1KFXS

Crystal structure of human m-calpain form i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
176
structure length
176
Chain Sequence
NESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords M-CALPAIN LARGE SUBUNIT
publication title The crystal structure of calcium-free human m-calpain suggests an electrostatic switch mechanism for activation by calcium.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2001-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kfxS00
5JOLA 3VRNA 1F4OA 4U8DA 4GFTA 4OVNF 3KEVA 1NPQA 2M3WA 4A4BA 1RFJA 2O60A 1PVBA 1KK8C 3BUNB 1SW8A 1TNXA 4OKHA 4A4CA 1U5IA 2ZNEA 3EKJA 3LK0A 1KCYA 2JPTA 1IWQA 3CTNA 5JJGA 5K89A 3WNXB 4FQOA 3D0YA 1XK4A 2LE9B 2HQ8A 1YTZC 2G9BA 4PE4A 3O2PA 1IQ3A 2Y1NA 4I5LB 1TCOB 5I2QA 1BMOA 4QJ3B 1BG1A 1ZUZA 1MUXA 3I5HC 3MSEB 3D10A 4HRGA 4WQ3A 5HYDA 1BR1B 5PALA 2L4HA 3TDZA 4DRWA 1S6JA 2LLSA 3JTDC 2M97A 5CSJA 1SL9A 1A03A 2LMVA 2Q91A 3OHMB 1RWYA 1AJ5A 2KFHA 1LA3A 1OMVA 4GUKA 1XA5A 1YUUA 1OMDA 4N1GA 4Q04A 1M46A 5KU1A 3E3RA 2LNKA 2LUXA 3AAKA 4XJKA 1ZACA 2I18A 1TIZA 1UP5A 1KWOB 4P5OE 2BL0B 1C7VA 2I7AA 1KQVA 2L4IA 3TDIA 4WRIA 3BYAA 1QXPA 2OPOA 1W7JB 1L2OB 2JNXA 2SCPA 1J1EA 1TN4A 3NSLA 1MHOA 1IH0A 1JBAA 2M8UA 2LM5A 2LVIA 1RECA 2E6WA 1WRLA 2MAZA 2LV7A 3SG3A 5G08A 1K94A 1SBJA 1M39A 1ZOTB 1SK6D 1TNPA 1EG3A 3TS5B 1F55A 4OR9B 2BBNA 4YGEB 3OX5A 3ICBA 3M0WA 2PMYA 2PRUA 2WOSA 3CS1A 5DKQA 4QJ5B 1CM4A 3OP0A 4USLA 2HF5A 3TZ1A 1M31A 1NX0A 2CBLA 4PHJA 1QLSA 3VRQA 3BXKA 2WCEA 1AVSA 2LLTA 3PLFB 1FI6A 3DD4A 1IJ5A 2SASA 4YBHB 2JU0A 4AQJA 2KAXA 1RROA 4XYNA 1SPYA 1TNQA 1CLMA 2CT9A 3EK8A 4ORCB 2KSPA 1DJIA 5F6TA 1CMFA 1B1GA 1J7QA 1NX3A 3ZWHA 1WDCB 2H61C 3EVVA 5ER4X 1HT9A 2MBXA 1K9UA 3JVTB 4QJ4B 3A4UB 4MRXA 3EK4A 1JFJA 3DF0B 2KQ6A 1KFUS 4JQ0D 1LKJA 5CPVA 1BODA 1S5GZ 2AUCA 2COLB 2JT0A 2NXQA 1PK0D 2KNEA 3BQ3A 1YUTA 4N5XA 1L7ZA 4YGCB 5AFPA 1QJTA 5IBWA 1DGVA 1QLKA 1ALVA 5HKZA 1N2DA 4MEWA 3RM1A 1Y0VH 4PHMA 1F54A 1IRJA 1NX1A 2ISDA 2AAOA 3VRPA 1B4CA 1KK7Z 2ZRSA 1H8BA 2Y4QA 2L98A 4PE7A 1U5IB 5CSFA 2KGBC 2JNFA 3VGOA 4NQGA 1PSBA 4CFRA 2JZIA 4PE1A 1KWOC 2BL0C 2LUCA 4ORAB 3D0YB 1SL7A 3WHTB 1KFUL 1A4PA 2M9GA 2FCDA 1L2OC 2KYFA 1YVHA 3TUYC 3GOFA 1CMGA 1SR6B 2VRGA 1CLLA 2NZ0A 1CDLA 1K9PA 1DTLA 1YUSA 2KBIA 2KAYA 1K93D 1V1FA 2BBMA 3FIAA 4YI8A 2L0PA 1S1EA 1WY9A 2HETA 1XFUO 3GK4X 1R6PA 3SG5A 1J7RA 3TS5C 2M1KB 1BR4B 1WRZA 2K2AA 2MA2A 1K9KA 2F2OA 2JTZA 5DKNA 2KI6D 1HQVA 1GJYA 4TNCA 1BU3A 3GK1A 4C0JA 1N65A 1DVIA 4XJKB 1FBVA 4I5JA 4NDCA 1KQMB 1B47A 1NCXA 1SCVA 2CTNA 3DVEA 1WLZA 1BF5A 4HREE 3AKBA 1J7PA 1OSAA 1S5GY 1V1GA 1W7IB 3SG7A 3KPXA 1R2UA 3K21A 1WDCC 1OMRA 3KO0A 3KHEA 3JVTC 1N0YA 1J7OA 2OTGB 3LCPC 2JTTA 1ZMZA 1JFKA 4GGFA 5CSNA 1EXRA 1NIWA 1RK9A 2BECA 5AANA 3PN7B 3HCMA 3O6BA 4BY4A 1YURA 4MBEA 1KK7Y 5I2OA 2V53A 4L9MA 3GK2A 1CLBA 1SCMB 1TTXA 1YVLA 1LINA 1XFYO 1SRAA 1XFXO 5AEQA 2LAPA 2CNPA 1YRTB 1EG4A 1PSRA 3TUYB 5BPJA 1K96A 4I5NB 1Y1AA 2CXJA 1UURA 2JC2A 1DJGA 4OCIA 4DIRA 1JF2A 2FJUB 4MZJA 1A75B 2WORA 3AKAA 1Y6WA 2PSRA 1DJZA 3DVKA 3EVUA 2KFGA 2WCFA 1C07A 1JF0A 1XVJA 1QATA 4M2OA 1FI5A 2G2BA 1EJ3A 1TCFA 2L51A 3WHUB 1CDPA 1QX2A 1XK4C 1KFXS 1Y1UA 2WNDA 1GGZA 2FCEA 4PDZA 4DUQA 3BOWB 3NXAA 1K2HA 1SR6C 1XFWO 4ETOA 1PRWA 1XO5A 2JQ6A 1C7WA 3C1VA 1AUIB 3BUMB 2D8NA 5J3XA 1IGVA 1B9AA 2AMIA 1MF8B 2LC5A 2HQWA 2M29A 2KBMA 2WC8A 1AP4A 1BJFA 2LHLA 3CR4X 1UWOA 2K7DA 2RGIA 2ZN9A 2R2IA 2PASA 3CR5X 2LLUA 4MLWA 3EKHA 4OV2A 1CTRA 5I8NA 1S26D 2LP2A 1PULA 2ZKMX 4YGDB 4N1FA 5KSZA 4AQIA 4WQ2A 1DMOA 1S6IA 1DF0B 3CZTX 2KQYA 2M7NA 1TRFA 4F0ZB 2JT8A 2PVBA 1KFXL 1SMGA 3SIAA 4C0KA 1X02A 2LCPA 1UUSA 3QRXA 2NCOA 2KOTA 1KQMC 2O5GA 5AXIA 2MLFC 3RLZA 4BY5A 2L2EA 3AAJA 3HX4A 5D69A 1QV0A 3SG4A 1CDNA 1MQ1A 1KSOA 2LMTA 1VRKA 3I5FB 2OS8B 1PALA 1UHJA 2OTGC 1MWNA 4AOMA 1JUOA 4DCKA 2LVJA 2JOJA 1GQMA 3CR2A 3PN7C 3SIBA 2TN4A 1TOPA 1SYMA 1FPWA 1JC2A 1UHHA 1CNPA 4CLNA 4FTGA 2BE6A 3DVJA 1OZOA 1SCMC 3NSKA 5FYXA 2JWWA 3NSIA 4YGBB 4ORBB 2E30A 2K2FA 2FOTA 4YRUA 2EGDA 1B8LA 1NSHA 1IJ6A 2M49B 1FW4A 2EC6B 2GGZA 5KTYA 1FF1A 2KHNA 2KI6C 2H2KA 2QACA 1IG5A 1QS7A 3OB1B 1EH2A 1NYAA 1XYDA 1D1OA 3H4SE 4C0LA 5HKWA 2KFFA 1OE9B 4M2PA 4IL1A 1S6CA 4PHNA 2JXCA 2GV5A 4GGNA 3IQOA 1QX7A 1LA0A 2KAVA 1F71A 2F8PA 1B7TZ 1EL4A 2NCPA 5GQQC 5AERA 3CWGA 1ALWA 2JRFA 3F45A 2KDHA 3TDUA 4GNKB 3PALA 2F3YA 3IQQA 1CM1A 1IQ5A 5HLOA 2L5XB 2P6BB 5ER5A 1JWDA 2QPTA 1QVIY 1QTXA 2BKHB 3PATA 1NP8A 2ZRTA 2KI4B 1JSAA 1DJYA 1B8RA 1AJ4A 1SY9A 4DS7A 2ZNDA 2LMUA 1MXLC 3O4YA 1M45A 2M7LA 2ZN8A 2BCAA 5B8IB 1PVAA 1J55A 2Y1MA 1WRKA 2A4JA 2BE4A 4I5KA 3I5GB 2BCXA 1ODBA 4P2YB 1AHRA 5D7FA 1NUBA 3I5FC 1BT6A 2JXLA 2OS8C 2K7OA 4JPZB 2F33A 1QX5B 1QV1A 4ICBA 1AK8A 1UHIA 4ZCVA 2MRDA 2Y5IA 3LK1A 5DKRA 1CB1A 2K61A 1NX2A 2K7BA 3O78A 2I2RE 2H61A 4PCWA 3BUWB 4MRYA 4PE0A 1WLMA 1A29A 1XFZO 1LXFC 4PALA 1BLQA 3NSOA 1YX7A 2HPSA 2F3ZA 1YR5A 3EK7A 2BKIB 1G33A 1S3PA 2M1UA 4E68A 1MXEA 1BOCA 2EC6C 3LLEA 1OZSA 4HSZA 3LL8B 4CIDA 3CGAA 1B7TY 1QIVA 1RTP1 2MHHA 3ZNIA 1K90D 2EHBA 2L50A 5I2LA 4D1EA 1KK8B 4GPLB 1G8IA 2CCMA 3VROA 1KSMA 3PSRA 1G4YR 3OX6A 3SG6A 1NWDA 4MZKA 2DOQA 2MLEC 1SNLA 2F2PA 3I5IC 4ZCUA 4MZLA 4GGFC 4YGAA 3BUOB 1SKTA 2K8MB 2JT3A 1Y1XA 2M0RA 1XFVO 3KF9A 3FS7A 4CPVA 3CLNA 1TNWA 2KGRA 1QASA 5HLVA 4MVFA 5CSIA 4UPGA 1CKKA 1QVIZ 3BUXB 2K0JA 5HKYA 2LHIA 1YRUB 3PM8A 2BCBA 1A75A 1CFPA 1H4BA 1CFFA 1F4QA 3I5HB 1DJWA 1DJXA 1NCZA 1OQPA 1DGUA 2LVKA 2KI4C 4R1EA 2I94A 4HRHA 1MR8A 4NDBA 2ZFDA 3EVRA 3JTDB 4MN0A 4JWQA 4NDDA 1B8CA 3FWBA 2NLNA 3OB2B 1LVCD 1OOJA 1NCYA 3BOWA 4GBAA 4CFQA 1GGWA 4M2QA 2JULA 2B1UA 2GGMA 2PALA 1F70A 3FWCA 4MSPA 1CDMA 1DJHA 3I5GC 5TNCA 4PHKA 3WXAA 1K8UA 1QIWA 3IF7A 4GAOA 3A8RA 2KYCA 4YI9A 1CFDA 3PFVA 1F8HA 3VRRA 2WCBA 1J1DA 1Q80A 2LP3A 2LANA 1SL8A 1A2XA 2K7CA 3SG2A 1M63B 1S36A 1DF0A 1DT7B 1ZFSA 3SJSA 1CFCA 1E8AA 3DF0A 3DVMA 2IS9A 1UHKA 1RJVA 1YX8A 1K95A 2Q4UA 1IKUA 3I5IB 2LVVA 1UHNA 2MJWB
chains in the Genus database with same CATH superfamily
5JOLA 2WC5A 3FE8A 3VRNA 1F4OA 4U8DA 4GFTA 2K60A 4OVNF 1TWOA 1NPQA 3KEVA 2M3WA 4A4BA 1RFJA 2O60A 1PVBA 1KK8C 3BUNB 1SW8A 1TNXA 4FQTA 4OKHA 1TUJA 3SS3A 4A4CA 1U5IA 2ZNEA 3EKJA 3LK0A 1KCYA 2JPTA 1IWQA 3CTNA 5JJGA 5K89A 2QEOA 3WNXB 1OOFA 4FQOA 3D0YA 1XK4A 4IJ7A 2LE9B 2HQ8A 1YTZC 2G9BA 4PE4A 3O2PA 1IQ3A 1CB1A 2Y1NA 4I5LB 1TCOB 5I2QA 1BMOA 4QJ3B 1BG1A 1ZUZA 1MUXA 3I5HC 3MSEB 3D10A 4HRGA 4WQ3A 3V2LA 1BR1B 5HYDA 2H8VA 5PALA 2L4HA 3TDZA 4DRWA 1S6JA 2LLSA 3FE6A 2WCJA 2M97A 3JTDC 5CSJA 1TUZA 1SL9A 1A03A 2LMVA 2Q91A 3OHMB 1RWYA 1AJ5A 2KFHA 1LA3A 1OMVA 4GUKA 1XA5A 1YUUA 1OMDA 3DY9A 4N1GA 1M46A 4INXA 4Q04A 3E3RA 2LNKA 5KU1A 2LUXA 3AAKA 4XJKA 1ZACA 2I18A 1TIZA 1UP5A 1KWOB 4P5OE 2BL0B 1C7VA 2BNXA 2I7AA 2L4IA 1KQVA 3TDIA 4WRIA 3BYAA 1QXPA 2OPOA 1GM0A 1W7JB 1L2OB 2JNXA 2SCPA 1J1EA 1TN4A 3NSLA 2P70A 1MHOA 3SS4A 1IH0A 1JBAA 2M8UA 2LM5A 2LVIA 1RECA 2P71A 2E6WA 1WRLA 2MAZA 2LV7A 3SG3A 5G08A 1K94A 1SBJA 3L47A 1M39A 3S0BA 3QMEA 1ZOTB 1SK6D 1TNPA 1EG3A 3TS5B 1F55A 4OR9B 2BBNA 4YGEB 3OX5A 3ICBA 3M0WA 3OGNA 2PMYA 2PRUA 2WOSA 3CS1A 4JD9A 5DKQA 1CM4A 4QJ5B 3OP0A 4USLA 2HF5A 4PT1A 3UNWA 3TZ1A 1M31A 1NX0A 2CBLA 4PHJA 1QLSA 3VRQA 3BXKA 3CZ2A 2WCEA 1AVSA 2LLTA 3PLFB 3B7AA 1FI6A 3DD4A 1IJ5A 2SASA 4YBHB 2JU0A 4AQJA 2KAXA 1RROA 4XYNA 1SPYA 1TNQA 1CLMA 2CT9A 3EK8A 3L4LA 2KSPA 1DJIA 4ORCB 5F6TA 1CMFA 1B1GA 1J7QA 1NX3A 3ZWHA 1WDCB 2H61C 3EVVA 5ER4X 1HT9A 2MBXA 1K9UA 3JVTB 4QJ4B 3A4UB 4MRXA 3EK4A 1JFJA 4KYNA 3DF0B 3IVTA 1OOHA 2KQ6A 1KFUS 4JQ0D 1LKJA 5CPVA 3S0EA 1S5GZ 1BODA 2AUCA 2COLB 2JT0A 2NXQA 1PK0D 2KNEA 3BQ3A 1Z2CB 2KLDA 1YUTA 4N5XA 1L7ZA 3D77A 4YGCB 5AFPA 1QJTA 5IBWA 1DGVA 1QLKA 1ALVA 5HKZA 1N2DA 4MEWA 3RM1A 1DC1A 1Y0VH 4PHMA 1F54A 1IRJA 1NX1A 2ISDA 2AAOA 3VRPA 1B4CA 1KK7Z 2ZRSA 1H8BA 2Y4QA 2L98A 4PE7A 1U5IB 4OZDA 5CSFA 2KGBC 2JNFA 3VGOA 4NQGA 1PSBA 4CFRA 2JZIA 4PE1A 1KWOC 2PQLA 2BL0C 2LUCA 4ORAB 3D0YB 1SL7A 1DEKA 3WHTB 1KFUL 1A4PA 2M9GA 2FCDA 1L2OC 2KYFA 1YVHA 4JKTA 3TUYC 3GOFA 1CMGA 1SR6B 2VRGA 1CLLA 2NZ0A 1CDLA 5D3OA 1K9PA 1DTLA 1YUSA 2KBIA 2KAYA 1K93D 1V1FA 2BBMA 2ERBA 3CDNA 3FIAA 4YI8A 2L0PA 1S1EA 1WY9A 2HETA 1XFUO 3GK4X 1R6PA 3SG5A 1J7RA 3TS5C 2M1KB 1BR4B 1WRZA 1C3ZA 2K2AA 2MA2A 3O4XA 1K9KA 2F2OA 2JTZA 5DKNA 2KI6D 1HQVA 1GJYA 4TNCA 3VB1A 1BU3A 3GK1A 4C0JA 1C3YA 1N65A 1DVIA 4XJKB 1FBVA 4I5JA 3S0GA 4NDCA 1KQMB 1B47A 1NCXA 1SCVA 2CTNA 3DVEA 3D74A 3EG5B 1WLZA 1BF5A 4HREE 3AKBA 1J7PA 1OSAA 1S5GY 1V1GA 1W7IB 3SG7A 2FJYA 3KPXA 1R2UA 3NHTA 3K21A 3B86A 5EL2A 1WDCC 1OMRA 3B87A 3KO0A 3KHEA 2WCHA 3JVTC 1N0YA 1J7OA 2OTGB 3LCPC 2JTTA 1ZMZA 1JFKA 4GGFA 5CSNA 1EXRA 1NIWA 1RK9A 2BECA 5AANA 3PN7B 3HCMA 3O6BA 2L5YA 4BY4A 1QWVA 1YURA 4MBEA 1KK7Y 5I2OA 2V53A 4L9MA 3GK2A 1CLBA 1SCMB 1TTXA 1YVLA 1LINA 1XFYO 1SRAA 1XFXO 5AEQA 3S0DA 2LAPA 2CNPA 1YRTB 1EG4A 1PSRA 2QDIA 3TUYB 5BPJA 1K96A 4I5NB 1Y1AA 2CXJA 1UURA 2JC2A 1DJGA 4OCIA 4DIRA 1JF2A 2FJUB 4MZJA 1A75B 2WORA 3AKAA 1Y6WA 2PSRA 1DJZA 3DVKA 3EVUA 2KFGA 2WCFA 3Q8IA 1C07A 1JF0A 5I94A 1XVJA 1QATA 4M2OA 2WC6A 1FI5A 2G2BA 1EJ3A 1TCFA 3BFHA 2L51A 3WHUB 1CDPA 1QX2A 1XK4C 1KFXS 1Y1UA 2WNDA 1GGZA 2FCEA 4PDZA 4DUQA 3BOWB 3NXAA 1K2HA 1SR6C 1XFWO 4ETOA 1PRWA 1XO5A 2JQ6A 1C7WA 3C1VA 2QEVA 1AUIB 2QEBA 1W9ZA 3BUMB 2D8NA 3DYEA 5J3XA 1IGVA 1B9AA 2AMIA 1MF8B 2LC5A 2HQWA 2M29A 2KBMA 2WC8A 1AP4A 1BJFA 2LHLA 3CR4X 1UWOA 2K7DA 2QEHA 2RGIA 2R2IA 2PASA 2ZN9A 2LLUA 3CR5X 4MLWA 1DQEA 3EKHA 4OV2A 1CTRA 5I8NA 1S26D 2LP2A 3D73A 1PULA 2ZKMX 4YGDB 4N1FA 5KSZA 4AQIA 4WQ2A 1DMOA 1S6IA 1DF0B 3CZTX 2KQYA 5HL1A 2M7NA 1TRFA 4F0ZB 2JT8A 2PVBA 1KFXL 1SMGA 1OOGA 3SIAA 4C0KA 1X02A 2LCPA 1UUSA 3QRXA 1OW4A 2NCOA 2KOTA 1KQMC 2O5GA 5AXIA 3S0AA 2MLFC 2GTEA 3RLZA 4BY5A 2L2EA 3AAJA 3HX4A 5D69A 1QV0A 3SG4A 1CDNA 5FI2A 1MQ1A 3K1EA 1KSOA 4INWA 2LMTA 1VRKA 3I5FB 2OS8B 1PALA 1UHJA 2OTGC 1MWNA 4AOMA 1DELA 2WCLA 1JUOA 4DCKA 2LVJA 2JOJA 1GQMA 3CR2A 3PN7C 3SIBA 2TN4A 1TOPA 1SYMA 1FPWA 1JC2A 1UHHA 3DZTA 3R72A 1CNPA 4CLNA 4FTGA 2BE6A 2WCMA 1OZOA 1SCMC 3DVJA 3NSKA 5FYXA 2JWWA 3NSIA 3L4AA 4YGBB 4ORBB 2E30A 2K2FA 3NGVA 2FOTA 4YRUA 2EGDA 1B8LA 1NSHA 1IJ6A 2M49B 3NHIA 1FW4A 2EC6B 2GGZA 5KTYA 1FF1A 2KHNA 2KI6C 3CYZA 2H2KA 2QACA 1IG5A 5FI6A 3SS5A 1QS7A 3OB1B 1EH2A 1NYAA 1XYDA 1D1OA 3H4SE 4C0LA 5HKWA 2KFFA 1OE9B 4M2PA 4IL1A 1S6CA 4PHNA 2JXCA 2GV5A 4GGNA 3IQOA 1QX7A 1LA0A 2KAVA 1F71A 2F8PA 1T14A 1B7TZ 1EL4A 2NCPA 5GQQC 3DXLA 5AERA 3CWGA 1ALWA 3R1VA 3R1PA 2JRFA 3R1OA 3F45A 2KDHA 3TDUA 4GNKB 3PALA 2F3YA 3UO9A 1SSEB 3IQQA 1CM1A 1IQ5A 5HLOA 3BFAA 2L5XB 2P6BB 5ER5A 1JWDA 2QPTA 1QVIY 1QTXA 2BKHB 3PATA 1NP8A 2ZRTA 2KI4B 1JSAA 1DJYA 1IIOA 1B8RA 1AJ4A 1SY9A 4DS7A 2ZNDA 3S0FA 2LMUA 1MXLC 3O4YA 1M45A 2M7LA 2PYQA 2ZN8A 2BCAA 5B8IB 1PVAA 1XFRA 1J55A 2Y1MA 1WRKA 2A4JA 2BE4A 4I5KA 3I5GB 2BCXA 1ODBA 2YGUA 3RZSA 4P2YB 1AHRA 5D7FA 1NUBA 3D76A 3B88A 1BT6A 2JXLA 2OS8C 2K7OA 3I5FC 4JPZB 1Z4HA 2F33A 1QX5B 1QV1A 4ICBA 1AK8A 1UHIA 4ZCVA 2MRDA 2Y5IA 3D75A 3LK1A 5DKRA 2K61A 1NX2A 2K7BA 3O78A 2I2RE 2H61A 4PCWA 2WCKA 3BUWB 3CZ1A 4MRYA 4PE0A 1WLMA 1A29A 1XFZO 1LXFC 3B6XA 4PALA 3NSOA 1BLQA 1YX7A 2HPSA 2F3ZA 1YR5A 3EK7A 2BKIB 2KPHA 1G33A 3PJIA 1S3PA 2M1UA 4E68A 1MXEA 1OOIX 1BOCA 2EC6C 3FE9A 3LLEA 1OZSA 4HSZA 3LL8B 4CIDA 3CGAA 1B7TY 1QIVA 1RTP1 2MHHA 3ZNIA 1K90D 2EHBA 2L50A 5I2LA 4D1EA 1KK8B 4GPLB 1G8IA 2CCMA 3VROA 1KSMA 3PSRA 1G4YR 3OX6A 3SG6A 1NWDA 4MZKA 2DOQA 2MLEC 1SNLA 2F2PA 3I5IC 2KLEA 4ZCUA 4MZLA 4GGFC 4YGAA 3BUOB 1SKTA 2K8MB 2JT3A 1Y1XA 2M0RA 1XFVO 3KF9A 3FS7A 3BJHA 3CLNA 4CPVA 1TNWA 2KGRA 1QASA 5HLVA 3CABA 4MVFA 5CSIA 3BFBA 4UPGA 1CKKA 3PM2A 1QVIZ 3BUXB 2K0JA 5HKYA 2LHIA 1YRUB 3PM8A 2BCBA 1A75A 1CFPA 2JPOA 1H4BA 1CFFA 1F4QA 3I5HB 1DJWA 1DJXA 1NCZA 1OQPA 1DGUA 2LVKA 2KI4C 4R1EA 2I94A 4HRHA 4F7FA 1MR8A 4NDBA 2ZFDA 3EVRA 3JTDB 4MN0A 4JWQA 4NDDA 1B8CA 3FWBA 2NLNA 3OB2B 3N7HA 1LVCD 1OOJA 1NCYA 3BOWA 4GBAA 4CFQA 1GGWA 4M2QA 2JULA 5FI7A 2B1UA 2GGMA 1ORGA 2PALA 1F70A 5DICA 3FWCA 4MSPA 1CDMA 1DJHA 2BAPA 3I5GC 5TNCA 4PHKA 3WXAA 1K8UA 1QIWA 1P28A 2L2CA 3OBVA 3IF7A 4GAOA 3A8RA 2KYCA 4YI9A 1CFDA 3PFVA 1F8HA 3VRRA 2WCBA 1J1DA 1Q80A 2LP3A 2LANA 1SL8A 1A2XA 1LS8A 2K7CA 1M63B 1S36A 1DF0A 3SG2A 3D78A 1DT7B 1ZFSA 3SJSA 1CFCA 1E8AA 3DF0A 3DVMA 2IS9A 1UHKA 1RJVA 1YX8A 3CZ0A 1K95A 2Q4UA 1IKUA 3I5IB 2LVVA 1UHNA 2MJWB
chains in the Genus database with same CATH topology
5JOLA 3VRNA 1F4OA 4U8DA 4GFTA 4OVNF 3KEVA 1NPQA 2M3WA 4A4BA 1RFJA 2O60A 1PVBA 1KK8C 3BUNB 1SW8A 1TNXA 4OKHA 4A4CA 1U5IA 2ZNEA 3EKJA 3LK0A 1KCYA 2JPTA 1IWQA 3CTNA 5JJGA 5K89A 3WNXB 4FQOA 3D0YA 1XK4A 2LE9B 2HQ8A 1YTZC 2G9BA 4PE4A 3O2PA 1IQ3A 2Y1NA 4I5LB 1TCOB 5I2QA 1BMOA 4QJ3B 1BG1A 1ZUZA 1MUXA 3I5HC 3MSEB 3D10A 4HRGA 4WQ3A 5HYDA 1BR1B 5PALA 2L4HA 3TDZA 4DRWA 1S6JA 2LLSA 3JTDC 2M97A 5CSJA 1SL9A 1A03A 2LMVA 2Q91A 3OHMB 1RWYA 1AJ5A 2KFHA 1LA3A 1OMVA 4GUKA 1XA5A 1YUUA 1OMDA 4N1GA 4Q04A 1M46A 5KU1A 3E3RA 2LNKA 2LUXA 3AAKA 4XJKA 1ZACA 2I18A 1TIZA 1UP5A 1KWOB 4P5OE 2BL0B 1C7VA 2I7AA 1KQVA 2L4IA 3TDIA 4WRIA 3BYAA 1QXPA 2OPOA 1W7JB 1L2OB 2JNXA 2SCPA 1J1EA 1TN4A 3NSLA 1MHOA 1IH0A 1JBAA 2M8UA 2LM5A 2LVIA 1RECA 2E6WA 1WRLA 2MAZA 2LV7A 3SG3A 5G08A 1K94A 1SBJA 1M39A 1ZOTB 1SK6D 1TNPA 1EG3A 3TS5B 1F55A 4OR9B 2BBNA 4YGEB 3OX5A 3ICBA 3M0WA 2PMYA 2PRUA 2WOSA 3CS1A 5DKQA 4QJ5B 1CM4A 3OP0A 4USLA 2HF5A 3TZ1A 1M31A 1NX0A 2CBLA 4PHJA 1QLSA 3VRQA 3BXKA 2WCEA 1AVSA 2LLTA 3PLFB 1FI6A 3DD4A 1IJ5A 2SASA 4YBHB 2JU0A 4AQJA 2KAXA 1RROA 4XYNA 1SPYA 1TNQA 1CLMA 2CT9A 3EK8A 4ORCB 2KSPA 1DJIA 5F6TA 1CMFA 1B1GA 1J7QA 1NX3A 3ZWHA 1WDCB 2H61C 3EVVA 5ER4X 1HT9A 2MBXA 1K9UA 3JVTB 4QJ4B 3A4UB 4MRXA 3EK4A 1JFJA 3DF0B 2KQ6A 1KFUS 4JQ0D 1LKJA 5CPVA 1BODA 1S5GZ 2AUCA 2COLB 2JT0A 2NXQA 1PK0D 2KNEA 3BQ3A 1YUTA 4N5XA 1L7ZA 4YGCB 5AFPA 1QJTA 5IBWA 1DGVA 1QLKA 1ALVA 5HKZA 1N2DA 4MEWA 3RM1A 1Y0VH 4PHMA 1F54A 1IRJA 1NX1A 2ISDA 2AAOA 3VRPA 1B4CA 1KK7Z 2ZRSA 1H8BA 2Y4QA 2L98A 4PE7A 1U5IB 5CSFA 2KGBC 2JNFA 3VGOA 4NQGA 1PSBA 4CFRA 2JZIA 4PE1A 1KWOC 2BL0C 2LUCA 4ORAB 3D0YB 1SL7A 3WHTB 1KFUL 1A4PA 2M9GA 2FCDA 1L2OC 2KYFA 1YVHA 3TUYC 3GOFA 1CMGA 1SR6B 2VRGA 1CLLA 2NZ0A 1CDLA 1K9PA 1DTLA 1YUSA 2KBIA 2KAYA 1K93D 1V1FA 2BBMA 3FIAA 4YI8A 2L0PA 1S1EA 1WY9A 2HETA 1XFUO 3GK4X 1R6PA 3SG5A 1J7RA 3TS5C 2M1KB 1BR4B 1WRZA 2K2AA 2MA2A 1K9KA 2F2OA 2JTZA 5DKNA 2KI6D 1HQVA 1GJYA 4TNCA 1BU3A 3GK1A 4C0JA 1N65A 1DVIA 4XJKB 1FBVA 4I5JA 4NDCA 1KQMB 1B47A 1NCXA 1SCVA 2CTNA 3DVEA 1WLZA 1BF5A 4HREE 3AKBA 1J7PA 1OSAA 1S5GY 1V1GA 1W7IB 3SG7A 3KPXA 1R2UA 3K21A 1WDCC 1OMRA 3KO0A 3KHEA 3JVTC 1N0YA 1J7OA 2OTGB 3LCPC 2JTTA 1ZMZA 1JFKA 4GGFA 5CSNA 1EXRA 1NIWA 1RK9A 2BECA 5AANA 3PN7B 3HCMA 3O6BA 4BY4A 1YURA 4MBEA 1KK7Y 5I2OA 2V53A 4L9MA 3GK2A 1CLBA 1SCMB 1TTXA 1YVLA 1LINA 1XFYO 1SRAA 1XFXO 5AEQA 2LAPA 2CNPA 1YRTB 1EG4A 1PSRA 3TUYB 5BPJA 1K96A 4I5NB 1Y1AA 2CXJA 1UURA 2JC2A 1DJGA 4OCIA 4DIRA 1JF2A 2FJUB 4MZJA 1A75B 2WORA 3AKAA 1Y6WA 2PSRA 1DJZA 3DVKA 3EVUA 2KFGA 2WCFA 1C07A 1JF0A 1XVJA 1QATA 4M2OA 1FI5A 2G2BA 1EJ3A 1TCFA 2L51A 3WHUB 1CDPA 1QX2A 1XK4C 1KFXS 1Y1UA 2WNDA 1GGZA 2FCEA 4PDZA 4DUQA 3BOWB 3NXAA 1K2HA 1SR6C 1XFWO 4ETOA 1PRWA 1XO5A 2JQ6A 1C7WA 3C1VA 1AUIB 3BUMB 2D8NA 5J3XA 1IGVA 1B9AA 2AMIA 1MF8B 2LC5A 2HQWA 2M29A 2KBMA 2WC8A 1AP4A 1BJFA 2LHLA 3CR4X 1UWOA 2K7DA 2RGIA 2ZN9A 2R2IA 2PASA 3CR5X 2LLUA 4MLWA 3EKHA 4OV2A 1CTRA 5I8NA 1S26D 2LP2A 1PULA 2ZKMX 4YGDB 4N1FA 5KSZA 4AQIA 4WQ2A 1DMOA 1S6IA 1DF0B 3CZTX 2KQYA 2M7NA 1TRFA 4F0ZB 2JT8A 2PVBA 1KFXL 1SMGA 3SIAA 4C0KA 1X02A 2LCPA 1UUSA 3QRXA 2NCOA 2KOTA 1KQMC 2O5GA 5AXIA 2MLFC 3RLZA 4BY5A 2L2EA 3AAJA 3HX4A 5D69A 1QV0A 3SG4A 1CDNA 1MQ1A 1KSOA 2LMTA 1VRKA 3I5FB 2OS8B 1PALA 1UHJA 2OTGC 1MWNA 4AOMA 1JUOA 4DCKA 2LVJA 2JOJA 1GQMA 3CR2A 3PN7C 3SIBA 2TN4A 1TOPA 1SYMA 1FPWA 1JC2A 1UHHA 1CNPA 4CLNA 4FTGA 2BE6A 3DVJA 1OZOA 1SCMC 3NSKA 5FYXA 2JWWA 3NSIA 4YGBB 4ORBB 2E30A 2K2FA 2FOTA 4YRUA 2EGDA 1B8LA 1NSHA 1IJ6A 2M49B 1FW4A 2EC6B 2GGZA 5KTYA 1FF1A 2KHNA 2KI6C 2H2KA 2QACA 1IG5A 1QS7A 3OB1B 1EH2A 1NYAA 1XYDA 1D1OA 3H4SE 4C0LA 5HKWA 2KFFA 1OE9B 4M2PA 4IL1A 1S6CA 4PHNA 2JXCA 2GV5A 4GGNA 3IQOA 1QX7A 1LA0A 2KAVA 1F71A 2F8PA 1B7TZ 1EL4A 2NCPA 5GQQC 5AERA 3CWGA 1ALWA 2JRFA 3F45A 2KDHA 3TDUA 4GNKB 3PALA 2F3YA 3IQQA 1CM1A 1IQ5A 5HLOA 2L5XB 2P6BB 5ER5A 1JWDA 2QPTA 1QVIY 1QTXA 2BKHB 3PATA 1NP8A 2ZRTA 2KI4B 1JSAA 1DJYA 1B8RA 1AJ4A 1SY9A 4DS7A 2ZNDA 2LMUA 1MXLC 3O4YA 1M45A 2M7LA 2ZN8A 2BCAA 5B8IB 1PVAA 1J55A 2Y1MA 1WRKA 2A4JA 2BE4A 4I5KA 3I5GB 2BCXA 1ODBA 4P2YB 1AHRA 5D7FA 1NUBA 3I5FC 1BT6A 2JXLA 2OS8C 2K7OA 4JPZB 2F33A 1QX5B 1QV1A 4ICBA 1AK8A 1UHIA 4ZCVA 2MRDA 2Y5IA 3LK1A 5DKRA 1CB1A 2K61A 1NX2A 2K7BA 3O78A 2I2RE 2H61A 4PCWA 3BUWB 4MRYA 4PE0A 1WLMA 1A29A 1XFZO 1LXFC 4PALA 1BLQA 3NSOA 1YX7A 2HPSA 2F3ZA 1YR5A 3EK7A 2BKIB 1G33A 1S3PA 2M1UA 4E68A 1MXEA 1BOCA 2EC6C 3LLEA 1OZSA 4HSZA 3LL8B 4CIDA 3CGAA 1B7TY 1QIVA 1RTP1 2MHHA 3ZNIA 1K90D 2EHBA 2L50A 5I2LA 4D1EA 1KK8B 4GPLB 1G8IA 2CCMA 3VROA 1KSMA 3PSRA 1G4YR 3OX6A 3SG6A 1NWDA 4MZKA 2DOQA 2MLEC 1SNLA 2F2PA 3I5IC 4ZCUA 4MZLA 4GGFC 4YGAA 3BUOB 1SKTA 2K8MB 2JT3A 1Y1XA 2M0RA 1XFVO 3KF9A 3FS7A 4CPVA 3CLNA 1TNWA 2KGRA 1QASA 5HLVA 4MVFA 5CSIA 4UPGA 1CKKA 1QVIZ 3BUXB 2K0JA 5HKYA 2LHIA 1YRUB 3PM8A 2BCBA 1A75A 1CFPA 1H4BA 1CFFA 1F4QA 3I5HB 1DJWA 1DJXA 1NCZA 1OQPA 1DGUA 2LVKA 2KI4C 4R1EA 2I94A 4HRHA 1MR8A 4NDBA 2ZFDA 3EVRA 3JTDB 4MN0A 4JWQA 4NDDA 1B8CA 3FWBA 2NLNA 3OB2B 1LVCD 1OOJA 1NCYA 3BOWA 4GBAA 4CFQA 1GGWA 4M2QA 2JULA 2B1UA 2GGMA 2PALA 1F70A 3FWCA 4MSPA 1CDMA 1DJHA 3I5GC 5TNCA 4PHKA 3WXAA 1K8UA 1QIWA 3IF7A 4GAOA 3A8RA 2KYCA 4YI9A 1CFDA 3PFVA 1F8HA 3VRRA 2WCBA 1J1DA 1Q80A 2LP3A 2LANA 1SL8A 1A2XA 2K7CA 3SG2A 1M63B 1S36A 1DF0A 1DT7B 1ZFSA 3SJSA 1CFCA 1E8AA 3DF0A 3DVMA 2IS9A 1UHKA 1RJVA 1YX8A 1K95A 2Q4UA 1IKUA 3I5IB 2LVVA 1UHNA 2MJWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JOL A;  3VRN A;  1F4O A;  4U8D A;  4GFT A;  4OVN F;  3KEV A;  1NPQ A;  2M3W A;  4A4B A;  1RFJ A;  2O60 A;  1PVB A;  1KK8 C;  3BUN B;  1SW8 A;  1TNX A;  4OKH A;  4A4C A;  1U5I A;  2ZNE A;  3EKJ A;  3LK0 A;  1KCY A;  2JPT A;  1IWQ A;  3CTN A;  5JJG A;  5K89 A;  3WNX B;  4FQO A;  3D0Y A;  1XK4 A;  2LE9 B;  2HQ8 A;  1YTZ C;  2G9B A;  4PE4 A;  3O2P A;  1IQ3 A;  2Y1N A;  4I5L B;  1TCO B;  5I2Q A;  1BMO A;  4QJ3 B;  1BG1 A;  1ZUZ A;  1MUX A;  3I5H C;  3MSE B;  3D10 A;  4HRG A;  4WQ3 A;  5HYD A;  1BR1 B;  5PAL A;  2L4H A;  3TDZ A;  4DRW A;  1S6J A;  2LLS A;  3JTD C;  2M97 A;  5CSJ A;  1SL9 A;  1A03 A;  2LMV A;  2Q91 A;  3OHM B;  1RWY A;  1AJ5 A;  2KFH A;  1LA3 A;  1OMV A;  4GUK A;  1XA5 A;  1YUU A;  1OMD A;  4N1G A;  4Q04 A;  1M46 A;  5KU1 A;  3E3R A;  2LNK A;  2LUX A;  3AAK A;  4XJK A;  1ZAC A;  2I18 A;  1TIZ A;  1UP5 A;  1KWO B;  4P5O E;  2BL0 B;  1C7V A;  2I7A A;  1KQV A;  2L4I A;  3TDI A;  4WRI A;  3BYA A;  1QXP A;  2OPO A;  1W7J B;  1L2O B;  2JNX A;  2SCP A;  1J1E A;  1TN4 A;  3NSL A;  1MHO A;  1IH0 A;  1JBA A;  2M8U A;  2LM5 A;  2LVI A;  1REC A;  2E6W A;  1WRL A;  2MAZ A;  2LV7 A;  3SG3 A;  5G08 A;  1K94 A;  1SBJ A;  1M39 A;  1ZOT B;  1SK6 D;  1TNP A;  1EG3 A;  3TS5 B;  1F55 A;  4OR9 B;  2BBN A;  4YGE B;  3OX5 A;  3ICB A;  3M0W A;  2PMY A;  2PRU A;  2WOS A;  3CS1 A;  5DKQ A;  4QJ5 B;  1CM4 A;  3OP0 A;  4USL A;  2HF5 A;  3TZ1 A;  1M31 A;  1NX0 A;  2CBL A;  4PHJ A;  1QLS A;  3VRQ A;  3BXK A;  2WCE A;  1AVS A;  2LLT A;  3PLF B;  1FI6 A;  3DD4 A;  1IJ5 A;  2SAS A;  4YBH B;  2JU0 A;  4AQJ A;  2KAX A;  1RRO A;  4XYN A;  1SPY A;  1TNQ A;  1CLM A;  2CT9 A;  3EK8 A;  4ORC B;  2KSP A;  1DJI A;  5F6T A;  1CMF A;  1B1G A;  1J7Q A;  1NX3 A;  3ZWH A;  1WDC B;  2H61 C;  3EVV A;  5ER4 X;  1HT9 A;  2MBX A;  1K9U A;  3JVT B;  4QJ4 B;  3A4U B;  4MRX A;  3EK4 A;  1JFJ A;  3DF0 B;  2KQ6 A;  1KFU S;  4JQ0 D;  1LKJ A;  5CPV A;  1BOD A;  1S5G Z;  2AUC A;  2COL B;  2JT0 A;  2NXQ A;  1PK0 D;  2KNE A;  3BQ3 A;  1YUT A;  4N5X A;  1L7Z A;  4YGC B;  5AFP A;  1QJT A;  5IBW A;  1DGV A;  1QLK A;  1ALV A;  5HKZ A;  1N2D A;  4MEW A;  3RM1 A;  1Y0V H;  4PHM A;  1F54 A;  1IRJ A;  1NX1 A;  2ISD A;  2AAO A;  3VRP A;  1B4C A;  1KK7 Z;  2ZRS A;  1H8B A;  2Y4Q A;  2L98 A;  4PE7 A;  1U5I B;  5CSF A;  2KGB C;  2JNF A;  3VGO A;  4NQG A;  1PSB A;  4CFR A;  2JZI A;  4PE1 A;  1KWO C;  2BL0 C;  2LUC A;  4ORA B;  3D0Y B;  1SL7 A;  3WHT B;  1KFU L;  1A4P A;  2M9G A;  2FCD A;  1L2O C;  2KYF A;  1YVH A;  3TUY C;  3GOF A;  1CMG A;  1SR6 B;  2VRG A;  1CLL A;  2NZ0 A;  1CDL A;  1K9P A;  1DTL A;  1YUS A;  2KBI A;  2KAY A;  1K93 D;  1V1F A;  2BBM A;  3FIA A;  4YI8 A;  2L0P A;  1S1E A;  1WY9 A;  2HET A;  1XFU O;  3GK4 X;  1R6P A;  3SG5 A;  1J7R A;  3TS5 C;  2M1K B;  1BR4 B;  1WRZ A;  2K2A A;  2MA2 A;  1K9K A;  2F2O A;  2JTZ A;  5DKN A;  2KI6 D;  1HQV A;  1GJY A;  4TNC A;  1BU3 A;  3GK1 A;  4C0J A;  1N65 A;  1DVI A;  4XJK B;  1FBV A;  4I5J A;  4NDC A;  1KQM B;  1B47 A;  1NCX A;  1SCV A;  2CTN A;  3DVE A;  1WLZ A;  1BF5 A;  4HRE E;  3AKB A;  1J7P A;  1OSA A;  1S5G Y;  1V1G A;  1W7I B;  3SG7 A;  3KPX A;  1R2U A;  3K21 A;  1WDC C;  1OMR A;  3KO0 A;  3KHE A;  3JVT C;  1N0Y A;  1J7O A;  2OTG B;  3LCP C;  2JTT A;  1ZMZ A;  1JFK A;  4GGF A;  5CSN A;  1EXR A;  1NIW A;  1RK9 A;  2BEC A;  5AAN A;  3PN7 B;  3HCM A;  3O6B A;  4BY4 A;  1YUR A;  4MBE A;  1KK7 Y;  5I2O A;  2V53 A;  4L9M A;  3GK2 A;  1CLB A;  1SCM B;  1TTX A;  1YVL A;  1LIN A;  1XFY O;  1SRA A;  1XFX O;  5AEQ A;  2LAP A;  2CNP A;  1YRT B;  1EG4 A;  1PSR A;  3TUY B;  5BPJ A;  1K96 A;  4I5N B;  1Y1A A;  2CXJ A;  1UUR A;  2JC2 A;  1DJG A;  4OCI A;  4DIR A;  1JF2 A;  2FJU B;  4MZJ A;  1A75 B;  2WOR A;  3AKA A;  1Y6W A;  2PSR A;  1DJZ A;  3DVK A;  3EVU A;  2KFG A;  2WCF A;  1C07 A;  1JF0 A;  1XVJ A;  1QAT A;  4M2O A;  1FI5 A;  2G2B A;  1EJ3 A;  1TCF A;  2L51 A;  3WHU B;  1CDP A;  1QX2 A;  1XK4 C;  1KFX S;  1Y1U A;  2WND A;  1GGZ A;  2FCE A;  4PDZ A;  4DUQ A;  3BOW B;  3NXA A;  1K2H A;  1SR6 C;  1XFW O;  4ETO A;  1PRW A;  1XO5 A;  2JQ6 A;  1C7W A;  3C1V A;  1AUI B;  3BUM B;  2D8N A;  5J3X A;  1IGV A;  1B9A A;  2AMI A;  1MF8 B;  2LC5 A;  2HQW A;  2M29 A;  2KBM A;  2WC8 A;  1AP4 A;  1BJF A;  2LHL A;  3CR4 X;  1UWO A;  2K7D A;  2RGI A;  2ZN9 A;  2R2I A;  2PAS A;  3CR5 X;  2LLU A;  4MLW A;  3EKH A;  4OV2 A;  1CTR A;  5I8N A;  1S26 D;  2LP2 A;  1PUL A;  2ZKM X;  4YGD B;  4N1F A;  5KSZ A;  4AQI A;  4WQ2 A;  1DMO A;  1S6I A;  1DF0 B;  3CZT X;  2KQY A;  2M7N A;  1TRF A;  4F0Z B;  2JT8 A;  2PVB A;  1KFX L;  1SMG A;  3SIA A;  4C0K A;  1X02 A;  2LCP A;  1UUS A;  3QRX A;  2NCO A;  2KOT A;  1KQM C;  2O5G A;  5AXI A;  2MLF C;  3RLZ A;  4BY5 A;  2L2E A;  3AAJ A;  3HX4 A;  5D69 A;  1QV0 A;  3SG4 A;  1CDN A;  1MQ1 A;  1KSO A;  2LMT A;  1VRK A;  3I5F B;  2OS8 B;  1PAL A;  1UHJ A;  2OTG C;  1MWN A;  4AOM A;  1JUO A;  4DCK A;  2LVJ A;  2JOJ A;  1GQM A;  3CR2 A;  3PN7 C;  3SIB A;  2TN4 A;  1TOP A;  1SYM A;  1FPW A;  1JC2 A;  1UHH A;  1CNP A;  4CLN A;  4FTG A;  2BE6 A;  3DVJ A;  1OZO A;  1SCM C;  3NSK A;  5FYX A;  2JWW A;  3NSI A;  4YGB B;  4ORB B;  2E30 A;  2K2F A;  2FOT A;  4YRU A;  2EGD A;  1B8L A;  1NSH A;  1IJ6 A;  2M49 B;  1FW4 A;  2EC6 B;  2GGZ A;  5KTY A;  1FF1 A;  2KHN A;  2KI6 C;  2H2K A;  2QAC A;  1IG5 A;  1QS7 A;  3OB1 B;  1EH2 A;  1NYA A;  1XYD A;  1D1O A;  3H4S E;  4C0L A;  5HKW A;  2KFF A;  1OE9 B;  4M2P A;  4IL1 A;  1S6C A;  4PHN A;  2JXC A;  2GV5 A;  4GGN A;  3IQO A;  1QX7 A;  1LA0 A;  2KAV A;  1F71 A;  2F8P A;  1B7T Z;  1EL4 A;  2NCP A;  5GQQ C;  5AER A;  3CWG A;  1ALW A;  2JRF A;  3F45 A;  2KDH A;  3TDU A;  4GNK B;  3PAL A;  2F3Y A;  3IQQ A;  1CM1 A;  1IQ5 A;  5HLO A;  2L5X B;  2P6B B;  5ER5 A;  1JWD A;  2QPT A;  1QVI Y;  1QTX A;  2BKH B;  3PAT A;  1NP8 A;  2ZRT A;  2KI4 B;  1JSA A;  1DJY A;  1B8R A;  1AJ4 A;  1SY9 A;  4DS7 A;  2ZND A;  2LMU A;  1MXL C;  3O4Y A;  1M45 A;  2M7L A;  2ZN8 A;  2BCA A;  5B8I B;  1PVA A;  1J55 A;  2Y1M A;  1WRK A;  2A4J A;  2BE4 A;  4I5K A;  3I5G B;  2BCX A;  1ODB A;  4P2Y B;  1AHR A;  5D7F A;  1NUB A;  3I5F C;  1BT6 A;  2JXL A;  2OS8 C;  2K7O A;  4JPZ B;  2F33 A;  1QX5 B;  1QV1 A;  4ICB A;  1AK8 A;  1UHI A;  4ZCV A;  2MRD A;  2Y5I A;  3LK1 A;  5DKR A;  1CB1 A;  2K61 A;  1NX2 A;  2K7B A;  3O78 A;  2I2R E;  2H61 A;  4PCW A;  3BUW B;  4MRY A;  4PE0 A;  1WLM A;  1A29 A;  1XFZ O;  1LXF C;  4PAL A;  1BLQ A;  3NSO A;  1YX7 A;  2HPS A;  2F3Z A;  1YR5 A;  3EK7 A;  2BKI B;  1G33 A;  1S3P A;  2M1U A;  4E68 A;  1MXE A;  1BOC A;  2EC6 C;  3LLE A;  1OZS A;  4HSZ A;  3LL8 B;  4CID A;  3CGA A;  1B7T Y;  1QIV A;  1RTP 1;  2MHH A;  3ZNI A;  1K90 D;  2EHB A;  2L50 A;  5I2L A;  4D1E A;  1KK8 B;  4GPL B;  1G8I A;  2CCM A;  3VRO A;  1KSM A;  3PSR A;  1G4Y R;  3OX6 A;  3SG6 A;  1NWD A;  4MZK A;  2DOQ A;  2MLE C;  1SNL A;  2F2P A;  3I5I C;  4ZCU A;  4MZL A;  4GGF C;  4YGA A;  3BUO B;  1SKT A;  2K8M B;  2JT3 A;  1Y1X A;  2M0R A;  1XFV O;  3KF9 A;  3FS7 A;  4CPV A;  3CLN A;  1TNW A;  2KGR A;  1QAS A;  5HLV A;  4MVF A;  5CSI A;  4UPG A;  1CKK A;  1QVI Z;  3BUX B;  2K0J A;  5HKY A;  2LHI A;  1YRU B;  3PM8 A;  2BCB A;  1A75 A;  1CFP A;  1H4B A;  1CFF A;  1F4Q A;  3I5H B;  1DJW A;  1DJX A;  1NCZ A;  1OQP A;  1DGU A;  2LVK A;  2KI4 C;  4R1E A;  2I94 A;  4HRH A;  1MR8 A;  4NDB A;  2ZFD A;  3EVR A;  3JTD B;  4MN0 A;  4JWQ A;  4NDD A;  1B8C A;  3FWB A;  2NLN A;  3OB2 B;  1LVC D;  1OOJ A;  1NCY A;  3BOW A;  4GBA A;  4CFQ A;  1GGW A;  4M2Q A;  2JUL A;  2B1U A;  2GGM A;  2PAL A;  1F70 A;  3FWC A;  4MSP A;  1CDM A;  1DJH A;  3I5G C;  5TNC A;  4PHK A;  3WXA A;  1K8U A;  1QIW A;  3IF7 A;  4GAO A;  3A8R A;  2KYC A;  4YI9 A;  1CFD A;  3PFV A;  1F8H A;  3VRR A;  2WCB A;  1J1D A;  1Q80 A;  2LP3 A;  2LAN A;  1SL8 A;  1A2X A;  2K7C A;  3SG2 A;  1M63 B;  1S36 A;  1DF0 A;  1DT7 B;  1ZFS A;  3SJS A;  1CFC A;  1E8A A;  3DF0 A;  3DVM A;  2IS9 A;  1UHK A;  1RJV A;  1YX8 A;  1K95 A;  2Q4U A;  1IKU A;  3I5I B;  2LVV A;  1UHN A;  2MJW B; 
#chains in the Genus database with same CATH topology
 5JOL A;  2WC5 A;  3FE8 A;  3VRN A;  1F4O A;  4U8D A;  4GFT A;  2K60 A;  4OVN F;  1TWO A;  1NPQ A;  3KEV A;  2M3W A;  4A4B A;  1RFJ A;  2O60 A;  1PVB A;  1KK8 C;  3BUN B;  1SW8 A;  1TNX A;  4FQT A;  4OKH A;  1TUJ A;  3SS3 A;  4A4C A;  1U5I A;  2ZNE A;  3EKJ A;  3LK0 A;  1KCY A;  2JPT A;  1IWQ A;  3CTN A;  5JJG A;  5K89 A;  2QEO A;  3WNX B;  1OOF A;  4FQO A;  3D0Y A;  1XK4 A;  4IJ7 A;  2LE9 B;  2HQ8 A;  1YTZ C;  2G9B A;  4PE4 A;  3O2P A;  1IQ3 A;  1CB1 A;  2Y1N A;  4I5L B;  1TCO B;  5I2Q A;  1BMO A;  4QJ3 B;  1BG1 A;  1ZUZ A;  1MUX A;  3I5H C;  3MSE B;  3D10 A;  4HRG A;  4WQ3 A;  3V2L A;  1BR1 B;  5HYD A;  2H8V A;  5PAL A;  2L4H A;  3TDZ A;  4DRW A;  1S6J A;  2LLS A;  3FE6 A;  2WCJ A;  2M97 A;  3JTD C;  5CSJ A;  1TUZ A;  1SL9 A;  1A03 A;  2LMV A;  2Q91 A;  3OHM B;  1RWY A;  1AJ5 A;  2KFH A;  1LA3 A;  1OMV A;  4GUK A;  1XA5 A;  1YUU A;  1OMD A;  3DY9 A;  4N1G A;  1M46 A;  4INX A;  4Q04 A;  3E3R A;  2LNK A;  5KU1 A;  2LUX A;  3AAK A;  4XJK A;  1ZAC A;  2I18 A;  1TIZ A;  1UP5 A;  1KWO B;  4P5O E;  2BL0 B;  1C7V A;  2BNX A;  2I7A A;  2L4I A;  1KQV A;  3TDI A;  4WRI A;  3BYA A;  1QXP A;  2OPO A;  1GM0 A;  1W7J B;  1L2O B;  2JNX A;  2SCP A;  1J1E A;  1TN4 A;  3NSL A;  2P70 A;  1MHO A;  3SS4 A;  1IH0 A;  1JBA A;  2M8U A;  2LM5 A;  2LVI A;  1REC A;  2P71 A;  2E6W A;  1WRL A;  2MAZ A;  2LV7 A;  3SG3 A;  5G08 A;  1K94 A;  1SBJ A;  3L47 A;  1M39 A;  3S0B A;  3QME A;  1ZOT B;  1SK6 D;  1TNP A;  1EG3 A;  3TS5 B;  1F55 A;  4OR9 B;  2BBN A;  4YGE B;  3OX5 A;  3ICB A;  3M0W A;  3OGN A;  2PMY A;  2PRU A;  2WOS A;  3CS1 A;  4JD9 A;  5DKQ A;  1CM4 A;  4QJ5 B;  3OP0 A;  4USL A;  2HF5 A;  4PT1 A;  3UNW A;  3TZ1 A;  1M31 A;  1NX0 A;  2CBL A;  4PHJ A;  1QLS A;  3VRQ A;  3BXK A;  3CZ2 A;  2WCE A;  1AVS A;  2LLT A;  3PLF B;  3B7A A;  1FI6 A;  3DD4 A;  1IJ5 A;  2SAS A;  4YBH B;  2JU0 A;  4AQJ A;  2KAX A;  1RRO A;  4XYN A;  1SPY A;  1TNQ A;  1CLM A;  2CT9 A;  3EK8 A;  3L4L A;  2KSP A;  1DJI A;  4ORC B;  5F6T A;  1CMF A;  1B1G A;  1J7Q A;  1NX3 A;  3ZWH A;  1WDC B;  2H61 C;  3EVV A;  5ER4 X;  1HT9 A;  2MBX A;  1K9U A;  3JVT B;  4QJ4 B;  3A4U B;  4MRX A;  3EK4 A;  1JFJ A;  4KYN A;  3DF0 B;  3IVT A;  1OOH A;  2KQ6 A;  1KFU S;  4JQ0 D;  1LKJ A;  5CPV A;  3S0E A;  1S5G Z;  1BOD A;  2AUC A;  2COL B;  2JT0 A;  2NXQ A;  1PK0 D;  2KNE A;  3BQ3 A;  1Z2C B;  2KLD A;  1YUT A;  4N5X A;  1L7Z A;  3D77 A;  4YGC B;  5AFP A;  1QJT A;  5IBW A;  1DGV A;  1QLK A;  1ALV A;  5HKZ A;  1N2D A;  4MEW A;  3RM1 A;  1DC1 A;  1Y0V H;  4PHM A;  1F54 A;  1IRJ A;  1NX1 A;  2ISD A;  2AAO A;  3VRP A;  1B4C A;  1KK7 Z;  2ZRS A;  1H8B A;  2Y4Q A;  2L98 A;  4PE7 A;  1U5I B;  4OZD A;  5CSF A;  2KGB C;  2JNF A;  3VGO A;  4NQG A;  1PSB A;  4CFR A;  2JZI A;  4PE1 A;  1KWO C;  2PQL A;  2BL0 C;  2LUC A;  4ORA B;  3D0Y B;  1SL7 A;  1DEK A;  3WHT B;  1KFU L;  1A4P A;  2M9G A;  2FCD A;  1L2O C;  2KYF A;  1YVH A;  4JKT A;  3TUY C;  3GOF A;  1CMG A;  1SR6 B;  2VRG A;  1CLL A;  2NZ0 A;  1CDL A;  5D3O A;  1K9P A;  1DTL A;  1YUS A;  2KBI A;  2KAY A;  1K93 D;  1V1F A;  2BBM A;  2ERB A;  3CDN A;  3FIA A;  4YI8 A;  2L0P A;  1S1E A;  1WY9 A;  2HET A;  1XFU O;  3GK4 X;  1R6P A;  3SG5 A;  1J7R A;  3TS5 C;  2M1K B;  1BR4 B;  1WRZ A;  1C3Z A;  2K2A A;  2MA2 A;  3O4X A;  1K9K A;  2F2O A;  2JTZ A;  5DKN A;  2KI6 D;  1HQV A;  1GJY A;  4TNC A;  3VB1 A;  1BU3 A;  3GK1 A;  4C0J A;  1C3Y A;  1N65 A;  1DVI A;  4XJK B;  1FBV A;  4I5J A;  3S0G A;  4NDC A;  1KQM B;  1B47 A;  1NCX A;  1SCV A;  2CTN A;  3DVE A;  3D74 A;  3EG5 B;  1WLZ A;  1BF5 A;  4HRE E;  3AKB A;  1J7P A;  1OSA A;  1S5G Y;  1V1G A;  1W7I B;  3SG7 A;  2FJY A;  3KPX A;  1R2U A;  3NHT A;  3K21 A;  3B86 A;  5EL2 A;  1WDC C;  1OMR A;  3B87 A;  3KO0 A;  3KHE A;  2WCH A;  3JVT C;  1N0Y A;  1J7O A;  2OTG B;  3LCP C;  2JTT A;  1ZMZ A;  1JFK A;  4GGF A;  5CSN A;  1EXR A;  1NIW A;  1RK9 A;  2BEC A;  5AAN A;  3PN7 B;  3HCM A;  3O6B A;  2L5Y A;  4BY4 A;  1QWV A;  1YUR A;  4MBE A;  1KK7 Y;  5I2O A;  2V53 A;  4L9M A;  3GK2 A;  1CLB A;  1SCM B;  1TTX A;  1YVL A;  1LIN A;  1XFY O;  1SRA A;  1XFX O;  5AEQ A;  3S0D A;  2LAP A;  2CNP A;  1YRT B;  1EG4 A;  1PSR A;  2QDI A;  3TUY B;  5BPJ A;  1K96 A;  4I5N B;  1Y1A A;  2CXJ A;  1UUR A;  2JC2 A;  1DJG A;  4OCI A;  4DIR A;  1JF2 A;  2FJU B;  4MZJ A;  1A75 B;  2WOR A;  3AKA A;  1Y6W A;  2PSR A;  1DJZ A;  3DVK A;  3EVU A;  2KFG A;  2WCF A;  3Q8I A;  1C07 A;  1JF0 A;  5I94 A;  1XVJ A;  1QAT A;  4M2O A;  2WC6 A;  1FI5 A;  2G2B A;  1EJ3 A;  1TCF A;  3BFH A;  2L51 A;  3WHU B;  1CDP A;  1QX2 A;  1XK4 C;  1KFX S;  1Y1U A;  2WND A;  1GGZ A;  2FCE A;  4PDZ A;  4DUQ A;  3BOW B;  3NXA A;  1K2H A;  1SR6 C;  1XFW O;  4ETO A;  1PRW A;  1XO5 A;  2JQ6 A;  1C7W A;  3C1V A;  2QEV A;  1AUI B;  2QEB A;  1W9Z A;  3BUM B;  2D8N A;  3DYE A;  5J3X A;  1IGV A;  1B9A A;  2AMI A;  1MF8 B;  2LC5 A;  2HQW A;  2M29 A;  2KBM A;  2WC8 A;  1AP4 A;  1BJF A;  2LHL A;  3CR4 X;  1UWO A;  2K7D A;  2QEH A;  2RGI A;  2R2I A;  2PAS A;  2ZN9 A;  2LLU A;  3CR5 X;  4MLW A;  1DQE A;  3EKH A;  4OV2 A;  1CTR A;  5I8N A;  1S26 D;  2LP2 A;  3D73 A;  1PUL A;  2ZKM X;  4YGD B;  4N1F A;  5KSZ A;  4AQI A;  4WQ2 A;  1DMO A;  1S6I A;  1DF0 B;  3CZT X;  2KQY A;  5HL1 A;  2M7N A;  1TRF A;  4F0Z B;  2JT8 A;  2PVB A;  1KFX L;  1SMG A;  1OOG A;  3SIA A;  4C0K A;  1X02 A;  2LCP A;  1UUS A;  3QRX A;  1OW4 A;  2NCO A;  2KOT A;  1KQM C;  2O5G A;  5AXI A;  3S0A A;  2MLF C;  2GTE A;  3RLZ A;  4BY5 A;  2L2E A;  3AAJ A;  3HX4 A;  5D69 A;  1QV0 A;  3SG4 A;  1CDN A;  5FI2 A;  1MQ1 A;  3K1E A;  1KSO A;  4INW A;  2LMT A;  1VRK A;  3I5F B;  2OS8 B;  1PAL A;  1UHJ A;  2OTG C;  1MWN A;  4AOM A;  1DEL A;  2WCL A;  1JUO A;  4DCK A;  2LVJ A;  2JOJ A;  1GQM A;  3CR2 A;  3PN7 C;  3SIB A;  2TN4 A;  1TOP A;  1SYM A;  1FPW A;  1JC2 A;  1UHH A;  3DZT A;  3R72 A;  1CNP A;  4CLN A;  4FTG A;  2BE6 A;  2WCM A;  1OZO A;  1SCM C;  3DVJ A;  3NSK A;  5FYX A;  2JWW A;  3NSI A;  3L4A A;  4YGB B;  4ORB B;  2E30 A;  2K2F A;  3NGV A;  2FOT A;  4YRU A;  2EGD A;  1B8L A;  1NSH A;  1IJ6 A;  2M49 B;  3NHI A;  1FW4 A;  2EC6 B;  2GGZ A;  5KTY A;  1FF1 A;  2KHN A;  2KI6 C;  3CYZ A;  2H2K A;  2QAC A;  1IG5 A;  5FI6 A;  3SS5 A;  1QS7 A;  3OB1 B;  1EH2 A;  1NYA A;  1XYD A;  1D1O A;  3H4S E;  4C0L A;  5HKW A;  2KFF A;  1OE9 B;  4M2P A;  4IL1 A;  1S6C A;  4PHN A;  2JXC A;  2GV5 A;  4GGN A;  3IQO A;  1QX7 A;  1LA0 A;  2KAV A;  1F71 A;  2F8P A;  1T14 A;  1B7T Z;  1EL4 A;  2NCP A;  5GQQ C;  3DXL A;  5AER A;  3CWG A;  1ALW A;  3R1V A;  3R1P A;  2JRF A;  3R1O A;  3F45 A;  2KDH A;  3TDU A;  4GNK B;  3PAL A;  2F3Y A;  3UO9 A;  1SSE B;  3IQQ A;  1CM1 A;  1IQ5 A;  5HLO A;  3BFA A;  2L5X B;  2P6B B;  5ER5 A;  1JWD A;  2QPT A;  1QVI Y;  1QTX A;  2BKH B;  3PAT A;  1NP8 A;  2ZRT A;  2KI4 B;  1JSA A;  1DJY A;  1IIO A;  1B8R A;  1AJ4 A;  1SY9 A;  4DS7 A;  2ZND A;  3S0F A;  2LMU A;  1MXL C;  3O4Y A;  1M45 A;  2M7L A;  2PYQ A;  2ZN8 A;  2BCA A;  5B8I B;  1PVA A;  1XFR A;  1J55 A;  2Y1M A;  1WRK A;  2A4J A;  2BE4 A;  4I5K A;  3I5G B;  2BCX A;  1ODB A;  2YGU A;  3RZS A;  4P2Y B;  1AHR A;  5D7F A;  1NUB A;  3D76 A;  3B88 A;  1BT6 A;  2JXL A;  2OS8 C;  2K7O A;  3I5F C;  4JPZ B;  1Z4H A;  2F33 A;  1QX5 B;  1QV1 A;  4ICB A;  1AK8 A;  1UHI A;  4ZCV A;  2MRD A;  2Y5I A;  3D75 A;  3LK1 A;  5DKR A;  2K61 A;  1NX2 A;  2K7B A;  3O78 A;  2I2R E;  2H61 A;  4PCW A;  2WCK A;  3BUW B;  3CZ1 A;  4MRY A;  4PE0 A;  1WLM A;  1A29 A;  1XFZ O;  1LXF C;  3B6X A;  4PAL A;  3NSO A;  1BLQ A;  1YX7 A;  2HPS A;  2F3Z A;  1YR5 A;  3EK7 A;  2BKI B;  2KPH A;  1G33 A;  3PJI A;  1S3P A;  2M1U A;  4E68 A;  1MXE A;  1OOI X;  1BOC A;  2EC6 C;  3FE9 A;  3LLE A;  1OZS A;  4HSZ A;  3LL8 B;  4CID A;  3CGA A;  1B7T Y;  1QIV A;  1RTP 1;  2MHH A;  3ZNI A;  1K90 D;  2EHB A;  2L50 A;  5I2L A;  4D1E A;  1KK8 B;  4GPL B;  1G8I A;  2CCM A;  3VRO A;  1KSM A;  3PSR A;  1G4Y R;  3OX6 A;  3SG6 A;  1NWD A;  4MZK A;  2DOQ A;  2MLE C;  1SNL A;  2F2P A;  3I5I C;  2KLE A;  4ZCU A;  4MZL A;  4GGF C;  4YGA A;  3BUO B;  1SKT A;  2K8M B;  2JT3 A;  1Y1X A;  2M0R A;  1XFV O;  3KF9 A;  3FS7 A;  3BJH A;  3CLN A;  4CPV A;  1TNW A;  2KGR A;  1QAS A;  5HLV A;  3CAB A;  4MVF A;  5CSI A;  3BFB A;  4UPG A;  1CKK A;  3PM2 A;  1QVI Z;  3BUX B;  2K0J A;  5HKY A;  2LHI A;  1YRU B;  3PM8 A;  2BCB A;  1A75 A;  1CFP A;  2JPO A;  1H4B A;  1CFF A;  1F4Q A;  3I5H B;  1DJW A;  1DJX A;  1NCZ A;  1OQP A;  1DGU A;  2LVK A;  2KI4 C;  4R1E A;  2I94 A;  4HRH A;  4F7F A;  1MR8 A;  4NDB A;  2ZFD A;  3EVR A;  3JTD B;  4MN0 A;  4JWQ A;  4NDD A;  1B8C A;  3FWB A;  2NLN A;  3OB2 B;  3N7H A;  1LVC D;  1OOJ A;  1NCY A;  3BOW A;  4GBA A;  4CFQ A;  1GGW A;  4M2Q A;  2JUL A;  5FI7 A;  2B1U A;  2GGM A;  1ORG A;  2PAL A;  1F70 A;  5DIC A;  3FWC A;  4MSP A;  1CDM A;  1DJH A;  2BAP A;  3I5G C;  5TNC A;  4PHK A;  3WXA A;  1K8U A;  1QIW A;  1P28 A;  2L2C A;  3OBV A;  3IF7 A;  4GAO A;  3A8R A;  2KYC A;  4YI9 A;  1CFD A;  3PFV A;  1F8H A;  3VRR A;  2WCB A;  1J1D A;  1Q80 A;  2LP3 A;  2LAN A;  1SL8 A;  1A2X A;  1LS8 A;  2K7C A;  1M63 B;  1S36 A;  1DF0 A;  3SG2 A;  3D78 A;  1DT7 B;  1ZFS A;  3SJS A;  1CFC A;  1E8A A;  3DF0 A;  3DVM A;  2IS9 A;  1UHK A;  1RJV A;  1YX8 A;  3CZ0 A;  1K95 A;  2Q4U A;  1IKU A;  3I5I B;  2LVV A;  1UHN A;  2MJW B; 
#chains in the Genus database with same CATH homology
 5JOL A;  3VRN A;  1F4O A;  4U8D A;  4GFT A;  4OVN F;  3KEV A;  1NPQ A;  2M3W A;  4A4B A;  1RFJ A;  2O60 A;  1PVB A;  1KK8 C;  3BUN B;  1SW8 A;  1TNX A;  4OKH A;  4A4C A;  1U5I A;  2ZNE A;  3EKJ A;  3LK0 A;  1KCY A;  2JPT A;  1IWQ A;  3CTN A;  5JJG A;  5K89 A;  3WNX B;  4FQO A;  3D0Y A;  1XK4 A;  2LE9 B;  2HQ8 A;  1YTZ C;  2G9B A;  4PE4 A;  3O2P A;  1IQ3 A;  2Y1N A;  4I5L B;  1TCO B;  5I2Q A;  1BMO A;  4QJ3 B;  1BG1 A;  1ZUZ A;  1MUX A;  3I5H C;  3MSE B;  3D10 A;  4HRG A;  4WQ3 A;  5HYD A;  1BR1 B;  5PAL A;  2L4H A;  3TDZ A;  4DRW A;  1S6J A;  2LLS A;  3JTD C;  2M97 A;  5CSJ A;  1SL9 A;  1A03 A;  2LMV A;  2Q91 A;  3OHM B;  1RWY A;  1AJ5 A;  2KFH A;  1LA3 A;  1OMV A;  4GUK A;  1XA5 A;  1YUU A;  1OMD A;  4N1G A;  4Q04 A;  1M46 A;  5KU1 A;  3E3R A;  2LNK A;  2LUX A;  3AAK A;  4XJK A;  1ZAC A;  2I18 A;  1TIZ A;  1UP5 A;  1KWO B;  4P5O E;  2BL0 B;  1C7V A;  2I7A A;  1KQV A;  2L4I A;  3TDI A;  4WRI A;  3BYA A;  1QXP A;  2OPO A;  1W7J B;  1L2O B;  2JNX A;  2SCP A;  1J1E A;  1TN4 A;  3NSL A;  1MHO A;  1IH0 A;  1JBA A;  2M8U A;  2LM5 A;  2LVI A;  1REC A;  2E6W A;  1WRL A;  2MAZ A;  2LV7 A;  3SG3 A;  5G08 A;  1K94 A;  1SBJ A;  1M39 A;  1ZOT B;  1SK6 D;  1TNP A;  1EG3 A;  3TS5 B;  1F55 A;  4OR9 B;  2BBN A;  4YGE B;  3OX5 A;  3ICB A;  3M0W A;  2PMY A;  2PRU A;  2WOS A;  3CS1 A;  5DKQ A;  4QJ5 B;  1CM4 A;  3OP0 A;  4USL A;  2HF5 A;  3TZ1 A;  1M31 A;  1NX0 A;  2CBL A;  4PHJ A;  1QLS A;  3VRQ A;  3BXK A;  2WCE A;  1AVS A;  2LLT A;  3PLF B;  1FI6 A;  3DD4 A;  1IJ5 A;  2SAS A;  4YBH B;  2JU0 A;  4AQJ A;  2KAX A;  1RRO A;  4XYN A;  1SPY A;  1TNQ A;  1CLM A;  2CT9 A;  3EK8 A;  4ORC B;  2KSP A;  1DJI A;  5F6T A;  1CMF A;  1B1G A;  1J7Q A;  1NX3 A;  3ZWH A;  1WDC B;  2H61 C;  3EVV A;  5ER4 X;  1HT9 A;  2MBX A;  1K9U A;  3JVT B;  4QJ4 B;  3A4U B;  4MRX A;  3EK4 A;  1JFJ A;  3DF0 B;  2KQ6 A;  1KFU S;  4JQ0 D;  1LKJ A;  5CPV A;  1BOD A;  1S5G Z;  2AUC A;  2COL B;  2JT0 A;  2NXQ A;  1PK0 D;  2KNE A;  3BQ3 A;  1YUT A;  4N5X A;  1L7Z A;  4YGC B;  5AFP A;  1QJT A;  5IBW A;  1DGV A;  1QLK A;  1ALV A;  5HKZ A;  1N2D A;  4MEW A;  3RM1 A;  1Y0V H;  4PHM A;  1F54 A;  1IRJ A;  1NX1 A;  2ISD A;  2AAO A;  3VRP A;  1B4C A;  1KK7 Z;  2ZRS A;  1H8B A;  2Y4Q A;  2L98 A;  4PE7 A;  1U5I B;  5CSF A;  2KGB C;  2JNF A;  3VGO A;  4NQG A;  1PSB A;  4CFR A;  2JZI A;  4PE1 A;  1KWO C;  2BL0 C;  2LUC A;  4ORA B;  3D0Y B;  1SL7 A;  3WHT B;  1KFU L;  1A4P A;  2M9G A;  2FCD A;  1L2O C;  2KYF A;  1YVH A;  3TUY C;  3GOF A;  1CMG A;  1SR6 B;  2VRG A;  1CLL A;  2NZ0 A;  1CDL A;  1K9P A;  1DTL A;  1YUS A;  2KBI A;  2KAY A;  1K93 D;  1V1F A;  2BBM A;  3FIA A;  4YI8 A;  2L0P A;  1S1E A;  1WY9 A;  2HET A;  1XFU O;  3GK4 X;  1R6P A;  3SG5 A;  1J7R A;  3TS5 C;  2M1K B;  1BR4 B;  1WRZ A;  2K2A A;  2MA2 A;  1K9K A;  2F2O A;  2JTZ A;  5DKN A;  2KI6 D;  1HQV A;  1GJY A;  4TNC A;  1BU3 A;  3GK1 A;  4C0J A;  1N65 A;  1DVI A;  4XJK B;  1FBV A;  4I5J A;  4NDC A;  1KQM B;  1B47 A;  1NCX A;  1SCV A;  2CTN A;  3DVE A;  1WLZ A;  1BF5 A;  4HRE E;  3AKB A;  1J7P A;  1OSA A;  1S5G Y;  1V1G A;  1W7I B;  3SG7 A;  3KPX A;  1R2U A;  3K21 A;  1WDC C;  1OMR A;  3KO0 A;  3KHE A;  3JVT C;  1N0Y A;  1J7O A;  2OTG B;  3LCP C;  2JTT A;  1ZMZ A;  1JFK A;  4GGF A;  5CSN A;  1EXR A;  1NIW A;  1RK9 A;  2BEC A;  5AAN A;  3PN7 B;  3HCM A;  3O6B A;  4BY4 A;  1YUR A;  4MBE A;  1KK7 Y;  5I2O A;  2V53 A;  4L9M A;  3GK2 A;  1CLB A;  1SCM B;  1TTX A;  1YVL A;  1LIN A;  1XFY O;  1SRA A;  1XFX O;  5AEQ A;  2LAP A;  2CNP A;  1YRT B;  1EG4 A;  1PSR A;  3TUY B;  5BPJ A;  1K96 A;  4I5N B;  1Y1A A;  2CXJ A;  1UUR A;  2JC2 A;  1DJG A;  4OCI A;  4DIR A;  1JF2 A;  2FJU B;  4MZJ A;  1A75 B;  2WOR A;  3AKA A;  1Y6W A;  2PSR A;  1DJZ A;  3DVK A;  3EVU A;  2KFG A;  2WCF A;  1C07 A;  1JF0 A;  1XVJ A;  1QAT A;  4M2O A;  1FI5 A;  2G2B A;  1EJ3 A;  1TCF A;  2L51 A;  3WHU B;  1CDP A;  1QX2 A;  1XK4 C;  1KFX S;  1Y1U A;  2WND A;  1GGZ A;  2FCE A;  4PDZ A;  4DUQ A;  3BOW B;  3NXA A;  1K2H A;  1SR6 C;  1XFW O;  4ETO A;  1PRW A;  1XO5 A;  2JQ6 A;  1C7W A;  3C1V A;  1AUI B;  3BUM B;  2D8N A;  5J3X A;  1IGV A;  1B9A A;  2AMI A;  1MF8 B;  2LC5 A;  2HQW A;  2M29 A;  2KBM A;  2WC8 A;  1AP4 A;  1BJF A;  2LHL A;  3CR4 X;  1UWO A;  2K7D A;  2RGI A;  2ZN9 A;  2R2I A;  2PAS A;  3CR5 X;  2LLU A;  4MLW A;  3EKH A;  4OV2 A;  1CTR A;  5I8N A;  1S26 D;  2LP2 A;  1PUL A;  2ZKM X;  4YGD B;  4N1F A;  5KSZ A;  4AQI A;  4WQ2 A;  1DMO A;  1S6I A;  1DF0 B;  3CZT X;  2KQY A;  2M7N A;  1TRF A;  4F0Z B;  2JT8 A;  2PVB A;  1KFX L;  1SMG A;  3SIA A;  4C0K A;  1X02 A;  2LCP A;  1UUS A;  3QRX A;  2NCO A;  2KOT A;  1KQM C;  2O5G A;  5AXI A;  2MLF C;  3RLZ A;  4BY5 A;  2L2E A;  3AAJ A;  3HX4 A;  5D69 A;  1QV0 A;  3SG4 A;  1CDN A;  1MQ1 A;  1KSO A;  2LMT A;  1VRK A;  3I5F B;  2OS8 B;  1PAL A;  1UHJ A;  2OTG C;  1MWN A;  4AOM A;  1JUO A;  4DCK A;  2LVJ A;  2JOJ A;  1GQM A;  3CR2 A;  3PN7 C;  3SIB A;  2TN4 A;  1TOP A;  1SYM A;  1FPW A;  1JC2 A;  1UHH A;  1CNP A;  4CLN A;  4FTG A;  2BE6 A;  3DVJ A;  1OZO A;  1SCM C;  3NSK A;  5FYX A;  2JWW A;  3NSI A;  4YGB B;  4ORB B;  2E30 A;  2K2F A;  2FOT A;  4YRU A;  2EGD A;  1B8L A;  1NSH A;  1IJ6 A;  2M49 B;  1FW4 A;  2EC6 B;  2GGZ A;  5KTY A;  1FF1 A;  2KHN A;  2KI6 C;  2H2K A;  2QAC A;  1IG5 A;  1QS7 A;  3OB1 B;  1EH2 A;  1NYA A;  1XYD A;  1D1O A;  3H4S E;  4C0L A;  5HKW A;  2KFF A;  1OE9 B;  4M2P A;  4IL1 A;  1S6C A;  4PHN A;  2JXC A;  2GV5 A;  4GGN A;  3IQO A;  1QX7 A;  1LA0 A;  2KAV A;  1F71 A;  2F8P A;  1B7T Z;  1EL4 A;  2NCP A;  5GQQ C;  5AER A;  3CWG A;  1ALW A;  2JRF A;  3F45 A;  2KDH A;  3TDU A;  4GNK B;  3PAL A;  2F3Y A;  3IQQ A;  1CM1 A;  1IQ5 A;  5HLO A;  2L5X B;  2P6B B;  5ER5 A;  1JWD A;  2QPT A;  1QVI Y;  1QTX A;  2BKH B;  3PAT A;  1NP8 A;  2ZRT A;  2KI4 B;  1JSA A;  1DJY A;  1B8R A;  1AJ4 A;  1SY9 A;  4DS7 A;  2ZND A;  2LMU A;  1MXL C;  3O4Y A;  1M45 A;  2M7L A;  2ZN8 A;  2BCA A;  5B8I B;  1PVA A;  1J55 A;  2Y1M A;  1WRK A;  2A4J A;  2BE4 A;  4I5K A;  3I5G B;  2BCX A;  1ODB A;  4P2Y B;  1AHR A;  5D7F A;  1NUB A;  3I5F C;  1BT6 A;  2JXL A;  2OS8 C;  2K7O A;  4JPZ B;  2F33 A;  1QX5 B;  1QV1 A;  4ICB A;  1AK8 A;  1UHI A;  4ZCV A;  2MRD A;  2Y5I A;  3LK1 A;  5DKR A;  1CB1 A;  2K61 A;  1NX2 A;  2K7B A;  3O78 A;  2I2R E;  2H61 A;  4PCW A;  3BUW B;  4MRY A;  4PE0 A;  1WLM A;  1A29 A;  1XFZ O;  1LXF C;  4PAL A;  1BLQ A;  3NSO A;  1YX7 A;  2HPS A;  2F3Z A;  1YR5 A;  3EK7 A;  2BKI B;  1G33 A;  1S3P A;  2M1U A;  4E68 A;  1MXE A;  1BOC A;  2EC6 C;  3LLE A;  1OZS A;  4HSZ A;  3LL8 B;  4CID A;  3CGA A;  1B7T Y;  1QIV A;  1RTP 1;  2MHH A;  3ZNI A;  1K90 D;  2EHB A;  2L50 A;  5I2L A;  4D1E A;  1KK8 B;  4GPL B;  1G8I A;  2CCM A;  3VRO A;  1KSM A;  3PSR A;  1G4Y R;  3OX6 A;  3SG6 A;  1NWD A;  4MZK A;  2DOQ A;  2MLE C;  1SNL A;  2F2P A;  3I5I C;  4ZCU A;  4MZL A;  4GGF C;  4YGA A;  3BUO B;  1SKT A;  2K8M B;  2JT3 A;  1Y1X A;  2M0R A;  1XFV O;  3KF9 A;  3FS7 A;  4CPV A;  3CLN A;  1TNW A;  2KGR A;  1QAS A;  5HLV A;  4MVF A;  5CSI A;  4UPG A;  1CKK A;  1QVI Z;  3BUX B;  2K0J A;  5HKY A;  2LHI A;  1YRU B;  3PM8 A;  2BCB A;  1A75 A;  1CFP A;  1H4B A;  1CFF A;  1F4Q A;  3I5H B;  1DJW A;  1DJX A;  1NCZ A;  1OQP A;  1DGU A;  2LVK A;  2KI4 C;  4R1E A;  2I94 A;  4HRH A;  1MR8 A;  4NDB A;  2ZFD A;  3EVR A;  3JTD B;  4MN0 A;  4JWQ A;  4NDD A;  1B8C A;  3FWB A;  2NLN A;  3OB2 B;  1LVC D;  1OOJ A;  1NCY A;  3BOW A;  4GBA A;  4CFQ A;  1GGW A;  4M2Q A;  2JUL A;  2B1U A;  2GGM A;  2PAL A;  1F70 A;  3FWC A;  4MSP A;  1CDM A;  1DJH A;  3I5G C;  5TNC A;  4PHK A;  3WXA A;  1K8U A;  1QIW A;  3IF7 A;  4GAO A;  3A8R A;  2KYC A;  4YI9 A;  1CFD A;  3PFV A;  1F8H A;  3VRR A;  2WCB A;  1J1D A;  1Q80 A;  2LP3 A;  2LAN A;  1SL8 A;  1A2X A;  2K7C A;  3SG2 A;  1M63 B;  1S36 A;  1DF0 A;  1DT7 B;  1ZFS A;  3SJS A;  1CFC A;  1E8A A;  3DF0 A;  3DVM A;  2IS9 A;  1UHK A;  1RJV A;  1YX8 A;  1K95 A;  2Q4U A;  1IKU A;  3I5I B;  2LVV A;  1UHN A;  2MJW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...