA 3D74A 2L98A 2HF5A 3CZTX 1YX8A 1D1OA 1Y0VH 3MSEB 1G33A 2BL0C 1DMOA 2ZN9A 5HKZA 1WLMA 3S0FA 3S0DA 3O4XA 1IG5A 2PVBA 3TZ1A 1CFFA 3S0BA 2BE4A 2MJWB 1XVJA 2KHNA 3SG7A 2QEHA 1ZFSA 2KI6C 2WC5A 1AUIB 1M31A 2I7AA 2JWWA 1Y1XA 5G08A 2LP3A 2QEVA 4MEWA 4A4BA 1BODA 1F54A 3PM2A 1SKTA 1DC1A 4GFTA 3RZSA 2L0PA 2KDHA 1SNLA 2KI4C 2WCEA 1NX3A 2AAOA 2P71A 2PMYA 4QJ3B 2ISDA 5HYDA 3CLNA 3OX5A 5FI6A 1CLBA 4BY4A 3EVRA 5DKRA 1J7PA 1CLLA 2PQLA 3RM1A 2WCJA 2JU0A 1OMRA 2DOQA 1B47A 1KK8B 1TWOA 1V1FA 2SCPA 2ZN8A 4FQOA 4HRHA 1ORGA 5D7FA 1AP4A 2SASA 1QXPA 1AJ4A 1LS8A 1IQ5A 3BUWB 2F2PA 1B8RA 3CDNA 1BOCA 4IJ7A 4GBAA 3A4UB 1B8LA 2Y1NA 3ICBA 3IF7A 1J55A 1JUOA 1V1GA 1TTXA 2PYQA 1T14A 1A75A 3SS5A 1FI5A 2KQYA 2IS9A 2ZFDA 1TCFA 5I94A 4XJKB 2L5XB 3DVKA 1UP5A 4PE1A 2M3WA 1BLQA 3DXLA 1SCVA 3VB1A 1TIZA 2P6BB 5HLOA 3NHTA 3B87A 2K2FA 2PALA 2WCFA 1G4YR 3DF0A 3D78A 3AAJA 5KU1A 2L2CA 2OTGC 3JTDC 1Y6WA 4AOMA 1K9UA 1BU3A 1OMVA 1OZSA 2NCPA 2WNDA 4GNKB 3I5HB 1KQMC 1SK6D 2WC6A 4OCIA 1PALA 3EKHA 2LCPA 2JXCA 1OOGA 1F4OA 2EC6C 3BUMB 2NCOA 2JOJA 1YVHA 1WDCC 2H2KA 5I2LA 2F33A 1C07A 2MA2A 2LAPA 3BXKA 3DY9A 2K7OA 5CPVA 1TNXA 4UPGA 1C7WA 1IRJA
chains in the Genus database with same CATH topology
1QX7A 1EG4A 4MZLA 2M7LA 1CKKA 2LANA 1NPQA 2JXLA 2M97A 2BCXA 1TOPA 2M29A 1RJVA 4MVFA 1SYMA 1SL8A 1NWDA 1SW8A 2KGRA 1JFKA 1HQVA 3OB1B 3CR2A 5JOLA 4OVNF 5I8NA 1FI6A 1LXFC 3BOWB 4MSPA 1LINA 1SL7A 5JJGA 2F3ZA 2V53A 4GGFA 2F2OA 4YGCB 1RTP1 1XK4C 2O5GA 1CM1A 1DJZA 1TNQA 2Q91A 4HREE 1DF0B 4DIRA 5CSNA 1F71A 1QJTA 1OQPA 1XFVO 3GK4X 4N1GA 3O2PA 2KYCA 4MZKA 1DJGA 1RFJA 3KF9A 2FCDA 2AMIA 3KHEA 1EXRA 1X02A 3BUNB 5KTYA 1UURA 3O6BA 1TNPA 1CLMA 1WY9A 2Y4QA 3A8RA 3RLZA 1YRUB 4PHNA 1CMGA 4ORAB 2KOTA 2WC8A 2E30A 1KFXS 1M46A 2FCEA 1UHHA 1KK7Y 2O60A 2JNXA 1KQMB 5CSFA 2EHBA 1J1DA 1KFXL 2MRDA 4L9MA 4DS7A 5TNCA 2JTTA 3PN7B 2JQ6A 1NCYA 1ALVA 2JZIA 1ZMZA 2A4JA 5FYXA 2M49B 1HT9A 2ZNDA 3I5IB 4PE4A 2NZ0A 3JVTC 2H61A 1MHOA 2KI6D 3DVEA 3I5HC 2Y5IA 2KYFA 2VRGA 4XJKA 1Q80A 2KNEA 1N2DA 1YRTB 5K89A 1BT6A 1K94A 1W7JB 3PALA 2TN4A 2PASA 4YGEB 5ER5A 1QATA 3VROA 4GUKA 1CFPA 2BCAA 2JULA 1PSRA 3CWGA 4OV2A 1K90D 4YI8A 2FJUB 1QIVA 1PVAA 1TCOB 2ZRTA 3F45A 3SG3A 4N5XA 1CNPA 1WRKA 5DKQA 1PRWA 3BQ3A 3LCPC 1TN4A 4N1FA 1C7VA 4CFQA 1DGUA 1B9AA 2WCBA 1AHRA 1SCMC 1VRKA 4JPZB 3E3RA 1K96A 2K7DA 1RK9A 3ZWHA 5AFPA 1DTLA 1H4BA 1IWQA 1K95A 2LE9B 1CDMA 2M1KB 3NSIA 4PALA 3VRQA 3VRRA 3D10A 2LVIA 3TDIA 2MLFC 1PULA 2G9BA 3AAKA 2KAVA 4NDBA 1QASA 1CTRA 4HRGA 1S6IA 4I5KA 4ETOA 1SPYA 3C1VA 1U5IA 1PK0D 3DD4A 2B1UA 1S5GZ 4NQGA 5CSJA 4M2OA 3WHTB 1NX2A 1UHNA 2I94A 3DVJA 1BF5A 4OR9B 1DF0A 3O4YA 2KBIA 4U8DA 2F3YA 3NSLA 3JVTB 1SBJA 2GGZA 2PSRA 2K0JA 5F6TA 1CFCA 2M7NA 1YVLA 3LLEA 4YGBB 2CT9A 1ZOTB 4F0ZB 3SG5A 2CTNA 3CTNA 3PN7C 4NDDA 1JF2A 2HPSA 3I5GC 2R2IA 3FWCA 1JWDA 1S26D 1DT7B 2NXQA 3I5IC 1OZOA 4PHJA 3FIAA 4C0KA 1G8IA 1S3PA 2BKHB 2JT3A 2K8MB 4IL1A 4Q04A 4CPVA 5I2QA 1QLKA 1SY9A 2JPTA 2JNFA 2KQ6A 1M39A 1S1EA 2AUCA 2Y1MA 1SCMB 2MAZA 1K9KA 3K21A 3CR5X 4NDCA 2WOSA 1BJFA 4D1EA 2L4HA 2WORA 4ZCUA 1YR5A 2LVKA 2BE6A 2LLUA 5CSIA 1IQ3A 2KSPA 4M2QA 1GGZA 2CCMA 3IQQA 2Q4UA 4ICBA 4YGAA 4YBHB 1GGWA 3EK4A 2L4IA 2OS8C 4WQ3A 1H8BA 1B7TZ 3AKBA 1JBAA 4WRIA 1FF1A 2HETA 1N0YA 1NX0A 1MXLC 1A75B 3BUXB 3SIAA 1J7RA 1LVCD 3PSRA 1XFZO 2MHHA 1XK4A 4P2YB 1XFXO 3GOFA 1UUSA 4I5NB 1XFUO 1XA5A 3CS1A 3DF0B 3HX4A 1SR6B 1OOJA 4XYNA 4PCWA 1QVIZ 1BG1A 1QV0A 2LUXA 3KO0A 5J3XA 2I2RE 2LMTA 3BYAA 2CNPA 1YURA 2GV5A 2LNKA 3KPXA 5HKYA 3GK1A 1F4QA 1OE9B 1KK7Z 2D8NA 1IKUA 3I5GB 4R1EA 2K2AA 2M0RA 2G2BA 1AVSA 3PATA 4PE0A 1XFWO 2LLSA 2JT8A 1IGVA 1BR1B 3H4SE 3BUOB 5D69A 1AK8A 2BECA 1UHKA 4GPLB 4I5LB 2BBNA 3TS5C 5I2OA 1MR8A 3PM8A 1QIWA 1ODBA 2CBLA 1FW4A 3CGAA 1A2XA 4HSZA 1KCYA 2BCBA 3WNXB 1RECA 3SJSA 1CDPA 2LC5A 5PALA 1PSBA 4QJ4B 1R2UA 3VRPA 3OB2B 3NSKA 4PHKA 4A4CA 2E6WA 1TNWA 1KSOA 1EJ3A 3I5FC 1PVBA 2LUCA 1UWOA 2KBMA 4QJ5B 1CMFA 3EK8A 4USLA 5AANA 1B8CA 4GGNA 2OS8B 4JWQA 1S36A 4M2PA 2ZNEA 1QLSA 2JTZA 1A4PA 2KAYA 3DVMA 1DJHA 3QRXA 3FWBA 4MRYA 3LK1A 1KWOB 4ORCB 1LA0A 1ZUZA 1YUSA 2LV7A 2QACA 5AEQA 3ZNIA 3TUYC 1XYDA 1KQVA 1K8UA 3D0YB 5HKWA 3SIBA 1KSMA 5AERA 1NIWA 1DJIA 1A03A 1JSAA 1S6CA 1YX7A 2FOTA 3NXAA 2BBMA 1OMDA 3LL8B 1CFDA 2K61A 2CXJA 1QX5B 1UHJA 3BOWA 1M45A 5B8IB 1JFJA 3SG6A 1AJ5A 2KFGA 2M1UA 4AQJA 2F8PA 5ER4X 4C0LA 4YRUA 1N65A 4GAOA 4P5OE 1K9PA 1NUBA 4JQ0D 1IH0A 2COLB 1SR6C 3EVVA 2QPTA 4PE7A 3EKJA 4DUQA 3TS5B 1FBVA 3EK7A 3LK0A 1S5GY 2M9GA 5AXIA 1A29A 2KAXA 1DJXA 1MXEA 1B4CA 1M63B 4MRXA 2MBXA 3VGOA 1ALWA 4DCKA 4TNCA 4CLNA 2OPOA 1QS7A 2BKIB 1SRAA 2L51A 5IBWA 1QX2A 2LM5A 4CIDA 2LVVA 3I5FB 3SG2A 2LMUA 4ORBB 1L7ZA 1F70A 1TRFA 4YI9A 5KSZA 1MWNA 3KEVA 4I5JA 3HCMA 1DVIA 2BL0B 2GGMA 1Y1AA 1F8HA 3AKAA 3WXAA 4FTGA 4AQIA 2K7BA 2L2EA 1L2OC 3NSOA 3GK2A 1LA3A 4GGFC 1LKJA 1SL9A 1YUTA 2LHLA 2LVJA 1UHIA 1IJ5A 1CB1A 3TUYB 1YTZC 1DJWA 2L50A 1WLZA 1NP8A 1CM4A 1NX1A 2HQWA 2KI4B 1XFYO 3TDZA 3TDUA 2PRUA 1DJYA 1B1GA 2JT0A 1E8AA 2K7CA 2EGDA 1F55A 2JRFA 1CDLA 1MUXA 1U5IB 1QV1A 1RWYA 3M0WA 3PFVA 1J7OA 2NLNA 2KFHA 1KWOC 3OHMB 2MLEC 2I18A 1B7TY 3CR4X 1EH2A 1K2HA 1NCZA 1NSHA 1S6JA 2HQ8A 1YUUA 2LMVA 4DRWA 1JF0A 2M8UA 4MN0A 1CDNA 2KFFA 2LHIA 1XO5A 1RROA 4C0JA 1W7IB 4MZJA 3PLFB 1NCXA 4CFRA 1Y1UA 1KK8C 1EG3A 1K93D 3EVUA 1OSAA 1QVIY 4PDZA 1WRZA 4MLWA 1GQMA 3FS7A 4WQ2A 2ZKMX 3D0YA 4YGDB 1SMGA 4E68A 1J7QA 5GQQC 2JC2A 2OTGB 2H61C 3JTDB 1R6PA 3OP0A 3VRNA 1JC2A 1BR4B 4OKHA 2LLTA 5HLVA 5BPJA 4PHMA 1ZACA 2RGIA 1QTXA 4ZCVA 4BY5A 3SG4A 1KFUS 2ZRSA 1WRLA 3OX6A 1DGVA 5DKNA 1GJYA 3O78A 1MF8B 2EC6B 3IQOA 1MQ1A 4MBEA 1J1EA 2LP2A 1WDCB 1L2OB 3WHUB 1EL4A 1BMOA 2KGBC 1KFUL 1NYAA 1IJ6A 1FPWA 2L98A 2HF5A 3CZTX 1YX8A 1D1OA 1Y0VH 3MSEB 1G33A 2BL0C 1DMOA 2ZN9A 5HKZA 1WLMA 1IG5A 2PVBA 3TZ1A 1CFFA 2BE4A 2MJWB 1XVJA 2KHNA 3SG7A 1ZFSA 2KI6C 1AUIB 1M31A 2I7AA 2JWWA 1Y1XA 5G08A 2LP3A 4MEWA 1BODA 4A4BA 1F54A 1SKTA 4GFTA 2L0PA 2KDHA 1SNLA 2KI4C 2WCEA 1NX3A 2AAOA 2PMYA 4QJ3B 2ISDA 5HYDA 3CLNA 3OX5A 1CLBA 4BY4A 3EVRA 5DKRA 1J7PA 1CLLA 3RM1A 2JU0A 1OMRA 2DOQA 1B47A 1KK8B 1V1FA 2SCPA 2ZN8A 4FQOA 4HRHA 5D7FA 1AP4A 2SASA 1QXPA 1AJ4A 1IQ5A 3BUWB 2F2PA 1B8RA 1BOCA 4GBAA 3A4UB 1B8LA 2Y1NA 3ICBA 3IF7A 1J55A 1JUOA 1V1GA 1TTXA 1A75A 1FI5A 2KQYA 2IS9A 2ZFDA 1TCFA 4XJKB 2L5XB 3DVKA 1UP5A 4PE1A 2M3WA 1BLQA 1SCVA 1TIZA 2P6BB 5HLOA 2K2FA 2PALA 2WCFA 1G4YR 3DF0A 3AAJA 5KU1A 2OTGC 3JTDC 1Y6WA 4AOMA 1K9UA 1BU3A 1OMVA 1OZSA 2NCPA 2WNDA 4GNKB 3I5HB 1KQMC 1SK6D 4OCIA 1PALA 3EKHA 2LCPA 2JXCA 1F4OA 2EC6C 3BUMB 2NCOA 2JOJA 1YVHA 1WDCC 2H2KA 5I2LA 2F33A 1C07A 2MA2A 2LAPA 3BXKA 2K7OA 5CPVA 1TNXA 4UPGA 1C7WA 1IRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX7 A;  1EG4 A;  4MZL A;  2M7L A;  1CKK A;  2LAN A;  1NPQ A;  2JXL A;  2M97 A;  2BCX A;  1TOP A;  2M29 A;  1RJV A;  4MVF A;  1SYM A;  1SL8 A;  1NWD A;  1SW8 A;  2KGR A;  1JFK A;  1HQV A;  3OB1 B;  3CR2 A;  5JOL A;  4OVN F;  5I8N A;  1FI6 A;  1LXF C;  3BOW B;  4MSP A;  1LIN A;  1SL7 A;  5JJG A;  2F3Z A;  2V53 A;  4GGF A;  2F2O A;  4YGC B;  1RTP 1;  1XK4 C;  2O5G A;  1CM1 A;  1DJZ A;  1TNQ A;  2Q91 A;  4HRE E;  1DF0 B;  4DIR A;  5CSN A;  1F71 A;  1QJT A;  1OQP A;  1XFV O;  3GK4 X;  4N1G A;  3O2P A;  2KYC A;  4MZK A;  1DJG A;  1RFJ A;  3KF9 A;  2FCD A;  2AMI A;  3KHE A;  1EXR A;  1X02 A;  3BUN B;  5KTY A;  1UUR A;  3O6B A;  1TNP A;  1CLM A;  1WY9 A;  2Y4Q A;  3A8R A;  3RLZ A;  1YRU B;  4PHN A;  1CMG A;  4ORA B;  2KOT A;  2WC8 A;  2E30 A;  1KFX S;  1M46 A;  2FCE A;  1UHH A;  1KK7 Y;  2O60 A;  2JNX A;  1KQM B;  5CSF A;  2EHB A;  1J1D A;  1KFX L;  2MRD A;  4L9M A;  4DS7 A;  5TNC A;  2JTT A;  3PN7 B;  2JQ6 A;  1NCY A;  1ALV A;  2JZI A;  1ZMZ A;  2A4J A;  5FYX A;  2M49 B;  1HT9 A;  2ZND A;  3I5I B;  4PE4 A;  2NZ0 A;  3JVT C;  2H61 A;  1MHO A;  2KI6 D;  3DVE A;  3I5H C;  2Y5I A;  2KYF A;  2VRG A;  4XJK A;  1Q80 A;  2KNE A;  1N2D A;  1YRT B;  5K89 A;  1BT6 A;  1K94 A;  1W7J B;  3PAL A;  2TN4 A;  2PAS A;  4YGE B;  5ER5 A;  1QAT A;  3VRO A;  4GUK A;  1CFP A;  2BCA A;  2JUL A;  1PSR A;  3CWG A;  4OV2 A;  1K90 D;  4YI8 A;  2FJU B;  1QIV A;  1PVA A;  1TCO B;  2ZRT A;  3F45 A;  3SG3 A;  4N5X A;  1CNP A;  1WRK A;  5DKQ A;  1PRW A;  3BQ3 A;  3LCP C;  1TN4 A;  4N1F A;  1C7V A;  4CFQ A;  1DGU A;  1B9A A;  2WCB A;  1AHR A;  1SCM C;  1VRK A;  4JPZ B;  3E3R A;  1K96 A;  2K7D A;  1RK9 A;  3ZWH A;  5AFP A;  1DTL A;  1H4B A;  1IWQ A;  1K95 A;  2LE9 B;  1CDM A;  2M1K B;  3NSI A;  4PAL A;  3VRQ A;  3VRR A;  3D10 A;  2LVI A;  3TDI A;  2MLF C;  1PUL A;  2G9B A;  3AAK A;  2KAV A;  4NDB A;  1QAS A;  1CTR A;  4HRG A;  1S6I A;  4I5K A;  4ETO A;  1SPY A;  3C1V A;  1U5I A;  1PK0 D;  3DD4 A;  2B1U A;  1S5G Z;  4NQG A;  5CSJ A;  4M2O A;  3WHT B;  1NX2 A;  1UHN A;  2I94 A;  3DVJ A;  1BF5 A;  4OR9 B;  1DF0 A;  3O4Y A;  2KBI A;  4U8D A;  2F3Y A;  3NSL A;  3JVT B;  1SBJ A;  2GGZ A;  2PSR A;  2K0J A;  5F6T A;  1CFC A;  2M7N A;  1YVL A;  3LLE A;  4YGB B;  2CT9 A;  1ZOT B;  4F0Z B;  3SG5 A;  2CTN A;  3CTN A;  3PN7 C;  4NDD A;  1JF2 A;  2HPS A;  3I5G C;  2R2I A;  3FWC A;  1JWD A;  1S26 D;  1DT7 B;  2NXQ A;  3I5I C;  1OZO A;  4PHJ A;  3FIA A;  4C0K A;  1G8I A;  1S3P A;  2BKH B;  2JT3 A;  2K8M B;  4IL1 A;  4Q04 A;  4CPV A;  5I2Q A;  1QLK A;  1SY9 A;  2JPT A;  2JNF A;  2KQ6 A;  1M39 A;  1S1E A;  2AUC A;  2Y1M A;  1SCM B;  2MAZ A;  1K9K A;  3K21 A;  3CR5 X;  4NDC A;  2WOS A;  1BJF A;  4D1E A;  2L4H A;  2WOR A;  4ZCU A;  1YR5 A;  2LVK A;  2BE6 A;  2LLU A;  5CSI A;  1IQ3 A;  2KSP A;  4M2Q A;  1GGZ A;  2CCM A;  3IQQ A;  2Q4U A;  4ICB A;  4YGA A;  4YBH B;  1GGW A;  3EK4 A;  2L4I A;  2OS8 C;  4WQ3 A;  1H8B A;  1B7T Z;  3AKB A;  1JBA A;  4WRI A;  1FF1 A;  2HET A;  1N0Y A;  1NX0 A;  1MXL C;  1A75 B;  3BUX B;  3SIA A;  1J7R A;  1LVC D;  3PSR A;  1XFZ O;  2MHH A;  1XK4 A;  4P2Y B;  1XFX O;  3GOF A;  1UUS A;  4I5N B;  1XFU O;  1XA5 A;  3CS1 A;  3DF0 B;  3HX4 A;  1SR6 B;  1OOJ A;  4XYN A;  4PCW A;  1QVI Z;  1BG1 A;  1QV0 A;  2LUX A;  3KO0 A;  5J3X A;  2I2R E;  2LMT A;  3BYA A;  2CNP A;  1YUR A;  2GV5 A;  2LNK A;  3KPX A;  5HKY A;  3GK1 A;  1F4Q A;  1OE9 B;  1KK7 Z;  2D8N A;  1IKU A;  3I5G B;  4R1E A;  2K2A A;  2M0R A;  2G2B A;  1AVS A;  3PAT A;  4PE0 A;  1XFW O;  2LLS A;  2JT8 A;  1IGV A;  1BR1 B;  3H4S E;  3BUO B;  5D69 A;  1AK8 A;  2BEC A;  1UHK A;  4GPL B;  4I5L B;  2BBN A;  3TS5 C;  5I2O A;  1MR8 A;  3PM8 A;  1QIW A;  1ODB A;  2CBL A;  1FW4 A;  3CGA A;  1A2X A;  4HSZ A;  1KCY A;  2BCB A;  3WNX B;  1REC A;  3SJS A;  1CDP A;  2LC5 A;  5PAL A;  1PSB A;  4QJ4 B;  1R2U A;  3VRP A;  3OB2 B;  3NSK A;  4PHK A;  4A4C A;  2E6W A;  1TNW A;  1KSO A;  1EJ3 A;  3I5F C;  1PVB A;  2LUC A;  1UWO A;  2KBM A;  4QJ5 B;  1CMF A;  3EK8 A;  4USL A;  5AAN A;  1B8C A;  4GGN A;  2OS8 B;  4JWQ A;  1S36 A;  4M2P A;  2ZNE A;  1QLS A;  2JTZ A;  1A4P A;  2KAY A;  3DVM A;  1DJH A;  3QRX A;  3FWB A;  4MRY A;  3LK1 A;  1KWO B;  4ORC B;  1LA0 A;  1ZUZ A;  1YUS A;  2LV7 A;  2QAC A;  5AEQ A;  3ZNI A;  3TUY C;  1XYD A;  1KQV A;  1K8U A;  3D0Y B;  5HKW A;  3SIB A;  1KSM A;  5AER A;  1NIW A;  1DJI A;  1A03 A;  1JSA A;  1S6C A;  1YX7 A;  2FOT A;  3NXA A;  2BBM A;  1OMD A;  3LL8 B;  1CFD A;  2K61 A;  2CXJ A;  1QX5 B;  1UHJ A;  3BOW A;  1M45 A;  5B8I B;  1JFJ A;  3SG6 A;  1AJ5 A;  2KFG A;  2M1U A;  4AQJ A;  2F8P A;  5ER4 X;  4C0L A;  4YRU A;  1N65 A;  4GAO A;  4P5O E;  1K9P A;  1NUB A;  4JQ0 D;  1IH0 A;  2COL B;  1SR6 C;  3EVV A;  2QPT A;  4PE7 A;  3EKJ A;  4DUQ A;  3TS5 B;  1FBV A;  3EK7 A;  3LK0 A;  1S5G Y;  2M9G A;  5AXI A;  1A29 A;  2KAX A;  1DJX A;  1MXE A;  1B4C A;  1M63 B;  4MRX A;  2MBX A;  3VGO A;  1ALW A;  4DCK A;  4TNC A;  4CLN A;  2OPO A;  1QS7 A;  2BKI B;  1SRA A;  2L51 A;  5IBW A;  1QX2 A;  2LM5 A;  4CID A;  2LVV A;  3I5F B;  3SG2 A;  2LMU A;  4ORB B;  1L7Z A;  1F70 A;  1TRF A;  4YI9 A;  5KSZ A;  1MWN A;  3KEV A;  4I5J A;  3HCM A;  1DVI A;  2BL0 B;  2GGM A;  1Y1A A;  1F8H A;  3AKA A;  3WXA A;  4FTG A;  4AQI A;  2K7B A;  2L2E A;  1L2O C;  3NSO A;  3GK2 A;  1LA3 A;  4GGF C;  1LKJ A;  1SL9 A;  1YUT A;  2LHL A;  2LVJ A;  1UHI A;  1IJ5 A;  1CB1 A;  3TUY B;  1YTZ C;  1DJW A;  2L50 A;  1WLZ A;  1NP8 A;  1CM4 A;  1NX1 A;  2HQW A;  2KI4 B;  1XFY O;  3TDZ A;  3TDU A;  2PRU A;  1DJY A;  1B1G A;  2JT0 A;  1E8A A;  2K7C A;  2EGD A;  1F55 A;  2JRF A;  1CDL A;  1MUX A;  1U5I B;  1QV1 A;  1RWY A;  3M0W A;  3PFV A;  1J7O A;  2NLN A;  2KFH A;  1KWO C;  3OHM B;  2MLE C;  2I18 A;  1B7T Y;  3CR4 X;  1EH2 A;  1K2H A;  1NCZ A;  1NSH A;  1S6J A;  2HQ8 A;  1YUU A;  2LMV A;  4DRW A;  1JF0 A;  2M8U A;  4MN0 A;  1CDN A;  2KFF A;  2LHI A;  1XO5 A;  1RRO A;  4C0J A;  1W7I B;  4MZJ A;  3PLF B;  1NCX A;  4CFR A;  1Y1U A;  1KK8 C;  1EG3 A;  1K93 D;  3EVU A;  1OSA A;  1QVI Y;  4PDZ A;  1WRZ A;  4MLW A;  1GQM A;  3FS7 A;  4WQ2 A;  2ZKM X;  3D0Y A;  4YGD B;  1SMG A;  4E68 A;  1J7Q A;  5GQQ C;  2JC2 A;  2OTG B;  2H61 C;  3JTD B;  1R6P A;  3OP0 A;  3VRN A;  1JC2 A;  1BR4 B;  4OKH A;  2LLT A;  5HLV A;  5BPJ A;  4PHM A;  1ZAC A;  2RGI A;  1QTX A;  4ZCV A;  4BY5 A;  3SG4 A;  1KFU S;  2ZRS A;  1WRL A;  3OX6 A;  1DGV A;  5DKN A;  1GJY A;  3O78 A;  1MF8 B;  2EC6 B;  3IQO A;  1MQ1 A;  4MBE A;  1J1E A;  2LP2 A;  1WDC B;  1L2O B;  3WHU B;  1EL4 A;  1BMO A;  2KGB C;  1KFU L;  1NYA A;  1IJ6 A;  1FPW A;  2L98 A;  2HF5 A;  3CZT X;  1YX8 A;  1D1O A;  1Y0V H;  3MSE B;  1G33 A;  2BL0 C;  1DMO A;  2ZN9 A;  5HKZ A;  1WLM A;  1IG5 A;  2PVB A;  3TZ1 A;  1CFF A;  2BE4 A;  2MJW B;  1XVJ A;  2KHN A;  3SG7 A;  1ZFS A;  2KI6 C;  1AUI B;  1M31 A;  2I7A A;  2JWW A;  1Y1X A;  5G08 A;  2LP3 A;  4MEW A;  1BOD A;  4A4B A;  1F54 A;  1SKT A;  4GFT A;  2L0P A;  2KDH A;  1SNL A;  2KI4 C;  2WCE A;  1NX3 A;  2AAO A;  2PMY A;  4QJ3 B;  2ISD A;  5HYD A;  3CLN A;  3OX5 A;  1CLB A;  4BY4 A;  3EVR A;  5DKR A;  1J7P A;  1CLL A;  3RM1 A;  2JU0 A;  1OMR A;  2DOQ A;  1B47 A;  1KK8 B;  1V1F A;  2SCP A;  2ZN8 A;  4FQO A;  4HRH A;  5D7F A;  1AP4 A;  2SAS A;  1QXP A;  1AJ4 A;  1IQ5 A;  3BUW B;  2F2P A;  1B8R A;  1BOC A;  4GBA A;  3A4U B;  1B8L A;  2Y1N A;  3ICB A;  3IF7 A;  1J55 A;  1JUO A;  1V1G A;  1TTX A;  1A75 A;  1FI5 A;  2KQY A;  2IS9 A;  2ZFD A;  1TCF A;  4XJK B;  2L5X B;  3DVK A;  1UP5 A;  4PE1 A;  2M3W A;  1BLQ A;  1SCV A;  1TIZ A;  2P6B B;  5HLO A;  2K2F A;  2PAL A;  2WCF A;  1G4Y R;  3DF0 A;  3AAJ A;  5KU1 A;  2OTG C;  3JTD C;  1Y6W A;  4AOM A;  1K9U A;  1BU3 A;  1OMV A;  1OZS A;  2NCP A;  2WND A;  4GNK B;  3I5H B;  1KQM C;  1SK6 D;  4OCI A;  1PAL A;  3EKH A;  2LCP A;  2JXC A;  1F4O A;  2EC6 C;  3BUM B;  2NCO A;  2JOJ A;  1YVH A;  1WDC C;  2H2K A;  5I2L A;  2F33 A;  1C07 A;  2MA2 A;  2LAP A;  3BXK A;  2K7O A;  5CPV A;  1TNX A;  4UPG A;  1C7W A;  1IRJ A; 
#chains in the Genus database with same CATH topology
 1QX7 A;  1EG4 A;  4MZL A;  2M7L A;  1CKK A;  2LAN A;  1NPQ A;  2JXL A;  2M97 A;  2BCX A;  1TOP A;  2M29 A;  1RJV A;  4MVF A;  1SYM A;  3B7A A;  1SL8 A;  1NWD A;  1SW8 A;  2KGR A;  1JFK A;  1HQV A;  3OB1 B;  4INX A;  3CR2 A;  5JOL A;  4OVN F;  3CZ2 A;  5I8N A;  1DQE A;  1FI6 A;  1LXF C;  3BOW B;  4MSP A;  1LIN A;  1SL7 A;  2JPO A;  2F3Z A;  2V53 A;  4GGF A;  2F2O A;  4OZD A;  5JJG A;  4YGC B;  1RTP 1;  1XK4 C;  2O5G A;  1CM1 A;  4FQT A;  1DJZ A;  1TNQ A;  2Q91 A;  4HRE E;  1DF0 B;  3CYZ A;  4DIR A;  5CSN A;  1F71 A;  1QJT A;  1OQP A;  1XFV O;  3GK4 X;  4N1G A;  3O2P A;  2KYC A;  3D77 A;  1DJG A;  3FE9 A;  4MZK A;  1RFJ A;  3KF9 A;  3D76 A;  2FCD A;  2AMI A;  3KHE A;  1EXR A;  1X02 A;  3BUN B;  5KTY A;  1UUR A;  3O6B A;  1TNP A;  1CLM A;  1WY9 A;  2Y4Q A;  3EG5 B;  3A8R A;  3RLZ A;  1YRU B;  4PHN A;  1CMG A;  4ORA B;  2KOT A;  2WC8 A;  2E30 A;  1KFX S;  1M46 A;  2FCE A;  1UHH A;  1KK7 Y;  2O60 A;  2JNX A;  1KQM B;  5CSF A;  5EL2 A;  2EHB A;  1J1D A;  1KFX L;  2MRD A;  4L9M A;  5FI2 A;  4DS7 A;  5TNC A;  2JTT A;  3PN7 B;  2JQ6 A;  1NCY A;  1ALV A;  2JZI A;  1ZMZ A;  1OW4 A;  2A4J A;  5FYX A;  2M49 B;  1HT9 A;  1OOH A;  2ZND A;  3I5I B;  4PE4 A;  2NZ0 A;  3JVT C;  2H61 A;  1MHO A;  2KI6 D;  3DVE A;  3BFA A;  3I5H C;  2Y5I A;  2KYF A;  2VRG A;  4INW A;  4XJK A;  1Q80 A;  2KNE A;  1Z4H A;  1N2D A;  3Q8I A;  1YRT B;  5K89 A;  1QWV A;  1BT6 A;  3CZ0 A;  1K94 A;  1W7J B;  3PAL A;  2TN4 A;  2PAS A;  4YGE B;  5ER5 A;  1QAT A;  3VRO A;  4GUK A;  1CFP A;  2BCA A;  2H8V A;  1PSR A;  1TUZ A;  2JUL A;  3CWG A;  4OV2 A;  3IVT A;  1K90 D;  4YI8 A;  2FJU B;  3S0G A;  3OGN A;  1QIV A;  1PVA A;  1TCO B;  2ZRT A;  3F45 A;  3SG3 A;  4N5X A;  1CNP A;  1WRK A;  5DKQ A;  1PRW A;  3BQ3 A;  3LCP C;  1TN4 A;  4N1F A;  1C7V A;  3S0E A;  1TUJ A;  4CFQ A;  1DGU A;  1B9A A;  2WCB A;  1AHR A;  4KYN A;  3S0A A;  1SCM C;  1VRK A;  4JPZ B;  3E3R A;  1K96 A;  2K7D A;  1RK9 A;  3ZWH A;  5AFP A;  2QEO A;  4JD9 A;  1DTL A;  1H4B A;  1IWQ A;  1K95 A;  2LE9 B;  1CDM A;  2M1K B;  3NSI A;  3PJI A;  4PAL A;  3VRQ A;  3VRR A;  3D10 A;  4JKT A;  2LVI A;  3TDI A;  2MLF C;  1PUL A;  2G9B A;  3AAK A;  2KAV A;  3DYE A;  1DEK A;  4NDB A;  1QAS A;  1CTR A;  4HRG A;  1S6I A;  4I5K A;  4ETO A;  1SPY A;  3C1V A;  1U5I A;  1PK0 D;  3DD4 A;  2B1U A;  1S5G Z;  4NQG A;  3NGV A;  5CSJ A;  4M2O A;  3WHT B;  1NX2 A;  1UHN A;  2I94 A;  3DVJ A;  1BF5 A;  4OR9 B;  1DF0 A;  3O4Y A;  2KBI A;  4U8D A;  2F3Y A;  3SS3 A;  3NSL A;  3JVT B;  1SBJ A;  2GGZ A;  2PSR A;  2K0J A;  5F6T A;  1CFC A;  2M7N A;  1YVL A;  3LLE A;  4YGB B;  2FJY A;  2CT9 A;  1ZOT B;  4F0Z B;  3SG5 A;  2CTN A;  3CTN A;  3PN7 C;  3UNW A;  4NDD A;  1JF2 A;  2HPS A;  3I5G C;  2R2I A;  3FWC A;  3DZT A;  1JWD A;  1S26 D;  1DT7 B;  2NXQ A;  3I5I C;  5HL1 A;  1OZO A;  4PHJ A;  3FIA A;  4C0K A;  3BJH A;  1G8I A;  1S3P A;  2BKH B;  2JT3 A;  2K8M B;  4IL1 A;  4Q04 A;  3SS4 A;  4CPV A;  5I2Q A;  1QLK A;  1SY9 A;  2JPT A;  2JNF A;  2KQ6 A;  5D3O A;  1M39 A;  1S1E A;  2AUC A;  2Y1M A;  1SCM B;  2MAZ A;  1K9K A;  3K21 A;  3CR5 X;  4NDC A;  2WOS A;  1BJF A;  2YGU A;  2L4H A;  2WOR A;  4ZCU A;  4D1E A;  1YR5 A;  2LVK A;  2BE6 A;  2LLU A;  5CSI A;  1IQ3 A;  2KSP A;  4M2Q A;  1DEL A;  3CZ1 A;  1GGZ A;  2CCM A;  3IQQ A;  2Q4U A;  4ICB A;  4YGA A;  3BFH A;  4YBH B;  1GGW A;  3EK4 A;  2L4I A;  2OS8 C;  4WQ3 A;  1H8B A;  1B7T Z;  2K60 A;  3AKB A;  2BNX A;  4WRI A;  1JBA A;  1FF1 A;  2HET A;  1N0Y A;  1NX0 A;  1MXL C;  1A75 B;  3BUX B;  3SIA A;  1J7R A;  3N7H A;  1LVC D;  3PSR A;  1XFZ O;  2MHH A;  1XK4 A;  4P2Y B;  1XFX O;  3GOF A;  1UUS A;  4I5N B;  3OBV A;  1XFU O;  1XA5 A;  3CS1 A;  3V2L A;  3DF0 B;  3HX4 A;  1SR6 B;  3CAB A;  1OOJ A;  3R1P A;  4PCW A;  1QVI Z;  4XYN A;  1BG1 A;  1QV0 A;  2LUX A;  3KO0 A;  5J3X A;  2I2R E;  2LMT A;  2KLE A;  2CNP A;  3BYA A;  1OOF A;  1YUR A;  2GV5 A;  2LNK A;  3R1V A;  1W9Z A;  3KPX A;  5HKY A;  3GK1 A;  4PT1 A;  1F4Q A;  1OE9 B;  3FE8 A;  1KK7 Z;  2D8N A;  1IKU A;  2GTE A;  3I5G B;  4R1E A;  2K2A A;  2M0R A;  2G2B A;  1AVS A;  3PAT A;  4PE0 A;  1XFW O;  2LLS A;  2JT8 A;  1IGV A;  1BR1 B;  3H4S E;  3BUO B;  5D69 A;  1AK8 A;  1UHK A;  2BEC A;  4GPL B;  4I5L B;  2BBN A;  2WCM A;  3TS5 C;  5I2O A;  1MR8 A;  3PM8 A;  1QIW A;  1SSE B;  1ODB A;  5FI7 A;  2CBL A;  1FW4 A;  3CGA A;  1A2X A;  4HSZ A;  1KCY A;  2BCB A;  3WNX B;  1REC A;  3SJS A;  1CDP A;  2LC5 A;  5PAL A;  1PSB A;  4QJ4 B;  1R2U A;  3VRP A;  3OB2 B;  3NSK A;  4PHK A;  4A4C A;  2E6W A;  2WCH A;  1TNW A;  1KSO A;  1EJ3 A;  3I5F C;  1PVB A;  3B86 A;  2LUC A;  1UWO A;  2KBM A;  1Z2C B;  2WCK A;  3K1E A;  4QJ5 B;  1CMF A;  3EK8 A;  4USL A;  5AAN A;  3D73 A;  1B8C A;  4GGN A;  2OS8 B;  4JWQ A;  1S36 A;  4M2P A;  2ZNE A;  1QLS A;  2JTZ A;  1A4P A;  3D75 A;  2KAY A;  3DVM A;  1DJH A;  3QRX A;  3FWB A;  4MRY A;  3LK1 A;  3B88 A;  1KWO B;  4ORC B;  1LA0 A;  1ZUZ A;  1YUS A;  2LV7 A;  2QAC A;  5AEQ A;  3ZNI A;  3R72 A;  1XYD A;  2WCL A;  3TUY C;  1K8U A;  5DIC A;  1KQV A;  3D0Y B;  5HKW A;  3SIB A;  1KSM A;  5AER A;  1NIW A;  1DJI A;  1A03 A;  1JSA A;  1S6C A;  1YX7 A;  2FOT A;  3NXA A;  2BBM A;  1OMD A;  3LL8 B;  1CFD A;  2K61 A;  2CXJ A;  1QX5 B;  1UHJ A;  3BOW A;  1M45 A;  5B8I B;  1JFJ A;  3SG6 A;  1AJ5 A;  2KFG A;  2M1U A;  4AQJ A;  2F8P A;  5ER4 X;  4C0L A;  4YRU A;  1N65 A;  3QME A;  4GAO A;  4P5O E;  1K9P A;  1NUB A;  4JQ0 D;  1IH0 A;  2COL B;  1SR6 C;  3EVV A;  2QPT A;  4PE7 A;  3EKJ A;  4DUQ A;  4F7F A;  2KPH A;  3TS5 B;  1FBV A;  3EK7 A;  3LK0 A;  1S5G Y;  2M9G A;  5AXI A;  1A29 A;  1C3Z A;  2KAX A;  1DJX A;  1MXE A;  1B4C A;  1M63 B;  3L4L A;  4MRX A;  2MBX A;  1ALW A;  3VGO A;  4DCK A;  4TNC A;  4CLN A;  2OPO A;  3NHI A;  1QS7 A;  2BKI B;  1SRA A;  2L51 A;  5IBW A;  1QX2 A;  2LM5 A;  2ERB A;  4CID A;  2LVV A;  1IIO A;  3I5F B;  3SG2 A;  2LMU A;  4ORB B;  1L7Z A;  1F70 A;  1TRF A;  4YI9 A;  3UO9 A;  5KSZ A;  2QEB A;  1MWN A;  3KEV A;  4I5J A;  3HCM A;  1DVI A;  2BL0 B;  3B6X A;  2GGM A;  1Y1A A;  1F8H A;  2KLD A;  3AKA A;  3WXA A;  4FTG A;  4AQI A;  3BFB A;  2K7B A;  2L2E A;  1L2O C;  3NSO A;  3GK2 A;  2L5Y A;  1LA3 A;  4GGF C;  1LKJ A;  1SL9 A;  1YUT A;  2LHL A;  2LVJ A;  1UHI A;  1IJ5 A;  1CB1 A;  3TUY B;  1YTZ C;  1DJW A;  2L50 A;  1GM0 A;  1WLZ A;  1NP8 A;  1CM4 A;  1NX1 A;  2HQW A;  2KI4 B;  1XFY O;  3TDZ A;  2QDI A;  3TDU A;  2PRU A;  1DJY A;  1B1G A;  2JT0 A;  1E8A A;  2K7C A;  2EGD A;  3R1O A;  1F55 A;  2JRF A;  1CDL A;  1MUX A;  1U5I B;  1QV1 A;  1RWY A;  3M0W A;  3PFV A;  1J7O A;  2NLN A;  2KFH A;  1KWO C;  1OOI X;  3OHM B;  2MLE C;  2I18 A;  1B7T Y;  3CR4 X;  1EH2 A;  1K2H A;  1NCZ A;  1NSH A;  1S6J A;  2HQ8 A;  1YUU A;  3FE6 A;  2LMV A;  1P28 A;  4DRW A;  1JF0 A;  2M8U A;  2BAP A;  4MN0 A;  1C3Y A;  1CDN A;  2KFF A;  2LHI A;  1XO5 A;  1RRO A;  4C0J A;  1W7I B;  4MZJ A;  3PLF B;  1NCX A;  4CFR A;  1Y1U A;  1KK8 C;  1EG3 A;  1K93 D;  3EVU A;  1OSA A;  1QVI Y;  3L47 A;  4PDZ A;  1WRZ A;  4MLW A;  1GQM A;  3FS7 A;  3L4A A;  2ZKM X;  3D0Y A;  4WQ2 A;  1SMG A;  2P70 A;  4YGD B;  4E68 A;  1J7Q A;  5GQQ C;  2JC2 A;  2OTG B;  2H61 C;  3JTD B;  1R6P A;  3OP0 A;  3VRN A;  1JC2 A;  1BR4 B;  4OKH A;  2LLT A;  5HLV A;  5BPJ A;  4PHM A;  1ZAC A;  2RGI A;  1QTX A;  1XFR A;  4ZCV A;  4BY5 A;  3SG4 A;  1KFU S;  2ZRS A;  1WRL A;  3OX6 A;  1DGV A;  5DKN A;  1GJY A;  3O78 A;  1MF8 B;  2EC6 B;  3IQO A;  1MQ1 A;  4MBE A;  1J1E A;  2LP2 A;  1WDC B;  1L2O B;  3WHU B;  1EL4 A;  1BMO A;  2KGB C;  1KFU L;  1NYA A;  1IJ6 A;  1FPW A;  3D74 A;  2L98 A;  2HF5 A;  3CZT X;  1YX8 A;  1D1O A;  1Y0V H;  3MSE B;  1G33 A;  2BL0 C;  1DMO A;  2ZN9 A;  5HKZ A;  1WLM A;  3S0F A;  3S0D A;  3O4X A;  1IG5 A;  2PVB A;  3TZ1 A;  1CFF A;  3S0B A;  2BE4 A;  2MJW B;  1XVJ A;  2KHN A;  3SG7 A;  2QEH A;  1ZFS A;  2KI6 C;  2WC5 A;  1AUI B;  1M31 A;  2I7A A;  2JWW A;  1Y1X A;  5G08 A;  2LP3 A;  2QEV A;  4MEW A;  4A4B A;  1BOD A;  1F54 A;  3PM2 A;  1SKT A;  1DC1 A;  4GFT A;  3RZS A;  2L0P A;  2KDH A;  1SNL A;  2KI4 C;  2WCE A;  1NX3 A;  2AAO A;  2P71 A;  2PMY A;  4QJ3 B;  2ISD A;  5HYD A;  3CLN A;  3OX5 A;  5FI6 A;  1CLB A;  4BY4 A;  3EVR A;  5DKR A;  1J7P A;  1CLL A;  2PQL A;  3RM1 A;  2WCJ A;  2JU0 A;  1OMR A;  2DOQ A;  1B47 A;  1KK8 B;  1TWO A;  1V1F A;  2SCP A;  2ZN8 A;  4FQO A;  4HRH A;  1ORG A;  5D7F A;  1AP4 A;  2SAS A;  1QXP A;  1AJ4 A;  1LS8 A;  1IQ5 A;  3BUW B;  2F2P A;  1B8R A;  3CDN A;  1BOC A;  4IJ7 A;  4GBA A;  3A4U B;  1B8L A;  2Y1N A;  3ICB A;  3IF7 A;  1J55 A;  1JUO A;  1V1G A;  1TTX A;  2PYQ A;  1T14 A;  1A75 A;  3SS5 A;  1FI5 A;  2KQY A;  2IS9 A;  2ZFD A;  1TCF A;  5I94 A;  4XJK B;  2L5X B;  3DVK A;  1UP5 A;  4PE1 A;  2M3W A;  1BLQ A;  3DXL A;  1SCV A;  3VB1 A;  1TIZ A;  2P6B B;  5HLO A;  3NHT A;  3B87 A;  2K2F A;  2PAL A;  2WCF A;  1G4Y R;  3DF0 A;  3D78 A;  3AAJ A;  5KU1 A;  2L2C A;  2OTG C;  3JTD C;  1Y6W A;  4AOM A;  1K9U A;  1BU3 A;  1OMV A;  1OZS A;  2NCP A;  2WND A;  4GNK B;  3I5H B;  1KQM C;  1SK6 D;  2WC6 A;  4OCI A;  1PAL A;  3EKH A;  2LCP A;  2JXC A;  1OOG A;  1F4O A;  2EC6 C;  3BUM B;  2NCO A;  2JOJ A;  1YVH A;  1WDC C;  2H2K A;  5I2L A;  2F33 A;  1C07 A;  2MA2 A;  2LAP A;  3BXK A;  3DY9 A;  2K7O A;  5CPV A;  1TNX A;  4UPG A;  1C7W A;  1IRJ A; 
#chains in the Genus database with same CATH homology
 1QX7 A;  1EG4 A;  4MZL A;  2M7L A;  1CKK A;  2LAN A;  1NPQ A;  2JXL A;  2M97 A;  2BCX A;  1TOP A;  2M29 A;  1RJV A;  4MVF A;  1SYM A;  1SL8 A;  1NWD A;  1SW8 A;  2KGR A;  1JFK A;  1HQV A;  3OB1 B;  3CR2 A;  5JOL A;  4OVN F;  5I8N A;  1FI6 A;  1LXF C;  3BOW B;  4MSP A;  1LIN A;  1SL7 A;  5JJG A;  2F3Z A;  2V53 A;  4GGF A;  2F2O A;  4YGC B;  1RTP 1;  1XK4 C;  2O5G A;  1CM1 A;  1DJZ A;  1TNQ A;  2Q91 A;  4HRE E;  1DF0 B;  4DIR A;  5CSN A;  1F71 A;  1QJT A;  1OQP A;  1XFV O;  3GK4 X;  4N1G A;  3O2P A;  2KYC A;  4MZK A;  1DJG A;  1RFJ A;  3KF9 A;  2FCD A;  2AMI A;  3KHE A;  1EXR A;  1X02 A;  3BUN B;  5KTY A;  1UUR A;  3O6B A;  1TNP A;  1CLM A;  1WY9 A;  2Y4Q A;  3A8R A;  3RLZ A;  1YRU B;  4PHN A;  1CMG A;  4ORA B;  2KOT A;  2WC8 A;  2E30 A;  1KFX S;  1M46 A;  2FCE A;  1UHH A;  1KK7 Y;  2O60 A;  2JNX A;  1KQM B;  5CSF A;  2EHB A;  1J1D A;  1KFX L;  2MRD A;  4L9M A;  4DS7 A;  5TNC A;  2JTT A;  3PN7 B;  2JQ6 A;  1NCY A;  1ALV A;  2JZI A;  1ZMZ A;  2A4J A;  5FYX A;  2M49 B;  1HT9 A;  2ZND A;  3I5I B;  4PE4 A;  2NZ0 A;  3JVT C;  2H61 A;  1MHO A;  2KI6 D;  3DVE A;  3I5H C;  2Y5I A;  2KYF A;  2VRG A;  4XJK A;  1Q80 A;  2KNE A;  1N2D A;  1YRT B;  5K89 A;  1BT6 A;  1K94 A;  1W7J B;  3PAL A;  2TN4 A;  2PAS A;  4YGE B;  5ER5 A;  1QAT A;  3VRO A;  4GUK A;  1CFP A;  2BCA A;  2JUL A;  1PSR A;  3CWG A;  4OV2 A;  1K90 D;  4YI8 A;  2FJU B;  1QIV A;  1PVA A;  1TCO B;  2ZRT A;  3F45 A;  3SG3 A;  4N5X A;  1CNP A;  1WRK A;  5DKQ A;  1PRW A;  3BQ3 A;  3LCP C;  1TN4 A;  4N1F A;  1C7V A;  4CFQ A;  1DGU A;  1B9A A;  2WCB A;  1AHR A;  1SCM C;  1VRK A;  4JPZ B;  3E3R A;  1K96 A;  2K7D A;  1RK9 A;  3ZWH A;  5AFP A;  1DTL A;  1H4B A;  1IWQ A;  1K95 A;  2LE9 B;  1CDM A;  2M1K B;  3NSI A;  4PAL A;  3VRQ A;  3VRR A;  3D10 A;  2LVI A;  3TDI A;  2MLF C;  1PUL A;  2G9B A;  3AAK A;  2KAV A;  4NDB A;  1QAS A;  1CTR A;  4HRG A;  1S6I A;  4I5K A;  4ETO A;  1SPY A;  3C1V A;  1U5I A;  1PK0 D;  3DD4 A;  2B1U A;  1S5G Z;  4NQG A;  5CSJ A;  4M2O A;  3WHT B;  1NX2 A;  1UHN A;  2I94 A;  3DVJ A;  1BF5 A;  4OR9 B;  1DF0 A;  3O4Y A;  2KBI A;  4U8D A;  2F3Y A;  3NSL A;  3JVT B;  1SBJ A;  2GGZ A;  2PSR A;  2K0J A;  5F6T A;  1CFC A;  2M7N A;  1YVL A;  3LLE A;  4YGB B;  2CT9 A;  1ZOT B;  4F0Z B;  3SG5 A;  2CTN A;  3CTN A;  3PN7 C;  4NDD A;  1JF2 A;  2HPS A;  3I5G C;  2R2I A;  3FWC A;  1JWD A;  1S26 D;  1DT7 B;  2NXQ A;  3I5I C;  1OZO A;  4PHJ A;  3FIA A;  4C0K A;  1G8I A;  1S3P A;  2BKH B;  2JT3 A;  2K8M B;  4IL1 A;  4Q04 A;  4CPV A;  5I2Q A;  1QLK A;  1SY9 A;  2JPT A;  2JNF A;  2KQ6 A;  1M39 A;  1S1E A;  2AUC A;  2Y1M A;  1SCM B;  2MAZ A;  1K9K A;  3K21 A;  3CR5 X;  4NDC A;  2WOS A;  1BJF A;  4D1E A;  2L4H A;  2WOR A;  4ZCU A;  1YR5 A;  2LVK A;  2BE6 A;  2LLU A;  5CSI A;  1IQ3 A;  2KSP A;  4M2Q A;  1GGZ A;  2CCM A;  3IQQ A;  2Q4U A;  4ICB A;  4YGA A;  4YBH B;  1GGW A;  3EK4 A;  2L4I A;  2OS8 C;  4WQ3 A;  1H8B A;  1B7T Z;  3AKB A;  1JBA A;  4WRI A;  1FF1 A;  2HET A;  1N0Y A;  1NX0 A;  1MXL C;  1A75 B;  3BUX B;  3SIA A;  1J7R A;  1LVC D;  3PSR A;  1XFZ O;  2MHH A;  1XK4 A;  4P2Y B;  1XFX O;  3GOF A;  1UUS A;  4I5N B;  1XFU O;  1XA5 A;  3CS1 A;  3DF0 B;  3HX4 A;  1SR6 B;  1OOJ A;  4XYN A;  4PCW A;  1QVI Z;  1BG1 A;  1QV0 A;  2LUX A;  3KO0 A;  5J3X A;  2I2R E;  2LMT A;  3BYA A;  2CNP A;  1YUR A;  2GV5 A;  2LNK A;  3KPX A;  5HKY A;  3GK1 A;  1F4Q A;  1OE9 B;  1KK7 Z;  2D8N A;  1IKU A;  3I5G B;  4R1E A;  2K2A A;  2M0R A;  2G2B A;  1AVS A;  3PAT A;  4PE0 A;  1XFW O;  2LLS A;  2JT8 A;  1IGV A;  1BR1 B;  3H4S E;  3BUO B;  5D69 A;  1AK8 A;  2BEC A;  1UHK A;  4GPL B;  4I5L B;  2BBN A;  3TS5 C;  5I2O A;  1MR8 A;  3PM8 A;  1QIW A;  1ODB A;  2CBL A;  1FW4 A;  3CGA A;  1A2X A;  4HSZ A;  1KCY A;  2BCB A;  3WNX B;  1REC A;  3SJS A;  1CDP A;  2LC5 A;  5PAL A;  1PSB A;  4QJ4 B;  1R2U A;  3VRP A;  3OB2 B;  3NSK A;  4PHK A;  4A4C A;  2E6W A;  1TNW A;  1KSO A;  1EJ3 A;  3I5F C;  1PVB A;  2LUC A;  1UWO A;  2KBM A;  4QJ5 B;  1CMF A;  3EK8 A;  4USL A;  5AAN A;  1B8C A;  4GGN A;  2OS8 B;  4JWQ A;  1S36 A;  4M2P A;  2ZNE A;  1QLS A;  2JTZ A;  1A4P A;  2KAY A;  3DVM A;  1DJH A;  3QRX A;  3FWB A;  4MRY A;  3LK1 A;  1KWO B;  4ORC B;  1LA0 A;  1ZUZ A;  1YUS A;  2LV7 A;  2QAC A;  5AEQ A;  3ZNI A;  3TUY C;  1XYD A;  1KQV A;  1K8U A;  3D0Y B;  5HKW A;  3SIB A;  1KSM A;  5AER A;  1NIW A;  1DJI A;  1A03 A;  1JSA A;  1S6C A;  1YX7 A;  2FOT A;  3NXA A;  2BBM A;  1OMD A;  3LL8 B;  1CFD A;  2K61 A;  2CXJ A;  1QX5 B;  1UHJ A;  3BOW A;  1M45 A;  5B8I B;  1JFJ A;  3SG6 A;  1AJ5 A;  2KFG A;  2M1U A;  4AQJ A;  2F8P A;  5ER4 X;  4C0L A;  4YRU A;  1N65 A;  4GAO A;  4P5O E;  1K9P A;  1NUB A;  4JQ0 D;  1IH0 A;  2COL B;  1SR6 C;  3EVV A;  2QPT A;  4PE7 A;  3EKJ A;  4DUQ A;  3TS5 B;  1FBV A;  3EK7 A;  3LK0 A;  1S5G Y;  2M9G A;  5AXI A;  1A29 A;  2KAX A;  1DJX A;  1MXE A;  1B4C A;  1M63 B;  4MRX A;  2MBX A;  3VGO A;  1ALW A;  4DCK A;  4TNC A;  4CLN A;  2OPO A;  1QS7 A;  2BKI B;  1SRA A;  2L51 A;  5IBW A;  1QX2 A;  2LM5 A;  4CID A;  2LVV A;  3I5F B;  3SG2 A;  2LMU A;  4ORB B;  1L7Z A;  1F70 A;  1TRF A;  4YI9 A;  5KSZ A;  1MWN A;  3KEV A;  4I5J A;  3HCM A;  1DVI A;  2BL0 B;  2GGM A;  1Y1A A;  1F8H A;  3AKA A;  3WXA A;  4FTG A;  4AQI A;  2K7B A;  2L2E A;  1L2O C;  3NSO A;  3GK2 A;  1LA3 A;  4GGF C;  1LKJ A;  1SL9 A;  1YUT A;  2LHL A;  2LVJ A;  1UHI A;  1IJ5 A;  1CB1 A;  3TUY B;  1YTZ C;  1DJW A;  2L50 A;  1WLZ A;  1NP8 A;  1CM4 A;  1NX1 A;  2HQW A;  2KI4 B;  1XFY O;  3TDZ A;  3TDU A;  2PRU A;  1DJY A;  1B1G A;  2JT0 A;  1E8A A;  2K7C A;  2EGD A;  1F55 A;  2JRF A;  1CDL A;  1MUX A;  1U5I B;  1QV1 A;  1RWY A;  3M0W A;  3PFV A;  1J7O A;  2NLN A;  2KFH A;  1KWO C;  3OHM B;  2MLE C;  2I18 A;  1B7T Y;  3CR4 X;  1EH2 A;  1K2H A;  1NCZ A;  1NSH A;  1S6J A;  2HQ8 A;  1YUU A;  2LMV A;  4DRW A;  1JF0 A;  2M8U A;  4MN0 A;  1CDN A;  2KFF A;  2LHI A;  1XO5 A;  1RRO A;  4C0J A;  1W7I B;  4MZJ A;  3PLF B;  1NCX A;  4CFR A;  1Y1U A;  1KK8 C;  1EG3 A;  1K93 D;  3EVU A;  1OSA A;  1QVI Y;  4PDZ A;  1WRZ A;  4MLW A;  1GQM A;  3FS7 A;  4WQ2 A;  2ZKM X;  3D0Y A;  4YGD B;  1SMG A;  4E68 A;  1J7Q A;  5GQQ C;  2JC2 A;  2OTG B;  2H61 C;  3JTD B;  1R6P A;  3OP0 A;  3VRN A;  1JC2 A;  1BR4 B;  4OKH A;  2LLT A;  5HLV A;  5BPJ A;  4PHM A;  1ZAC A;  2RGI A;  1QTX A;  4ZCV A;  4BY5 A;  3SG4 A;  1KFU S;  2ZRS A;  1WRL A;  3OX6 A;  1DGV A;  5DKN A;  1GJY A;  3O78 A;  1MF8 B;  2EC6 B;  3IQO A;  1MQ1 A;  4MBE A;  1J1E A;  2LP2 A;  1WDC B;  1L2O B;  3WHU B;  1EL4 A;  1BMO A;  2KGB C;  1KFU L;  1NYA A;  1IJ6 A;  1FPW A;  2L98 A;  2HF5 A;  3CZT X;  1YX8 A;  1D1O A;  1Y0V H;  3MSE B;  1G33 A;  2BL0 C;  1DMO A;  2ZN9 A;  5HKZ A;  1WLM A;  1IG5 A;  2PVB A;  3TZ1 A;  1CFF A;  2BE4 A;  2MJW B;  1XVJ A;  2KHN A;  3SG7 A;  1ZFS A;  2KI6 C;  1AUI B;  1M31 A;  2I7A A;  2JWW A;  1Y1X A;  5G08 A;  2LP3 A;  4MEW A;  1BOD A;  4A4B A;  1F54 A;  1SKT A;  4GFT A;  2L0P A;  2KDH A;  1SNL A;  2KI4 C;  2WCE A;  1NX3 A;  2AAO A;  2PMY A;  4QJ3 B;  2ISD A;  5HYD A;  3CLN A;  3OX5 A;  1CLB A;  4BY4 A;  3EVR A;  5DKR A;  1J7P A;  1CLL A;  3RM1 A;  2JU0 A;  1OMR A;  2DOQ A;  1B47 A;  1KK8 B;  1V1F A;  2SCP A;  2ZN8 A;  4FQO A;  4HRH A;  5D7F A;  1AP4 A;  2SAS A;  1QXP A;  1AJ4 A;  1IQ5 A;  3BUW B;  2F2P A;  1B8R A;  1BOC A;  4GBA A;  3A4U B;  1B8L A;  2Y1N A;  3ICB A;  3IF7 A;  1J55 A;  1JUO A;  1V1G A;  1TTX A;  1A75 A;  1FI5 A;  2KQY A;  2IS9 A;  2ZFD A;  1TCF A;  4XJK B;  2L5X B;  3DVK A;  1UP5 A;  4PE1 A;  2M3W A;  1BLQ A;  1SCV A;  1TIZ A;  2P6B B;  5HLO A;  2K2F A;  2PAL A;  2WCF A;  1G4Y R;  3DF0 A;  3AAJ A;  5KU1 A;  2OTG C;  3JTD C;  1Y6W A;  4AOM A;  1K9U A;  1BU3 A;  1OMV A;  1OZS A;  2NCP A;  2WND A;  4GNK B;  3I5H B;  1KQM C;  1SK6 D;  4OCI A;  1PAL A;  3EKH A;  2LCP A;  2JXC A;  1F4O A;  2EC6 C;  3BUM B;  2NCO A;  2JOJ A;  1YVH A;  1WDC C;  2H2K A;  5I2L A;  2F33 A;  1C07 A;  2MA2 A;  2LAP A;  3BXK A;  2K7O A;  5CPV A;  1TNX A;  4UPG A;  1C7W A;  1IRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...