1PSRA

Human psoriasin (s100a7)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
100
structure length
100
Chain Sequence
b'SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSORIASIN
publication title EF-hands at atomic resolution: the structure of human psoriasin (S100A7) solved by MAD phasing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ef-hand protein
total genus 36
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1psrA00
1YTZC 4MZLA 4CLNA 2O5GA 3RLZA 2BL0B 3ZWHA 1S36A 1F4OA 1CDNA 1XFVO 1NIWA 1Y0VH 2EC6C 3NXAA 1OE9B 1IKUA 1SNLA 1SYMA 2CBLA 4XJKB 5I2OA 1KWOC 2M29A 5I2LA 1K94A 4GFTA 5K89A 4NDDA 5KTYA 1JSAA 2PMYA 3CWGA 1FBVA 1AP4A 3EVVA 1CM4A 4DCKA 2EHBA 1Q80A 4P2YB 4ZCUA 1A75A 1L7ZA 1S6IA 1EG4A 2LMUA 1SR6C 1ZFSA 1PVAA 5HLOA 3DF0B 3I5FC 1DJWA 4M2OA 1B47A 1M63B 1XFWO 2M0RA 2H61A 2HETA 1BJFA 2PRUA 1BF5A 2JWWA 1U5IB 3SG2A 1KFUL 1WLZA 2KHNA 2L98A 2KNEA 1WY9A 1EH2A 5D69A 5HKYA 3FWBA 2L4HA 5DKQA 4Q04A 2ZKMX 1W7JB 2K2FA 1NCZA 1SL8A 1MR8A 2HQ8A 1YVHA 3GOFA 2F3ZA 3VRRA 2JULA 3EVUA 2AUCA 3SIBA 2AAOA 2JNXA 3AKAA 3SIAA 5J3XA 3SG7A 2K7DA 2BE4A 2AMIA 1DVIA 1YX8A 3LLEA 1TCOB 1L2OC 3FIAA 4PHKA 1CFFA 1DTLA 2Q91A 2Y4QA 1QIWA 2NCPA 2PVBA 4A4CA 5B8IB 2L51A 1BOCA 2Y1MA 1IJ5A 2M7NA 1IQ5A 2JXCA 4U8DA 1BG1A 1DMOA 1S5GZ 1B8RA 3OX6A 2O60A 4MVFA 2LMVA 3TS5B 5CSJA 1PALA 1CMFA 1TOPA 1BLQA 4NQGA 1YX7A 1AVSA 1IWQA 1K90D 2BECA 3O4YA 2BL0C 4ETOA 1B7TZ 3IF7A 4L9MA 5G08A 3PN7C 5AFPA 4WQ3A 4CFQA 3F45A 4ICBA 1DJXA 1DF0B 2JXLA 2KFHA 2JT3A 2KOTA 2Y1NA 1EG3A 4PE0A 4ZCVA 2MBXA 2CCMA 4YBHB 2KYCA 2MHHA 1DJYA 1DGUA 2BCAA 3E3RA 1PSBA 3CR4X 1K8UA 2NLNA 1UUSA 3D0YB 4PE7A 4QJ5B 1K2HA 1PULA 2F33A 1BR1B 1YVLA 3QRXA 5I2QA 2COLB 4GPLB 2LUCA 5D7FA 1KFXL 1QX5B 1SY9A 3CLNA 2QACA 1CLLA 3GK1A 4GGFA 3BUWB 4MZJA 1XO5A 4TNCA 1DJGA 1HQVA 1NWDA 1Y1UA 4AQJA 3PALA 1W7IB 4PHMA 1GJYA 2FCDA 3BQ3A 4XYNA 1R2UA 3JVTB 1MXLC 1NCXA 1NX2A 3CGAA 2LVKA 2Y5IA 4MRYA 2A4JA 2BE6A 2NCOA 1M39A 3K21A 5AANA 1LA0A 2ZN9A 2P6BB 1AK8A 2BCBA 1XFZO 1FF1A 4GNKB 1GGWA 3KHEA 3SG5A 1NUBA 2KBMA 2KAXA 2LP2A 2MA2A 4YI9A 2KBIA 1K95A 1LA3A 1JUOA 1TIZA 1YR5A 1NPQA 1PSRA 1G33A 2K0JA 5BPJA 1F55A 1WRZA 4GBAA 1AJ5A 2I94A 3CTNA 1UHNA 3BOWB 3BUMB 2F2OA 2JOJA 5CSFA 1N65A 1SPYA 3EK7A 4MRXA 1JWDA 1K9PA 1CDLA 1UHKA 1CFPA 2WCFA 4F0ZB 3RM1A 1SCMB 5JJGA 4HRHA 1YUSA 3LK0A 2KI4B 3GK2A 3PN7B 3TS5C 5KU1A 2WC8A 1S6JA 2FCEA 4C0LA 2L50A 1QLKA 1MF8B 1QLSA 1YUTA 2I2RE 3HCMA 1IQ3A 3TDUA 4WQ2A 2DOQA 2JTTA 1XK4C 1OMVA 1BODA 1QX7A 1ALVA 3TDIA 4GUKA 2LHIA 1MUXA 2BKHB 3CR5X 1HT9A 2L4IA 1C7WA 2KFGA 1B8LA 3NSLA 2KAVA 2KAYA 1DJZA 3AAKA 3JTDB 1TN4A 1KQMB 1CB1A 1E8AA 2JT8A 4ORCB 1RECA 3TUYB 1SK6D 5I8NA 3DF0A 1A03A 1CNPA 1JC2A 2JPTA 1N2DA 2E30A 4UPGA 2MLEC 2KQ6A 3BYAA 2K2AA 2KI6C 3IQQA 2LVIA 1NX3A 3AAJA 3BUNB 4OR9B 2OTGB 1BU3A 1NYAA 1WDCB 5F6TA 3LCPC 4ORAB 4YGAA 1A75B 3DVJA 1KFUS 4I5LB 2GGMA 1NCYA 1LINA 1FI6A 4YGCB 2M97A 1V1FA 3JVTC 1OSAA 1F54A 1GGZA 1B1GA 1FI5A 3NSKA 1F70A 4N1GA 1KK8B 2LLTA 5CPVA 4MSPA 4WRIA 4IL1A 1MHOA 4PE4A 1J55A 1F8HA 1G8IA 2LVVA 2FOTA 1EL4A 5DKRA 4OV2A 4CFRA 3EKHA 3KEVA 1QV0A 4AQIA 4NDCA 2MJWB 4JWQA 3I5HB 4USLA 3WHTB 5KSZA 1RK9A 2MAZA 5DKNA 5AEQA 4OCIA 4YGEB 1TNQA 2L2EA 5GQQC 2SASA 1J7RA 1K9UA 1UHIA 3TDZA 4I5NB 1SCMC 1G4YR 2KI4C 4DRWA 2JZIA 3I5IB 3GK4X 1IJ6A 2JU0A 3PATA 2KYFA 1A2XA 5CSNA 3DVEA 3CS1A 1IGVA 2WCBA 1XFXO 2G2BA 3LK1A 4HSZA 4I5JA 1CKKA 1YUUA 2E6WA 1QS7A 1V1GA 1S26D 1N0YA 2LM5A 3SJSA 3PM8A 3VRNA 1QXPA 4N1FA 3WXAA 4BY5A 3JTDC 2ZN8A 3WNXB 1SL7A 1KQVA 1TNWA 1RROA 1KQMC 2EGDA 3TUYC 2MLFC 2CT9A 2K7BA 3FS7A 1WRKA 1WLMA 2F2PA 4QJ4B 1S1EA 1CFCA 1FPWA 1S3PA 2BBMA 2LAPA 1FW4A 3H4SE 2ZNEA 2OTGC 1WDCC 1UHJA 1TRFA 1B9AA 2K8MB 1B4CA 3VGOA 5CSIA 3SG4A 3ZNIA 1QVIY 1J7OA 1GQMA 1B8CA 1KCYA 2BCXA 2NXQA 3CZTX 2H61C 1ODBA 4JQ0D 4C0JA 2LLUA 2B1UA 3O78A 3TZ1A 1KK8C 1ZMZA 1DJHA 1LKJA 3BUXB 3VROA 1OZSA 1H4BA 3M0WA 1NP8A 1Y6WA 4PHNA 1CFDA 1ZOTB 3I5HC 2R2IA 2LUXA 2ZRSA 5TNCA 4MEWA 2QPTA 2LE9B 1M31A 4AOMA 2KGRA 2PSRA 3EK4A 4ORBB 2Q4UA 1DT7B 1MWNA 2CXJA 2LV7A 3OP0A 4XJKA 1CTRA 5HKZA 1D1OA 4QJ3B 2JTZA 3EK8A 1Y1AA 1MXEA 1OQPA 3I5IC 5AXIA 1SMGA 1RFJA 4DUQA 1NX1A 2L0PA 1EJ3A 2G9BA 3EVRA 4P5OE 1UHHA 1PVBA 3DD4A 2LC5A 4HREE 1QX2A 1CMGA 2WOSA 1TCFA 1LVCD 1LXFC 3OX5A 1Y1XA 2BBNA 3A4UB 1ALWA 3NSIA 1VRKA 2BKIB 1OOJA 3WHUB 3LL8B 4E68A 2KFFA 4DS7A 1J7QA 1IG5A 4OKHA 4M2PA 3DVKA 1U5IA 1X02A 3A8RA 1EXRA 1OZOA 2KQYA 1ZACA 4MLWA 2M7LA 4YGDB 2TN4A 2GGZA 4CIDA 1NSHA 4OVNF 1SL9A 1A4PA 2PALA 4FTGA 1M46A 5HKWA 3OHMB 5FYXA 5HYDA 1DGVA 1MQ1A 3VRPA 2L5XB 1ZUZA 1QATA 5PALA 2H2KA 1OMDA 3FWCA 4A4BA 5AERA 1XFYO 2F8PA 2NZ0A 2WCEA 4HRGA 1AJ4A 1TTXA 2LANA 1JF2A 1KSOA 3OB1B 2LHLA 2ZNDA 2JQ6A 4PALA 1JF0A 4GGFC 2M1KB 1IRJA 2I18A 2KI6D 1AUIB 1XA5A 2K7OA 1SBJA 2M49B 4I5KA 2PASA 3DVMA 4JPZB 4MN0A 1IH0A 1QJTA 2LLSA 1SKTA 1OMRA 4R1EA 1CDPA 4D1EA 1M45A 4GAOA 3SG3A 2JNFA 3MSEB 1R6PA 1NX0A 2IS9A 1QASA 3AKBA 5IBWA 3BXKA 2GV5A 1J1DA 2V53A 1J7PA 1CM1A 5ER5A 2ISDA 4C0KA 1XK4A 2CTNA 2OS8B 3I5GB 1CLBA 1AHRA 2K61A 1QV1A 2OPOA 3IQOA 1JFJA 1DF0A 3PSRA 1TNPA 1PRWA 1SRAA 3D10A 2CNPA 3PFVA 3ICBA 4YGBB 1A29A 2M8UA 2WNDA 1C7VA 3HX4A 2EC6B 2HF5A 2D8NA 1J1EA 5JOLA 1KSMA 1QVIZ 2LVJA 4PHJA 3D0YA 3O2PA 1KWOB 1CLMA 1XFUO 4MZKA 4DIRA 5HLVA 1SCVA 3KF9A 1TNXA 3NSOA 1XYDA 4YRUA 1K93D 2HQWA 2HPSA 2I7AA 1DJIA 1KFXS 1KK7Z 1RJVA 4PCWA 1SR6B 3CR2A 1UP5A 2LMTA 1RTP1 1S5GY 3I5FB 1WRLA 3KPXA 1RWYA 5ER4X 3PLFB 2VRGA 3C1VA 2M3WA 2KGBC 2LCPA 1BMOA 1YURA 1CDMA 1YRUB 2WORA 1C07A 2M9GA 2JC2A 1B7TY 4M2QA 1SW8A 2LNKA 1UWOA 1JBAA 1YRTB 2K7CA 2MRDA 2JRFA 4FQOA 2KSPA 3VRQA 1H8BA 2ZFDA 1KK7Y 1F71A 1BR4B 3BOWA 2M1UA 2F3YA 4NDBA 1XVJA 2RGIA 3BUOB 1K9KA 2LP3A 1QIVA 1S6CA 1UURA 1PK0D 3O6BA 1L2OB 1QTXA 3OB2B 4N5XA 2ZRTA 4PE1A 4MBEA 3EKJA 1BT6A 4BY4A 1JFKA 2JT0A 4YI8A 4CPVA 2KDHA 1F4QA 4PDZA 3SG6A 2OS8C 3I5GC 4GGNA 2FJUB 1K96A 2SCPA 3KO0A
chains in the Genus database with same CATH superfamily
1YTZC 4MZLA 4CLNA 2O5GA 3RLZA 2BL0B 3D76A 3ZWHA 1S36A 1F4OA 1CDNA 1XFVO 3FE8A 1NIWA 1Y0VH 1CB1A 2EC6C 3NXAA 1OE9B 1IKUA 1Z4HA 1SNLA 1SYMA 1TWOA 2CBLA 4XJKB 5I2OA 1KWOC 3D74A 2M29A 5I2LA 1K94A 4GFTA 5K89A 3DZTA 4NDDA 5KTYA 1JSAA 2PMYA 3CWGA 1DQEA 1FBVA 1AP4A 3EVVA 1CM4A 4DCKA 2EHBA 1Q80A 4P2YB 4ZCUA 1A75A 1L7ZA 1S6IA 1EG4A 2LMUA 1SR6C 1ZFSA 1PVAA 5HLOA 3DF0B 3I5FC 1DJWA 4M2OA 1B47A 1M63B 1XFWO 2KLDA 2M0RA 2H61A 2HETA 1BJFA 2PRUA 3S0EA 1BF5A 2JWWA 1U5IB 3SG2A 1KFUL 1WLZA 2KHNA 2L98A 2KNEA 1WY9A 1EH2A 5D69A 5HKYA 3FWBA 2L4HA 3RZSA 5DKQA 4Q04A 2ZKMX 1W7JB 2K2FA 1NCZA 1SL8A 1MR8A 2HQ8A 3B7AA 1YVHA 3GOFA 2F3ZA 3VRRA 2JULA 3EVUA 2AUCA 2WC5A 3SIBA 2AAOA 2JNXA 3AKAA 3SIAA 2GTEA 5J3XA 3B88A 3SG7A 2K7DA 2BE4A 1W9ZA 2AMIA 1DVIA 1YX8A 3LLEA 1TCOB 1L2OC 3FIAA 4PHKA 1CFFA 1DTLA 2Q91A 2Y4QA 1QIWA 2NCPA 2PVBA 4A4CA 5B8IB 2L51A 1BOCA 2Y1MA 1CNPA 1IJ5A 2M7NA 1IQ5A 2JXCA 4U8DA 1BG1A 1DMOA 1S5GZ 1B8RA 3OX6A 3S0FA 2O60A 4MVFA 2LMVA 3TS5B 5CSJA 1PALA 1CMFA 1TOPA 1BLQA 2WCKA 4NQGA 1YX7A 1AVSA 1IWQA 1K90D 2BECA 3O4YA 3QMEA 2BL0C 2QEBA 3S0GA 4ETOA 1B7TZ 3IF7A 4L9MA 5G08A 3PN7C 3D73A 5AFPA 4WQ3A 3CZ0A 4CFQA 3F45A 4ICBA 1DJXA 1DF0B 2JXLA 2KFHA 2JT3A 2KOTA 2Y1NA 1EG3A 4PE0A 4ZCVA 2MBXA 2CCMA 4YBHB 3S0BA 2KYCA 2MHHA 1C3YA 1DJYA 3NHTA 1OOHA 1DGUA 2BCAA 5EL2A 3E3RA 1PSBA 1Z2CB 3CR4X 1K8UA 1OOIX 3OGNA 2NLNA 1UUSA 3D0YB 4PE7A 4QJ5B 1K2HA 1PULA 3DY9A 2F33A 1BR1B 1YVLA 3QRXA 5I2QA 2COLB 4GPLB 3D77A 2LUCA 5D7FA 1KFXL 1QX5B 1SY9A 3CLNA 3FE6A 3OBVA 2QACA 3CYZA 1CLLA 2QEOA 3GK1A 4GGFA 3BUWB 3O4XA 3BFBA 4MZJA 1XO5A 4TNCA 1DJGA 1HQVA 3S0AA 1NWDA 1Y1UA 4AQJA 3PALA 1W7IB 4PHMA 1GJYA 2FCDA 3BQ3A 4XYNA 1R2UA 2WC6A 3JVTB 1MXLC 1NCXA 1NX2A 3CGAA 2LVKA 3BJHA 2Y5IA 4MRYA 2A4JA 2BE6A 2NCOA 1M39A 3K21A 5AANA 1LA0A 2ZN9A 2P6BB 1AK8A 2BCBA 1XFZO 3B86A 4GNKB 1FF1A 3KHEA 3SG5A 1NUBA 1GGWA 2KBMA 2KAXA 2LP2A 2MA2A 4YI9A 2KBIA 1K95A 1LA3A 1JUOA 1TIZA 1YR5A 1NPQA 1PSRA 1G33A 2K0JA 5BPJA 1F55A 5FI6A 1WRZA 4GBAA 1AJ5A 2I94A 3CTNA 5DICA 1UHNA 3BOWB 3BUMB 2F2OA 2JOJA 3IVTA 5CSFA 1N65A 1SPYA 3EK7A 4MRXA 1JWDA 1K9PA 1CDLA 1UHKA 1CFPA 2WCFA 4F0ZB 3RM1A 1SCMB 5JJGA 2BAPA 4HRHA 1YUSA 3LK0A 2KI4B 3GK2A 3PN7B 3TS5C 3VB1A 5KU1A 1OW4A 2WC8A 1LS8A 1S6JA 2FCEA 4C0LA 2L50A 1QLKA 1MF8B 1QLSA 1YUTA 2I2RE 3HCMA 1IQ3A 3TDUA 4WQ2A 2DOQA 2JTTA 1XK4C 1TUJA 1OMVA 1BODA 1QX7A 1ALVA 3TDIA 4GUKA 2LHIA 1MUXA 2BKHB 3CR5X 1HT9A 2L4IA 1C7WA 2KFGA 1B8LA 3NSLA 2KAVA 3Q8IA 2KAYA 3B6XA 2P70A 1DJZA 3AAKA 3JTDB 1TN4A 1KQMB 3K1EA 1E8AA 2JT8A 4ORCB 1RECA 3TUYB 1SK6D 5I8NA 3DF0A 1A03A 1DELA 1JC2A 2JPTA 1N2DA 2E30A 4UPGA 2MLEC 2KQ6A 3BYAA 2K2AA 2KI6C 3IQQA 2LVIA 1NX3A 3AAJA 3BUNB 4OR9B 2OTGB 1BU3A 1NYAA 1WDCB 5F6TA 5FI7A 3LCPC 4ORAB 4YGAA 1A75B 3DVJA 1KFUS 3CZ2A 4I5LB 2GGMA 1NCYA 1LINA 4INXA 1FI6A 4YGCB 2M97A 1V1FA 3JVTC 1XFRA 1OSAA 3NHIA 1F54A 2PYQA 1GGZA 1SSEB 3BFAA 1B1GA 1IIOA 1FI5A 3NSKA 1F70A 2WCLA 4N1GA 1KK8B 2LLTA 5CPVA 1QWVA 4MSPA 4WRIA 4IL1A 1MHOA 4PE4A 1OOFA 1J55A 3V2LA 1F8HA 1G8IA 2LVVA 2FOTA 1EL4A 5DKRA 4OV2A 4CFRA 3EKHA 3KEVA 1QV0A 4AQIA 4NDCA 2MJWB 4JWQA 3I5HB 4USLA 3WHTB 5KSZA 1RK9A 2MAZA 5DKNA 5AEQA 4OCIA 4YGEB 1TNQA 2L2EA 3N7HA 5GQQC 2SASA 1J7RA 1K9UA 1UHIA 2WCHA 4I5NB 3TDZA 1SCMC 1G4YR 2KI4C 4DRWA 2JZIA 3I5IB 3GK4X 1IJ6A 2JU0A 2KPHA 2KYFA 3PATA 1A2XA 5CSNA 3DVEA 3CS1A 1IGVA 2WCBA 3UO9A 1XFXO 2G2BA 3LK1A 4HSZA 4I5JA 3PM2A 1CKKA 1YUUA 1OOGA 2E6WA 1QS7A 2L5YA 1V1GA 4JD9A 1S26D 1N0YA 2LM5A 3R1PA 3SJSA 3PM8A 3VRNA 1QXPA 4N1FA 3WXAA 3BFHA 4BY5A 3JTDC 2ZN8A 3WNXB 1SL7A 1KQVA 1TNWA 1RROA 1KQMC 2EGDA 3TUYC 2MLFC 2CT9A 2K7BA 3FS7A 4JKTA 3D78A 1WRKA 1WLMA 2F2PA 4QJ4B 1S1EA 1CFCA 1FPWA 2QDIA 1S3PA 2BBMA 2LAPA 1FW4A 3H4SE 2ZNEA 2OTGC 1GM0A 1WDCC 1UHJA 1TRFA 1B9AA 2K8MB 1B4CA 3VGOA 5CSIA 3D75A 3EG5B 3SS5A 3SG4A 3ZNIA 1QVIY 1J7OA 1GQMA 1B8CA 1KCYA 2BCXA 2NXQA 3CZTX 2H61C 3PJIA 1ODBA 4JQ0D 2JPOA 4C0JA 3DYEA 2LLUA 2B1UA 1ORGA 3O78A 3TZ1A 1KK8C 1ZMZA 4PT1A 1DJHA 1LKJA 3BUXB 3VROA 1OZSA 1H4BA 5HL1A 3M0WA 1NP8A 1Y6WA 4PHNA 1CFDA 1ZOTB 3I5HC 2R2IA 2LUXA 2ZRSA 5TNCA 4MEWA 2QPTA 2L2CA 2LE9B 1M31A 2QEHA 2KGRA 2PSRA 4AOMA 3EK4A 4ORBB 2Q4UA 1DT7B 1MWNA 2CXJA 2LV7A 3OP0A 4XJKA 1CTRA 5HKZA 1D1OA 4QJ3B 2JTZA 3EK8A 1Y1AA 1MXEA 1OQPA 3I5IC 5AXIA 1SMGA 1RFJA 4DUQA 1NX1A 2L0PA 1EJ3A 2G9BA 3EVRA 2H8VA 3SS4A 4P5OE 1UHHA 1PVBA 3DD4A 2LC5A 4HREE 1QX2A 4F7FA 1CMGA 2WOSA 1TCFA 1LVCD 1LXFC 3OX5A 1Y1XA 2BBNA 3A4UB 1ALWA 3NSIA 1VRKA 2BKIB 1OOJA 3WHUB 2PQLA 3LL8B 4E68A 3UNWA 2KFFA 4DS7A 3S0DA 1J7QA 3L47A 1IG5A 4OKHA 4M2PA 3CABA 3DVKA 1U5IA 1X02A 3A8RA 1EXRA 1OZOA 2KQYA 1ZACA 4MLWA 2M7LA 4YGDB 2TN4A 2GGZA 4CIDA 3NGVA 1NSHA 4INWA 1SL9A 4OVNF 1A4PA 2PALA 4FTGA 5D3OA 4KYNA 1M46A 5HKWA 3OHMB 5FYXA 3R1OA 1DGVA 5HYDA 1MQ1A 3VRPA 2L5XB 1ZUZA 1QATA 5PALA 2H2KA 1OMDA 3FWCA 4A4BA 5AERA 3R72A 1XFYO 1TUZA 2F8PA 2NZ0A 2WCEA 4HRGA 1AJ4A 1TTXA 2LANA 1JF2A 1KSOA 3OB1B 2LHLA 2ZNDA 2JQ6A 4PALA 1JF0A 4GGFC 4OZDA 2M1KB 1IRJA 2I18A 2KI6D 1AUIB 1XA5A 2K7OA 1SBJA 2M49B 4I5KA 2PASA 3DVMA 4JPZB 4MN0A 1IH0A 1QJTA 2LLSA 1SKTA 1OMRA 4R1EA 1CDPA 4D1EA 1M45A 4GAOA 3SG3A 2JNFA 3MSEB 2WCMA 1R6PA 1NX0A 2IS9A 1QASA 2WCJA 3AKBA 5IBWA 3BXKA 2GV5A 1J1DA 2V53A 3B87A 1CM1A 1J7PA 5ER5A 2ISDA 4C0KA 1XK4A 2CTNA 2OS8B 3I5GB 1CLBA 1AHRA 2K61A 1QV1A 2OPOA 3IQOA 3R1VA 1JFJA 1DF0A 3PSRA 1TNPA 1PRWA 1SRAA 3D10A 2CNPA 3PFVA 3ICBA 4YGBB 1A29A 2M8UA 2WNDA 1C7VA 2QEVA 3HX4A 2EC6B 2HF5A 2D8NA 1J1EA 5JOLA 5I94A 1KSMA 1QVIZ 2LVJA 4PHJA 3D0YA 3O2PA 1KWOB 1CLMA 1XFUO 4MZKA 4DIRA 5HLVA 1SCVA 2YGUA 3KF9A 1TNXA 3NSOA 1XYDA 2FJYA 4YRUA 1K93D 2HQWA 2HPSA 2ERBA 2BNXA 2I7AA 3L4LA 1DJIA 1KFXS 1KK7Z 1RJVA 4PCWA 1SR6B 3CR2A 1UP5A 2LMTA 3FE9A 1RTP1 1S5GY 3CZ1A 4IJ7A 3I5FB 1WRLA 3KPXA 1RWYA 5ER4X 3PLFB 2VRGA 3C1VA 2M3WA 2KGBC 2LCPA 1BMOA 1YURA 1CDMA 1YRUB 2WORA 1C07A 2M9GA 2JC2A 1B7TY 4M2QA 1SW8A 2LNKA 1UWOA 1JBAA 1YRTB 2K7CA 2MRDA 2JRFA 3L4AA 2KSPA 4FQOA 3VRQA 1H8BA 3DXLA 2ZFDA 1KK7Y 5FI2A 1F71A 1BR4B 3BOWA 2M1UA 1C3ZA 2F3YA 4NDBA 1XVJA 2RGIA 3BUOB 1K9KA 2LP3A 1T14A 1DC1A 1QIVA 1S6CA 1UURA 4FQTA 1P28A 1PK0D 3O6BA 3CDNA 1L2OB 1QTXA 3OB2B 4N5XA 2ZRTA 4PE1A 4MBEA 3EKJA 1BT6A 4BY4A 1JFKA 2JT0A 2P71A 2K60A 4YI8A 3SS3A 4CPVA 2KDHA 1DEKA 2KLEA 1F4QA 4PDZA 3SG6A 2OS8C 3I5GC 4GGNA 2FJUB 1K96A 2SCPA 3KO0A
chains in the Genus database with same CATH topology
1YTZC 4MZLA 4CLNA 2O5GA 3RLZA 2BL0B 3ZWHA 1S36A 1F4OA 1CDNA 1XFVO 1NIWA 1Y0VH 2EC6C 3NXAA 1OE9B 1IKUA 1SNLA 1SYMA 2CBLA 4XJKB 5I2OA 1KWOC 2M29A 5I2LA 1K94A 4GFTA 5K89A 4NDDA 5KTYA 1JSAA 2PMYA 3CWGA 1FBVA 1AP4A 3EVVA 1CM4A 4DCKA 2EHBA 1Q80A 4P2YB 4ZCUA 1A75A 1L7ZA 1S6IA 1EG4A 2LMUA 1SR6C 1ZFSA 1PVAA 5HLOA 3DF0B 3I5FC 1DJWA 4M2OA 1B47A 1M63B 1XFWO 2M0RA 2H61A 2HETA 1BJFA 2PRUA 1BF5A 2JWWA 1U5IB 3SG2A 1KFUL 1WLZA 2KHNA 2L98A 2KNEA 1WY9A 1EH2A 5D69A 5HKYA 3FWBA 2L4HA 5DKQA 4Q04A 2ZKMX 1W7JB 2K2FA 1NCZA 1SL8A 1MR8A 2HQ8A 1YVHA 3GOFA 2F3ZA 3VRRA 2JULA 3EVUA 2AUCA 3SIBA 2AAOA 2JNXA 3AKAA 3SIAA 5J3XA 3SG7A 2K7DA 2BE4A 2AMIA 1DVIA 1YX8A 3LLEA 1TCOB 1L2OC 3FIAA 4PHKA 1CFFA 1DTLA 2Q91A 2Y4QA 1QIWA 2NCPA 2PVBA 4A4CA 5B8IB 2L51A 1BOCA 2Y1MA 1IJ5A 2M7NA 1IQ5A 2JXCA 4U8DA 1BG1A 1DMOA 1S5GZ 1B8RA 3OX6A 2O60A 4MVFA 2LMVA 3TS5B 5CSJA 1PALA 1CMFA 1TOPA 1BLQA 4NQGA 1YX7A 1AVSA 1IWQA 1K90D 2BECA 3O4YA 2BL0C 4ETOA 1B7TZ 3IF7A 4L9MA 5G08A 3PN7C 5AFPA 4WQ3A 4CFQA 3F45A 4ICBA 1DJXA 1DF0B 2JXLA 2KFHA 2JT3A 2KOTA 2Y1NA 1EG3A 4PE0A 4ZCVA 2MBXA 2CCMA 4YBHB 2KYCA 2MHHA 1DJYA 1DGUA 2BCAA 3E3RA 1PSBA 3CR4X 1K8UA 2NLNA 1UUSA 3D0YB 4PE7A 4QJ5B 1K2HA 1PULA 2F33A 1BR1B 1YVLA 3QRXA 5I2QA 2COLB 4GPLB 2LUCA 5D7FA 1KFXL 1QX5B 1SY9A 3CLNA 2QACA 1CLLA 3GK1A 4GGFA 3BUWB 4MZJA 1XO5A 4TNCA 1DJGA 1HQVA 1NWDA 1Y1UA 4AQJA 3PALA 1W7IB 4PHMA 1GJYA 2FCDA 3BQ3A 4XYNA 1R2UA 3JVTB 1MXLC 1NCXA 1NX2A 3CGAA 2LVKA 2Y5IA 4MRYA 2A4JA 2BE6A 2NCOA 1M39A 3K21A 5AANA 1LA0A 2ZN9A 2P6BB 1AK8A 2BCBA 1XFZO 1FF1A 4GNKB 1GGWA 3KHEA 3SG5A 1NUBA 2KBMA 2KAXA 2LP2A 2MA2A 4YI9A 2KBIA 1K95A 1LA3A 1JUOA 1TIZA 1YR5A 1NPQA 1PSRA 1G33A 2K0JA 5BPJA 1F55A 1WRZA 4GBAA 1AJ5A 2I94A 3CTNA 1UHNA 3BOWB 3BUMB 2F2OA 2JOJA 5CSFA 1N65A 1SPYA 3EK7A 4MRXA 1JWDA 1K9PA 1CDLA 1UHKA 1CFPA 2WCFA 4F0ZB 3RM1A 1SCMB 5JJGA 4HRHA 1YUSA 3LK0A 2KI4B 3GK2A 3PN7B 3TS5C 5KU1A 2WC8A 1S6JA 2FCEA 4C0LA 2L50A 1QLKA 1MF8B 1QLSA 1YUTA 2I2RE 3HCMA 1IQ3A 3TDUA 4WQ2A 2DOQA 2JTTA 1XK4C 1OMVA 1BODA 1QX7A 1ALVA 3TDIA 4GUKA 2LHIA 1MUXA 2BKHB 3CR5X 1HT9A 2L4IA 1C7WA 2KFGA 1B8LA 3NSLA 2KAVA 2KAYA 1DJZA 3AAKA 3JTDB 1TN4A 1KQMB 1CB1A 1E8AA 2JT8A 4ORCB 1RECA 3TUYB 1SK6D 5I8NA 3DF0A 1A03A 1CNPA 1JC2A 2JPTA 1N2DA 2E30A 4UPGA 2MLEC 2KQ6A 3BYAA 2K2AA 2KI6C 3IQQA 2LVIA 1NX3A 3AAJA 3BUNB 4OR9B 2OTGB 1BU3A 1NYAA 1WDCB 5F6TA 3LCPC 4ORAB 4YGAA 1A75B 3DVJA 1KFUS 4I5LB 2GGMA 1NCYA 1LINA 1FI6A 4YGCB 2M97A 1V1FA 3JVTC 1OSAA 1F54A 1GGZA 1B1GA 1FI5A 3NSKA 1F70A 4N1GA 1KK8B 2LLTA 5CPVA 4MSPA 4WRIA 4IL1A 1MHOA 4PE4A 1J55A 1F8HA 1G8IA 2LVVA 2FOTA 1EL4A 5DKRA 4OV2A 4CFRA 3EKHA 3KEVA 1QV0A 4AQIA 4NDCA 2MJWB 4JWQA 3I5HB 4USLA 3WHTB 5KSZA 1RK9A 2MAZA 5DKNA 5AEQA 4OCIA 4YGEB 1TNQA 2L2EA 5GQQC 2SASA 1J7RA 1K9UA 1UHIA 3TDZA 4I5NB 1SCMC 1G4YR 2KI4C 4DRWA 2JZIA 3I5IB 3GK4X 1IJ6A 2JU0A 3PATA 2KYFA 1A2XA 5CSNA 3DVEA 3CS1A 1IGVA 2WCBA 1XFXO 2G2BA 3LK1A 4HSZA 4I5JA 1CKKA 1YUUA 2E6WA 1QS7A 1V1GA 1S26D 1N0YA 2LM5A 3SJSA 3PM8A 3VRNA 1QXPA 4N1FA 3WXAA 4BY5A 3JTDC 2ZN8A 3WNXB 1SL7A 1KQVA 1TNWA 1RROA 1KQMC 2EGDA 3TUYC 2MLFC 2CT9A 2K7BA 3FS7A 1WRKA 1WLMA 2F2PA 4QJ4B 1S1EA 1CFCA 1FPWA 1S3PA 2BBMA 2LAPA 1FW4A 3H4SE 2ZNEA 2OTGC 1WDCC 1UHJA 1TRFA 1B9AA 2K8MB 1B4CA 3VGOA 5CSIA 3SG4A 3ZNIA 1QVIY 1J7OA 1GQMA 1B8CA 1KCYA 2BCXA 2NXQA 3CZTX 2H61C 1ODBA 4JQ0D 4C0JA 2LLUA 2B1UA 3O78A 3TZ1A 1KK8C 1ZMZA 1DJHA 1LKJA 3BUXB 3VROA 1OZSA 1H4BA 3M0WA 1NP8A 1Y6WA 4PHNA 1CFDA 1ZOTB 3I5HC 2R2IA 2LUXA 2ZRSA 5TNCA 4MEWA 2QPTA 2LE9B 1M31A 4AOMA 2KGRA 2PSRA 3EK4A 4ORBB 2Q4UA 1DT7B 1MWNA 2CXJA 2LV7A 3OP0A 4XJKA 1CTRA 5HKZA 1D1OA 4QJ3B 2JTZA 3EK8A 1Y1AA 1MXEA 1OQPA 3I5IC 5AXIA 1SMGA 1RFJA 4DUQA 1NX1A 2L0PA 1EJ3A 2G9BA 3EVRA 4P5OE 1UHHA 1PVBA 3DD4A 2LC5A 4HREE 1QX2A 1CMGA 2WOSA 1TCFA 1LVCD 1LXFC 3OX5A 1Y1XA 2BBNA 3A4UB 1ALWA 3NSIA 1VRKA 2BKIB 1OOJA 3WHUB 3LL8B 4E68A 2KFFA 4DS7A 1J7QA 1IG5A 4OKHA 4M2PA 3DVKA 1U5IA 1X02A 3A8RA 1EXRA 1OZOA 2KQYA 1ZACA 4MLWA 2M7LA 4YGDB 2TN4A 2GGZA 4CIDA 1NSHA 4OVNF 1SL9A 1A4PA 2PALA 4FTGA 1M46A 5HKWA 3OHMB 5FYXA 5HYDA 1DGVA 1MQ1A 3VRPA 2L5XB 1ZUZA 1QATA 5PALA 2H2KA 1OMDA 3FWCA 4A4BA 5AERA 1XFYO 2F8PA 2NZ0A 2WCEA 4HRGA 1AJ4A 1TTXA 2LANA 1JF2A 1KSOA 3OB1B 2LHLA 2ZNDA 2JQ6A 4PALA 1JF0A 4GGFC 2M1KB 1IRJA 2I18A 2KI6D 1AUIB 1XA5A 2K7OA 1SBJA 2M49B 4I5KA 2PASA 3DVMA 4JPZB 4MN0A 1IH0A 1QJTA 2LLSA 1SKTA 1OMRA 4R1EA 1CDPA 4D1EA 1M45A 4GAOA 3SG3A 2JNFA 3MSEB 1R6PA 1NX0A 2IS9A 1QASA 3AKBA 5IBWA 3BXKA 2GV5A 1J1DA 2V53A 1J7PA 1CM1A 5ER5A 2ISDA 4C0KA 1XK4A 2CTNA 2OS8B 3I5GB 1CLBA 1AHRA 2K61A 1QV1A 2OPOA 3IQOA 1JFJA 1DF0A 3PSRA 1TNPA 1PRWA 1SRAA 3D10A 2CNPA 3PFVA 3ICBA 4YGBB 1A29A 2M8UA 2WNDA 1C7VA 3HX4A 2EC6B 2HF5A 2D8NA 1J1EA 5JOLA 1KSMA 1QVIZ 2LVJA 4PHJA 3D0YA 3O2PA 1KWOB 1CLMA 1XFUO 4MZKA 4DIRA 5HLVA 1SCVA 3KF9A 1TNXA 3NSOA 1XYDA 4YRUA 1K93D 2HQWA 2HPSA 2I7AA 1DJIA 1KFXS 1KK7Z 1RJVA 4PCWA 1SR6B 3CR2A 1UP5A 2LMTA 1RTP1 1S5GY 3I5FB 1WRLA 3KPXA 1RWYA 5ER4X 3PLFB 2VRGA 3C1VA 2M3WA 2KGBC 2LCPA 1BMOA 1YURA 1CDMA 1YRUB 2WORA 1C07A 2M9GA 2JC2A 1B7TY 4M2QA 1SW8A 2LNKA 1UWOA 1JBAA 1YRTB 2K7CA 2MRDA 2JRFA 4FQOA 2KSPA 3VRQA 1H8BA 2ZFDA 1KK7Y 1F71A 1BR4B 3BOWA 2M1UA 2F3YA 4NDBA 1XVJA 2RGIA 3BUOB 1K9KA 2LP3A 1QIVA 1S6CA 1UURA 1PK0D 3O6BA 1L2OB 1QTXA 3OB2B 4N5XA 2ZRTA 4PE1A 4MBEA 3EKJA 1BT6A 4BY4A 1JFKA 2JT0A 4YI8A 4CPVA 2KDHA 1F4QA 4PDZA 3SG6A 2OS8C 3I5GC 4GGNA 2FJUB 1K96A 2SCPA 3KO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTZ C;  4MZL A;  4CLN A;  2O5G A;  3RLZ A;  2BL0 B;  3ZWH A;  1S36 A;  1F4O A;  1CDN A;  1XFV O;  1NIW A;  1Y0V H;  2EC6 C;  3NXA A;  1OE9 B;  1IKU A;  1SNL A;  1SYM A;  2CBL A;  4XJK B;  5I2O A;  1KWO C;  2M29 A;  5I2L A;  1K94 A;  4GFT A;  5K89 A;  4NDD A;  5KTY A;  1JSA A;  2PMY A;  3CWG A;  1FBV A;  1AP4 A;  3EVV A;  1CM4 A;  4DCK A;  2EHB A;  1Q80 A;  4P2Y B;  4ZCU A;  1A75 A;  1L7Z A;  1S6I A;  1EG4 A;  2LMU A;  1SR6 C;  1ZFS A;  1PVA A;  5HLO A;  3DF0 B;  3I5F C;  1DJW A;  4M2O A;  1B47 A;  1M63 B;  1XFW O;  2M0R A;  2H61 A;  2HET A;  1BJF A;  2PRU A;  1BF5 A;  2JWW A;  1U5I B;  3SG2 A;  1KFU L;  1WLZ A;  2KHN A;  2L98 A;  2KNE A;  1WY9 A;  1EH2 A;  5D69 A;  5HKY A;  3FWB A;  2L4H A;  5DKQ A;  4Q04 A;  2ZKM X;  1W7J B;  2K2F A;  1NCZ A;  1SL8 A;  1MR8 A;  2HQ8 A;  1YVH A;  3GOF A;  2F3Z A;  3VRR A;  2JUL A;  3EVU A;  2AUC A;  3SIB A;  2AAO A;  2JNX A;  3AKA A;  3SIA A;  5J3X A;  3SG7 A;  2K7D A;  2BE4 A;  2AMI A;  1DVI A;  1YX8 A;  3LLE A;  1TCO B;  1L2O C;  3FIA A;  4PHK A;  1CFF A;  1DTL A;  2Q91 A;  2Y4Q A;  1QIW A;  2NCP A;  2PVB A;  4A4C A;  5B8I B;  2L51 A;  1BOC A;  2Y1M A;  1IJ5 A;  2M7N A;  1IQ5 A;  2JXC A;  4U8D A;  1BG1 A;  1DMO A;  1S5G Z;  1B8R A;  3OX6 A;  2O60 A;  4MVF A;  2LMV A;  3TS5 B;  5CSJ A;  1PAL A;  1CMF A;  1TOP A;  1BLQ A;  4NQG A;  1YX7 A;  1AVS A;  1IWQ A;  1K90 D;  2BEC A;  3O4Y A;  2BL0 C;  4ETO A;  1B7T Z;  3IF7 A;  4L9M A;  5G08 A;  3PN7 C;  5AFP A;  4WQ3 A;  4CFQ A;  3F45 A;  4ICB A;  1DJX A;  1DF0 B;  2JXL A;  2KFH A;  2JT3 A;  2KOT A;  2Y1N A;  1EG3 A;  4PE0 A;  4ZCV A;  2MBX A;  2CCM A;  4YBH B;  2KYC A;  2MHH A;  1DJY A;  1DGU A;  2BCA A;  3E3R A;  1PSB A;  3CR4 X;  1K8U A;  2NLN A;  1UUS A;  3D0Y B;  4PE7 A;  4QJ5 B;  1K2H A;  1PUL A;  2F33 A;  1BR1 B;  1YVL A;  3QRX A;  5I2Q A;  2COL B;  4GPL B;  2LUC A;  5D7F A;  1KFX L;  1QX5 B;  1SY9 A;  3CLN A;  2QAC A;  1CLL A;  3GK1 A;  4GGF A;  3BUW B;  4MZJ A;  1XO5 A;  4TNC A;  1DJG A;  1HQV A;  1NWD A;  1Y1U A;  4AQJ A;  3PAL A;  1W7I B;  4PHM A;  1GJY A;  2FCD A;  3BQ3 A;  4XYN A;  1R2U A;  3JVT B;  1MXL C;  1NCX A;  1NX2 A;  3CGA A;  2LVK A;  2Y5I A;  4MRY A;  2A4J A;  2BE6 A;  2NCO A;  1M39 A;  3K21 A;  5AAN A;  1LA0 A;  2ZN9 A;  2P6B B;  1AK8 A;  2BCB A;  1XFZ O;  1FF1 A;  4GNK B;  1GGW A;  3KHE A;  3SG5 A;  1NUB A;  2KBM A;  2KAX A;  2LP2 A;  2MA2 A;  4YI9 A;  2KBI A;  1K95 A;  1LA3 A;  1JUO A;  1TIZ A;  1YR5 A;  1NPQ A;  1PSR A;  1G33 A;  2K0J A;  5BPJ A;  1F55 A;  1WRZ A;  4GBA A;  1AJ5 A;  2I94 A;  3CTN A;  1UHN A;  3BOW B;  3BUM B;  2F2O A;  2JOJ A;  5CSF A;  1N65 A;  1SPY A;  3EK7 A;  4MRX A;  1JWD A;  1K9P A;  1CDL A;  1UHK A;  1CFP A;  2WCF A;  4F0Z B;  3RM1 A;  1SCM B;  5JJG A;  4HRH A;  1YUS A;  3LK0 A;  2KI4 B;  3GK2 A;  3PN7 B;  3TS5 C;  5KU1 A;  2WC8 A;  1S6J A;  2FCE A;  4C0L A;  2L50 A;  1QLK A;  1MF8 B;  1QLS A;  1YUT A;  2I2R E;  3HCM A;  1IQ3 A;  3TDU A;  4WQ2 A;  2DOQ A;  2JTT A;  1XK4 C;  1OMV A;  1BOD A;  1QX7 A;  1ALV A;  3TDI A;  4GUK A;  2LHI A;  1MUX A;  2BKH B;  3CR5 X;  1HT9 A;  2L4I A;  1C7W A;  2KFG A;  1B8L A;  3NSL A;  2KAV A;  2KAY A;  1DJZ A;  3AAK A;  3JTD B;  1TN4 A;  1KQM B;  1CB1 A;  1E8A A;  2JT8 A;  4ORC B;  1REC A;  3TUY B;  1SK6 D;  5I8N A;  3DF0 A;  1A03 A;  1CNP A;  1JC2 A;  2JPT A;  1N2D A;  2E30 A;  4UPG A;  2MLE C;  2KQ6 A;  3BYA A;  2K2A A;  2KI6 C;  3IQQ A;  2LVI A;  1NX3 A;  3AAJ A;  3BUN B;  4OR9 B;  2OTG B;  1BU3 A;  1NYA A;  1WDC B;  5F6T A;  3LCP C;  4ORA B;  4YGA A;  1A75 B;  3DVJ A;  1KFU S;  4I5L B;  2GGM A;  1NCY A;  1LIN A;  1FI6 A;  4YGC B;  2M97 A;  1V1F A;  3JVT C;  1OSA A;  1F54 A;  1GGZ A;  1B1G A;  1FI5 A;  3NSK A;  1F70 A;  4N1G A;  1KK8 B;  2LLT A;  5CPV A;  4MSP A;  4WRI A;  4IL1 A;  1MHO A;  4PE4 A;  1J55 A;  1F8H A;  1G8I A;  2LVV A;  2FOT A;  1EL4 A;  5DKR A;  4OV2 A;  4CFR A;  3EKH A;  3KEV A;  1QV0 A;  4AQI A;  4NDC A;  2MJW B;  4JWQ A;  3I5H B;  4USL A;  3WHT B;  5KSZ A;  1RK9 A;  2MAZ A;  5DKN A;  5AEQ A;  4OCI A;  4YGE B;  1TNQ A;  2L2E A;  5GQQ C;  2SAS A;  1J7R A;  1K9U A;  1UHI A;  3TDZ A;  4I5N B;  1SCM C;  1G4Y R;  2KI4 C;  4DRW A;  2JZI A;  3I5I B;  3GK4 X;  1IJ6 A;  2JU0 A;  3PAT A;  2KYF A;  1A2X A;  5CSN A;  3DVE A;  3CS1 A;  1IGV A;  2WCB A;  1XFX O;  2G2B A;  3LK1 A;  4HSZ A;  4I5J A;  1CKK A;  1YUU A;  2E6W A;  1QS7 A;  1V1G A;  1S26 D;  1N0Y A;  2LM5 A;  3SJS A;  3PM8 A;  3VRN A;  1QXP A;  4N1F A;  3WXA A;  4BY5 A;  3JTD C;  2ZN8 A;  3WNX B;  1SL7 A;  1KQV A;  1TNW A;  1RRO A;  1KQM C;  2EGD A;  3TUY C;  2MLF C;  2CT9 A;  2K7B A;  3FS7 A;  1WRK A;  1WLM A;  2F2P A;  4QJ4 B;  1S1E A;  1CFC A;  1FPW A;  1S3P A;  2BBM A;  2LAP A;  1FW4 A;  3H4S E;  2ZNE A;  2OTG C;  1WDC C;  1UHJ A;  1TRF A;  1B9A A;  2K8M B;  1B4C A;  3VGO A;  5CSI A;  3SG4 A;  3ZNI A;  1QVI Y;  1J7O A;  1GQM A;  1B8C A;  1KCY A;  2BCX A;  2NXQ A;  3CZT X;  2H61 C;  1ODB A;  4JQ0 D;  4C0J A;  2LLU A;  2B1U A;  3O78 A;  3TZ1 A;  1KK8 C;  1ZMZ A;  1DJH A;  1LKJ A;  3BUX B;  3VRO A;  1OZS A;  1H4B A;  3M0W A;  1NP8 A;  1Y6W A;  4PHN A;  1CFD A;  1ZOT B;  3I5H C;  2R2I A;  2LUX A;  2ZRS A;  5TNC A;  4MEW A;  2QPT A;  2LE9 B;  1M31 A;  4AOM A;  2KGR A;  2PSR A;  3EK4 A;  4ORB B;  2Q4U A;  1DT7 B;  1MWN A;  2CXJ A;  2LV7 A;  3OP0 A;  4XJK A;  1CTR A;  5HKZ A;  1D1O A;  4QJ3 B;  2JTZ A;  3EK8 A;  1Y1A A;  1MXE A;  1OQP A;  3I5I C;  5AXI A;  1SMG A;  1RFJ A;  4DUQ A;  1NX1 A;  2L0P A;  1EJ3 A;  2G9B A;  3EVR A;  4P5O E;  1UHH A;  1PVB A;  3DD4 A;  2LC5 A;  4HRE E;  1QX2 A;  1CMG A;  2WOS A;  1TCF A;  1LVC D;  1LXF C;  3OX5 A;  1Y1X A;  2BBN A;  3A4U B;  1ALW A;  3NSI A;  1VRK A;  2BKI B;  1OOJ A;  3WHU B;  3LL8 B;  4E68 A;  2KFF A;  4DS7 A;  1J7Q A;  1IG5 A;  4OKH A;  4M2P A;  3DVK A;  1U5I A;  1X02 A;  3A8R A;  1EXR A;  1OZO A;  2KQY A;  1ZAC A;  4MLW A;  2M7L A;  4YGD B;  2TN4 A;  2GGZ A;  4CID A;  1NSH A;  4OVN F;  1SL9 A;  1A4P A;  2PAL A;  4FTG A;  1M46 A;  5HKW A;  3OHM B;  5FYX A;  5HYD A;  1DGV A;  1MQ1 A;  3VRP A;  2L5X B;  1ZUZ A;  1QAT A;  5PAL A;  2H2K A;  1OMD A;  3FWC A;  4A4B A;  5AER A;  1XFY O;  2F8P A;  2NZ0 A;  2WCE A;  4HRG A;  1AJ4 A;  1TTX A;  2LAN A;  1JF2 A;  1KSO A;  3OB1 B;  2LHL A;  2ZND A;  2JQ6 A;  4PAL A;  1JF0 A;  4GGF C;  2M1K B;  1IRJ A;  2I18 A;  2KI6 D;  1AUI B;  1XA5 A;  2K7O A;  1SBJ A;  2M49 B;  4I5K A;  2PAS A;  3DVM A;  4JPZ B;  4MN0 A;  1IH0 A;  1QJT A;  2LLS A;  1SKT A;  1OMR A;  4R1E A;  1CDP A;  4D1E A;  1M45 A;  4GAO A;  3SG3 A;  2JNF A;  3MSE B;  1R6P A;  1NX0 A;  2IS9 A;  1QAS A;  3AKB A;  5IBW A;  3BXK A;  2GV5 A;  1J1D A;  2V53 A;  1J7P A;  1CM1 A;  5ER5 A;  2ISD A;  4C0K A;  1XK4 A;  2CTN A;  2OS8 B;  3I5G B;  1CLB A;  1AHR A;  2K61 A;  1QV1 A;  2OPO A;  3IQO A;  1JFJ A;  1DF0 A;  3PSR A;  1TNP A;  1PRW A;  1SRA A;  3D10 A;  2CNP A;  3PFV A;  3ICB A;  4YGB B;  1A29 A;  2M8U A;  2WND A;  1C7V A;  3HX4 A;  2EC6 B;  2HF5 A;  2D8N A;  1J1E A;  5JOL A;  1KSM A;  1QVI Z;  2LVJ A;  4PHJ A;  3D0Y A;  3O2P A;  1KWO B;  1CLM A;  1XFU O;  4MZK A;  4DIR A;  5HLV A;  1SCV A;  3KF9 A;  1TNX A;  3NSO A;  1XYD A;  4YRU A;  1K93 D;  2HQW A;  2HPS A;  2I7A A;  1DJI A;  1KFX S;  1KK7 Z;  1RJV A;  4PCW A;  1SR6 B;  3CR2 A;  1UP5 A;  2LMT A;  1RTP 1;  1S5G Y;  3I5F B;  1WRL A;  3KPX A;  1RWY A;  5ER4 X;  3PLF B;  2VRG A;  3C1V A;  2M3W A;  2KGB C;  2LCP A;  1BMO A;  1YUR A;  1CDM A;  1YRU B;  2WOR A;  1C07 A;  2M9G A;  2JC2 A;  1B7T Y;  4M2Q A;  1SW8 A;  2LNK A;  1UWO A;  1JBA A;  1YRT B;  2K7C A;  2MRD A;  2JRF A;  4FQO A;  2KSP A;  3VRQ A;  1H8B A;  2ZFD A;  1KK7 Y;  1F71 A;  1BR4 B;  3BOW A;  2M1U A;  2F3Y A;  4NDB A;  1XVJ A;  2RGI A;  3BUO B;  1K9K A;  2LP3 A;  1QIV A;  1S6C A;  1UUR A;  1PK0 D;  3O6B A;  1L2O B;  1QTX A;  3OB2 B;  4N5X A;  2ZRT A;  4PE1 A;  4MBE A;  3EKJ A;  1BT6 A;  4BY4 A;  1JFK A;  2JT0 A;  4YI8 A;  4CPV A;  2KDH A;  1F4Q A;  4PDZ A;  3SG6 A;  2OS8 C;  3I5G C;  4GGN A;  2FJU B;  1K96 A;  2SCP A;  3KO0 A; 
#chains in the Genus database with same CATH topology
 1YTZ C;  4MZL A;  4CLN A;  2O5G A;  3RLZ A;  2BL0 B;  3D76 A;  3ZWH A;  1S36 A;  1F4O A;  1CDN A;  1XFV O;  3FE8 A;  1NIW A;  1Y0V H;  1CB1 A;  2EC6 C;  3NXA A;  1OE9 B;  1IKU A;  1Z4H A;  1SNL A;  1SYM A;  1TWO A;  2CBL A;  4XJK B;  5I2O A;  1KWO C;  3D74 A;  2M29 A;  5I2L A;  1K94 A;  4GFT A;  5K89 A;  3DZT A;  4NDD A;  5KTY A;  1JSA A;  2PMY A;  3CWG A;  1DQE A;  1FBV A;  1AP4 A;  3EVV A;  1CM4 A;  4DCK A;  2EHB A;  1Q80 A;  4P2Y B;  4ZCU A;  1A75 A;  1L7Z A;  1S6I A;  1EG4 A;  2LMU A;  1SR6 C;  1ZFS A;  1PVA A;  5HLO A;  3DF0 B;  3I5F C;  1DJW A;  4M2O A;  1B47 A;  1M63 B;  1XFW O;  2KLD A;  2M0R A;  2H61 A;  2HET A;  1BJF A;  2PRU A;  3S0E A;  1BF5 A;  2JWW A;  1U5I B;  3SG2 A;  1KFU L;  1WLZ A;  2KHN A;  2L98 A;  2KNE A;  1WY9 A;  1EH2 A;  5D69 A;  5HKY A;  3FWB A;  2L4H A;  3RZS A;  5DKQ A;  4Q04 A;  2ZKM X;  1W7J B;  2K2F A;  1NCZ A;  1SL8 A;  1MR8 A;  2HQ8 A;  3B7A A;  1YVH A;  3GOF A;  2F3Z A;  3VRR A;  2JUL A;  3EVU A;  2AUC A;  2WC5 A;  3SIB A;  2AAO A;  2JNX A;  3AKA A;  3SIA A;  2GTE A;  5J3X A;  3B88 A;  3SG7 A;  2K7D A;  2BE4 A;  1W9Z A;  2AMI A;  1DVI A;  1YX8 A;  3LLE A;  1TCO B;  1L2O C;  3FIA A;  4PHK A;  1CFF A;  1DTL A;  2Q91 A;  2Y4Q A;  1QIW A;  2NCP A;  2PVB A;  4A4C A;  5B8I B;  2L51 A;  1BOC A;  2Y1M A;  1CNP A;  1IJ5 A;  2M7N A;  1IQ5 A;  2JXC A;  4U8D A;  1BG1 A;  1DMO A;  1S5G Z;  1B8R A;  3OX6 A;  3S0F A;  2O60 A;  4MVF A;  2LMV A;  3TS5 B;  5CSJ A;  1PAL A;  1CMF A;  1TOP A;  1BLQ A;  2WCK A;  4NQG A;  1YX7 A;  1AVS A;  1IWQ A;  1K90 D;  2BEC A;  3O4Y A;  3QME A;  2BL0 C;  2QEB A;  3S0G A;  4ETO A;  1B7T Z;  3IF7 A;  4L9M A;  5G08 A;  3PN7 C;  3D73 A;  5AFP A;  4WQ3 A;  3CZ0 A;  4CFQ A;  3F45 A;  4ICB A;  1DJX A;  1DF0 B;  2JXL A;  2KFH A;  2JT3 A;  2KOT A;  2Y1N A;  1EG3 A;  4PE0 A;  4ZCV A;  2MBX A;  2CCM A;  4YBH B;  3S0B A;  2KYC A;  2MHH A;  1C3Y A;  1DJY A;  3NHT A;  1OOH A;  1DGU A;  2BCA A;  5EL2 A;  3E3R A;  1PSB A;  1Z2C B;  3CR4 X;  1K8U A;  1OOI X;  3OGN A;  2NLN A;  1UUS A;  3D0Y B;  4PE7 A;  4QJ5 B;  1K2H A;  1PUL A;  3DY9 A;  2F33 A;  1BR1 B;  1YVL A;  3QRX A;  5I2Q A;  2COL B;  4GPL B;  3D77 A;  2LUC A;  5D7F A;  1KFX L;  1QX5 B;  1SY9 A;  3CLN A;  3FE6 A;  3OBV A;  2QAC A;  3CYZ A;  1CLL A;  2QEO A;  3GK1 A;  4GGF A;  3BUW B;  3O4X A;  3BFB A;  4MZJ A;  1XO5 A;  4TNC A;  1DJG A;  1HQV A;  3S0A A;  1NWD A;  1Y1U A;  4AQJ A;  3PAL A;  1W7I B;  4PHM A;  1GJY A;  2FCD A;  3BQ3 A;  4XYN A;  1R2U A;  2WC6 A;  3JVT B;  1MXL C;  1NCX A;  1NX2 A;  3CGA A;  2LVK A;  3BJH A;  2Y5I A;  4MRY A;  2A4J A;  2BE6 A;  2NCO A;  1M39 A;  3K21 A;  5AAN A;  1LA0 A;  2ZN9 A;  2P6B B;  1AK8 A;  2BCB A;  1XFZ O;  3B86 A;  4GNK B;  1FF1 A;  3KHE A;  3SG5 A;  1NUB A;  1GGW A;  2KBM A;  2KAX A;  2LP2 A;  2MA2 A;  4YI9 A;  2KBI A;  1K95 A;  1LA3 A;  1JUO A;  1TIZ A;  1YR5 A;  1NPQ A;  1PSR A;  1G33 A;  2K0J A;  5BPJ A;  1F55 A;  5FI6 A;  1WRZ A;  4GBA A;  1AJ5 A;  2I94 A;  3CTN A;  5DIC A;  1UHN A;  3BOW B;  3BUM B;  2F2O A;  2JOJ A;  3IVT A;  5CSF A;  1N65 A;  1SPY A;  3EK7 A;  4MRX A;  1JWD A;  1K9P A;  1CDL A;  1UHK A;  1CFP A;  2WCF A;  4F0Z B;  3RM1 A;  1SCM B;  5JJG A;  2BAP A;  4HRH A;  1YUS A;  3LK0 A;  2KI4 B;  3GK2 A;  3PN7 B;  3TS5 C;  3VB1 A;  5KU1 A;  1OW4 A;  2WC8 A;  1LS8 A;  1S6J A;  2FCE A;  4C0L A;  2L50 A;  1QLK A;  1MF8 B;  1QLS A;  1YUT A;  2I2R E;  3HCM A;  1IQ3 A;  3TDU A;  4WQ2 A;  2DOQ A;  2JTT A;  1XK4 C;  1TUJ A;  1OMV A;  1BOD A;  1QX7 A;  1ALV A;  3TDI A;  4GUK A;  2LHI A;  1MUX A;  2BKH B;  3CR5 X;  1HT9 A;  2L4I A;  1C7W A;  2KFG A;  1B8L A;  3NSL A;  2KAV A;  3Q8I A;  2KAY A;  3B6X A;  2P70 A;  1DJZ A;  3AAK A;  3JTD B;  1TN4 A;  1KQM B;  3K1E A;  1E8A A;  2JT8 A;  4ORC B;  1REC A;  3TUY B;  1SK6 D;  5I8N A;  3DF0 A;  1A03 A;  1DEL A;  1JC2 A;  2JPT A;  1N2D A;  2E30 A;  4UPG A;  2MLE C;  2KQ6 A;  3BYA A;  2K2A A;  2KI6 C;  3IQQ A;  2LVI A;  1NX3 A;  3AAJ A;  3BUN B;  4OR9 B;  2OTG B;  1BU3 A;  1NYA A;  1WDC B;  5F6T A;  5FI7 A;  3LCP C;  4ORA B;  4YGA A;  1A75 B;  3DVJ A;  1KFU S;  3CZ2 A;  4I5L B;  2GGM A;  1NCY A;  1LIN A;  4INX A;  1FI6 A;  4YGC B;  2M97 A;  1V1F A;  3JVT C;  1XFR A;  1OSA A;  3NHI A;  1F54 A;  2PYQ A;  1GGZ A;  1SSE B;  3BFA A;  1B1G A;  1IIO A;  1FI5 A;  3NSK A;  1F70 A;  2WCL A;  4N1G A;  1KK8 B;  2LLT A;  5CPV A;  1QWV A;  4MSP A;  4WRI A;  4IL1 A;  1MHO A;  4PE4 A;  1OOF A;  1J55 A;  3V2L A;  1F8H A;  1G8I A;  2LVV A;  2FOT A;  1EL4 A;  5DKR A;  4OV2 A;  4CFR A;  3EKH A;  3KEV A;  1QV0 A;  4AQI A;  4NDC A;  2MJW B;  4JWQ A;  3I5H B;  4USL A;  3WHT B;  5KSZ A;  1RK9 A;  2MAZ A;  5DKN A;  5AEQ A;  4OCI A;  4YGE B;  1TNQ A;  2L2E A;  3N7H A;  5GQQ C;  2SAS A;  1J7R A;  1K9U A;  1UHI A;  2WCH A;  4I5N B;  3TDZ A;  1SCM C;  1G4Y R;  2KI4 C;  4DRW A;  2JZI A;  3I5I B;  3GK4 X;  1IJ6 A;  2JU0 A;  2KPH A;  2KYF A;  3PAT A;  1A2X A;  5CSN A;  3DVE A;  3CS1 A;  1IGV A;  2WCB A;  3UO9 A;  1XFX O;  2G2B A;  3LK1 A;  4HSZ A;  4I5J A;  3PM2 A;  1CKK A;  1YUU A;  1OOG A;  2E6W A;  1QS7 A;  2L5Y A;  1V1G A;  4JD9 A;  1S26 D;  1N0Y A;  2LM5 A;  3R1P A;  3SJS A;  3PM8 A;  3VRN A;  1QXP A;  4N1F A;  3WXA A;  3BFH A;  4BY5 A;  3JTD C;  2ZN8 A;  3WNX B;  1SL7 A;  1KQV A;  1TNW A;  1RRO A;  1KQM C;  2EGD A;  3TUY C;  2MLF C;  2CT9 A;  2K7B A;  3FS7 A;  4JKT A;  3D78 A;  1WRK A;  1WLM A;  2F2P A;  4QJ4 B;  1S1E A;  1CFC A;  1FPW A;  2QDI A;  1S3P A;  2BBM A;  2LAP A;  1FW4 A;  3H4S E;  2ZNE A;  2OTG C;  1GM0 A;  1WDC C;  1UHJ A;  1TRF A;  1B9A A;  2K8M B;  1B4C A;  3VGO A;  5CSI A;  3D75 A;  3EG5 B;  3SS5 A;  3SG4 A;  3ZNI A;  1QVI Y;  1J7O A;  1GQM A;  1B8C A;  1KCY A;  2BCX A;  2NXQ A;  3CZT X;  2H61 C;  3PJI A;  1ODB A;  4JQ0 D;  2JPO A;  4C0J A;  3DYE A;  2LLU A;  2B1U A;  1ORG A;  3O78 A;  3TZ1 A;  1KK8 C;  1ZMZ A;  4PT1 A;  1DJH A;  1LKJ A;  3BUX B;  3VRO A;  1OZS A;  1H4B A;  5HL1 A;  3M0W A;  1NP8 A;  1Y6W A;  4PHN A;  1CFD A;  1ZOT B;  3I5H C;  2R2I A;  2LUX A;  2ZRS A;  5TNC A;  4MEW A;  2QPT A;  2L2C A;  2LE9 B;  1M31 A;  2QEH A;  2KGR A;  2PSR A;  4AOM A;  3EK4 A;  4ORB B;  2Q4U A;  1DT7 B;  1MWN A;  2CXJ A;  2LV7 A;  3OP0 A;  4XJK A;  1CTR A;  5HKZ A;  1D1O A;  4QJ3 B;  2JTZ A;  3EK8 A;  1Y1A A;  1MXE A;  1OQP A;  3I5I C;  5AXI A;  1SMG A;  1RFJ A;  4DUQ A;  1NX1 A;  2L0P A;  1EJ3 A;  2G9B A;  3EVR A;  2H8V A;  3SS4 A;  4P5O E;  1UHH A;  1PVB A;  3DD4 A;  2LC5 A;  4HRE E;  1QX2 A;  4F7F A;  1CMG A;  2WOS A;  1TCF A;  1LVC D;  1LXF C;  3OX5 A;  1Y1X A;  2BBN A;  3A4U B;  1ALW A;  3NSI A;  1VRK A;  2BKI B;  1OOJ A;  3WHU B;  2PQL A;  3LL8 B;  4E68 A;  3UNW A;  2KFF A;  4DS7 A;  3S0D A;  1J7Q A;  3L47 A;  1IG5 A;  4OKH A;  4M2P A;  3CAB A;  3DVK A;  1U5I A;  1X02 A;  3A8R A;  1EXR A;  1OZO A;  2KQY A;  1ZAC A;  4MLW A;  2M7L A;  4YGD B;  2TN4 A;  2GGZ A;  4CID A;  3NGV A;  1NSH A;  4INW A;  1SL9 A;  4OVN F;  1A4P A;  2PAL A;  4FTG A;  5D3O A;  4KYN A;  1M46 A;  5HKW A;  3OHM B;  5FYX A;  3R1O A;  1DGV A;  5HYD A;  1MQ1 A;  3VRP A;  2L5X B;  1ZUZ A;  1QAT A;  5PAL A;  2H2K A;  1OMD A;  3FWC A;  4A4B A;  5AER A;  3R72 A;  1XFY O;  1TUZ A;  2F8P A;  2NZ0 A;  2WCE A;  4HRG A;  1AJ4 A;  1TTX A;  2LAN A;  1JF2 A;  1KSO A;  3OB1 B;  2LHL A;  2ZND A;  2JQ6 A;  4PAL A;  1JF0 A;  4GGF C;  4OZD A;  2M1K B;  1IRJ A;  2I18 A;  2KI6 D;  1AUI B;  1XA5 A;  2K7O A;  1SBJ A;  2M49 B;  4I5K A;  2PAS A;  3DVM A;  4JPZ B;  4MN0 A;  1IH0 A;  1QJT A;  2LLS A;  1SKT A;  1OMR A;  4R1E A;  1CDP A;  4D1E A;  1M45 A;  4GAO A;  3SG3 A;  2JNF A;  3MSE B;  2WCM A;  1R6P A;  1NX0 A;  2IS9 A;  1QAS A;  2WCJ A;  3AKB A;  5IBW A;  3BXK A;  2GV5 A;  1J1D A;  2V53 A;  3B87 A;  1CM1 A;  1J7P A;  5ER5 A;  2ISD A;  4C0K A;  1XK4 A;  2CTN A;  2OS8 B;  3I5G B;  1CLB A;  1AHR A;  2K61 A;  1QV1 A;  2OPO A;  3IQO A;  3R1V A;  1JFJ A;  1DF0 A;  3PSR A;  1TNP A;  1PRW A;  1SRA A;  3D10 A;  2CNP A;  3PFV A;  3ICB A;  4YGB B;  1A29 A;  2M8U A;  2WND A;  1C7V A;  2QEV A;  3HX4 A;  2EC6 B;  2HF5 A;  2D8N A;  1J1E A;  5JOL A;  5I94 A;  1KSM A;  1QVI Z;  2LVJ A;  4PHJ A;  3D0Y A;  3O2P A;  1KWO B;  1CLM A;  1XFU O;  4MZK A;  4DIR A;  5HLV A;  1SCV A;  2YGU A;  3KF9 A;  1TNX A;  3NSO A;  1XYD A;  2FJY A;  4YRU A;  1K93 D;  2HQW A;  2HPS A;  2ERB A;  2BNX A;  2I7A A;  3L4L A;  1DJI A;  1KFX S;  1KK7 Z;  1RJV A;  4PCW A;  1SR6 B;  3CR2 A;  1UP5 A;  2LMT A;  3FE9 A;  1RTP 1;  1S5G Y;  3CZ1 A;  4IJ7 A;  3I5F B;  1WRL A;  3KPX A;  1RWY A;  5ER4 X;  3PLF B;  2VRG A;  3C1V A;  2M3W A;  2KGB C;  2LCP A;  1BMO A;  1YUR A;  1CDM A;  1YRU B;  2WOR A;  1C07 A;  2M9G A;  2JC2 A;  1B7T Y;  4M2Q A;  1SW8 A;  2LNK A;  1UWO A;  1JBA A;  1YRT B;  2K7C A;  2MRD A;  2JRF A;  3L4A A;  2KSP A;  4FQO A;  3VRQ A;  1H8B A;  3DXL A;  2ZFD A;  1KK7 Y;  5FI2 A;  1F71 A;  1BR4 B;  3BOW A;  2M1U A;  1C3Z A;  2F3Y A;  4NDB A;  1XVJ A;  2RGI A;  3BUO B;  1K9K A;  2LP3 A;  1T14 A;  1DC1 A;  1QIV A;  1S6C A;  1UUR A;  4FQT A;  1P28 A;  1PK0 D;  3O6B A;  3CDN A;  1L2O B;  1QTX A;  3OB2 B;  4N5X A;  2ZRT A;  4PE1 A;  4MBE A;  3EKJ A;  1BT6 A;  4BY4 A;  1JFK A;  2JT0 A;  2P71 A;  2K60 A;  4YI8 A;  3SS3 A;  4CPV A;  2KDH A;  1DEK A;  2KLE A;  1F4Q A;  4PDZ A;  3SG6 A;  2OS8 C;  3I5G C;  4GGN A;  2FJU B;  1K96 A;  2SCP A;  3KO0 A; 
#chains in the Genus database with same CATH homology
 1YTZ C;  4MZL A;  4CLN A;  2O5G A;  3RLZ A;  2BL0 B;  3ZWH A;  1S36 A;  1F4O A;  1CDN A;  1XFV O;  1NIW A;  1Y0V H;  2EC6 C;  3NXA A;  1OE9 B;  1IKU A;  1SNL A;  1SYM A;  2CBL A;  4XJK B;  5I2O A;  1KWO C;  2M29 A;  5I2L A;  1K94 A;  4GFT A;  5K89 A;  4NDD A;  5KTY A;  1JSA A;  2PMY A;  3CWG A;  1FBV A;  1AP4 A;  3EVV A;  1CM4 A;  4DCK A;  2EHB A;  1Q80 A;  4P2Y B;  4ZCU A;  1A75 A;  1L7Z A;  1S6I A;  1EG4 A;  2LMU A;  1SR6 C;  1ZFS A;  1PVA A;  5HLO A;  3DF0 B;  3I5F C;  1DJW A;  4M2O A;  1B47 A;  1M63 B;  1XFW O;  2M0R A;  2H61 A;  2HET A;  1BJF A;  2PRU A;  1BF5 A;  2JWW A;  1U5I B;  3SG2 A;  1KFU L;  1WLZ A;  2KHN A;  2L98 A;  2KNE A;  1WY9 A;  1EH2 A;  5D69 A;  5HKY A;  3FWB A;  2L4H A;  5DKQ A;  4Q04 A;  2ZKM X;  1W7J B;  2K2F A;  1NCZ A;  1SL8 A;  1MR8 A;  2HQ8 A;  1YVH A;  3GOF A;  2F3Z A;  3VRR A;  2JUL A;  3EVU A;  2AUC A;  3SIB A;  2AAO A;  2JNX A;  3AKA A;  3SIA A;  5J3X A;  3SG7 A;  2K7D A;  2BE4 A;  2AMI A;  1DVI A;  1YX8 A;  3LLE A;  1TCO B;  1L2O C;  3FIA A;  4PHK A;  1CFF A;  1DTL A;  2Q91 A;  2Y4Q A;  1QIW A;  2NCP A;  2PVB A;  4A4C A;  5B8I B;  2L51 A;  1BOC A;  2Y1M A;  1IJ5 A;  2M7N A;  1IQ5 A;  2JXC A;  4U8D A;  1BG1 A;  1DMO A;  1S5G Z;  1B8R A;  3OX6 A;  2O60 A;  4MVF A;  2LMV A;  3TS5 B;  5CSJ A;  1PAL A;  1CMF A;  1TOP A;  1BLQ A;  4NQG A;  1YX7 A;  1AVS A;  1IWQ A;  1K90 D;  2BEC A;  3O4Y A;  2BL0 C;  4ETO A;  1B7T Z;  3IF7 A;  4L9M A;  5G08 A;  3PN7 C;  5AFP A;  4WQ3 A;  4CFQ A;  3F45 A;  4ICB A;  1DJX A;  1DF0 B;  2JXL A;  2KFH A;  2JT3 A;  2KOT A;  2Y1N A;  1EG3 A;  4PE0 A;  4ZCV A;  2MBX A;  2CCM A;  4YBH B;  2KYC A;  2MHH A;  1DJY A;  1DGU A;  2BCA A;  3E3R A;  1PSB A;  3CR4 X;  1K8U A;  2NLN A;  1UUS A;  3D0Y B;  4PE7 A;  4QJ5 B;  1K2H A;  1PUL A;  2F33 A;  1BR1 B;  1YVL A;  3QRX A;  5I2Q A;  2COL B;  4GPL B;  2LUC A;  5D7F A;  1KFX L;  1QX5 B;  1SY9 A;  3CLN A;  2QAC A;  1CLL A;  3GK1 A;  4GGF A;  3BUW B;  4MZJ A;  1XO5 A;  4TNC A;  1DJG A;  1HQV A;  1NWD A;  1Y1U A;  4AQJ A;  3PAL A;  1W7I B;  4PHM A;  1GJY A;  2FCD A;  3BQ3 A;  4XYN A;  1R2U A;  3JVT B;  1MXL C;  1NCX A;  1NX2 A;  3CGA A;  2LVK A;  2Y5I A;  4MRY A;  2A4J A;  2BE6 A;  2NCO A;  1M39 A;  3K21 A;  5AAN A;  1LA0 A;  2ZN9 A;  2P6B B;  1AK8 A;  2BCB A;  1XFZ O;  1FF1 A;  4GNK B;  1GGW A;  3KHE A;  3SG5 A;  1NUB A;  2KBM A;  2KAX A;  2LP2 A;  2MA2 A;  4YI9 A;  2KBI A;  1K95 A;  1LA3 A;  1JUO A;  1TIZ A;  1YR5 A;  1NPQ A;  1PSR A;  1G33 A;  2K0J A;  5BPJ A;  1F55 A;  1WRZ A;  4GBA A;  1AJ5 A;  2I94 A;  3CTN A;  1UHN A;  3BOW B;  3BUM B;  2F2O A;  2JOJ A;  5CSF A;  1N65 A;  1SPY A;  3EK7 A;  4MRX A;  1JWD A;  1K9P A;  1CDL A;  1UHK A;  1CFP A;  2WCF A;  4F0Z B;  3RM1 A;  1SCM B;  5JJG A;  4HRH A;  1YUS A;  3LK0 A;  2KI4 B;  3GK2 A;  3PN7 B;  3TS5 C;  5KU1 A;  2WC8 A;  1S6J A;  2FCE A;  4C0L A;  2L50 A;  1QLK A;  1MF8 B;  1QLS A;  1YUT A;  2I2R E;  3HCM A;  1IQ3 A;  3TDU A;  4WQ2 A;  2DOQ A;  2JTT A;  1XK4 C;  1OMV A;  1BOD A;  1QX7 A;  1ALV A;  3TDI A;  4GUK A;  2LHI A;  1MUX A;  2BKH B;  3CR5 X;  1HT9 A;  2L4I A;  1C7W A;  2KFG A;  1B8L A;  3NSL A;  2KAV A;  2KAY A;  1DJZ A;  3AAK A;  3JTD B;  1TN4 A;  1KQM B;  1CB1 A;  1E8A A;  2JT8 A;  4ORC B;  1REC A;  3TUY B;  1SK6 D;  5I8N A;  3DF0 A;  1A03 A;  1CNP A;  1JC2 A;  2JPT A;  1N2D A;  2E30 A;  4UPG A;  2MLE C;  2KQ6 A;  3BYA A;  2K2A A;  2KI6 C;  3IQQ A;  2LVI A;  1NX3 A;  3AAJ A;  3BUN B;  4OR9 B;  2OTG B;  1BU3 A;  1NYA A;  1WDC B;  5F6T A;  3LCP C;  4ORA B;  4YGA A;  1A75 B;  3DVJ A;  1KFU S;  4I5L B;  2GGM A;  1NCY A;  1LIN A;  1FI6 A;  4YGC B;  2M97 A;  1V1F A;  3JVT C;  1OSA A;  1F54 A;  1GGZ A;  1B1G A;  1FI5 A;  3NSK A;  1F70 A;  4N1G A;  1KK8 B;  2LLT A;  5CPV A;  4MSP A;  4WRI A;  4IL1 A;  1MHO A;  4PE4 A;  1J55 A;  1F8H A;  1G8I A;  2LVV A;  2FOT A;  1EL4 A;  5DKR A;  4OV2 A;  4CFR A;  3EKH A;  3KEV A;  1QV0 A;  4AQI A;  4NDC A;  2MJW B;  4JWQ A;  3I5H B;  4USL A;  3WHT B;  5KSZ A;  1RK9 A;  2MAZ A;  5DKN A;  5AEQ A;  4OCI A;  4YGE B;  1TNQ A;  2L2E A;  5GQQ C;  2SAS A;  1J7R A;  1K9U A;  1UHI A;  3TDZ A;  4I5N B;  1SCM C;  1G4Y R;  2KI4 C;  4DRW A;  2JZI A;  3I5I B;  3GK4 X;  1IJ6 A;  2JU0 A;  3PAT A;  2KYF A;  1A2X A;  5CSN A;  3DVE A;  3CS1 A;  1IGV A;  2WCB A;  1XFX O;  2G2B A;  3LK1 A;  4HSZ A;  4I5J A;  1CKK A;  1YUU A;  2E6W A;  1QS7 A;  1V1G A;  1S26 D;  1N0Y A;  2LM5 A;  3SJS A;  3PM8 A;  3VRN A;  1QXP A;  4N1F A;  3WXA A;  4BY5 A;  3JTD C;  2ZN8 A;  3WNX B;  1SL7 A;  1KQV A;  1TNW A;  1RRO A;  1KQM C;  2EGD A;  3TUY C;  2MLF C;  2CT9 A;  2K7B A;  3FS7 A;  1WRK A;  1WLM A;  2F2P A;  4QJ4 B;  1S1E A;  1CFC A;  1FPW A;  1S3P A;  2BBM A;  2LAP A;  1FW4 A;  3H4S E;  2ZNE A;  2OTG C;  1WDC C;  1UHJ A;  1TRF A;  1B9A A;  2K8M B;  1B4C A;  3VGO A;  5CSI A;  3SG4 A;  3ZNI A;  1QVI Y;  1J7O A;  1GQM A;  1B8C A;  1KCY A;  2BCX A;  2NXQ A;  3CZT X;  2H61 C;  1ODB A;  4JQ0 D;  4C0J A;  2LLU A;  2B1U A;  3O78 A;  3TZ1 A;  1KK8 C;  1ZMZ A;  1DJH A;  1LKJ A;  3BUX B;  3VRO A;  1OZS A;  1H4B A;  3M0W A;  1NP8 A;  1Y6W A;  4PHN A;  1CFD A;  1ZOT B;  3I5H C;  2R2I A;  2LUX A;  2ZRS A;  5TNC A;  4MEW A;  2QPT A;  2LE9 B;  1M31 A;  4AOM A;  2KGR A;  2PSR A;  3EK4 A;  4ORB B;  2Q4U A;  1DT7 B;  1MWN A;  2CXJ A;  2LV7 A;  3OP0 A;  4XJK A;  1CTR A;  5HKZ A;  1D1O A;  4QJ3 B;  2JTZ A;  3EK8 A;  1Y1A A;  1MXE A;  1OQP A;  3I5I C;  5AXI A;  1SMG A;  1RFJ A;  4DUQ A;  1NX1 A;  2L0P A;  1EJ3 A;  2G9B A;  3EVR A;  4P5O E;  1UHH A;  1PVB A;  3DD4 A;  2LC5 A;  4HRE E;  1QX2 A;  1CMG A;  2WOS A;  1TCF A;  1LVC D;  1LXF C;  3OX5 A;  1Y1X A;  2BBN A;  3A4U B;  1ALW A;  3NSI A;  1VRK A;  2BKI B;  1OOJ A;  3WHU B;  3LL8 B;  4E68 A;  2KFF A;  4DS7 A;  1J7Q A;  1IG5 A;  4OKH A;  4M2P A;  3DVK A;  1U5I A;  1X02 A;  3A8R A;  1EXR A;  1OZO A;  2KQY A;  1ZAC A;  4MLW A;  2M7L A;  4YGD B;  2TN4 A;  2GGZ A;  4CID A;  1NSH A;  4OVN F;  1SL9 A;  1A4P A;  2PAL A;  4FTG A;  1M46 A;  5HKW A;  3OHM B;  5FYX A;  5HYD A;  1DGV A;  1MQ1 A;  3VRP A;  2L5X B;  1ZUZ A;  1QAT A;  5PAL A;  2H2K A;  1OMD A;  3FWC A;  4A4B A;  5AER A;  1XFY O;  2F8P A;  2NZ0 A;  2WCE A;  4HRG A;  1AJ4 A;  1TTX A;  2LAN A;  1JF2 A;  1KSO A;  3OB1 B;  2LHL A;  2ZND A;  2JQ6 A;  4PAL A;  1JF0 A;  4GGF C;  2M1K B;  1IRJ A;  2I18 A;  2KI6 D;  1AUI B;  1XA5 A;  2K7O A;  1SBJ A;  2M49 B;  4I5K A;  2PAS A;  3DVM A;  4JPZ B;  4MN0 A;  1IH0 A;  1QJT A;  2LLS A;  1SKT A;  1OMR A;  4R1E A;  1CDP A;  4D1E A;  1M45 A;  4GAO A;  3SG3 A;  2JNF A;  3MSE B;  1R6P A;  1NX0 A;  2IS9 A;  1QAS A;  3AKB A;  5IBW A;  3BXK A;  2GV5 A;  1J1D A;  2V53 A;  1J7P A;  1CM1 A;  5ER5 A;  2ISD A;  4C0K A;  1XK4 A;  2CTN A;  2OS8 B;  3I5G B;  1CLB A;  1AHR A;  2K61 A;  1QV1 A;  2OPO A;  3IQO A;  1JFJ A;  1DF0 A;  3PSR A;  1TNP A;  1PRW A;  1SRA A;  3D10 A;  2CNP A;  3PFV A;  3ICB A;  4YGB B;  1A29 A;  2M8U A;  2WND A;  1C7V A;  3HX4 A;  2EC6 B;  2HF5 A;  2D8N A;  1J1E A;  5JOL A;  1KSM A;  1QVI Z;  2LVJ A;  4PHJ A;  3D0Y A;  3O2P A;  1KWO B;  1CLM A;  1XFU O;  4MZK A;  4DIR A;  5HLV A;  1SCV A;  3KF9 A;  1TNX A;  3NSO A;  1XYD A;  4YRU A;  1K93 D;  2HQW A;  2HPS A;  2I7A A;  1DJI A;  1KFX S;  1KK7 Z;  1RJV A;  4PCW A;  1SR6 B;  3CR2 A;  1UP5 A;  2LMT A;  1RTP 1;  1S5G Y;  3I5F B;  1WRL A;  3KPX A;  1RWY A;  5ER4 X;  3PLF B;  2VRG A;  3C1V A;  2M3W A;  2KGB C;  2LCP A;  1BMO A;  1YUR A;  1CDM A;  1YRU B;  2WOR A;  1C07 A;  2M9G A;  2JC2 A;  1B7T Y;  4M2Q A;  1SW8 A;  2LNK A;  1UWO A;  1JBA A;  1YRT B;  2K7C A;  2MRD A;  2JRF A;  4FQO A;  2KSP A;  3VRQ A;  1H8B A;  2ZFD A;  1KK7 Y;  1F71 A;  1BR4 B;  3BOW A;  2M1U A;  2F3Y A;  4NDB A;  1XVJ A;  2RGI A;  3BUO B;  1K9K A;  2LP3 A;  1QIV A;  1S6C A;  1UUR A;  1PK0 D;  3O6B A;  1L2O B;  1QTX A;  3OB2 B;  4N5X A;  2ZRT A;  4PE1 A;  4MBE A;  3EKJ A;  1BT6 A;  4BY4 A;  1JFK A;  2JT0 A;  4YI8 A;  4CPV A;  2KDH A;  1F4Q A;  4PDZ A;  3SG6 A;  2OS8 C;  3I5G C;  4GGN A;  2FJU B;  1K96 A;  2SCP A;  3KO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...