1KFXS

Crystal structure of human m-calpain form i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
176
Chain Sequence
NESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords M-CALPAIN LARGE SUBUNIT
publication title The crystal structure of calcium-free human m-calpain suggests an electrostatic switch mechanism for activation by calcium.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2001-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kfxS00
1AJ4A 2KDHA 4DRWA 1N0YA 1CNPA 2K2FA 1JSAA 1JF2A 3CTNA 1NX0A 1K9PA 1BU3A 5CSIA 3PATA 1YX7A 2Y4QA 4BY4A 4OCIA 1MUXA 4NDBA 1KWOC 1L2OB 2IS9A 4ORAB 1YRTB 4HRHA 1JBAA 1PRWA 1QLSA 1KSMA 2MA2A 2KYFA 1A03A 1ODBA 1OOJA 1S5GZ 2MBXA 2I7AA 1RK9A 5D7FA 3GK1A 1KFUS 3GOFA 2WOSA 3BUNB 1KQMC 4C0KA 2Y1MA 3HCMA 2LUXA 3O6BA 2K61A 2M8UA 4PALA 5AERA 1TRFA 1NYAA 3CR5X 2ZFDA 2BBMA 3CGAA 5CSNA 1OZSA 1DGVA 2BL0B 2BKHB 1CLLA 2NZ0A 4MZKA 4YI8A 1K93D 2L2EA 3O4YA 1U5IA 2GV5A 1V1GA 1LINA 2KQ6A 2L0PA 3QRXA 2Y5IA 4GNKB 3TDIA 3OX6A 1K2HA 2LE9B 1K8UA 4AQJA 1DJGA 1MWNA 1MR8A 1AVSA 4OKHA 1IWQA 5HLVA 3EK7A 4PE1A 2M3WA 1UP5A 1CFFA 2JU0A 1WDCC 1YR5A 1IRJA 3BUWB 3I5IB 1H8BA 1DJXA 1Q80A 1SK6D 3AAJA 2WCBA 1TTXA 1KK8C 4WQ2A 5B8IB 1OSAA 5BPJA 3RLZA 1CDMA 1CFCA 2JQ6A 4JPZB 4OVNF 1U5IB 2BE4A 4AQIA 1L7ZA 2I2RE 1BJFA 5DKNA 2P6BB 1UUSA 1BODA 3PM8A 1H4BA 2M49B 3I5GC 1ZACA 2M7LA 3FS7A 1RTP1 3LK0A 1NPQA 1PALA 2NLNA 4A4BA 1KSOA 2CT9A 1KFUL 3DVMA 1NX3A 1G33A 1LXFC 4MLWA 4ZCUA 1R2UA 3KO0A 1SMGA 4USLA 1TNPA 1MQ1A 4R1EA 4QJ3B 1TN4A 3M0WA 4IL1A 1JFKA 1DVIA 1Y6WA 2JNXA 2NCPA 2BCBA 2K8MB 3PSRA 4YGCB 4CFRA 2BBNA 2KFFA 3K21A 4BY5A 4L9MA 3EK4A 3SIAA 2BCAA 1C7WA 3KEVA 3CR4X 1CTRA 1YRUB 1IJ5A 1SY9A 1NCXA 4UPGA 3DVKA 1OMVA 1ALWA 5KSZA 2WCFA 1NX2A 3OX5A 1J7QA 2JWWA 2JC2A 1K90D 3TUYC 2KI4B 1SNLA 1BG1A 1SBJA 5CSJA 3OP0A 4YGBB 1S1EA 1J1EA 4CIDA 3F45A 4AOMA 2K2AA 3CLNA 1RECA 1SR6B 1TCOB 1XK4A 2KBMA 3PN7C 3H4SE 3I5HC 1QX7A 2B1UA 2BECA 1YX8A 1TCFA 3NSIA 1SCMC 2OTGC 1CDLA 1QV0A 3EKJA 4CPVA 5F6TA 4PE0A 1ZFSA 2ZN9A 1KK7Z 4PE4A 3WHTB 5IBWA 1FW4A 2F8PA 2PVBA 2LMVA 1F55A 1ZOTB 1QVIY 3PALA 1QASA 3I5FC 2Y1NA 1CKKA 4GGFC 1D1OA 1E8AA 4XYNA 4PHKA 2OS8B 3E3RA 2K7DA 1B7TZ 2M29A 4WQ3A 2L51A 5JOLA 1AJ5A 2M97A 1Y1UA 2LC5A 2ZRTA 2Q91A 4YGAA 2LP2A 3D10A 5ER4X 3JTDB 1EG4A 1S26D 1SYMA 4C0LA 2JTZA 2H61A 1S6IA 2LP3A 4YI9A 4WRIA 1KCYA 5G08A 1XFXO 3TZ1A 5GQQC 1XFUO 1QV1A 2NXQA 1XFYO 2F2PA 1DJWA 1B8LA 1A2XA 2CBLA 1TNQA 2M1KB 4MSPA 2G9BA 4P2YB 2QACA 1QXPA 2KYCA 2AAOA 5KTYA 5HYDA 1IJ6A 3C1VA 1IKUA 1XO5A 3EVUA 4JQ0D 2JOJA 2TN4A 2JT0A 2L98A 1KFXS 1UHKA 1NX1A 2PASA 2LAPA 3A4UB 1B8RA 3O78A 5D69A 1C07A 2LVIA 1LA3A 2KHNA 1BLQA 1DTLA 1W7JB 1OE9B 4HRGA 2R2IA 3DVJA 4GUKA 1F4OA 1G4YR 4MZJA 2Q4UA 1IGVA 3IQOA 4DS7A 3IQQA 3VRQA 1UHNA 1VRKA 4OR9B 1ZUZA 1JF0A 1BR4B 3LCPC 1GJYA 2FCDA 3TDUA 3BOWA 2I18A 1EJ3A 3NSKA 2KI6C 4FTGA 1JFJA 3OHMB 4ICBA 3CR2A 1RJVA 5I2LA 1B47A 1DMOA 3JVTB 1L2OC 1UHJA 2MHHA 2VRGA 5AFPA 1M63B 2L5XB 1A75A 2K7OA 1HT9A 4P5OE 1HQVA 2CXJA 2F2OA 4N1GA 1CFPA 4ETOA 1CDPA 1F4QA 2L50A 2MAZA 1BMOA 3KF9A 4GPLB 1DJHA 1PSRA 1TNXA 5JJGA 4MRXA 3IF7A 1OMRA 1N2DA 2DOQA 3TS5B 1QVIZ 1YUUA 2K7CA 3BOWB 1EL4A 2WORA 2LHLA 3GK4X 3BYAA 3KHEA 2LNKA 1N65A 1B1GA 2BL0C 2K7BA 5HKWA 1PULA 1GQMA 1YVLA 2D8NA 2HETA 3NSLA 1A75B 2JT8A 2L4HA 1QJTA 1TIZA 3WXAA 1LVCD 4I5KA 1J7PA 3VRNA 1PVBA 1AK8A 1KFXL 1XA5A 4PCWA 1FF1A 2KGRA 1CLBA 4MN0A 2KAXA 2NCOA 3LLEA 3OB1B 1WRZA 1S5GY 3SG4A 1IQ3A 3OB2B 4U8DA 2KQYA 2KOTA 4YBHB 1IQ5A 1PK0D 1Y0VH 2EC6B 1Y1AA 2I94A 3I5IC 4MEWA 4M2QA 1XFWO 2MJWB 1SL8A 1MXEA 1DGUA 3LL8B 3SG7A 2M1UA 2FCEA 2KNEA 3A8RA 1RROA 4PE7A 2QPTA 1QLKA 1Y1XA 1MHOA 2KAYA 1DJIA 1A4PA 1SCVA 4I5JA 1K96A 4PHNA 5TNCA 2HPSA 2LVKA 2LLUA 5AEQA 5AXIA 1KWOB 2CTNA 2G2BA 2JULA 3GK2A 4MZLA 1RWYA 3CS1A 1X02A 1WRKA 4GAOA 1B9AA 3LK1A 1F71A 1S3PA 1YVHA 5DKRA 1QIWA 2MRDA 2F3ZA 1SKTA 4MRYA 1J55A 1KQMB 2LMUA 4D1EA 2JRFA 1WLMA 3FWCA 2AMIA 2ISDA 2KAVA 3FIAA 4GBAA 2LV7A 1UHIA 1K9KA 1OMDA 1XFZO 2LCPA 2ZRSA 4M2OA 3SG5A 1J7OA 5I8NA 3O2PA 2E6WA 5CPVA 4NQGA 1QIVA 2LM5A 5CSFA 2KI4C 5I2OA 2GGZA 2F33A 3BUOB 2JXCA 4DCKA 1WLZA 1SL9A 3PFVA 4ZCVA 1SRAA 3MSEB 5KU1A 2RGIA 2V53A 2SCPA 3DVEA 1W7IB 4CFQA 3ICBA 1DF0A 1SR6C 5DKQA 1BT6A 5HKYA 1K94A 2PALA 2KGBC 3BUXB 5HLOA 1AP4A 1DT7B 2H2KA 1WDCB 1B4CA 4F0ZB 1IG5A 1V1FA 1KK8B 5AANA 1BR1B 4YRUA 4PDZA 2FJUB 1M31A 2M7NA 3BXKA 4MBEA 2AUCA 1S6CA 3BQ3A 2O60A 2F3YA 1EH2A 3SIBA 2OS8C 1K9UA 2WNDA 3WHUB 1A29A 1DF0B 3I5GB 3EVVA 2WCEA 4NDDA 5FYXA 3CZTX 1XK4C 2LHIA 1NSHA 1UWOA 2KFHA 3JTDC 1BOCA 3WNXB 3VRPA 2L4IA 3SG3A 1LKJA 2PRUA 2HQWA 1M39A 4ORCB 2A4JA 1MXLC 1GGZA 1NCYA 1CDNA 2JZIA 1OZOA 1UHHA 1AUIB 1KK7Y 1JWDA 2PMYA 1TOPA 3DF0A 4A4CA 1DJZA 1UURA 2CCMA 2EHBA 5K89A 2ZNDA 1IH0A 2M0RA 2HF5A 2OPOA 4YGEB 5ER5A 3TDZA 2KBIA 4N5XA 3RM1A 1BF5A 1SPYA 2KSPA 5I2QA 3AKAA 2JTTA 2BKIB 1B7TY 2JXLA 2LVVA 2H61C 2LMTA 3EK8A 1MF8B 3TUYB 4GGFA 1CM1A 3SG6A 4M2PA 1K95A 1NWDA 4E68A 3PLFB 3VGOA 3SG2A 3VROA 1FBVA 4HREE 2JT3A 4XJKA 5J3XA 4JWQA 3DD4A 5PALA 2KFGA 1M46A 1NP8A 1XVJA 3PN7B 3AKBA 1QATA 3JVTC 3I5HB 2LANA 2KI6D 2LUCA 1YTZC 3DF0B 3EKHA 1F54A 1SCMB 4I5NB 2OTGB 1F8HA 1FI5A 2COLB 1FI6A 4GGNA 1S36A 2LLTA 3AAKA 1CMFA 2ZNEA 2ZKMX 3VRRA 4HSZA 1WY9A 1ALVA 2JNFA 3I5FB 3ZNIA 2PSRA 4GFTA 4CLNA 2BCXA 1NIWA 1PSBA 4ORBB 3SJSA 1CB1A 4QJ5B 3D0YA 2MLFC 2M9GA 1GGWA 1NCZA 3TS5C 4TNCA 1G8IA 5HKZA 1NUBA 2WC8A 1S6JA 3NSOA 1FPWA 4XJKB 4N1FA 1B8CA 1QTXA 2HQ8A 2GGMA 1XYDA 1SL7A 2BE6A 1CFDA 3HX4A 1YURA 1QX2A 1PVAA 1ZMZA 4DIRA 3FWBA 4I5LB 4PHJA 1LA0A 1EXRA 2JPTA 4QJ4B 1EG3A 4DUQA 1SW8A 2SASA 3KPXA 2LLSA 4C0JA 1F70A 1J1DA 2ZN8A 1RFJA 1TNWA 3EVRA 4Q04A 1R6PA 1XFVO 1M45A 1QX5B 4YGDB 1J7RA 1KQVA 3ZWHA 3NXAA 3D0YB 2CNPA 1JUOA 1WRLA 1CLMA 2FOTA 1AHRA 2EC6C 4MVFA 4PHMA 4FQOA 1CMGA 1YUSA 2K0JA 2LVJA 3CWGA 2E30A 1YUTA 1OQPA 2MLEC 2O5GA 1QS7A 1CM4A 1DJYA 1JC2A 4NDCA 1C7VA 3BUMB 2EGDA 4OV2A
chains in the Genus database with same CATH superfamily
1AJ4A 2KDHA 4DRWA 1N0YA 1CNPA 2K2FA 1JSAA 1JF2A 1TUJA 3CTNA 1NX0A 1K9PA 1BU3A 5CSIA 3PATA 1YX7A 2Y4QA 2PYQA 4BY4A 4OCIA 2L5YA 3S0EA 1MUXA 4NDBA 1KWOC 1L2OB 2IS9A 4ORAB 1YRTB 4HRHA 1JBAA 1PRWA 1QLSA 1KSMA 2MA2A 2KYFA 1A03A 1ODBA 1OOJA 1S5GZ 2MBXA 2I7AA 1RK9A 5D7FA 3GK1A 1KFUS 3GOFA 2WOSA 3BUNB 1KQMC 3NHIA 4C0KA 2Y1MA 3HCMA 2LUXA 3O6BA 2K61A 2M8UA 4PALA 5AERA 1TRFA 1NYAA 3CR5X 3R1VA 2ZFDA 2BBMA 3S0BA 3D75A 3CGAA 5CSNA 2ERBA 1OZSA 1DGVA 2BL0B 4INWA 2BKHB 1CLLA 2NZ0A 4MZKA 4YI8A 1K93D 2L2EA 3O4YA 1U5IA 2GV5A 1V1GA 3D74A 1LINA 2KQ6A 2L0PA 3QRXA 2Y5IA 4GNKB 3TDIA 3OX6A 1K2HA 2L2CA 2LE9B 1K8UA 4AQJA 3FE6A 1DJGA 1MWNA 1MR8A 1AVSA 3R1PA 4OKHA 1IWQA 2QEVA 5HLVA 3EK7A 4PE1A 2M3WA 1UP5A 1CFFA 2JU0A 1WDCC 1YR5A 1IRJA 3BUWB 3I5IB 1ORGA 1H8BA 1DJXA 1Q80A 1SK6D 3AAJA 2WCBA 1TTXA 3FE9A 1KK8C 4WQ2A 3L4AA 3B7AA 5B8IB 1OSAA 5BPJA 3RLZA 1CDMA 4JKTA 2JQ6A 4JPZB 1CFCA 4OVNF 1U5IB 2BE4A 4AQIA 1L7ZA 2I2RE 1BJFA 5DKNA 2P6BB 1UUSA 3FE8A 1BODA 3PM8A 2WCHA 1H4BA 2M49B 3I5GC 1ZACA 2M7LA 3FS7A 1RTP1 3LK0A 1NPQA 1PALA 2NLNA 3UO9A 1KSOA 2CT9A 4A4BA 1KFUL 3DVMA 1LS8A 1G33A 1LXFC 1NX3A 4MLWA 4ZCUA 1R2UA 3KO0A 1SMGA 1Z4HA 4USLA 1TNPA 1MQ1A 4R1EA 4QJ3B 1TN4A 3M0WA 2K60A 4IL1A 1JFKA 3B6XA 1DVIA 1Y6WA 3RZSA 2BNXA 2JNXA 2NCPA 2BCBA 2K8MB 2BAPA 3PSRA 4YGCB 4CFRA 5HL1A 2BBNA 2KFFA 3K21A 4BY5A 3BJHA 4L9MA 3EK4A 4OZDA 3SIAA 2BCAA 1C7WA 3KEVA 3CR4X 1CTRA 1YRUB 1IJ5A 1GM0A 1SY9A 1NCXA 4UPGA 3DVKA 1OMVA 1C3YA 1ALWA 1OOHA 5KSZA 2WCFA 1NX2A 3OX5A 2WC6A 2JWWA 1J7QA 2JC2A 1K90D 3TUYC 1OOIX 2KI4B 3SS5A 1SNLA 1BG1A 1SBJA 5CSJA 3OP0A 4YGBB 1OW4A 1S1EA 1J1EA 3B86A 3F45A 4CIDA 4AOMA 2K2AA 3CLNA 1RECA 1SR6B 1TCOB 1T14A 1XK4A 2KBMA 3PN7C 3H4SE 3I5HC 1QX7A 2B1UA 2KLEA 2BECA 1YX8A 1TCFA 2PQLA 1SCMC 3NSIA 2OTGC 1CDLA 1QV0A 3EKJA 4CPVA 5F6TA 3DXLA 4PE0A 1ZFSA 2ZN9A 1KK7Z 5DICA 4PE4A 3WHTB 5IBWA 3OGNA 1FW4A 2F8PA 2PVBA 2LMVA 1F55A 1ZOTB 1QVIY 3PALA 1QASA 3I5FC 1DC1A 2Y1NA 1CKKA 3V2LA 4GGFC 1D1OA 1E8AA 4XYNA 4PHKA 5FI6A 2OS8B 2JPOA 2QEOA 1QWVA 2K7DA 1B7TZ 2M29A 3E3RA 4WQ3A 2L51A 5JOLA 3SS4A 1AJ5A 2M97A 1Y1UA 2LC5A 2ZRTA 4PT1A 2Q91A 4YGAA 2LP2A 3D10A 5ER4X 3JTDB 1EG4A 1S26D 1SYMA 4C0LA 2JTZA 2H61A 1S6IA 2LP3A 4YI9A 4WRIA 1KCYA 5G08A 1XFXO 3TZ1A 3CZ0A 5GQQC 1XFUO 1QV1A 2NXQA 1XFYO 2F2PA 5I94A 1DJWA 1DEKA 1B8LA 1A2XA 1TNQA 2CBLA 2M1KB 4MSPA 2G9BA 4P2YB 2QACA 1QXPA 2KYCA 3DYEA 2AAOA 5KTYA 5HYDA 1IJ6A 3C1VA 1IKUA 1XO5A 3EVUA 4JQ0D 2JOJA 2TN4A 2JT0A 2L98A 1KFXS 1UHKA 1NX1A 2PASA 2LAPA 3A4UB 1B8RA 3O78A 5D69A 1C07A 2LVIA 1LA3A 2KHNA 1BLQA 1DTLA 1W7JB 1OE9B 4HRGA 2R2IA 3DVJA 4GUKA 1F4OA 1G4YR 1OOGA 4MZJA 2Q4UA 1IGVA 3IQOA 4DS7A 3IQQA 3VRQA 1UHNA 1VRKA 4OR9B 1ZUZA 1JF0A 1BR4B 3LCPC 1GJYA 2FCDA 3TDUA 3BOWA 2I18A 1EJ3A 3NSKA 2KI6C 4FTGA 1JFJA 3OHMB 4KYNA 4ICBA 3CR2A 1RJVA 5I2LA 1B47A 1DMOA 3JVTB 1L2OC 1UHJA 2MHHA 2VRGA 5AFPA 1M63B 1TWOA 1W9ZA 2L5XB 1A75A 2K7OA 1HT9A 4P5OE 1HQVA 2CXJA 2F2OA 4N1GA 1CFPA 4ETOA 1CDPA 1F4QA 2L50A 3BFBA 2MAZA 1BMOA 2P71A 3PM2A 3KF9A 4GPLB 1DJHA 2QDIA 1PSRA 1TNXA 5JJGA 4MRXA 3IF7A 1OMRA 1N2DA 2DOQA 3TS5B 1QVIZ 1YUUA 2K7CA 3BOWB 1EL4A 2WORA 2LHLA 3GK4X 3BYAA 3KHEA 2LNKA 3IVTA 1N65A 1B1GA 2BL0C 2K7BA 5HKWA 1PULA 1GQMA 1YVLA 2D8NA 2HETA 3NSLA 3B88A 1A75B 2JT8A 2L4HA 3R1OA 1QJTA 1TIZA 3WXAA 1LVCD 4I5KA 1J7PA 3VRNA 1PVBA 1AK8A 1KFXL 1XA5A 4PCWA 1FF1A 2KGRA 1TUZA 2YGUA 2KAXA 2NCOA 4MN0A 1CLBA 3LLEA 3OB1B 1WRZA 1S5GY 3SG4A 1IQ3A 3OB2B 4U8DA 2KQYA 3SS3A 2KOTA 4YBHB 1IQ5A 1PK0D 1Y0VH 2EC6B 1Y1AA 2I94A 3CZ2A 3I5IC 4MEWA 4M2QA 1XFWO 1Z2CB 2MJWB 1SL8A 1MXEA 1DGUA 3LL8B 3SG7A 2M1UA 2FCEA 2KNEA 3A8RA 1RROA 4PE7A 2QPTA 1QLKA 1Y1XA 1MHOA 2KAYA 4JD9A 1DJIA 3L47A 1A4PA 1SCVA 4I5JA 1K96A 4PHNA 5TNCA 2HPSA 2LVKA 3N7HA 5D3OA 2LLUA 2WCLA 5AEQA 5AXIA 1KWOB 2CTNA 3NGVA 3K1EA 2G2BA 2JULA 3GK2A 4MZLA 1RWYA 3VB1A 3CS1A 1X02A 1WRKA 4GAOA 1B9AA 3LK1A 1F71A 1C3ZA 1S3PA 3O4XA 3D73A 1YVHA 5DKRA 3CDNA 1QIWA 2MRDA 2F3ZA 1SKTA 4MRYA 1J55A 1KQMB 2LMUA 4D1EA 2QEHA 2JRFA 1WLMA 3FWCA 2AMIA 2ISDA 2KAVA 3S0AA 3FIAA 4GBAA 2KLDA 3OBVA 2LV7A 3DZTA 1UHIA 1K9KA 5FI2A 1OMDA 1XFZO 2LCPA 2ZRSA 4M2OA 3SG5A 1J7OA 5I8NA 3D78A 3O2PA 2E6WA 5CPVA 2WCKA 4NQGA 1QIVA 2LM5A 5CSFA 2KI4C 3BFHA 2GGZA 5I2OA 2F33A 3BUOB 3Q8IA 2JXCA 4DCKA 1WLZA 1SL9A 3PFVA 4ZCVA 1SRAA 3MSEB 5KU1A 1DELA 2RGIA 2V53A 2SCPA 3DVEA 1W7IB 4CFQA 3ICBA 1DF0A 3CYZA 1SR6C 5DKQA 1BT6A 5HKYA 1K94A 2PALA 2KGBC 3BUXB 5HLOA 1AP4A 1DT7B 2H2KA 1WDCB 1B4CA 4F0ZB 1IG5A 1V1FA 1XFRA 1KK8B 5AANA 3QMEA 1BR1B 4YRUA 4PDZA 2FJUB 1M31A 2M7NA 1C7VA 3BXKA 4MBEA 2AUCA 1S6CA 3BQ3A 2O60A 2F3YA 5EL2A 1EH2A 3SIBA 3L4LA 2OS8C 1K9UA 2WNDA 3WHUB 1A29A 1DF0B 3I5GB 3EVVA 2WCEA 4NDDA 5FYXA 3UNWA 3CZTX 2WCJA 1XK4C 2LHIA 1DQEA 1NSHA 1UWOA 2KFHA 3JTDC 1BOCA 3WNXB 4IJ7A 3VRPA 1P28A 2L4IA 3SG3A 1LKJA 2PRUA 2HQWA 1M39A 3CZ1A 4ORCB 1MXLC 2A4JA 1IIOA 1GGZA 1NCYA 1CDNA 2JZIA 1OZOA 4FQTA 1UHHA 1AUIB 1KK7Y 1JWDA 2PMYA 1OOFA 1TOPA 3DF0A 1DJZA 2WCMA 4A4CA 1UURA 2CCMA 2EHBA 5K89A 2ZNDA 1IH0A 2M0RA 3S0DA 2HF5A 2OPOA 4YGEB 5ER5A 3TDZA 2KBIA 4N5XA 3RM1A 1BF5A 1SPYA 2KSPA 5I2QA 3AKAA 2JTTA 2BKIB 1B7TY 2JXLA 2LVVA 2H61C 2LMTA 3EK8A 1MF8B 3TUYB 4GGFA 1CM1A 3EG5B 3SG6A 4M2PA 1K95A 1NWDA 4E68A 3PLFB 3VGOA 3SG2A 3VROA 1FBVA 2H8VA 4INXA 4HREE 2JT3A 4XJKA 5J3XA 4JWQA 3DD4A 5PALA 2KFGA 1M46A 1NP8A 1XVJA 3PN7B 3AKBA 1QATA 3JVTC 3I5HB 2LANA 2KI6D 2LUCA 1YTZC 3DF0B 3EKHA 2P70A 1F54A 1SCMB 4I5NB 2OTGB 1F8HA 1SSEB 2COLB 3S0FA 1FI5A 1FI6A 4GGNA 1S36A 2LLTA 2QEBA 3AAKA 1CMFA 2ZNEA 2ZKMX 5FI7A 3VRRA 4HSZA 1WY9A 1ALVA 2JNFA 2WC5A 3D76A 3I5FB 3ZNIA 2PSRA 4GFTA 4CLNA 2BCXA 1NIWA 1PSBA 3PJIA 4ORBB 3SJSA 1CB1A 4QJ5B 3D0YA 2MLFC 2M9GA 1GGWA 1NCZA 3TS5C 4TNCA 1G8IA 5HKZA 1NUBA 2WC8A 1S6JA 3DY9A 3NSOA 1FPWA 4XJKB 4N1FA 1B8CA 1QTXA 2HQ8A 2GGMA 3D77A 1XYDA 1SL7A 2BE6A 1CFDA 2KPHA 1YURA 3HX4A 1QX2A 3S0GA 1PVAA 1ZMZA 4DIRA 3CABA 3FWBA 4I5LB 4PHJA 1LA0A 1EXRA 2JPTA 4QJ4B 1EG3A 4DUQA 1SW8A 4F7FA 2SASA 3KPXA 2LLSA 4C0JA 1F70A 1J1DA 2ZN8A 1RFJA 1TNWA 3EVRA 4Q04A 1R6PA 1XFVO 1M45A 1QX5B 2FJYA 3NHTA 3R72A 4YGDB 1J7RA 1KQVA 3ZWHA 3NXAA 3D0YB 1JUOA 1WRLA 1CLMA 2CNPA 2FOTA 1AHRA 2EC6C 4MVFA 4PHMA 4FQOA 1CMGA 1YUSA 2K0JA 2LVJA 2GTEA 2E30A 3BFAA 3CWGA 1YUTA 1OQPA 2MLEC 2O5GA 1QS7A 1CM4A 1DJYA 1JC2A 4NDCA 3B87A 3BUMB 2EGDA 4OV2A
chains in the Genus database with same CATH topology
1AJ4A 2KDHA 4DRWA 1N0YA 1CNPA 2K2FA 1JSAA 1JF2A 3CTNA 1NX0A 1K9PA 1BU3A 5CSIA 3PATA 1YX7A 2Y4QA 4BY4A 4OCIA 1MUXA 4NDBA 1KWOC 1L2OB 2IS9A 4ORAB 1YRTB 4HRHA 1JBAA 1PRWA 1QLSA 1KSMA 2MA2A 2KYFA 1A03A 1ODBA 1OOJA 1S5GZ 2MBXA 2I7AA 1RK9A 5D7FA 3GK1A 1KFUS 3GOFA 2WOSA 3BUNB 1KQMC 4C0KA 2Y1MA 3HCMA 2LUXA 3O6BA 2K61A 2M8UA 4PALA 5AERA 1TRFA 1NYAA 3CR5X 2ZFDA 2BBMA 3CGAA 5CSNA 1OZSA 1DGVA 2BL0B 2BKHB 1CLLA 2NZ0A 4MZKA 4YI8A 1K93D 2L2EA 3O4YA 1U5IA 2GV5A 1V1GA 1LINA 2KQ6A 2L0PA 3QRXA 2Y5IA 4GNKB 3TDIA 3OX6A 1K2HA 2LE9B 1K8UA 4AQJA 1DJGA 1MWNA 1MR8A 1AVSA 4OKHA 1IWQA 5HLVA 3EK7A 4PE1A 2M3WA 1UP5A 1CFFA 2JU0A 1WDCC 1YR5A 1IRJA 3BUWB 3I5IB 1H8BA 1DJXA 1Q80A 1SK6D 3AAJA 2WCBA 1TTXA 1KK8C 4WQ2A 5B8IB 1OSAA 5BPJA 3RLZA 1CDMA 1CFCA 2JQ6A 4JPZB 4OVNF 1U5IB 2BE4A 4AQIA 1L7ZA 2I2RE 1BJFA 5DKNA 2P6BB 1UUSA 1BODA 3PM8A 1H4BA 2M49B 3I5GC 1ZACA 2M7LA 3FS7A 1RTP1 3LK0A 1NPQA 1PALA 2NLNA 4A4BA 1KSOA 2CT9A 1KFUL 3DVMA 1NX3A 1G33A 1LXFC 4MLWA 4ZCUA 1R2UA 3KO0A 1SMGA 4USLA 1TNPA 1MQ1A 4R1EA 4QJ3B 1TN4A 3M0WA 4IL1A 1JFKA 1DVIA 1Y6WA 2JNXA 2NCPA 2BCBA 2K8MB 3PSRA 4YGCB 4CFRA 2BBNA 2KFFA 3K21A 4BY5A 4L9MA 3EK4A 3SIAA 2BCAA 1C7WA 3KEVA 3CR4X 1CTRA 1YRUB 1IJ5A 1SY9A 1NCXA 4UPGA 3DVKA 1OMVA 1ALWA 5KSZA 2WCFA 1NX2A 3OX5A 1J7QA 2JWWA 2JC2A 1K90D 3TUYC 2KI4B 1SNLA 1BG1A 1SBJA 5CSJA 3OP0A 4YGBB 1S1EA 1J1EA 4CIDA 3F45A 4AOMA 2K2AA 3CLNA 1RECA 1SR6B 1TCOB 1XK4A 2KBMA 3PN7C 3H4SE 3I5HC 1QX7A 2B1UA 2BECA 1YX8A 1TCFA 3NSIA 1SCMC 2OTGC 1CDLA 1QV0A 3EKJA 4CPVA 5F6TA 4PE0A 1ZFSA 2ZN9A 1KK7Z 4PE4A 3WHTB 5IBWA 1FW4A 2F8PA 2PVBA 2LMVA 1F55A 1ZOTB 1QVIY 3PALA 1QASA 3I5FC 2Y1NA 1CKKA 4GGFC 1D1OA 1E8AA 4XYNA 4PHKA 2OS8B 3E3RA 2K7DA 1B7TZ 2M29A 4WQ3A 2L51A 5JOLA 1AJ5A 2M97A 1Y1UA 2LC5A 2ZRTA 2Q91A 4YGAA 2LP2A 3D10A 5ER4X 3JTDB 1EG4A 1S26D 1SYMA 4C0LA 2JTZA 2H61A 1S6IA 2LP3A 4YI9A 4WRIA 1KCYA 5G08A 1XFXO 3TZ1A 5GQQC 1XFUO 1QV1A 2NXQA 1XFYO 2F2PA 1DJWA 1B8LA 1A2XA 2CBLA 1TNQA 2M1KB 4MSPA 2G9BA 4P2YB 2QACA 1QXPA 2KYCA 2AAOA 5KTYA 5HYDA 1IJ6A 3C1VA 1IKUA 1XO5A 3EVUA 4JQ0D 2JOJA 2TN4A 2JT0A 2L98A 1KFXS 1UHKA 1NX1A 2PASA 2LAPA 3A4UB 1B8RA 3O78A 5D69A 1C07A 2LVIA 1LA3A 2KHNA 1BLQA 1DTLA 1W7JB 1OE9B 4HRGA 2R2IA 3DVJA 4GUKA 1F4OA 1G4YR 4MZJA 2Q4UA 1IGVA 3IQOA 4DS7A 3IQQA 3VRQA 1UHNA 1VRKA 4OR9B 1ZUZA 1JF0A 1BR4B 3LCPC 1GJYA 2FCDA 3TDUA 3BOWA 2I18A 1EJ3A 3NSKA 2KI6C 4FTGA 1JFJA 3OHMB 4ICBA 3CR2A 1RJVA 5I2LA 1B47A 1DMOA 3JVTB 1L2OC 1UHJA 2MHHA 2VRGA 5AFPA 1M63B 2L5XB 1A75A 2K7OA 1HT9A 4P5OE 1HQVA 2CXJA 2F2OA 4N1GA 1CFPA 4ETOA 1CDPA 1F4QA 2L50A 2MAZA 1BMOA 3KF9A 4GPLB 1DJHA 1PSRA 1TNXA 5JJGA 4MRXA 3IF7A 1OMRA 1N2DA 2DOQA 3TS5B 1QVIZ 1YUUA 2K7CA 3BOWB 1EL4A 2WORA 2LHLA 3GK4X 3BYAA 3KHEA 2LNKA 1N65A 1B1GA 2BL0C 2K7BA 5HKWA 1PULA 1GQMA 1YVLA 2D8NA 2HETA 3NSLA 1A75B 2JT8A 2L4HA 1QJTA 1TIZA 3WXAA 1LVCD 4I5KA 1J7PA 3VRNA 1PVBA 1AK8A 1KFXL 1XA5A 4PCWA 1FF1A 2KGRA 1CLBA 4MN0A 2KAXA 2NCOA 3LLEA 3OB1B 1WRZA 1S5GY 3SG4A 1IQ3A 3OB2B 4U8DA 2KQYA 2KOTA 4YBHB 1IQ5A 1PK0D 1Y0VH 2EC6B 1Y1AA 2I94A 3I5IC 4MEWA 4M2QA 1XFWO 2MJWB 1SL8A 1MXEA 1DGUA 3LL8B 3SG7A 2M1UA 2FCEA 2KNEA 3A8RA 1RROA 4PE7A 2QPTA 1QLKA 1Y1XA 1MHOA 2KAYA 1DJIA 1A4PA 1SCVA 4I5JA 1K96A 4PHNA 5TNCA 2HPSA 2LVKA 2LLUA 5AEQA 5AXIA 1KWOB 2CTNA 2G2BA 2JULA 3GK2A 4MZLA 1RWYA 3CS1A 1X02A 1WRKA 4GAOA 1B9AA 3LK1A 1F71A 1S3PA 1YVHA 5DKRA 1QIWA 2MRDA 2F3ZA 1SKTA 4MRYA 1J55A 1KQMB 2LMUA 4D1EA 2JRFA 1WLMA 3FWCA 2AMIA 2ISDA 2KAVA 3FIAA 4GBAA 2LV7A 1UHIA 1K9KA 1OMDA 1XFZO 2LCPA 2ZRSA 4M2OA 3SG5A 1J7OA 5I8NA 3O2PA 2E6WA 5CPVA 4NQGA 1QIVA 2LM5A 5CSFA 2KI4C 5I2OA 2GGZA 2F33A 3BUOB 2JXCA 4DCKA 1WLZA 1SL9A 3PFVA 4ZCVA 1SRAA 3MSEB 5KU1A 2RGIA 2V53A 2SCPA 3DVEA 1W7IB 4CFQA 3ICBA 1DF0A 1SR6C 5DKQA 1BT6A 5HKYA 1K94A 2PALA 2KGBC 3BUXB 5HLOA 1AP4A 1DT7B 2H2KA 1WDCB 1B4CA 4F0ZB 1IG5A 1V1FA 1KK8B 5AANA 1BR1B 4YRUA 4PDZA 2FJUB 1M31A 2M7NA 3BXKA 4MBEA 2AUCA 1S6CA 3BQ3A 2O60A 2F3YA 1EH2A 3SIBA 2OS8C 1K9UA 2WNDA 3WHUB 1A29A 1DF0B 3I5GB 3EVVA 2WCEA 4NDDA 5FYXA 3CZTX 1XK4C 2LHIA 1NSHA 1UWOA 2KFHA 3JTDC 1BOCA 3WNXB 3VRPA 2L4IA 3SG3A 1LKJA 2PRUA 2HQWA 1M39A 4ORCB 2A4JA 1MXLC 1GGZA 1NCYA 1CDNA 2JZIA 1OZOA 1UHHA 1AUIB 1KK7Y 1JWDA 2PMYA 1TOPA 3DF0A 4A4CA 1DJZA 1UURA 2CCMA 2EHBA 5K89A 2ZNDA 1IH0A 2M0RA 2HF5A 2OPOA 4YGEB 5ER5A 3TDZA 2KBIA 4N5XA 3RM1A 1BF5A 1SPYA 2KSPA 5I2QA 3AKAA 2JTTA 2BKIB 1B7TY 2JXLA 2LVVA 2H61C 2LMTA 3EK8A 1MF8B 3TUYB 4GGFA 1CM1A 3SG6A 4M2PA 1K95A 1NWDA 4E68A 3PLFB 3VGOA 3SG2A 3VROA 1FBVA 4HREE 2JT3A 4XJKA 5J3XA 4JWQA 3DD4A 5PALA 2KFGA 1M46A 1NP8A 1XVJA 3PN7B 3AKBA 1QATA 3JVTC 3I5HB 2LANA 2KI6D 2LUCA 1YTZC 3DF0B 3EKHA 1F54A 1SCMB 4I5NB 2OTGB 1F8HA 1FI5A 2COLB 1FI6A 4GGNA 1S36A 2LLTA 3AAKA 1CMFA 2ZNEA 2ZKMX 3VRRA 4HSZA 1WY9A 1ALVA 2JNFA 3I5FB 3ZNIA 2PSRA 4GFTA 4CLNA 2BCXA 1NIWA 1PSBA 4ORBB 3SJSA 1CB1A 4QJ5B 3D0YA 2MLFC 2M9GA 1GGWA 1NCZA 3TS5C 4TNCA 1G8IA 5HKZA 1NUBA 2WC8A 1S6JA 3NSOA 1FPWA 4XJKB 4N1FA 1B8CA 1QTXA 2HQ8A 2GGMA 1XYDA 1SL7A 2BE6A 1CFDA 3HX4A 1YURA 1QX2A 1PVAA 1ZMZA 4DIRA 3FWBA 4I5LB 4PHJA 1LA0A 1EXRA 2JPTA 4QJ4B 1EG3A 4DUQA 1SW8A 2SASA 3KPXA 2LLSA 4C0JA 1F70A 1J1DA 2ZN8A 1RFJA 1TNWA 3EVRA 4Q04A 1R6PA 1XFVO 1M45A 1QX5B 4YGDB 1J7RA 1KQVA 3ZWHA 3NXAA 3D0YB 2CNPA 1JUOA 1WRLA 1CLMA 2FOTA 1AHRA 2EC6C 4MVFA 4PHMA 4FQOA 1CMGA 1YUSA 2K0JA 2LVJA 3CWGA 2E30A 1YUTA 1OQPA 2MLEC 2O5GA 1QS7A 1CM4A 1DJYA 1JC2A 4NDCA 1C7VA 3BUMB 2EGDA 4OV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJ4 A;  2KDH A;  4DRW A;  1N0Y A;  1CNP A;  2K2F A;  1JSA A;  1JF2 A;  3CTN A;  1NX0 A;  1K9P A;  1BU3 A;  5CSI A;  3PAT A;  1YX7 A;  2Y4Q A;  4BY4 A;  4OCI A;  1MUX A;  4NDB A;  1KWO C;  1L2O B;  2IS9 A;  4ORA B;  1YRT B;  4HRH A;  1JBA A;  1PRW A;  1QLS A;  1KSM A;  2MA2 A;  2KYF A;  1A03 A;  1ODB A;  1OOJ A;  1S5G Z;  2MBX A;  2I7A A;  1RK9 A;  5D7F A;  3GK1 A;  1KFU S;  3GOF A;  2WOS A;  3BUN B;  1KQM C;  4C0K A;  2Y1M A;  3HCM A;  2LUX A;  3O6B A;  2K61 A;  2M8U A;  4PAL A;  5AER A;  1TRF A;  1NYA A;  3CR5 X;  2ZFD A;  2BBM A;  3CGA A;  5CSN A;  1OZS A;  1DGV A;  2BL0 B;  2BKH B;  1CLL A;  2NZ0 A;  4MZK A;  4YI8 A;  1K93 D;  2L2E A;  3O4Y A;  1U5I A;  2GV5 A;  1V1G A;  1LIN A;  2KQ6 A;  2L0P A;  3QRX A;  2Y5I A;  4GNK B;  3TDI A;  3OX6 A;  1K2H A;  2LE9 B;  1K8U A;  4AQJ A;  1DJG A;  1MWN A;  1MR8 A;  1AVS A;  4OKH A;  1IWQ A;  5HLV A;  3EK7 A;  4PE1 A;  2M3W A;  1UP5 A;  1CFF A;  2JU0 A;  1WDC C;  1YR5 A;  1IRJ A;  3BUW B;  3I5I B;  1H8B A;  1DJX A;  1Q80 A;  1SK6 D;  3AAJ A;  2WCB A;  1TTX A;  1KK8 C;  4WQ2 A;  5B8I B;  1OSA A;  5BPJ A;  3RLZ A;  1CDM A;  1CFC A;  2JQ6 A;  4JPZ B;  4OVN F;  1U5I B;  2BE4 A;  4AQI A;  1L7Z A;  2I2R E;  1BJF A;  5DKN A;  2P6B B;  1UUS A;  1BOD A;  3PM8 A;  1H4B A;  2M49 B;  3I5G C;  1ZAC A;  2M7L A;  3FS7 A;  1RTP 1;  3LK0 A;  1NPQ A;  1PAL A;  2NLN A;  4A4B A;  1KSO A;  2CT9 A;  1KFU L;  3DVM A;  1NX3 A;  1G33 A;  1LXF C;  4MLW A;  4ZCU A;  1R2U A;  3KO0 A;  1SMG A;  4USL A;  1TNP A;  1MQ1 A;  4R1E A;  4QJ3 B;  1TN4 A;  3M0W A;  4IL1 A;  1JFK A;  1DVI A;  1Y6W A;  2JNX A;  2NCP A;  2BCB A;  2K8M B;  3PSR A;  4YGC B;  4CFR A;  2BBN A;  2KFF A;  3K21 A;  4BY5 A;  4L9M A;  3EK4 A;  3SIA A;  2BCA A;  1C7W A;  3KEV A;  3CR4 X;  1CTR A;  1YRU B;  1IJ5 A;  1SY9 A;  1NCX A;  4UPG A;  3DVK A;  1OMV A;  1ALW A;  5KSZ A;  2WCF A;  1NX2 A;  3OX5 A;  1J7Q A;  2JWW A;  2JC2 A;  1K90 D;  3TUY C;  2KI4 B;  1SNL A;  1BG1 A;  1SBJ A;  5CSJ A;  3OP0 A;  4YGB B;  1S1E A;  1J1E A;  4CID A;  3F45 A;  4AOM A;  2K2A A;  3CLN A;  1REC A;  1SR6 B;  1TCO B;  1XK4 A;  2KBM A;  3PN7 C;  3H4S E;  3I5H C;  1QX7 A;  2B1U A;  2BEC A;  1YX8 A;  1TCF A;  3NSI A;  1SCM C;  2OTG C;  1CDL A;  1QV0 A;  3EKJ A;  4CPV A;  5F6T A;  4PE0 A;  1ZFS A;  2ZN9 A;  1KK7 Z;  4PE4 A;  3WHT B;  5IBW A;  1FW4 A;  2F8P A;  2PVB A;  2LMV A;  1F55 A;  1ZOT B;  1QVI Y;  3PAL A;  1QAS A;  3I5F C;  2Y1N A;  1CKK A;  4GGF C;  1D1O A;  1E8A A;  4XYN A;  4PHK A;  2OS8 B;  3E3R A;  2K7D A;  1B7T Z;  2M29 A;  4WQ3 A;  2L51 A;  5JOL A;  1AJ5 A;  2M97 A;  1Y1U A;  2LC5 A;  2ZRT A;  2Q91 A;  4YGA A;  2LP2 A;  3D10 A;  5ER4 X;  3JTD B;  1EG4 A;  1S26 D;  1SYM A;  4C0L A;  2JTZ A;  2H61 A;  1S6I A;  2LP3 A;  4YI9 A;  4WRI A;  1KCY A;  5G08 A;  1XFX O;  3TZ1 A;  5GQQ C;  1XFU O;  1QV1 A;  2NXQ A;  1XFY O;  2F2P A;  1DJW A;  1B8L A;  1A2X A;  2CBL A;  1TNQ A;  2M1K B;  4MSP A;  2G9B A;  4P2Y B;  2QAC A;  1QXP A;  2KYC A;  2AAO A;  5KTY A;  5HYD A;  1IJ6 A;  3C1V A;  1IKU A;  1XO5 A;  3EVU A;  4JQ0 D;  2JOJ A;  2TN4 A;  2JT0 A;  2L98 A;  1KFX S;  1UHK A;  1NX1 A;  2PAS A;  2LAP A;  3A4U B;  1B8R A;  3O78 A;  5D69 A;  1C07 A;  2LVI A;  1LA3 A;  2KHN A;  1BLQ A;  1DTL A;  1W7J B;  1OE9 B;  4HRG A;  2R2I A;  3DVJ A;  4GUK A;  1F4O A;  1G4Y R;  4MZJ A;  2Q4U A;  1IGV A;  3IQO A;  4DS7 A;  3IQQ A;  3VRQ A;  1UHN A;  1VRK A;  4OR9 B;  1ZUZ A;  1JF0 A;  1BR4 B;  3LCP C;  1GJY A;  2FCD A;  3TDU A;  3BOW A;  2I18 A;  1EJ3 A;  3NSK A;  2KI6 C;  4FTG A;  1JFJ A;  3OHM B;  4ICB A;  3CR2 A;  1RJV A;  5I2L A;  1B47 A;  1DMO A;  3JVT B;  1L2O C;  1UHJ A;  2MHH A;  2VRG A;  5AFP A;  1M63 B;  2L5X B;  1A75 A;  2K7O A;  1HT9 A;  4P5O E;  1HQV A;  2CXJ A;  2F2O A;  4N1G A;  1CFP A;  4ETO A;  1CDP A;  1F4Q A;  2L50 A;  2MAZ A;  1BMO A;  3KF9 A;  4GPL B;  1DJH A;  1PSR A;  1TNX A;  5JJG A;  4MRX A;  3IF7 A;  1OMR A;  1N2D A;  2DOQ A;  3TS5 B;  1QVI Z;  1YUU A;  2K7C A;  3BOW B;  1EL4 A;  2WOR A;  2LHL A;  3GK4 X;  3BYA A;  3KHE A;  2LNK A;  1N65 A;  1B1G A;  2BL0 C;  2K7B A;  5HKW A;  1PUL A;  1GQM A;  1YVL A;  2D8N A;  2HET A;  3NSL A;  1A75 B;  2JT8 A;  2L4H A;  1QJT A;  1TIZ A;  3WXA A;  1LVC D;  4I5K A;  1J7P A;  3VRN A;  1PVB A;  1AK8 A;  1KFX L;  1XA5 A;  4PCW A;  1FF1 A;  2KGR A;  1CLB A;  4MN0 A;  2KAX A;  2NCO A;  3LLE A;  3OB1 B;  1WRZ A;  1S5G Y;  3SG4 A;  1IQ3 A;  3OB2 B;  4U8D A;  2KQY A;  2KOT A;  4YBH B;  1IQ5 A;  1PK0 D;  1Y0V H;  2EC6 B;  1Y1A A;  2I94 A;  3I5I C;  4MEW A;  4M2Q A;  1XFW O;  2MJW B;  1SL8 A;  1MXE A;  1DGU A;  3LL8 B;  3SG7 A;  2M1U A;  2FCE A;  2KNE A;  3A8R A;  1RRO A;  4PE7 A;  2QPT A;  1QLK A;  1Y1X A;  1MHO A;  2KAY A;  1DJI A;  1A4P A;  1SCV A;  4I5J A;  1K96 A;  4PHN A;  5TNC A;  2HPS A;  2LVK A;  2LLU A;  5AEQ A;  5AXI A;  1KWO B;  2CTN A;  2G2B A;  2JUL A;  3GK2 A;  4MZL A;  1RWY A;  3CS1 A;  1X02 A;  1WRK A;  4GAO A;  1B9A A;  3LK1 A;  1F71 A;  1S3P A;  1YVH A;  5DKR A;  1QIW A;  2MRD A;  2F3Z A;  1SKT A;  4MRY A;  1J55 A;  1KQM B;  2LMU A;  4D1E A;  2JRF A;  1WLM A;  3FWC A;  2AMI A;  2ISD A;  2KAV A;  3FIA A;  4GBA A;  2LV7 A;  1UHI A;  1K9K A;  1OMD A;  1XFZ O;  2LCP A;  2ZRS A;  4M2O A;  3SG5 A;  1J7O A;  5I8N A;  3O2P A;  2E6W A;  5CPV A;  4NQG A;  1QIV A;  2LM5 A;  5CSF A;  2KI4 C;  5I2O A;  2GGZ A;  2F33 A;  3BUO B;  2JXC A;  4DCK A;  1WLZ A;  1SL9 A;  3PFV A;  4ZCV A;  1SRA A;  3MSE B;  5KU1 A;  2RGI A;  2V53 A;  2SCP A;  3DVE A;  1W7I B;  4CFQ A;  3ICB A;  1DF0 A;  1SR6 C;  5DKQ A;  1BT6 A;  5HKY A;  1K94 A;  2PAL A;  2KGB C;  3BUX B;  5HLO A;  1AP4 A;  1DT7 B;  2H2K A;  1WDC B;  1B4C A;  4F0Z B;  1IG5 A;  1V1F A;  1KK8 B;  5AAN A;  1BR1 B;  4YRU A;  4PDZ A;  2FJU B;  1M31 A;  2M7N A;  3BXK A;  4MBE A;  2AUC A;  1S6C A;  3BQ3 A;  2O60 A;  2F3Y A;  1EH2 A;  3SIB A;  2OS8 C;  1K9U A;  2WND A;  3WHU B;  1A29 A;  1DF0 B;  3I5G B;  3EVV A;  2WCE A;  4NDD A;  5FYX A;  3CZT X;  1XK4 C;  2LHI A;  1NSH A;  1UWO A;  2KFH A;  3JTD C;  1BOC A;  3WNX B;  3VRP A;  2L4I A;  3SG3 A;  1LKJ A;  2PRU A;  2HQW A;  1M39 A;  4ORC B;  2A4J A;  1MXL C;  1GGZ A;  1NCY A;  1CDN A;  2JZI A;  1OZO A;  1UHH A;  1AUI B;  1KK7 Y;  1JWD A;  2PMY A;  1TOP A;  3DF0 A;  4A4C A;  1DJZ A;  1UUR A;  2CCM A;  2EHB A;  5K89 A;  2ZND A;  1IH0 A;  2M0R A;  2HF5 A;  2OPO A;  4YGE B;  5ER5 A;  3TDZ A;  2KBI A;  4N5X A;  3RM1 A;  1BF5 A;  1SPY A;  2KSP A;  5I2Q A;  3AKA A;  2JTT A;  2BKI B;  1B7T Y;  2JXL A;  2LVV A;  2H61 C;  2LMT A;  3EK8 A;  1MF8 B;  3TUY B;  4GGF A;  1CM1 A;  3SG6 A;  4M2P A;  1K95 A;  1NWD A;  4E68 A;  3PLF B;  3VGO A;  3SG2 A;  3VRO A;  1FBV A;  4HRE E;  2JT3 A;  4XJK A;  5J3X A;  4JWQ A;  3DD4 A;  5PAL A;  2KFG A;  1M46 A;  1NP8 A;  1XVJ A;  3PN7 B;  3AKB A;  1QAT A;  3JVT C;  3I5H B;  2LAN A;  2KI6 D;  2LUC A;  1YTZ C;  3DF0 B;  3EKH A;  1F54 A;  1SCM B;  4I5N B;  2OTG B;  1F8H A;  1FI5 A;  2COL B;  1FI6 A;  4GGN A;  1S36 A;  2LLT A;  3AAK A;  1CMF A;  2ZNE A;  2ZKM X;  3VRR A;  4HSZ A;  1WY9 A;  1ALV A;  2JNF A;  3I5F B;  3ZNI A;  2PSR A;  4GFT A;  4CLN A;  2BCX A;  1NIW A;  1PSB A;  4ORB B;  3SJS A;  1CB1 A;  4QJ5 B;  3D0Y A;  2MLF C;  2M9G A;  1GGW A;  1NCZ A;  3TS5 C;  4TNC A;  1G8I A;  5HKZ A;  1NUB A;  2WC8 A;  1S6J A;  3NSO A;  1FPW A;  4XJK B;  4N1F A;  1B8C A;  1QTX A;  2HQ8 A;  2GGM A;  1XYD A;  1SL7 A;  2BE6 A;  1CFD A;  3HX4 A;  1YUR A;  1QX2 A;  1PVA A;  1ZMZ A;  4DIR A;  3FWB A;  4I5L B;  4PHJ A;  1LA0 A;  1EXR A;  2JPT A;  4QJ4 B;  1EG3 A;  4DUQ A;  1SW8 A;  2SAS A;  3KPX A;  2LLS A;  4C0J A;  1F70 A;  1J1D A;  2ZN8 A;  1RFJ A;  1TNW A;  3EVR A;  4Q04 A;  1R6P A;  1XFV O;  1M45 A;  1QX5 B;  4YGD B;  1J7R A;  1KQV A;  3ZWH A;  3NXA A;  3D0Y B;  2CNP A;  1JUO A;  1WRL A;  1CLM A;  2FOT A;  1AHR A;  2EC6 C;  4MVF A;  4PHM A;  4FQO A;  1CMG A;  1YUS A;  2K0J A;  2LVJ A;  3CWG A;  2E30 A;  1YUT A;  1OQP A;  2MLE C;  2O5G A;  1QS7 A;  1CM4 A;  1DJY A;  1JC2 A;  4NDC A;  1C7V A;  3BUM B;  2EGD A;  4OV2 A; 
#chains in the Genus database with same CATH topology
 1AJ4 A;  2KDH A;  4DRW A;  1N0Y A;  1CNP A;  2K2F A;  1JSA A;  1JF2 A;  1TUJ A;  3CTN A;  1NX0 A;  1K9P A;  1BU3 A;  5CSI A;  3PAT A;  1YX7 A;  2Y4Q A;  2PYQ A;  4BY4 A;  4OCI A;  2L5Y A;  3S0E A;  1MUX A;  4NDB A;  1KWO C;  1L2O B;  2IS9 A;  4ORA B;  1YRT B;  4HRH A;  1JBA A;  1PRW A;  1QLS A;  1KSM A;  2MA2 A;  2KYF A;  1A03 A;  1ODB A;  1OOJ A;  1S5G Z;  2MBX A;  2I7A A;  1RK9 A;  5D7F A;  3GK1 A;  1KFU S;  3GOF A;  2WOS A;  3BUN B;  1KQM C;  3NHI A;  4C0K A;  2Y1M A;  3HCM A;  2LUX A;  3O6B A;  2K61 A;  2M8U A;  4PAL A;  5AER A;  1TRF A;  1NYA A;  3CR5 X;  3R1V A;  2ZFD A;  2BBM A;  3S0B A;  3D75 A;  3CGA A;  5CSN A;  2ERB A;  1OZS A;  1DGV A;  2BL0 B;  4INW A;  2BKH B;  1CLL A;  2NZ0 A;  4MZK A;  4YI8 A;  1K93 D;  2L2E A;  3O4Y A;  1U5I A;  2GV5 A;  1V1G A;  3D74 A;  1LIN A;  2KQ6 A;  2L0P A;  3QRX A;  2Y5I A;  4GNK B;  3TDI A;  3OX6 A;  1K2H A;  2L2C A;  2LE9 B;  1K8U A;  4AQJ A;  3FE6 A;  1DJG A;  1MWN A;  1MR8 A;  1AVS A;  3R1P A;  4OKH A;  1IWQ A;  2QEV A;  5HLV A;  3EK7 A;  4PE1 A;  2M3W A;  1UP5 A;  1CFF A;  2JU0 A;  1WDC C;  1YR5 A;  1IRJ A;  3BUW B;  3I5I B;  1ORG A;  1H8B A;  1DJX A;  1Q80 A;  1SK6 D;  3AAJ A;  2WCB A;  1TTX A;  3FE9 A;  1KK8 C;  4WQ2 A;  3L4A A;  3B7A A;  5B8I B;  1OSA A;  5BPJ A;  3RLZ A;  1CDM A;  4JKT A;  2JQ6 A;  4JPZ B;  1CFC A;  4OVN F;  1U5I B;  2BE4 A;  4AQI A;  1L7Z A;  2I2R E;  1BJF A;  5DKN A;  2P6B B;  1UUS A;  3FE8 A;  1BOD A;  3PM8 A;  2WCH A;  1H4B A;  2M49 B;  3I5G C;  1ZAC A;  2M7L A;  3FS7 A;  1RTP 1;  3LK0 A;  1NPQ A;  1PAL A;  2NLN A;  3UO9 A;  1KSO A;  2CT9 A;  4A4B A;  1KFU L;  3DVM A;  1LS8 A;  1G33 A;  1LXF C;  1NX3 A;  4MLW A;  4ZCU A;  1R2U A;  3KO0 A;  1SMG A;  1Z4H A;  4USL A;  1TNP A;  1MQ1 A;  4R1E A;  4QJ3 B;  1TN4 A;  3M0W A;  2K60 A;  4IL1 A;  1JFK A;  3B6X A;  1DVI A;  1Y6W A;  3RZS A;  2BNX A;  2JNX A;  2NCP A;  2BCB A;  2K8M B;  2BAP A;  3PSR A;  4YGC B;  4CFR A;  5HL1 A;  2BBN A;  2KFF A;  3K21 A;  4BY5 A;  3BJH A;  4L9M A;  3EK4 A;  4OZD A;  3SIA A;  2BCA A;  1C7W A;  3KEV A;  3CR4 X;  1CTR A;  1YRU B;  1IJ5 A;  1GM0 A;  1SY9 A;  1NCX A;  4UPG A;  3DVK A;  1OMV A;  1C3Y A;  1ALW A;  1OOH A;  5KSZ A;  2WCF A;  1NX2 A;  3OX5 A;  2WC6 A;  2JWW A;  1J7Q A;  2JC2 A;  1K90 D;  3TUY C;  1OOI X;  2KI4 B;  3SS5 A;  1SNL A;  1BG1 A;  1SBJ A;  5CSJ A;  3OP0 A;  4YGB B;  1OW4 A;  1S1E A;  1J1E A;  3B86 A;  3F45 A;  4CID A;  4AOM A;  2K2A A;  3CLN A;  1REC A;  1SR6 B;  1TCO B;  1T14 A;  1XK4 A;  2KBM A;  3PN7 C;  3H4S E;  3I5H C;  1QX7 A;  2B1U A;  2KLE A;  2BEC A;  1YX8 A;  1TCF A;  2PQL A;  1SCM C;  3NSI A;  2OTG C;  1CDL A;  1QV0 A;  3EKJ A;  4CPV A;  5F6T A;  3DXL A;  4PE0 A;  1ZFS A;  2ZN9 A;  1KK7 Z;  5DIC A;  4PE4 A;  3WHT B;  5IBW A;  3OGN A;  1FW4 A;  2F8P A;  2PVB A;  2LMV A;  1F55 A;  1ZOT B;  1QVI Y;  3PAL A;  1QAS A;  3I5F C;  1DC1 A;  2Y1N A;  1CKK A;  3V2L A;  4GGF C;  1D1O A;  1E8A A;  4XYN A;  4PHK A;  5FI6 A;  2OS8 B;  2JPO A;  2QEO A;  1QWV A;  2K7D A;  1B7T Z;  2M29 A;  3E3R A;  4WQ3 A;  2L51 A;  5JOL A;  3SS4 A;  1AJ5 A;  2M97 A;  1Y1U A;  2LC5 A;  2ZRT A;  4PT1 A;  2Q91 A;  4YGA A;  2LP2 A;  3D10 A;  5ER4 X;  3JTD B;  1EG4 A;  1S26 D;  1SYM A;  4C0L A;  2JTZ A;  2H61 A;  1S6I A;  2LP3 A;  4YI9 A;  4WRI A;  1KCY A;  5G08 A;  1XFX O;  3TZ1 A;  3CZ0 A;  5GQQ C;  1XFU O;  1QV1 A;  2NXQ A;  1XFY O;  2F2P A;  5I94 A;  1DJW A;  1DEK A;  1B8L A;  1A2X A;  1TNQ A;  2CBL A;  2M1K B;  4MSP A;  2G9B A;  4P2Y B;  2QAC A;  1QXP A;  2KYC A;  3DYE A;  2AAO A;  5KTY A;  5HYD A;  1IJ6 A;  3C1V A;  1IKU A;  1XO5 A;  3EVU A;  4JQ0 D;  2JOJ A;  2TN4 A;  2JT0 A;  2L98 A;  1KFX S;  1UHK A;  1NX1 A;  2PAS A;  2LAP A;  3A4U B;  1B8R A;  3O78 A;  5D69 A;  1C07 A;  2LVI A;  1LA3 A;  2KHN A;  1BLQ A;  1DTL A;  1W7J B;  1OE9 B;  4HRG A;  2R2I A;  3DVJ A;  4GUK A;  1F4O A;  1G4Y R;  1OOG A;  4MZJ A;  2Q4U A;  1IGV A;  3IQO A;  4DS7 A;  3IQQ A;  3VRQ A;  1UHN A;  1VRK A;  4OR9 B;  1ZUZ A;  1JF0 A;  1BR4 B;  3LCP C;  1GJY A;  2FCD A;  3TDU A;  3BOW A;  2I18 A;  1EJ3 A;  3NSK A;  2KI6 C;  4FTG A;  1JFJ A;  3OHM B;  4KYN A;  4ICB A;  3CR2 A;  1RJV A;  5I2L A;  1B47 A;  1DMO A;  3JVT B;  1L2O C;  1UHJ A;  2MHH A;  2VRG A;  5AFP A;  1M63 B;  1TWO A;  1W9Z A;  2L5X B;  1A75 A;  2K7O A;  1HT9 A;  4P5O E;  1HQV A;  2CXJ A;  2F2O A;  4N1G A;  1CFP A;  4ETO A;  1CDP A;  1F4Q A;  2L50 A;  3BFB A;  2MAZ A;  1BMO A;  2P71 A;  3PM2 A;  3KF9 A;  4GPL B;  1DJH A;  2QDI A;  1PSR A;  1TNX A;  5JJG A;  4MRX A;  3IF7 A;  1OMR A;  1N2D A;  2DOQ A;  3TS5 B;  1QVI Z;  1YUU A;  2K7C A;  3BOW B;  1EL4 A;  2WOR A;  2LHL A;  3GK4 X;  3BYA A;  3KHE A;  2LNK A;  3IVT A;  1N65 A;  1B1G A;  2BL0 C;  2K7B A;  5HKW A;  1PUL A;  1GQM A;  1YVL A;  2D8N A;  2HET A;  3NSL A;  3B88 A;  1A75 B;  2JT8 A;  2L4H A;  3R1O A;  1QJT A;  1TIZ A;  3WXA A;  1LVC D;  4I5K A;  1J7P A;  3VRN A;  1PVB A;  1AK8 A;  1KFX L;  1XA5 A;  4PCW A;  1FF1 A;  2KGR A;  1TUZ A;  2YGU A;  2KAX A;  2NCO A;  4MN0 A;  1CLB A;  3LLE A;  3OB1 B;  1WRZ A;  1S5G Y;  3SG4 A;  1IQ3 A;  3OB2 B;  4U8D A;  2KQY A;  3SS3 A;  2KOT A;  4YBH B;  1IQ5 A;  1PK0 D;  1Y0V H;  2EC6 B;  1Y1A A;  2I94 A;  3CZ2 A;  3I5I C;  4MEW A;  4M2Q A;  1XFW O;  1Z2C B;  2MJW B;  1SL8 A;  1MXE A;  1DGU A;  3LL8 B;  3SG7 A;  2M1U A;  2FCE A;  2KNE A;  3A8R A;  1RRO A;  4PE7 A;  2QPT A;  1QLK A;  1Y1X A;  1MHO A;  2KAY A;  4JD9 A;  1DJI A;  3L47 A;  1A4P A;  1SCV A;  4I5J A;  1K96 A;  4PHN A;  5TNC A;  2HPS A;  2LVK A;  3N7H A;  5D3O A;  2LLU A;  2WCL A;  5AEQ A;  5AXI A;  1KWO B;  2CTN A;  3NGV A;  3K1E A;  2G2B A;  2JUL A;  3GK2 A;  4MZL A;  1RWY A;  3VB1 A;  3CS1 A;  1X02 A;  1WRK A;  4GAO A;  1B9A A;  3LK1 A;  1F71 A;  1C3Z A;  1S3P A;  3O4X A;  3D73 A;  1YVH A;  5DKR A;  3CDN A;  1QIW A;  2MRD A;  2F3Z A;  1SKT A;  4MRY A;  1J55 A;  1KQM B;  2LMU A;  4D1E A;  2QEH A;  2JRF A;  1WLM A;  3FWC A;  2AMI A;  2ISD A;  2KAV A;  3S0A A;  3FIA A;  4GBA A;  2KLD A;  3OBV A;  2LV7 A;  3DZT A;  1UHI A;  1K9K A;  5FI2 A;  1OMD A;  1XFZ O;  2LCP A;  2ZRS A;  4M2O A;  3SG5 A;  1J7O A;  5I8N A;  3D78 A;  3O2P A;  2E6W A;  5CPV A;  2WCK A;  4NQG A;  1QIV A;  2LM5 A;  5CSF A;  2KI4 C;  3BFH A;  2GGZ A;  5I2O A;  2F33 A;  3BUO B;  3Q8I A;  2JXC A;  4DCK A;  1WLZ A;  1SL9 A;  3PFV A;  4ZCV A;  1SRA A;  3MSE B;  5KU1 A;  1DEL A;  2RGI A;  2V53 A;  2SCP A;  3DVE A;  1W7I B;  4CFQ A;  3ICB A;  1DF0 A;  3CYZ A;  1SR6 C;  5DKQ A;  1BT6 A;  5HKY A;  1K94 A;  2PAL A;  2KGB C;  3BUX B;  5HLO A;  1AP4 A;  1DT7 B;  2H2K A;  1WDC B;  1B4C A;  4F0Z B;  1IG5 A;  1V1F A;  1XFR A;  1KK8 B;  5AAN A;  3QME A;  1BR1 B;  4YRU A;  4PDZ A;  2FJU B;  1M31 A;  2M7N A;  1C7V A;  3BXK A;  4MBE A;  2AUC A;  1S6C A;  3BQ3 A;  2O60 A;  2F3Y A;  5EL2 A;  1EH2 A;  3SIB A;  3L4L A;  2OS8 C;  1K9U A;  2WND A;  3WHU B;  1A29 A;  1DF0 B;  3I5G B;  3EVV A;  2WCE A;  4NDD A;  5FYX A;  3UNW A;  3CZT X;  2WCJ A;  1XK4 C;  2LHI A;  1DQE A;  1NSH A;  1UWO A;  2KFH A;  3JTD C;  1BOC A;  3WNX B;  4IJ7 A;  3VRP A;  1P28 A;  2L4I A;  3SG3 A;  1LKJ A;  2PRU A;  2HQW A;  1M39 A;  3CZ1 A;  4ORC B;  1MXL C;  2A4J A;  1IIO A;  1GGZ A;  1NCY A;  1CDN A;  2JZI A;  1OZO A;  4FQT A;  1UHH A;  1AUI B;  1KK7 Y;  1JWD A;  2PMY A;  1OOF A;  1TOP A;  3DF0 A;  1DJZ A;  2WCM A;  4A4C A;  1UUR A;  2CCM A;  2EHB A;  5K89 A;  2ZND A;  1IH0 A;  2M0R A;  3S0D A;  2HF5 A;  2OPO A;  4YGE B;  5ER5 A;  3TDZ A;  2KBI A;  4N5X A;  3RM1 A;  1BF5 A;  1SPY A;  2KSP A;  5I2Q A;  3AKA A;  2JTT A;  2BKI B;  1B7T Y;  2JXL A;  2LVV A;  2H61 C;  2LMT A;  3EK8 A;  1MF8 B;  3TUY B;  4GGF A;  1CM1 A;  3EG5 B;  3SG6 A;  4M2P A;  1K95 A;  1NWD A;  4E68 A;  3PLF B;  3VGO A;  3SG2 A;  3VRO A;  1FBV A;  2H8V A;  4INX A;  4HRE E;  2JT3 A;  4XJK A;  5J3X A;  4JWQ A;  3DD4 A;  5PAL A;  2KFG A;  1M46 A;  1NP8 A;  1XVJ A;  3PN7 B;  3AKB A;  1QAT A;  3JVT C;  3I5H B;  2LAN A;  2KI6 D;  2LUC A;  1YTZ C;  3DF0 B;  3EKH A;  2P70 A;  1F54 A;  1SCM B;  4I5N B;  2OTG B;  1F8H A;  1SSE B;  2COL B;  3S0F A;  1FI5 A;  1FI6 A;  4GGN A;  1S36 A;  2LLT A;  2QEB A;  3AAK A;  1CMF A;  2ZNE A;  2ZKM X;  5FI7 A;  3VRR A;  4HSZ A;  1WY9 A;  1ALV A;  2JNF A;  2WC5 A;  3D76 A;  3I5F B;  3ZNI A;  2PSR A;  4GFT A;  4CLN A;  2BCX A;  1NIW A;  1PSB A;  3PJI A;  4ORB B;  3SJS A;  1CB1 A;  4QJ5 B;  3D0Y A;  2MLF C;  2M9G A;  1GGW A;  1NCZ A;  3TS5 C;  4TNC A;  1G8I A;  5HKZ A;  1NUB A;  2WC8 A;  1S6J A;  3DY9 A;  3NSO A;  1FPW A;  4XJK B;  4N1F A;  1B8C A;  1QTX A;  2HQ8 A;  2GGM A;  3D77 A;  1XYD A;  1SL7 A;  2BE6 A;  1CFD A;  2KPH A;  1YUR A;  3HX4 A;  1QX2 A;  3S0G A;  1PVA A;  1ZMZ A;  4DIR A;  3CAB A;  3FWB A;  4I5L B;  4PHJ A;  1LA0 A;  1EXR A;  2JPT A;  4QJ4 B;  1EG3 A;  4DUQ A;  1SW8 A;  4F7F A;  2SAS A;  3KPX A;  2LLS A;  4C0J A;  1F70 A;  1J1D A;  2ZN8 A;  1RFJ A;  1TNW A;  3EVR A;  4Q04 A;  1R6P A;  1XFV O;  1M45 A;  1QX5 B;  2FJY A;  3NHT A;  3R72 A;  4YGD B;  1J7R A;  1KQV A;  3ZWH A;  3NXA A;  3D0Y B;  1JUO A;  1WRL A;  1CLM A;  2CNP A;  2FOT A;  1AHR A;  2EC6 C;  4MVF A;  4PHM A;  4FQO A;  1CMG A;  1YUS A;  2K0J A;  2LVJ A;  2GTE A;  2E30 A;  3BFA A;  3CWG A;  1YUT A;  1OQP A;  2MLE C;  2O5G A;  1QS7 A;  1CM4 A;  1DJY A;  1JC2 A;  4NDC A;  3B87 A;  3BUM B;  2EGD A;  4OV2 A; 
#chains in the Genus database with same CATH homology
 1AJ4 A;  2KDH A;  4DRW A;  1N0Y A;  1CNP A;  2K2F A;  1JSA A;  1JF2 A;  3CTN A;  1NX0 A;  1K9P A;  1BU3 A;  5CSI A;  3PAT A;  1YX7 A;  2Y4Q A;  4BY4 A;  4OCI A;  1MUX A;  4NDB A;  1KWO C;  1L2O B;  2IS9 A;  4ORA B;  1YRT B;  4HRH A;  1JBA A;  1PRW A;  1QLS A;  1KSM A;  2MA2 A;  2KYF A;  1A03 A;  1ODB A;  1OOJ A;  1S5G Z;  2MBX A;  2I7A A;  1RK9 A;  5D7F A;  3GK1 A;  1KFU S;  3GOF A;  2WOS A;  3BUN B;  1KQM C;  4C0K A;  2Y1M A;  3HCM A;  2LUX A;  3O6B A;  2K61 A;  2M8U A;  4PAL A;  5AER A;  1TRF A;  1NYA A;  3CR5 X;  2ZFD A;  2BBM A;  3CGA A;  5CSN A;  1OZS A;  1DGV A;  2BL0 B;  2BKH B;  1CLL A;  2NZ0 A;  4MZK A;  4YI8 A;  1K93 D;  2L2E A;  3O4Y A;  1U5I A;  2GV5 A;  1V1G A;  1LIN A;  2KQ6 A;  2L0P A;  3QRX A;  2Y5I A;  4GNK B;  3TDI A;  3OX6 A;  1K2H A;  2LE9 B;  1K8U A;  4AQJ A;  1DJG A;  1MWN A;  1MR8 A;  1AVS A;  4OKH A;  1IWQ A;  5HLV A;  3EK7 A;  4PE1 A;  2M3W A;  1UP5 A;  1CFF A;  2JU0 A;  1WDC C;  1YR5 A;  1IRJ A;  3BUW B;  3I5I B;  1H8B A;  1DJX A;  1Q80 A;  1SK6 D;  3AAJ A;  2WCB A;  1TTX A;  1KK8 C;  4WQ2 A;  5B8I B;  1OSA A;  5BPJ A;  3RLZ A;  1CDM A;  1CFC A;  2JQ6 A;  4JPZ B;  4OVN F;  1U5I B;  2BE4 A;  4AQI A;  1L7Z A;  2I2R E;  1BJF A;  5DKN A;  2P6B B;  1UUS A;  1BOD A;  3PM8 A;  1H4B A;  2M49 B;  3I5G C;  1ZAC A;  2M7L A;  3FS7 A;  1RTP 1;  3LK0 A;  1NPQ A;  1PAL A;  2NLN A;  4A4B A;  1KSO A;  2CT9 A;  1KFU L;  3DVM A;  1NX3 A;  1G33 A;  1LXF C;  4MLW A;  4ZCU A;  1R2U A;  3KO0 A;  1SMG A;  4USL A;  1TNP A;  1MQ1 A;  4R1E A;  4QJ3 B;  1TN4 A;  3M0W A;  4IL1 A;  1JFK A;  1DVI A;  1Y6W A;  2JNX A;  2NCP A;  2BCB A;  2K8M B;  3PSR A;  4YGC B;  4CFR A;  2BBN A;  2KFF A;  3K21 A;  4BY5 A;  4L9M A;  3EK4 A;  3SIA A;  2BCA A;  1C7W A;  3KEV A;  3CR4 X;  1CTR A;  1YRU B;  1IJ5 A;  1SY9 A;  1NCX A;  4UPG A;  3DVK A;  1OMV A;  1ALW A;  5KSZ A;  2WCF A;  1NX2 A;  3OX5 A;  1J7Q A;  2JWW A;  2JC2 A;  1K90 D;  3TUY C;  2KI4 B;  1SNL A;  1BG1 A;  1SBJ A;  5CSJ A;  3OP0 A;  4YGB B;  1S1E A;  1J1E A;  4CID A;  3F45 A;  4AOM A;  2K2A A;  3CLN A;  1REC A;  1SR6 B;  1TCO B;  1XK4 A;  2KBM A;  3PN7 C;  3H4S E;  3I5H C;  1QX7 A;  2B1U A;  2BEC A;  1YX8 A;  1TCF A;  3NSI A;  1SCM C;  2OTG C;  1CDL A;  1QV0 A;  3EKJ A;  4CPV A;  5F6T A;  4PE0 A;  1ZFS A;  2ZN9 A;  1KK7 Z;  4PE4 A;  3WHT B;  5IBW A;  1FW4 A;  2F8P A;  2PVB A;  2LMV A;  1F55 A;  1ZOT B;  1QVI Y;  3PAL A;  1QAS A;  3I5F C;  2Y1N A;  1CKK A;  4GGF C;  1D1O A;  1E8A A;  4XYN A;  4PHK A;  2OS8 B;  3E3R A;  2K7D A;  1B7T Z;  2M29 A;  4WQ3 A;  2L51 A;  5JOL A;  1AJ5 A;  2M97 A;  1Y1U A;  2LC5 A;  2ZRT A;  2Q91 A;  4YGA A;  2LP2 A;  3D10 A;  5ER4 X;  3JTD B;  1EG4 A;  1S26 D;  1SYM A;  4C0L A;  2JTZ A;  2H61 A;  1S6I A;  2LP3 A;  4YI9 A;  4WRI A;  1KCY A;  5G08 A;  1XFX O;  3TZ1 A;  5GQQ C;  1XFU O;  1QV1 A;  2NXQ A;  1XFY O;  2F2P A;  1DJW A;  1B8L A;  1A2X A;  2CBL A;  1TNQ A;  2M1K B;  4MSP A;  2G9B A;  4P2Y B;  2QAC A;  1QXP A;  2KYC A;  2AAO A;  5KTY A;  5HYD A;  1IJ6 A;  3C1V A;  1IKU A;  1XO5 A;  3EVU A;  4JQ0 D;  2JOJ A;  2TN4 A;  2JT0 A;  2L98 A;  1KFX S;  1UHK A;  1NX1 A;  2PAS A;  2LAP A;  3A4U B;  1B8R A;  3O78 A;  5D69 A;  1C07 A;  2LVI A;  1LA3 A;  2KHN A;  1BLQ A;  1DTL A;  1W7J B;  1OE9 B;  4HRG A;  2R2I A;  3DVJ A;  4GUK A;  1F4O A;  1G4Y R;  4MZJ A;  2Q4U A;  1IGV A;  3IQO A;  4DS7 A;  3IQQ A;  3VRQ A;  1UHN A;  1VRK A;  4OR9 B;  1ZUZ A;  1JF0 A;  1BR4 B;  3LCP C;  1GJY A;  2FCD A;  3TDU A;  3BOW A;  2I18 A;  1EJ3 A;  3NSK A;  2KI6 C;  4FTG A;  1JFJ A;  3OHM B;  4ICB A;  3CR2 A;  1RJV A;  5I2L A;  1B47 A;  1DMO A;  3JVT B;  1L2O C;  1UHJ A;  2MHH A;  2VRG A;  5AFP A;  1M63 B;  2L5X B;  1A75 A;  2K7O A;  1HT9 A;  4P5O E;  1HQV A;  2CXJ A;  2F2O A;  4N1G A;  1CFP A;  4ETO A;  1CDP A;  1F4Q A;  2L50 A;  2MAZ A;  1BMO A;  3KF9 A;  4GPL B;  1DJH A;  1PSR A;  1TNX A;  5JJG A;  4MRX A;  3IF7 A;  1OMR A;  1N2D A;  2DOQ A;  3TS5 B;  1QVI Z;  1YUU A;  2K7C A;  3BOW B;  1EL4 A;  2WOR A;  2LHL A;  3GK4 X;  3BYA A;  3KHE A;  2LNK A;  1N65 A;  1B1G A;  2BL0 C;  2K7B A;  5HKW A;  1PUL A;  1GQM A;  1YVL A;  2D8N A;  2HET A;  3NSL A;  1A75 B;  2JT8 A;  2L4H A;  1QJT A;  1TIZ A;  3WXA A;  1LVC D;  4I5K A;  1J7P A;  3VRN A;  1PVB A;  1AK8 A;  1KFX L;  1XA5 A;  4PCW A;  1FF1 A;  2KGR A;  1CLB A;  4MN0 A;  2KAX A;  2NCO A;  3LLE A;  3OB1 B;  1WRZ A;  1S5G Y;  3SG4 A;  1IQ3 A;  3OB2 B;  4U8D A;  2KQY A;  2KOT A;  4YBH B;  1IQ5 A;  1PK0 D;  1Y0V H;  2EC6 B;  1Y1A A;  2I94 A;  3I5I C;  4MEW A;  4M2Q A;  1XFW O;  2MJW B;  1SL8 A;  1MXE A;  1DGU A;  3LL8 B;  3SG7 A;  2M1U A;  2FCE A;  2KNE A;  3A8R A;  1RRO A;  4PE7 A;  2QPT A;  1QLK A;  1Y1X A;  1MHO A;  2KAY A;  1DJI A;  1A4P A;  1SCV A;  4I5J A;  1K96 A;  4PHN A;  5TNC A;  2HPS A;  2LVK A;  2LLU A;  5AEQ A;  5AXI A;  1KWO B;  2CTN A;  2G2B A;  2JUL A;  3GK2 A;  4MZL A;  1RWY A;  3CS1 A;  1X02 A;  1WRK A;  4GAO A;  1B9A A;  3LK1 A;  1F71 A;  1S3P A;  1YVH A;  5DKR A;  1QIW A;  2MRD A;  2F3Z A;  1SKT A;  4MRY A;  1J55 A;  1KQM B;  2LMU A;  4D1E A;  2JRF A;  1WLM A;  3FWC A;  2AMI A;  2ISD A;  2KAV A;  3FIA A;  4GBA A;  2LV7 A;  1UHI A;  1K9K A;  1OMD A;  1XFZ O;  2LCP A;  2ZRS A;  4M2O A;  3SG5 A;  1J7O A;  5I8N A;  3O2P A;  2E6W A;  5CPV A;  4NQG A;  1QIV A;  2LM5 A;  5CSF A;  2KI4 C;  5I2O A;  2GGZ A;  2F33 A;  3BUO B;  2JXC A;  4DCK A;  1WLZ A;  1SL9 A;  3PFV A;  4ZCV A;  1SRA A;  3MSE B;  5KU1 A;  2RGI A;  2V53 A;  2SCP A;  3DVE A;  1W7I B;  4CFQ A;  3ICB A;  1DF0 A;  1SR6 C;  5DKQ A;  1BT6 A;  5HKY A;  1K94 A;  2PAL A;  2KGB C;  3BUX B;  5HLO A;  1AP4 A;  1DT7 B;  2H2K A;  1WDC B;  1B4C A;  4F0Z B;  1IG5 A;  1V1F A;  1KK8 B;  5AAN A;  1BR1 B;  4YRU A;  4PDZ A;  2FJU B;  1M31 A;  2M7N A;  3BXK A;  4MBE A;  2AUC A;  1S6C A;  3BQ3 A;  2O60 A;  2F3Y A;  1EH2 A;  3SIB A;  2OS8 C;  1K9U A;  2WND A;  3WHU B;  1A29 A;  1DF0 B;  3I5G B;  3EVV A;  2WCE A;  4NDD A;  5FYX A;  3CZT X;  1XK4 C;  2LHI A;  1NSH A;  1UWO A;  2KFH A;  3JTD C;  1BOC A;  3WNX B;  3VRP A;  2L4I A;  3SG3 A;  1LKJ A;  2PRU A;  2HQW A;  1M39 A;  4ORC B;  2A4J A;  1MXL C;  1GGZ A;  1NCY A;  1CDN A;  2JZI A;  1OZO A;  1UHH A;  1AUI B;  1KK7 Y;  1JWD A;  2PMY A;  1TOP A;  3DF0 A;  4A4C A;  1DJZ A;  1UUR A;  2CCM A;  2EHB A;  5K89 A;  2ZND A;  1IH0 A;  2M0R A;  2HF5 A;  2OPO A;  4YGE B;  5ER5 A;  3TDZ A;  2KBI A;  4N5X A;  3RM1 A;  1BF5 A;  1SPY A;  2KSP A;  5I2Q A;  3AKA A;  2JTT A;  2BKI B;  1B7T Y;  2JXL A;  2LVV A;  2H61 C;  2LMT A;  3EK8 A;  1MF8 B;  3TUY B;  4GGF A;  1CM1 A;  3SG6 A;  4M2P A;  1K95 A;  1NWD A;  4E68 A;  3PLF B;  3VGO A;  3SG2 A;  3VRO A;  1FBV A;  4HRE E;  2JT3 A;  4XJK A;  5J3X A;  4JWQ A;  3DD4 A;  5PAL A;  2KFG A;  1M46 A;  1NP8 A;  1XVJ A;  3PN7 B;  3AKB A;  1QAT A;  3JVT C;  3I5H B;  2LAN A;  2KI6 D;  2LUC A;  1YTZ C;  3DF0 B;  3EKH A;  1F54 A;  1SCM B;  4I5N B;  2OTG B;  1F8H A;  1FI5 A;  2COL B;  1FI6 A;  4GGN A;  1S36 A;  2LLT A;  3AAK A;  1CMF A;  2ZNE A;  2ZKM X;  3VRR A;  4HSZ A;  1WY9 A;  1ALV A;  2JNF A;  3I5F B;  3ZNI A;  2PSR A;  4GFT A;  4CLN A;  2BCX A;  1NIW A;  1PSB A;  4ORB B;  3SJS A;  1CB1 A;  4QJ5 B;  3D0Y A;  2MLF C;  2M9G A;  1GGW A;  1NCZ A;  3TS5 C;  4TNC A;  1G8I A;  5HKZ A;  1NUB A;  2WC8 A;  1S6J A;  3NSO A;  1FPW A;  4XJK B;  4N1F A;  1B8C A;  1QTX A;  2HQ8 A;  2GGM A;  1XYD A;  1SL7 A;  2BE6 A;  1CFD A;  3HX4 A;  1YUR A;  1QX2 A;  1PVA A;  1ZMZ A;  4DIR A;  3FWB A;  4I5L B;  4PHJ A;  1LA0 A;  1EXR A;  2JPT A;  4QJ4 B;  1EG3 A;  4DUQ A;  1SW8 A;  2SAS A;  3KPX A;  2LLS A;  4C0J A;  1F70 A;  1J1D A;  2ZN8 A;  1RFJ A;  1TNW A;  3EVR A;  4Q04 A;  1R6P A;  1XFV O;  1M45 A;  1QX5 B;  4YGD B;  1J7R A;  1KQV A;  3ZWH A;  3NXA A;  3D0Y B;  2CNP A;  1JUO A;  1WRL A;  1CLM A;  2FOT A;  1AHR A;  2EC6 C;  4MVF A;  4PHM A;  4FQO A;  1CMG A;  1YUS A;  2K0J A;  2LVJ A;  3CWG A;  2E30 A;  1YUT A;  1OQP A;  2MLE C;  2O5G A;  1QS7 A;  1CM4 A;  1DJY A;  1JC2 A;  4NDC A;  1C7V A;  3BUM B;  2EGD A;  4OV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...