1PSRA

Human psoriasin (s100a7)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
100
structure length
100
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSORIASIN
publication title EF-hands at atomic resolution: the structure of human psoriasin (S100A7) solved by MAD phasing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ef-hand protein
total genus 36
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1psrA00
1AJ4A 4DIRA 4E68A 1SYMA 1YUUA 2ZKMX 3RLZA 2L51A 4WQ2A 2M9GA 3C1VA 4MRYA 3DVJA 1BT6A 1YVLA 1DJXA 2FCEA 2F33A 2K7DA 2D8NA 1QS7A 1PRWA 1LVCD 2IS9A 2Y5IA 3EK7A 3TZ1A 3CR5X 1GGZA 3IF7A 3KF9A 2EC6C 1FI5A 3ZNIA 1ALVA 1UWOA 4PCWA 1JF2A 4PHKA 1L7ZA 4YI8A 2M97A 3RM1A 1AUIB 4ICBA 3I5GC 3BUXB 1TIZA 4PE4A 3TS5C 2KFFA 4HSZA 2LV7A 2MBXA 3OHMB 2LLSA 1IG5A 1IH0A 4NQGA 4GNKB 4L9MA 2L0PA 5AANA 2OS8B 3F45A 2L4HA 2KFHA 1UHIA 1WDCC 1AP4A 3DVKA 1F71A 1K95A 1NCXA 2MHHA 2BCBA 3SJSA 5I8NA 3BXKA 1TTXA 4PHMA 1J7OA 2WNDA 1TNPA 4HRGA 2MRDA 3PM8A 1U5IA 2HPSA 1G4YR 3A8RA 1OZSA 2MAZA 1YRTB 1GGWA 1JUOA 1F4QA 4GPLB 2L2EA 3NSIA 1KK7Z 4CFRA 1ODBA 2F3YA 3BUMB 1B47A 1YTZC 2NCPA 1KFXL 2ZRTA 3TDUA 2CCMA 2RGIA 2JTTA 1SBJA 2F2PA 1SL9A 3EVUA 1JF0A 1VRKA 4PE0A 1TNQA 5HKZA 2M0RA 1ZMZA 1K9UA 4BY5A 3FS7A 1J7RA 1DTLA 4N1GA 3LK1A 1G8IA 1SCMB 1BMOA 1NCZA 4FTGA 1TOPA 2LVVA 4PHNA 3EVRA 1TCFA 2KNEA 2K0JA 4YGDB 1GJYA 3PFVA 2CT9A 4PHJA 3D10A 3NSOA 1MHOA 2M49B 1KSMA 2LUCA 2L5XB 1XFVO 1AHRA 2KI4C 1NCYA 3O4YA 2JZIA 4YRUA 3TUYC 1WLMA 2ISDA 2LMVA 2F3ZA 1NX1A 1DJZA 4D1EA 2MA2A 2K2FA 1J1EA 4AQIA 3AKBA 2K7BA 1JWDA 1SCVA 2WOSA 1OZOA 5ER4X 4C0LA 1KK8B 3GK2A 4OVNF 4UPGA 3SG4A 4P2YB 1MR8A 5CSNA 1TNWA 3LLEA 1SL8A 3MSEB 1TN4A 2I7AA 4OCIA 3WNXB 1J7PA 1CDLA 4TNCA 2KBMA 3WXAA 2O60A 2EGDA 2LAPA 2L4IA 2V53A 1Y1AA 1SKTA 1CM4A 1XO5A 2BCAA 3DD4A 3I5FC 3DVEA 3IQQA 4YBHB 5KU1A 1CLMA 1U5IB 4GGFA 1CMGA 3TUYB 1K94A 1SK6D 2QACA 1CFCA 3NXAA 2BL0C 2H61A 4C0JA 1CKKA 4GUKA 3HCMA 1KFUS 1F70A 2M1UA 3WHTB 4QJ4B 3KEVA 3ICBA 3AAKA 1QX2A 2QPTA 3EK8A 4WQ3A 1B8RA 2OTGC 3I5IB 3DF0B 1B1GA 1XFYO 2NZ0A 2E30A 1XVJA 1S26D 1K9KA 2LHIA 2K7OA 3K21A 5J3XA 1FW4A 1LKJA 1SNLA 1KQMB 1K8UA 1TCOB 3EK4A 1BLQA 4I5JA 1B8LA 4NDCA 1WRLA 1QASA 2BE4A 2Q91A 3JTDB 3TDZA 2R2IA 5HKWA 1K96A 1A75A 2JU0A 4ORCB 5HKYA 1MWNA 5CPVA 2GGZA 3PATA 2E6WA 4MVFA 2PASA 2CBLA 3O2PA 4AOMA 4I5LB 1UHHA 3H4SE 1CLLA 2KAYA 3SIAA 1RWYA 2L98A 3LCPC 3OX6A 5DKQA 1CNPA 4MN0A 1PSRA 2KOTA 2K2AA 2KAXA 3PN7C 4GGFC 4N5XA 1M31A 2I2RE 2GV5A 1N65A 2H61C 1YR5A 2MLEC 2F8PA 2L50A 1FF1A 1L2OC 2LUXA 2I94A 1MQ1A 1SY9A 1K93D 3AKAA 1IKUA 1DJGA 3CLNA 5AEQA 1PVBA 2NLNA 2P6BB 2G9BA 2Y1NA 1EXRA 1YX8A 2LLUA 3VROA 1SR6C 1MF8B 1R6PA 1BJFA 1IJ5A 2EC6B 5PALA 3FWCA 3CTNA 1LINA 4M2OA 1DF0B 1CFDA 1LA0A 5I2QA 4PALA 3VRNA 3SG5A 1OMRA 1YX7A 2PALA 1KSOA 1JFJA 2JXLA 4JQ0D 1KCYA 1BF5A 3I5GB 1CTRA 2KGBC 1W7JB 3DVMA 1A2XA 4JPZB 1YURA 2G2BA 3GK1A 1WLZA 1B9AA 3TS5B 1KWOC 1YUSA 1OMDA 1Y6WA 1NX2A 2JULA 3PN7B 1TRFA 1J7QA 4XJKA 1EJ3A 1IQ5A 3FWBA 4HREE 4CIDA 1WRZA 2TN4A 2Y1MA 3SIBA 1UHKA 1WDCB 1XFXO 3EKJA 2BECA 4M2PA 4A4BA 4QJ5B 1EG4A 1OQPA 4GFTA 3NSKA 2JT0A 1SW8A 1QLKA 3BOWA 4HRHA 2FJUB 2KAVA 5G08A 5HLOA 1NYAA 2LP3A 1C07A 4ETOA 1H8BA 3JVTC 3VGOA 4F0ZB 1A4PA 1DGVA 2LM5A 2LVKA 1M39A 1QXPA 2HF5A 3OX5A 1K9PA 4BY4A 1RTP1 1ZOTB 2LE9B 3PSRA 5AERA 2LMUA 4CLNA 1UUSA 3VRPA 3I5HC 1JBAA 1FPWA 1DJWA 1PALA 1IWQA 1K90D 2LANA 2NCOA 1IRJA 3SG7A 2FCDA 1KQVA 1DGUA 1NPQA 2KSPA 1G33A 3BYAA 3LK0A 2MLFC 1NWDA 1DJHA 1S6IA 2K7CA 1UHNA 1K2HA 1NP8A 3CZTX 2NXQA 1QLSA 3QRXA 4IL1A 2M7NA 2LVJA 2FOTA 4FQOA 5KTYA 2F2OA 1DT7B 1B7TY 1KFXS 1CDNA 1BR1B 1XFUO 1QIVA 3SG3A 1YRUB 2B1UA 2JNFA 4WRIA 1CB1A 4CFQA 3PLFB 1J1DA 1W7IB 2COLB 2KI4B 1Y1UA 1SL7A 2KBIA 2M1KB 4ZCUA 1N2DA 1QV1A 2JNXA 4MZJA 4QJ3B 1LXFC 4CPVA 4ORBB 1DJIA 5BPJA 2LP2A 2I18A 2JT8A 1GQMA 2AAOA 2H2KA 1XK4C 1CFPA 1S5GY 2K8MB 4C0KA 1DVIA 1BG1A 3CWGA 2PSRA 4MSPA 1IQ3A 3GK4X 2JRFA 2WCFA 1X02A 1UP5A 3ZWHA 3E3RA 1QX7A 2KGRA 4GBAA 4YGAA 4XJKB 1CM1A 1TNXA 1F55A 1QJTA 1AJ5A 1QIWA 1QVIY 4M2QA 1F54A 2AMIA 4MRXA 2HETA 1IJ6A 5DKNA 1QX5B 4NDBA 2AUCA 1M46A 2KQYA 4PE7A 2PRUA 1S6CA 4YGEB 1BOCA 3I5FB 2WCEA 2ZN9A 2ZFDA 2SCPA 1SPYA 1MXEA 2O5GA 2BL0B 5CSIA 4Q04A 2KQ6A 2LLTA 1BU3A 3A4UB 4ZCVA 3M0WA 2OS8C 2KYCA 3BUWB 1ZFSA 3GOFA 3HX4A 1B4CA 2OTGB 1NX0A 1S1EA 1A29A 2PMYA 2ZRSA 4DS7A 1PULA 2M3WA 5K89A 2Q4UA 4I5KA 5FYXA 1S5GZ 2BKHB 3BUNB 2WORA 1A03A 4GGNA 1RK9A 2OPOA 4NDDA 4I5NB 2BCXA 3SG6A 2JXCA 2JQ6A 1KK7Y 1Y0VH 3BUOB 1NIWA 3EKHA 1QVIZ 2BE6A 2HQWA 3CR4X 1OE9B 1XYDA 2BBNA 1E8AA 3D0YA 1CLBA 4OR9B 2JPTA 2LHLA 2JTZA 2JC2A 2JWWA 5JOLA 1SMGA 1DMOA 1HT9A 4ORAB 2WC8A 1LA3A 2A4JA 1R2UA 4JWQA 1YVHA 1EH2A 1D1OA 1CDMA 3KO0A 1SCMC 4YI9A 1JC2A 1EG3A 2CNPA 3CR2A 3PALA 1UHJA 2LC5A 1SRAA 1PSBA 1L2OB 3FIAA 5D69A 2VRGA 1QTXA 5I2OA 2KYFA 4MLWA 2BKIB 2LCPA 3CGAA 5F6TA 1CFFA 5JJGA 1N0YA 3SG2A 4PDZA 1SR6B 1S6JA 3WHUB 1OMVA 3VRRA 2CTNA 3BQ3A 3DF0A 2HQ8A 1AK8A 1UURA 1J55A 3OP0A 4OKHA 1F4OA 1XK4A 2CXJA 1Q80A 2ZNEA 5D7FA 2MJWB 1PVAA 5ER5A 4MBEA 4R1EA 2M29A 4DCKA 2BBMA 5GQQC 1MXLC 1KWOB 3CS1A 2LVIA 2WCBA 5CSFA 1A75B 3KHEA 1HQVA 4N1FA 4YGBB 1KK8C 1B8CA 1S36A 1KFUL 5DKRA 3TDIA 1M45A 2SASA 1NUBA 3EVVA 3NSLA 1ZUZA 2PVBA 4DRWA 3O78A 1OOJA 2M7LA 3AAJA 2KI6C 3JVTB 1IGVA 1RJVA 3KPXA 3IQOA 3VRQA 4PE1A 2KI6D 5AXIA 1WRKA 1CMFA 2DOQA 2KFGA 4MZKA 3OB1B 4P5OE 1S3PA 1F8HA 4MEWA 2JOJA 4OV2A 1NX3A 1QV0A 3I5HB 1BR4B 3OB2B 2EHBA 4AQJA 1BODA 5HLVA 2Y4QA 4USLA 5HYDA 5IBWA 5CSJA 1V1FA 3D0YB 1QATA 2ZNDA 4DUQA 1MUXA 1XFWO 3I5IC 1XFZO 1OSAA 1M63B 4XYNA 5TNCA 1DF0A 2M8UA 4YGCB 1KQMC 2ZN8A 2K61A 1NSHA 2LNKA 2JT3A 1FI6A 1FBVA 5KSZA 1ALWA 2KHNA 5B8IB 1C7VA 1DJYA 2KDHA 1RFJA 1JFKA 1WY9A 3JTDC 2GGMA 4U8DA 1EL4A 1ZACA 1CDPA 1Y1XA 4GAOA 1C7WA 3O6BA 4A4CA 1B7TZ 1H4BA 1RECA 3BOWB 1PK0D 5I2LA 1JSAA 3LL8B 4MZLA 1V1GA 1RROA 1AVSA 2LMTA 1XA5A 1YUTA 5AFPA
chains in the Genus database with same CATH superfamily
3DXLA 1AJ4A 4DIRA 4E68A 1SYMA 1YUUA 2H8VA 2ZKMX 3RLZA 2L51A 4WQ2A 2M9GA 3C1VA 3O4XA 3DVJA 4MRYA 1BT6A 1YVLA 1DJXA 3FE6A 2FCEA 2F33A 2K7DA 2D8NA 1P28A 1QS7A 1PRWA 1LVCD 2IS9A 2Y5IA 3EK7A 3TZ1A 3CR5X 4IJ7A 5FI2A 3D76A 1GGZA 3IF7A 1Z2CB 3KF9A 2EC6C 3UNWA 1FI5A 3ZNIA 1ALVA 1UWOA 4PCWA 3QMEA 1JF2A 4PHKA 1L7ZA 4YI8A 2M97A 3D74A 3RM1A 1AUIB 4ICBA 3I5GC 2KLDA 3BUXB 5FI7A 4PT1A 1TIZA 4PE4A 3TS5C 2KFFA 4HSZA 2LV7A 3CZ2A 2MBXA 3OHMB 2LLSA 1IG5A 3R1OA 4NQGA 4GNKB 4L9MA 1IH0A 2L0PA 5AANA 2OS8B 3F45A 2L4HA 2KFHA 1UHIA 3DY9A 2WCKA 1WDCC 1AP4A 3D75A 3DVKA 1F71A 1K95A 1NCXA 2MHHA 2BCBA 3SJSA 5I8NA 3B88A 3BXKA 1TTXA 4OZDA 4PHMA 1J7OA 2WNDA 1TNPA 4HRGA 2MRDA 3PM8A 1U5IA 2HPSA 1G4YR 3L4AA 3A8RA 1C3YA 1OZSA 2MAZA 4JD9A 1YRTB 1GGWA 1JUOA 1F4QA 4GPLB 2L2EA 3NSIA 1KK7Z 4CFRA 1ODBA 2F3YA 3BUMB 1B47A 1YTZC 2NCPA 3V2LA 1KFXL 2ZRTA 3TDUA 2CCMA 2RGIA 2JTTA 1SBJA 2F2PA 1SL9A 3EVUA 1JF0A 1VRKA 4PE0A 1TNQA 5HKZA 2M0RA 1ZMZA 1K9UA 4BY5A 3FS7A 1J7RA 1DTLA 2GTEA 4N1GA 3LK1A 1G8IA 1SCMB 3D77A 1BMOA 1NCZA 4FTGA 1TOPA 2LVVA 4PHNA 3EVRA 1TCFA 2KNEA 2K0JA 4YGDB 1C3ZA 1GJYA 3PFVA 2CT9A 4PHJA 2K60A 3D10A 3NSOA 1MHOA 2M49B 1KSMA 3OGNA 2LUCA 2L5XB 1XFVO 1AHRA 2KI4C 1NCYA 3O4YA 2JZIA 4YRUA 3TUYC 1WLMA 2ISDA 5HLOA 2LMVA 2F3ZA 1NX1A 1DJZA 4D1EA 2MA2A 2K2FA 4KYNA 1J1EA 2WCHA 4AQIA 3AKBA 2K7BA 1JWDA 1SCVA 2WOSA 1OZOA 5ER4X 4C0LA 1KK8B 3GK2A 4OVNF 4UPGA 3SG4A 4P2YB 1MR8A 5CSNA 1TNWA 3LLEA 1SL8A 3K1EA 1OW4A 3MSEB 1TN4A 2I7AA 4OCIA 3WNXB 1J7PA 1CDLA 4TNCA 2KBMA 3WXAA 2O60A 2EGDA 2LAPA 2L4IA 2V53A 1Y1AA 1SKTA 1CM4A 1XO5A 2BCAA 3D73A 3DD4A 3I5FC 3DVEA 3IQQA 4YBHB 5KU1A 1CLMA 1U5IB 4GGFA 1CMGA 3TUYB 1K94A 1SK6D 2QACA 3RZSA 1CFCA 3NXAA 2BL0C 2H61A 1T14A 4C0JA 1CKKA 4GUKA 3HCMA 1KFUS 1F70A 2M1UA 3WHTB 4QJ4B 3KEVA 3ICBA 3AAKA 1QX2A 2PYQA 2QPTA 3EK8A 4WQ3A 1B8RA 2OTGC 3I5IB 3DF0B 1B1GA 1XFYO 2NZ0A 2KPHA 5FI6A 1DELA 2E30A 1XVJA 3R72A 1S26D 4JKTA 1K9KA 2FJYA 2LHIA 2K7OA 3K21A 5J3XA 2P71A 1FW4A 1LKJA 1SNLA 1KQMB 1K8UA 2L2CA 3N7HA 1TCOB 3EK4A 1BLQA 4I5JA 1B8LA 4NDCA 1WRLA 1QASA 2BE4A 2Q91A 3JTDB 3TDZA 2R2IA 5HKWA 1K96A 1A75A 2JU0A 4ORCB 5HKYA 1MWNA 5CPVA 2GGZA 3PJIA 3PATA 2E6WA 4MVFA 4INXA 2PASA 2WC6A 2CBLA 2L5YA 3O2PA 4AOMA 4I5LB 1UHHA 3H4SE 1CLLA 2KAYA 3SIAA 1RWYA 2L98A 3LCPC 3OX6A 5DKQA 1CNPA 4MN0A 3PM2A 1PSRA 2KLEA 2K2AA 2KAXA 2KOTA 3NHIA 3PN7C 1M31A 4GGFC 4N5XA 2I2RE 2GV5A 3FE9A 1N65A 2H61C 1YR5A 2MLEC 2F8PA 2L50A 1FF1A 1L2OC 2LUXA 3OBVA 2I94A 1MQ1A 1SY9A 2QEHA 1K93D 3FE8A 3AKAA 1IKUA 1DJGA 1GM0A 3CLNA 5AEQA 1PVBA 2NLNA 2P6BB 2G9BA 2Y1NA 1EXRA 1YX8A 2LLUA 3VROA 1SR6C 1MF8B 1R6PA 1BJFA 1IJ5A 2EC6B 5PALA 3FWCA 3CTNA 1LINA 4M2OA 1DF0B 1CFDA 1LA0A 5I2QA 3SS3A 4PALA 3VRNA 3SG5A 1OMRA 1YX7A 2PALA 1KSOA 1JFJA 3R1VA 2JXLA 3B87A 4JQ0D 1KCYA 4FQTA 1BF5A 3I5GB 1CTRA 2KGBC 1W7JB 3DVMA 1A2XA 4JPZB 1YURA 2G2BA 3GK1A 1WLZA 1B9AA 1Z4HA 3TS5B 1KWOC 1YUSA 1OMDA 1Y6WA 1NX2A 2JULA 3PN7B 1TRFA 1J7QA 3S0EA 4XJKA 1EJ3A 1IQ5A 2JPOA 3FWBA 4HREE 4CIDA 1WRZA 2TN4A 2Y1MA 3SIBA 1QWVA 1UHKA 1WDCB 1XFXO 3EKJA 2BECA 4M2PA 4A4BA 4QJ5B 1EG4A 1OQPA 3DZTA 4GFTA 3B6XA 2JT0A 1SW8A 1QLKA 3BOWA 3NSKA 2FJUB 2KAVA 4HRHA 5G08A 1NYAA 2LP3A 2BAPA 4ETOA 1C07A 1H8BA 3JVTC 3VGOA 4F0ZB 1A4PA 1DGVA 1OOIX 2LM5A 2LVKA 1M39A 1QXPA 2HF5A 3OX5A 1K9PA 4BY4A 1RTP1 1ZOTB 2LE9B 3PSRA 5AERA 1W9ZA 1TUJA 1UUSA 2LMUA 3I5HC 3VRPA 4CLNA 1DJWA 1PALA 1JBAA 1FPWA 1IWQA 1K90D 2LANA 2NCOA 1IRJA 1TUZA 3L4LA 5D3OA 2FCDA 3SG7A 3Q8IA 1KQVA 1DGUA 1NPQA 2KSPA 1G33A 3BYAA 5EL2A 4INWA 3LK0A 1XFRA 2MLFC 1NWDA 1DJHA 1S6IA 2K7CA 1UHNA 1K2HA 1NP8A 3CZTX 2NXQA 1QLSA 3QRXA 4IL1A 2M7NA 2LVJA 2P70A 1TWOA 3CDNA 2WCLA 2FOTA 4FQOA 5KTYA 2F2OA 1DT7B 3CABA 1B7TY 1KFXS 1CDNA 1BR1B 1XFUO 1QIVA 2QEBA 3SG3A 1YRUB 2B1UA 2JNFA 4WRIA 3S0AA 1CB1A 4CFQA 3PLFB 1J1DA 1W7IB 2COLB 2QEOA 2KI4B 1Y1UA 1SL7A 2WCMA 2KBIA 2M1KB 4ZCUA 1N2DA 1QV1A 2JNXA 4MZJA 4QJ3B 1LXFC 4CPVA 4ORBB 1DJIA 5BPJA 2LP2A 3S0FA 2I18A 2JT8A 1GQMA 2AAOA 2H2KA 1XK4C 1CFPA 1S5GY 2K8MB 4C0KA 1DVIA 1BG1A 3CWGA 2PSRA 1DQEA 4MSPA 1IQ3A 3GK4X 2JRFA 2WCFA 3BFBA 1X02A 1UP5A 3ZWHA 2BNXA 3E3RA 1QX7A 5HL1A 2KGRA 4GBAA 4YGAA 2QDIA 4XJKB 1CM1A 1TNXA 1F55A 1QJTA 1AJ5A 1QIWA 1QVIY 4M2QA 1F54A 3S0DA 2YGUA 2AMIA 1LS8A 4MRXA 2HETA 1IJ6A 5DKNA 1QX5B 4NDBA 2AUCA 1M46A 2KQYA 3BJHA 4PE7A 2PRUA 3S0GA 1S6CA 4YGEB 1BOCA 3I5FB 2WCEA 2ZN9A 2ZFDA 3NGVA 2SCPA 1SPYA 3IVTA 1MXEA 2O5GA 2BL0B 5CSIA 4Q04A 2KQ6A 2LLTA 1BU3A 3A4UB 3VB1A 4ZCVA 3M0WA 2OS8C 2KYCA 3BUWB 1ZFSA 3GOFA 3HX4A 2WCJA 2OTGB 1B4CA 1NX0A 1S1EA 1A29A 2PMYA 2ZRSA 3EG5B 4DS7A 1PULA 2M3WA 5K89A 2Q4UA 4I5KA 5FYXA 1S5GZ 1ORGA 3BFHA 2BKHB 1IIOA 3BUNB 2WORA 1A03A 4GGNA 1RK9A 2OPOA 4NDDA 4I5NB 1OOFA 2BCXA 3SG6A 2JXCA 2JQ6A 1KK7Y 1Y0VH 3BUOB 1NIWA 3EKHA 1QVIZ 3B86A 2BE6A 2HQWA 3CR4X 1OE9B 2QEVA 1XYDA 2BBNA 1E8AA 3B7AA 3D0YA 1CLBA 4OR9B 2ERBA 1DC1A 2JPTA 3S0BA 2LHLA 2JTZA 2JC2A 2JWWA 5JOLA 1SMGA 1DMOA 1HT9A 4ORAB 2WC8A 1LA3A 2A4JA 1R2UA 4JWQA 1YVHA 1EH2A 1D1OA 1CDMA 3KO0A 1SCMC 4YI9A 4F7FA 1EG3A 1JC2A 2CNPA 2WC5A 3CR2A 1OOGA 1UHJA 2LC5A 1SRAA 1PSBA 1L2OB 3FIAA 3PALA 2VRGA 1QTXA 5D69A 5I2OA 2KYFA 4MLWA 2BKIB 2LCPA 3CGAA 5F6TA 3CZ0A 1CFFA 5JJGA 1N0YA 3SG2A 4PDZA 1SR6B 1S6JA 3WHUB 1OMVA 3VRRA 1SSEB 2CTNA 3BQ3A 3DF0A 2HQ8A 3DYEA 1UURA 1AK8A 1J55A 3OP0A 4OKHA 1F4OA 1XK4A 2CXJA 1Q80A 2ZNEA 5D7FA 2MJWB 1PVAA 5ER5A 4MBEA 4R1EA 2M29A 4DCKA 2BBMA 5GQQC 1MXLC 1KWOB 3CS1A 2LVIA 2WCBA 3NHTA 5CSFA 1A75B 3KHEA 1HQVA 4N1FA 4YGBB 1KK8C 1B8CA 1S36A 1KFUL 5DKRA 3TDIA 1M45A 2SASA 3D78A 1NUBA 1OOHA 3EVVA 3BFAA 3NSLA 1ZUZA 2PVBA 4DRWA 3O78A 1OOJA 2M7LA 3UO9A 3AAJA 2KI6C 3JVTB 1IGVA 1RJVA 2PQLA 3KPXA 3IQOA 3VRQA 4PE1A 2KI6D 5AXIA 1WRKA 1CMFA 5DICA 2DOQA 2KFGA 4MZKA 3OB1B 4P5OE 1S3PA 1F8HA 4MEWA 2JOJA 3CZ1A 4OV2A 1NX3A 1QV0A 3I5HB 1BR4B 3OB2B 2EHBA 4AQJA 1BODA 5HLVA 2Y4QA 4USLA 5HYDA 5IBWA 5CSJA 1V1FA 3D0YB 1QATA 2ZNDA 4DUQA 1MUXA 1XFWO 3I5IC 1XFZO 1OSAA 3L47A 5I94A 3SS5A 1DEKA 3R1PA 1M63B 4XYNA 5TNCA 1DF0A 2M8UA 4YGCB 3SS4A 1KQMC 2ZN8A 2K61A 1NSHA 2LNKA 2JT3A 1FI6A 1FBVA 5KSZA 1ALWA 2KHNA 3CYZA 5B8IB 1C7VA 1DJYA 2KDHA 1RFJA 1JFKA 1WY9A 3JTDC 2GGMA 4U8DA 1EL4A 1ZACA 1CDPA 1Y1XA 4GAOA 1C7WA 3O6BA 4A4CA 1B7TZ 1H4BA 1RECA 3BOWB 1PK0D 5I2LA 1JSAA 3LL8B 4MZLA 1V1GA 1RROA 1AVSA 2LMTA 1XA5A 1YUTA 5AFPA
chains in the Genus database with same CATH topology
1AJ4A 4DIRA 4E68A 1SYMA 1YUUA 2ZKMX 3RLZA 2L51A 4WQ2A 2M9GA 3C1VA 4MRYA 3DVJA 1BT6A 1YVLA 1DJXA 2FCEA 2F33A 2K7DA 2D8NA 1QS7A 1PRWA 1LVCD 2IS9A 2Y5IA 3EK7A 3TZ1A 3CR5X 1GGZA 3IF7A 3KF9A 2EC6C 1FI5A 3ZNIA 1ALVA 1UWOA 4PCWA 1JF2A 4PHKA 1L7ZA 4YI8A 2M97A 3RM1A 1AUIB 4ICBA 3I5GC 3BUXB 1TIZA 4PE4A 3TS5C 2KFFA 4HSZA 2LV7A 2MBXA 3OHMB 2LLSA 1IG5A 1IH0A 4NQGA 4GNKB 4L9MA 2L0PA 5AANA 2OS8B 3F45A 2L4HA 2KFHA 1UHIA 1WDCC 1AP4A 3DVKA 1F71A 1K95A 1NCXA 2MHHA 2BCBA 3SJSA 5I8NA 3BXKA 1TTXA 4PHMA 1J7OA 2WNDA 1TNPA 4HRGA 2MRDA 3PM8A 1U5IA 2HPSA 1G4YR 3A8RA 1OZSA 2MAZA 1YRTB 1GGWA 1JUOA 1F4QA 4GPLB 2L2EA 3NSIA 1KK7Z 4CFRA 1ODBA 2F3YA 3BUMB 1B47A 1YTZC 2NCPA 1KFXL 2ZRTA 3TDUA 2CCMA 2RGIA 2JTTA 1SBJA 2F2PA 1SL9A 3EVUA 1JF0A 1VRKA 4PE0A 1TNQA 5HKZA 2M0RA 1ZMZA 1K9UA 4BY5A 3FS7A 1J7RA 1DTLA 4N1GA 3LK1A 1G8IA 1SCMB 1BMOA 1NCZA 4FTGA 1TOPA 2LVVA 4PHNA 3EVRA 1TCFA 2KNEA 2K0JA 4YGDB 1GJYA 3PFVA 2CT9A 4PHJA 3D10A 3NSOA 1MHOA 2M49B 1KSMA 2LUCA 2L5XB 1XFVO 1AHRA 2KI4C 1NCYA 3O4YA 2JZIA 4YRUA 3TUYC 1WLMA 2ISDA 2LMVA 2F3ZA 1NX1A 1DJZA 4D1EA 2MA2A 2K2FA 1J1EA 4AQIA 3AKBA 2K7BA 1JWDA 1SCVA 2WOSA 1OZOA 5ER4X 4C0LA 1KK8B 3GK2A 4OVNF 4UPGA 3SG4A 4P2YB 1MR8A 5CSNA 1TNWA 3LLEA 1SL8A 3MSEB 1TN4A 2I7AA 4OCIA 3WNXB 1J7PA 1CDLA 4TNCA 2KBMA 3WXAA 2O60A 2EGDA 2LAPA 2L4IA 2V53A 1Y1AA 1SKTA 1CM4A 1XO5A 2BCAA 3DD4A 3I5FC 3DVEA 3IQQA 4YBHB 5KU1A 1CLMA 1U5IB 4GGFA 1CMGA 3TUYB 1K94A 1SK6D 2QACA 1CFCA 3NXAA 2BL0C 2H61A 4C0JA 1CKKA 4GUKA 3HCMA 1KFUS 1F70A 2M1UA 3WHTB 4QJ4B 3KEVA 3ICBA 3AAKA 1QX2A 2QPTA 3EK8A 4WQ3A 1B8RA 2OTGC 3I5IB 3DF0B 1B1GA 1XFYO 2NZ0A 2E30A 1XVJA 1S26D 1K9KA 2LHIA 2K7OA 3K21A 5J3XA 1FW4A 1LKJA 1SNLA 1KQMB 1K8UA 1TCOB 3EK4A 1BLQA 4I5JA 1B8LA 4NDCA 1WRLA 1QASA 2BE4A 2Q91A 3JTDB 3TDZA 2R2IA 5HKWA 1K96A 1A75A 2JU0A 4ORCB 5HKYA 1MWNA 5CPVA 2GGZA 3PATA 2E6WA 4MVFA 2PASA 2CBLA 3O2PA 4AOMA 4I5LB 1UHHA 3H4SE 1CLLA 2KAYA 3SIAA 1RWYA 2L98A 3LCPC 3OX6A 5DKQA 1CNPA 4MN0A 1PSRA 2KOTA 2K2AA 2KAXA 3PN7C 4GGFC 4N5XA 1M31A 2I2RE 2GV5A 1N65A 2H61C 1YR5A 2MLEC 2F8PA 2L50A 1FF1A 1L2OC 2LUXA 2I94A 1MQ1A 1SY9A 1K93D 3AKAA 1IKUA 1DJGA 3CLNA 5AEQA 1PVBA 2NLNA 2P6BB 2G9BA 2Y1NA 1EXRA 1YX8A 2LLUA 3VROA 1SR6C 1MF8B 1R6PA 1BJFA 1IJ5A 2EC6B 5PALA 3FWCA 3CTNA 1LINA 4M2OA 1DF0B 1CFDA 1LA0A 5I2QA 4PALA 3VRNA 3SG5A 1OMRA 1YX7A 2PALA 1KSOA 1JFJA 2JXLA 4JQ0D 1KCYA 1BF5A 3I5GB 1CTRA 2KGBC 1W7JB 3DVMA 1A2XA 4JPZB 1YURA 2G2BA 3GK1A 1WLZA 1B9AA 3TS5B 1KWOC 1YUSA 1OMDA 1Y6WA 1NX2A 2JULA 3PN7B 1TRFA 1J7QA 4XJKA 1EJ3A 1IQ5A 3FWBA 4HREE 4CIDA 1WRZA 2TN4A 2Y1MA 3SIBA 1UHKA 1WDCB 1XFXO 3EKJA 2BECA 4M2PA 4A4BA 4QJ5B 1EG4A 1OQPA 4GFTA 3NSKA 2JT0A 1SW8A 1QLKA 3BOWA 4HRHA 2FJUB 2KAVA 5G08A 5HLOA 1NYAA 2LP3A 1C07A 4ETOA 1H8BA 3JVTC 3VGOA 4F0ZB 1A4PA 1DGVA 2LM5A 2LVKA 1M39A 1QXPA 2HF5A 3OX5A 1K9PA 4BY4A 1RTP1 1ZOTB 2LE9B 3PSRA 5AERA 2LMUA 4CLNA 1UUSA 3VRPA 3I5HC 1JBAA 1FPWA 1DJWA 1PALA 1IWQA 1K90D 2LANA 2NCOA 1IRJA 3SG7A 2FCDA 1KQVA 1DGUA 1NPQA 2KSPA 1G33A 3BYAA 3LK0A 2MLFC 1NWDA 1DJHA 1S6IA 2K7CA 1UHNA 1K2HA 1NP8A 3CZTX 2NXQA 1QLSA 3QRXA 4IL1A 2M7NA 2LVJA 2FOTA 4FQOA 5KTYA 2F2OA 1DT7B 1B7TY 1KFXS 1CDNA 1BR1B 1XFUO 1QIVA 3SG3A 1YRUB 2B1UA 2JNFA 4WRIA 1CB1A 4CFQA 3PLFB 1J1DA 1W7IB 2COLB 2KI4B 1Y1UA 1SL7A 2KBIA 2M1KB 4ZCUA 1N2DA 1QV1A 2JNXA 4MZJA 4QJ3B 1LXFC 4CPVA 4ORBB 1DJIA 5BPJA 2LP2A 2I18A 2JT8A 1GQMA 2AAOA 2H2KA 1XK4C 1CFPA 1S5GY 2K8MB 4C0KA 1DVIA 1BG1A 3CWGA 2PSRA 4MSPA 1IQ3A 3GK4X 2JRFA 2WCFA 1X02A 1UP5A 3ZWHA 3E3RA 1QX7A 2KGRA 4GBAA 4YGAA 4XJKB 1CM1A 1TNXA 1F55A 1QJTA 1AJ5A 1QIWA 1QVIY 4M2QA 1F54A 2AMIA 4MRXA 2HETA 1IJ6A 5DKNA 1QX5B 4NDBA 2AUCA 1M46A 2KQYA 4PE7A 2PRUA 1S6CA 4YGEB 1BOCA 3I5FB 2WCEA 2ZN9A 2ZFDA 2SCPA 1SPYA 1MXEA 2O5GA 2BL0B 5CSIA 4Q04A 2KQ6A 2LLTA 1BU3A 3A4UB 4ZCVA 3M0WA 2OS8C 2KYCA 3BUWB 1ZFSA 3GOFA 3HX4A 1B4CA 2OTGB 1NX0A 1S1EA 1A29A 2PMYA 2ZRSA 4DS7A 1PULA 2M3WA 5K89A 2Q4UA 4I5KA 5FYXA 1S5GZ 2BKHB 3BUNB 2WORA 1A03A 4GGNA 1RK9A 2OPOA 4NDDA 4I5NB 2BCXA 3SG6A 2JXCA 2JQ6A 1KK7Y 1Y0VH 3BUOB 1NIWA 3EKHA 1QVIZ 2BE6A 2HQWA 3CR4X 1OE9B 1XYDA 2BBNA 1E8AA 3D0YA 1CLBA 4OR9B 2JPTA 2LHLA 2JTZA 2JC2A 2JWWA 5JOLA 1SMGA 1DMOA 1HT9A 4ORAB 2WC8A 1LA3A 2A4JA 1R2UA 4JWQA 1YVHA 1EH2A 1D1OA 1CDMA 3KO0A 1SCMC 4YI9A 1JC2A 1EG3A 2CNPA 3CR2A 3PALA 1UHJA 2LC5A 1SRAA 1PSBA 1L2OB 3FIAA 5D69A 2VRGA 1QTXA 5I2OA 2KYFA 4MLWA 2BKIB 2LCPA 3CGAA 5F6TA 1CFFA 5JJGA 1N0YA 3SG2A 4PDZA 1SR6B 1S6JA 3WHUB 1OMVA 3VRRA 2CTNA 3BQ3A 3DF0A 2HQ8A 1AK8A 1UURA 1J55A 3OP0A 4OKHA 1F4OA 1XK4A 2CXJA 1Q80A 2ZNEA 5D7FA 2MJWB 1PVAA 5ER5A 4MBEA 4R1EA 2M29A 4DCKA 2BBMA 5GQQC 1MXLC 1KWOB 3CS1A 2LVIA 2WCBA 5CSFA 1A75B 3KHEA 1HQVA 4N1FA 4YGBB 1KK8C 1B8CA 1S36A 1KFUL 5DKRA 3TDIA 1M45A 2SASA 1NUBA 3EVVA 3NSLA 1ZUZA 2PVBA 4DRWA 3O78A 1OOJA 2M7LA 3AAJA 2KI6C 3JVTB 1IGVA 1RJVA 3KPXA 3IQOA 3VRQA 4PE1A 2KI6D 5AXIA 1WRKA 1CMFA 2DOQA 2KFGA 4MZKA 3OB1B 4P5OE 1S3PA 1F8HA 4MEWA 2JOJA 4OV2A 1NX3A 1QV0A 3I5HB 1BR4B 3OB2B 2EHBA 4AQJA 1BODA 5HLVA 2Y4QA 4USLA 5HYDA 5IBWA 5CSJA 1V1FA 3D0YB 1QATA 2ZNDA 4DUQA 1MUXA 1XFWO 3I5IC 1XFZO 1OSAA 1M63B 4XYNA 5TNCA 1DF0A 2M8UA 4YGCB 1KQMC 2ZN8A 2K61A 1NSHA 2LNKA 2JT3A 1FI6A 1FBVA 5KSZA 1ALWA 2KHNA 5B8IB 1C7VA 1DJYA 2KDHA 1RFJA 1JFKA 1WY9A 3JTDC 2GGMA 4U8DA 1EL4A 1ZACA 1CDPA 1Y1XA 4GAOA 1C7WA 3O6BA 4A4CA 1B7TZ 1H4BA 1RECA 3BOWB 1PK0D 5I2LA 1JSAA 3LL8B 4MZLA 1V1GA 1RROA 1AVSA 2LMTA 1XA5A 1YUTA 5AFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJ4 A;  4DIR A;  4E68 A;  1SYM A;  1YUU A;  2ZKM X;  3RLZ A;  2L51 A;  4WQ2 A;  2M9G A;  3C1V A;  4MRY A;  3DVJ A;  1BT6 A;  1YVL A;  1DJX A;  2FCE A;  2F33 A;  2K7D A;  2D8N A;  1QS7 A;  1PRW A;  1LVC D;  2IS9 A;  2Y5I A;  3EK7 A;  3TZ1 A;  3CR5 X;  1GGZ A;  3IF7 A;  3KF9 A;  2EC6 C;  1FI5 A;  3ZNI A;  1ALV A;  1UWO A;  4PCW A;  1JF2 A;  4PHK A;  1L7Z A;  4YI8 A;  2M97 A;  3RM1 A;  1AUI B;  4ICB A;  3I5G C;  3BUX B;  1TIZ A;  4PE4 A;  3TS5 C;  2KFF A;  4HSZ A;  2LV7 A;  2MBX A;  3OHM B;  2LLS A;  1IG5 A;  1IH0 A;  4NQG A;  4GNK B;  4L9M A;  2L0P A;  5AAN A;  2OS8 B;  3F45 A;  2L4H A;  2KFH A;  1UHI A;  1WDC C;  1AP4 A;  3DVK A;  1F71 A;  1K95 A;  1NCX A;  2MHH A;  2BCB A;  3SJS A;  5I8N A;  3BXK A;  1TTX A;  4PHM A;  1J7O A;  2WND A;  1TNP A;  4HRG A;  2MRD A;  3PM8 A;  1U5I A;  2HPS A;  1G4Y R;  3A8R A;  1OZS A;  2MAZ A;  1YRT B;  1GGW A;  1JUO A;  1F4Q A;  4GPL B;  2L2E A;  3NSI A;  1KK7 Z;  4CFR A;  1ODB A;  2F3Y A;  3BUM B;  1B47 A;  1YTZ C;  2NCP A;  1KFX L;  2ZRT A;  3TDU A;  2CCM A;  2RGI A;  2JTT A;  1SBJ A;  2F2P A;  1SL9 A;  3EVU A;  1JF0 A;  1VRK A;  4PE0 A;  1TNQ A;  5HKZ A;  2M0R A;  1ZMZ A;  1K9U A;  4BY5 A;  3FS7 A;  1J7R A;  1DTL A;  4N1G A;  3LK1 A;  1G8I A;  1SCM B;  1BMO A;  1NCZ A;  4FTG A;  1TOP A;  2LVV A;  4PHN A;  3EVR A;  1TCF A;  2KNE A;  2K0J A;  4YGD B;  1GJY A;  3PFV A;  2CT9 A;  4PHJ A;  3D10 A;  3NSO A;  1MHO A;  2M49 B;  1KSM A;  2LUC A;  2L5X B;  1XFV O;  1AHR A;  2KI4 C;  1NCY A;  3O4Y A;  2JZI A;  4YRU A;  3TUY C;  1WLM A;  2ISD A;  2LMV A;  2F3Z A;  1NX1 A;  1DJZ A;  4D1E A;  2MA2 A;  2K2F A;  1J1E A;  4AQI A;  3AKB A;  2K7B A;  1JWD A;  1SCV A;  2WOS A;  1OZO A;  5ER4 X;  4C0L A;  1KK8 B;  3GK2 A;  4OVN F;  4UPG A;  3SG4 A;  4P2Y B;  1MR8 A;  5CSN A;  1TNW A;  3LLE A;  1SL8 A;  3MSE B;  1TN4 A;  2I7A A;  4OCI A;  3WNX B;  1J7P A;  1CDL A;  4TNC A;  2KBM A;  3WXA A;  2O60 A;  2EGD A;  2LAP A;  2L4I A;  2V53 A;  1Y1A A;  1SKT A;  1CM4 A;  1XO5 A;  2BCA A;  3DD4 A;  3I5F C;  3DVE A;  3IQQ A;  4YBH B;  5KU1 A;  1CLM A;  1U5I B;  4GGF A;  1CMG A;  3TUY B;  1K94 A;  1SK6 D;  2QAC A;  1CFC A;  3NXA A;  2BL0 C;  2H61 A;  4C0J A;  1CKK A;  4GUK A;  3HCM A;  1KFU S;  1F70 A;  2M1U A;  3WHT B;  4QJ4 B;  3KEV A;  3ICB A;  3AAK A;  1QX2 A;  2QPT A;  3EK8 A;  4WQ3 A;  1B8R A;  2OTG C;  3I5I B;  3DF0 B;  1B1G A;  1XFY O;  2NZ0 A;  2E30 A;  1XVJ A;  1S26 D;  1K9K A;  2LHI A;  2K7O A;  3K21 A;  5J3X A;  1FW4 A;  1LKJ A;  1SNL A;  1KQM B;  1K8U A;  1TCO B;  3EK4 A;  1BLQ A;  4I5J A;  1B8L A;  4NDC A;  1WRL A;  1QAS A;  2BE4 A;  2Q91 A;  3JTD B;  3TDZ A;  2R2I A;  5HKW A;  1K96 A;  1A75 A;  2JU0 A;  4ORC B;  5HKY A;  1MWN A;  5CPV A;  2GGZ A;  3PAT A;  2E6W A;  4MVF A;  2PAS A;  2CBL A;  3O2P A;  4AOM A;  4I5L B;  1UHH A;  3H4S E;  1CLL A;  2KAY A;  3SIA A;  1RWY A;  2L98 A;  3LCP C;  3OX6 A;  5DKQ A;  1CNP A;  4MN0 A;  1PSR A;  2KOT A;  2K2A A;  2KAX A;  3PN7 C;  4GGF C;  4N5X A;  1M31 A;  2I2R E;  2GV5 A;  1N65 A;  2H61 C;  1YR5 A;  2MLE C;  2F8P A;  2L50 A;  1FF1 A;  1L2O C;  2LUX A;  2I94 A;  1MQ1 A;  1SY9 A;  1K93 D;  3AKA A;  1IKU A;  1DJG A;  3CLN A;  5AEQ A;  1PVB A;  2NLN A;  2P6B B;  2G9B A;  2Y1N A;  1EXR A;  1YX8 A;  2LLU A;  3VRO A;  1SR6 C;  1MF8 B;  1R6P A;  1BJF A;  1IJ5 A;  2EC6 B;  5PAL A;  3FWC A;  3CTN A;  1LIN A;  4M2O A;  1DF0 B;  1CFD A;  1LA0 A;  5I2Q A;  4PAL A;  3VRN A;  3SG5 A;  1OMR A;  1YX7 A;  2PAL A;  1KSO A;  1JFJ A;  2JXL A;  4JQ0 D;  1KCY A;  1BF5 A;  3I5G B;  1CTR A;  2KGB C;  1W7J B;  3DVM A;  1A2X A;  4JPZ B;  1YUR A;  2G2B A;  3GK1 A;  1WLZ A;  1B9A A;  3TS5 B;  1KWO C;  1YUS A;  1OMD A;  1Y6W A;  1NX2 A;  2JUL A;  3PN7 B;  1TRF A;  1J7Q A;  4XJK A;  1EJ3 A;  1IQ5 A;  3FWB A;  4HRE E;  4CID A;  1WRZ A;  2TN4 A;  2Y1M A;  3SIB A;  1UHK A;  1WDC B;  1XFX O;  3EKJ A;  2BEC A;  4M2P A;  4A4B A;  4QJ5 B;  1EG4 A;  1OQP A;  4GFT A;  3NSK A;  2JT0 A;  1SW8 A;  1QLK A;  3BOW A;  4HRH A;  2FJU B;  2KAV A;  5G08 A;  5HLO A;  1NYA A;  2LP3 A;  1C07 A;  4ETO A;  1H8B A;  3JVT C;  3VGO A;  4F0Z B;  1A4P A;  1DGV A;  2LM5 A;  2LVK A;  1M39 A;  1QXP A;  2HF5 A;  3OX5 A;  1K9P A;  4BY4 A;  1RTP 1;  1ZOT B;  2LE9 B;  3PSR A;  5AER A;  2LMU A;  4CLN A;  1UUS A;  3VRP A;  3I5H C;  1JBA A;  1FPW A;  1DJW A;  1PAL A;  1IWQ A;  1K90 D;  2LAN A;  2NCO A;  1IRJ A;  3SG7 A;  2FCD A;  1KQV A;  1DGU A;  1NPQ A;  2KSP A;  1G33 A;  3BYA A;  3LK0 A;  2MLF C;  1NWD A;  1DJH A;  1S6I A;  2K7C A;  1UHN A;  1K2H A;  1NP8 A;  3CZT X;  2NXQ A;  1QLS A;  3QRX A;  4IL1 A;  2M7N A;  2LVJ A;  2FOT A;  4FQO A;  5KTY A;  2F2O A;  1DT7 B;  1B7T Y;  1KFX S;  1CDN A;  1BR1 B;  1XFU O;  1QIV A;  3SG3 A;  1YRU B;  2B1U A;  2JNF A;  4WRI A;  1CB1 A;  4CFQ A;  3PLF B;  1J1D A;  1W7I B;  2COL B;  2KI4 B;  1Y1U A;  1SL7 A;  2KBI A;  2M1K B;  4ZCU A;  1N2D A;  1QV1 A;  2JNX A;  4MZJ A;  4QJ3 B;  1LXF C;  4CPV A;  4ORB B;  1DJI A;  5BPJ A;  2LP2 A;  2I18 A;  2JT8 A;  1GQM A;  2AAO A;  2H2K A;  1XK4 C;  1CFP A;  1S5G Y;  2K8M B;  4C0K A;  1DVI A;  1BG1 A;  3CWG A;  2PSR A;  4MSP A;  1IQ3 A;  3GK4 X;  2JRF A;  2WCF A;  1X02 A;  1UP5 A;  3ZWH A;  3E3R A;  1QX7 A;  2KGR A;  4GBA A;  4YGA A;  4XJK B;  1CM1 A;  1TNX A;  1F55 A;  1QJT A;  1AJ5 A;  1QIW A;  1QVI Y;  4M2Q A;  1F54 A;  2AMI A;  4MRX A;  2HET A;  1IJ6 A;  5DKN A;  1QX5 B;  4NDB A;  2AUC A;  1M46 A;  2KQY A;  4PE7 A;  2PRU A;  1S6C A;  4YGE B;  1BOC A;  3I5F B;  2WCE A;  2ZN9 A;  2ZFD A;  2SCP A;  1SPY A;  1MXE A;  2O5G A;  2BL0 B;  5CSI A;  4Q04 A;  2KQ6 A;  2LLT A;  1BU3 A;  3A4U B;  4ZCV A;  3M0W A;  2OS8 C;  2KYC A;  3BUW B;  1ZFS A;  3GOF A;  3HX4 A;  1B4C A;  2OTG B;  1NX0 A;  1S1E A;  1A29 A;  2PMY A;  2ZRS A;  4DS7 A;  1PUL A;  2M3W A;  5K89 A;  2Q4U A;  4I5K A;  5FYX A;  1S5G Z;  2BKH B;  3BUN B;  2WOR A;  1A03 A;  4GGN A;  1RK9 A;  2OPO A;  4NDD A;  4I5N B;  2BCX A;  3SG6 A;  2JXC A;  2JQ6 A;  1KK7 Y;  1Y0V H;  3BUO B;  1NIW A;  3EKH A;  1QVI Z;  2BE6 A;  2HQW A;  3CR4 X;  1OE9 B;  1XYD A;  2BBN A;  1E8A A;  3D0Y A;  1CLB A;  4OR9 B;  2JPT A;  2LHL A;  2JTZ A;  2JC2 A;  2JWW A;  5JOL A;  1SMG A;  1DMO A;  1HT9 A;  4ORA B;  2WC8 A;  1LA3 A;  2A4J A;  1R2U A;  4JWQ A;  1YVH A;  1EH2 A;  1D1O A;  1CDM A;  3KO0 A;  1SCM C;  4YI9 A;  1JC2 A;  1EG3 A;  2CNP A;  3CR2 A;  3PAL A;  1UHJ A;  2LC5 A;  1SRA A;  1PSB A;  1L2O B;  3FIA A;  5D69 A;  2VRG A;  1QTX A;  5I2O A;  2KYF A;  4MLW A;  2BKI B;  2LCP A;  3CGA A;  5F6T A;  1CFF A;  5JJG A;  1N0Y A;  3SG2 A;  4PDZ A;  1SR6 B;  1S6J A;  3WHU B;  1OMV A;  3VRR A;  2CTN A;  3BQ3 A;  3DF0 A;  2HQ8 A;  1AK8 A;  1UUR A;  1J55 A;  3OP0 A;  4OKH A;  1F4O A;  1XK4 A;  2CXJ A;  1Q80 A;  2ZNE A;  5D7F A;  2MJW B;  1PVA A;  5ER5 A;  4MBE A;  4R1E A;  2M29 A;  4DCK A;  2BBM A;  5GQQ C;  1MXL C;  1KWO B;  3CS1 A;  2LVI A;  2WCB A;  5CSF A;  1A75 B;  3KHE A;  1HQV A;  4N1F A;  4YGB B;  1KK8 C;  1B8C A;  1S36 A;  1KFU L;  5DKR A;  3TDI A;  1M45 A;  2SAS A;  1NUB A;  3EVV A;  3NSL A;  1ZUZ A;  2PVB A;  4DRW A;  3O78 A;  1OOJ A;  2M7L A;  3AAJ A;  2KI6 C;  3JVT B;  1IGV A;  1RJV A;  3KPX A;  3IQO A;  3VRQ A;  4PE1 A;  2KI6 D;  5AXI A;  1WRK A;  1CMF A;  2DOQ A;  2KFG A;  4MZK A;  3OB1 B;  4P5O E;  1S3P A;  1F8H A;  4MEW A;  2JOJ A;  4OV2 A;  1NX3 A;  1QV0 A;  3I5H B;  1BR4 B;  3OB2 B;  2EHB A;  4AQJ A;  1BOD A;  5HLV A;  2Y4Q A;  4USL A;  5HYD A;  5IBW A;  5CSJ A;  1V1F A;  3D0Y B;  1QAT A;  2ZND A;  4DUQ A;  1MUX A;  1XFW O;  3I5I C;  1XFZ O;  1OSA A;  1M63 B;  4XYN A;  5TNC A;  1DF0 A;  2M8U A;  4YGC B;  1KQM C;  2ZN8 A;  2K61 A;  1NSH A;  2LNK A;  2JT3 A;  1FI6 A;  1FBV A;  5KSZ A;  1ALW A;  2KHN A;  5B8I B;  1C7V A;  1DJY A;  2KDH A;  1RFJ A;  1JFK A;  1WY9 A;  3JTD C;  2GGM A;  4U8D A;  1EL4 A;  1ZAC A;  1CDP A;  1Y1X A;  4GAO A;  1C7W A;  3O6B A;  4A4C A;  1B7T Z;  1H4B A;  1REC A;  3BOW B;  1PK0 D;  5I2L A;  1JSA A;  3LL8 B;  4MZL A;  1V1G A;  1RRO A;  1AVS A;  2LMT A;  1XA5 A;  1YUT A;  5AFP A; 
#chains in the Genus database with same CATH topology
 3DXL A;  1AJ4 A;  4DIR A;  4E68 A;  1SYM A;  1YUU A;  2H8V A;  2ZKM X;  3RLZ A;  2L51 A;  4WQ2 A;  2M9G A;  3C1V A;  3O4X A;  3DVJ A;  4MRY A;  1BT6 A;  1YVL A;  1DJX A;  3FE6 A;  2FCE A;  2F33 A;  2K7D A;  2D8N A;  1P28 A;  1QS7 A;  1PRW A;  1LVC D;  2IS9 A;  2Y5I A;  3EK7 A;  3TZ1 A;  3CR5 X;  4IJ7 A;  5FI2 A;  3D76 A;  1GGZ A;  3IF7 A;  1Z2C B;  3KF9 A;  2EC6 C;  3UNW A;  1FI5 A;  3ZNI A;  1ALV A;  1UWO A;  4PCW A;  3QME A;  1JF2 A;  4PHK A;  1L7Z A;  4YI8 A;  2M97 A;  3D74 A;  3RM1 A;  1AUI B;  4ICB A;  3I5G C;  2KLD A;  3BUX B;  5FI7 A;  4PT1 A;  1TIZ A;  4PE4 A;  3TS5 C;  2KFF A;  4HSZ A;  2LV7 A;  3CZ2 A;  2MBX A;  3OHM B;  2LLS A;  1IG5 A;  3R1O A;  4NQG A;  4GNK B;  4L9M A;  1IH0 A;  2L0P A;  5AAN A;  2OS8 B;  3F45 A;  2L4H A;  2KFH A;  1UHI A;  3DY9 A;  2WCK A;  1WDC C;  1AP4 A;  3D75 A;  3DVK A;  1F71 A;  1K95 A;  1NCX A;  2MHH A;  2BCB A;  3SJS A;  5I8N A;  3B88 A;  3BXK A;  1TTX A;  4OZD A;  4PHM A;  1J7O A;  2WND A;  1TNP A;  4HRG A;  2MRD A;  3PM8 A;  1U5I A;  2HPS A;  1G4Y R;  3L4A A;  3A8R A;  1C3Y A;  1OZS A;  2MAZ A;  4JD9 A;  1YRT B;  1GGW A;  1JUO A;  1F4Q A;  4GPL B;  2L2E A;  3NSI A;  1KK7 Z;  4CFR A;  1ODB A;  2F3Y A;  3BUM B;  1B47 A;  1YTZ C;  2NCP A;  3V2L A;  1KFX L;  2ZRT A;  3TDU A;  2CCM A;  2RGI A;  2JTT A;  1SBJ A;  2F2P A;  1SL9 A;  3EVU A;  1JF0 A;  1VRK A;  4PE0 A;  1TNQ A;  5HKZ A;  2M0R A;  1ZMZ A;  1K9U A;  4BY5 A;  3FS7 A;  1J7R A;  1DTL A;  2GTE A;  4N1G A;  3LK1 A;  1G8I A;  1SCM B;  3D77 A;  1BMO A;  1NCZ A;  4FTG A;  1TOP A;  2LVV A;  4PHN A;  3EVR A;  1TCF A;  2KNE A;  2K0J A;  4YGD B;  1C3Z A;  1GJY A;  3PFV A;  2CT9 A;  4PHJ A;  2K60 A;  3D10 A;  3NSO A;  1MHO A;  2M49 B;  1KSM A;  3OGN A;  2LUC A;  2L5X B;  1XFV O;  1AHR A;  2KI4 C;  1NCY A;  3O4Y A;  2JZI A;  4YRU A;  3TUY C;  1WLM A;  2ISD A;  5HLO A;  2LMV A;  2F3Z A;  1NX1 A;  1DJZ A;  4D1E A;  2MA2 A;  2K2F A;  4KYN A;  1J1E A;  2WCH A;  4AQI A;  3AKB A;  2K7B A;  1JWD A;  1SCV A;  2WOS A;  1OZO A;  5ER4 X;  4C0L A;  1KK8 B;  3GK2 A;  4OVN F;  4UPG A;  3SG4 A;  4P2Y B;  1MR8 A;  5CSN A;  1TNW A;  3LLE A;  1SL8 A;  3K1E A;  1OW4 A;  3MSE B;  1TN4 A;  2I7A A;  4OCI A;  3WNX B;  1J7P A;  1CDL A;  4TNC A;  2KBM A;  3WXA A;  2O60 A;  2EGD A;  2LAP A;  2L4I A;  2V53 A;  1Y1A A;  1SKT A;  1CM4 A;  1XO5 A;  2BCA A;  3D73 A;  3DD4 A;  3I5F C;  3DVE A;  3IQQ A;  4YBH B;  5KU1 A;  1CLM A;  1U5I B;  4GGF A;  1CMG A;  3TUY B;  1K94 A;  1SK6 D;  2QAC A;  3RZS A;  1CFC A;  3NXA A;  2BL0 C;  2H61 A;  1T14 A;  4C0J A;  1CKK A;  4GUK A;  3HCM A;  1KFU S;  1F70 A;  2M1U A;  3WHT B;  4QJ4 B;  3KEV A;  3ICB A;  3AAK A;  1QX2 A;  2PYQ A;  2QPT A;  3EK8 A;  4WQ3 A;  1B8R A;  2OTG C;  3I5I B;  3DF0 B;  1B1G A;  1XFY O;  2NZ0 A;  2KPH A;  5FI6 A;  1DEL A;  2E30 A;  1XVJ A;  3R72 A;  1S26 D;  4JKT A;  1K9K A;  2FJY A;  2LHI A;  2K7O A;  3K21 A;  5J3X A;  2P71 A;  1FW4 A;  1LKJ A;  1SNL A;  1KQM B;  1K8U A;  2L2C A;  3N7H A;  1TCO B;  3EK4 A;  1BLQ A;  4I5J A;  1B8L A;  4NDC A;  1WRL A;  1QAS A;  2BE4 A;  2Q91 A;  3JTD B;  3TDZ A;  2R2I A;  5HKW A;  1K96 A;  1A75 A;  2JU0 A;  4ORC B;  5HKY A;  1MWN A;  5CPV A;  2GGZ A;  3PJI A;  3PAT A;  2E6W A;  4MVF A;  4INX A;  2PAS A;  2WC6 A;  2CBL A;  2L5Y A;  3O2P A;  4AOM A;  4I5L B;  1UHH A;  3H4S E;  1CLL A;  2KAY A;  3SIA A;  1RWY A;  2L98 A;  3LCP C;  3OX6 A;  5DKQ A;  1CNP A;  4MN0 A;  3PM2 A;  1PSR A;  2KLE A;  2K2A A;  2KAX A;  2KOT A;  3NHI A;  3PN7 C;  1M31 A;  4GGF C;  4N5X A;  2I2R E;  2GV5 A;  3FE9 A;  1N65 A;  2H61 C;  1YR5 A;  2MLE C;  2F8P A;  2L50 A;  1FF1 A;  1L2O C;  2LUX A;  3OBV A;  2I94 A;  1MQ1 A;  1SY9 A;  2QEH A;  1K93 D;  3FE8 A;  3AKA A;  1IKU A;  1DJG A;  1GM0 A;  3CLN A;  5AEQ A;  1PVB A;  2NLN A;  2P6B B;  2G9B A;  2Y1N A;  1EXR A;  1YX8 A;  2LLU A;  3VRO A;  1SR6 C;  1MF8 B;  1R6P A;  1BJF A;  1IJ5 A;  2EC6 B;  5PAL A;  3FWC A;  3CTN A;  1LIN A;  4M2O A;  1DF0 B;  1CFD A;  1LA0 A;  5I2Q A;  3SS3 A;  4PAL A;  3VRN A;  3SG5 A;  1OMR A;  1YX7 A;  2PAL A;  1KSO A;  1JFJ A;  3R1V A;  2JXL A;  3B87 A;  4JQ0 D;  1KCY A;  4FQT A;  1BF5 A;  3I5G B;  1CTR A;  2KGB C;  1W7J B;  3DVM A;  1A2X A;  4JPZ B;  1YUR A;  2G2B A;  3GK1 A;  1WLZ A;  1B9A A;  1Z4H A;  3TS5 B;  1KWO C;  1YUS A;  1OMD A;  1Y6W A;  1NX2 A;  2JUL A;  3PN7 B;  1TRF A;  1J7Q A;  3S0E A;  4XJK A;  1EJ3 A;  1IQ5 A;  2JPO A;  3FWB A;  4HRE E;  4CID A;  1WRZ A;  2TN4 A;  2Y1M A;  3SIB A;  1QWV A;  1UHK A;  1WDC B;  1XFX O;  3EKJ A;  2BEC A;  4M2P A;  4A4B A;  4QJ5 B;  1EG4 A;  1OQP A;  3DZT A;  4GFT A;  3B6X A;  2JT0 A;  1SW8 A;  1QLK A;  3BOW A;  3NSK A;  2FJU B;  2KAV A;  4HRH A;  5G08 A;  1NYA A;  2LP3 A;  2BAP A;  4ETO A;  1C07 A;  1H8B A;  3JVT C;  3VGO A;  4F0Z B;  1A4P A;  1DGV A;  1OOI X;  2LM5 A;  2LVK A;  1M39 A;  1QXP A;  2HF5 A;  3OX5 A;  1K9P A;  4BY4 A;  1RTP 1;  1ZOT B;  2LE9 B;  3PSR A;  5AER A;  1W9Z A;  1TUJ A;  1UUS A;  2LMU A;  3I5H C;  3VRP A;  4CLN A;  1DJW A;  1PAL A;  1JBA A;  1FPW A;  1IWQ A;  1K90 D;  2LAN A;  2NCO A;  1IRJ A;  1TUZ A;  3L4L A;  5D3O A;  2FCD A;  3SG7 A;  3Q8I A;  1KQV A;  1DGU A;  1NPQ A;  2KSP A;  1G33 A;  3BYA A;  5EL2 A;  4INW A;  3LK0 A;  1XFR A;  2MLF C;  1NWD A;  1DJH A;  1S6I A;  2K7C A;  1UHN A;  1K2H A;  1NP8 A;  3CZT X;  2NXQ A;  1QLS A;  3QRX A;  4IL1 A;  2M7N A;  2LVJ A;  2P70 A;  1TWO A;  3CDN A;  2WCL A;  2FOT A;  4FQO A;  5KTY A;  2F2O A;  1DT7 B;  3CAB A;  1B7T Y;  1KFX S;  1CDN A;  1BR1 B;  1XFU O;  1QIV A;  2QEB A;  3SG3 A;  1YRU B;  2B1U A;  2JNF A;  4WRI A;  3S0A A;  1CB1 A;  4CFQ A;  3PLF B;  1J1D A;  1W7I B;  2COL B;  2QEO A;  2KI4 B;  1Y1U A;  1SL7 A;  2WCM A;  2KBI A;  2M1K B;  4ZCU A;  1N2D A;  1QV1 A;  2JNX A;  4MZJ A;  4QJ3 B;  1LXF C;  4CPV A;  4ORB B;  1DJI A;  5BPJ A;  2LP2 A;  3S0F A;  2I18 A;  2JT8 A;  1GQM A;  2AAO A;  2H2K A;  1XK4 C;  1CFP A;  1S5G Y;  2K8M B;  4C0K A;  1DVI A;  1BG1 A;  3CWG A;  2PSR A;  1DQE A;  4MSP A;  1IQ3 A;  3GK4 X;  2JRF A;  2WCF A;  3BFB A;  1X02 A;  1UP5 A;  3ZWH A;  2BNX A;  3E3R A;  1QX7 A;  5HL1 A;  2KGR A;  4GBA A;  4YGA A;  2QDI A;  4XJK B;  1CM1 A;  1TNX A;  1F55 A;  1QJT A;  1AJ5 A;  1QIW A;  1QVI Y;  4M2Q A;  1F54 A;  3S0D A;  2YGU A;  2AMI A;  1LS8 A;  4MRX A;  2HET A;  1IJ6 A;  5DKN A;  1QX5 B;  4NDB A;  2AUC A;  1M46 A;  2KQY A;  3BJH A;  4PE7 A;  2PRU A;  3S0G A;  1S6C A;  4YGE B;  1BOC A;  3I5F B;  2WCE A;  2ZN9 A;  2ZFD A;  3NGV A;  2SCP A;  1SPY A;  3IVT A;  1MXE A;  2O5G A;  2BL0 B;  5CSI A;  4Q04 A;  2KQ6 A;  2LLT A;  1BU3 A;  3A4U B;  3VB1 A;  4ZCV A;  3M0W A;  2OS8 C;  2KYC A;  3BUW B;  1ZFS A;  3GOF A;  3HX4 A;  2WCJ A;  2OTG B;  1B4C A;  1NX0 A;  1S1E A;  1A29 A;  2PMY A;  2ZRS A;  3EG5 B;  4DS7 A;  1PUL A;  2M3W A;  5K89 A;  2Q4U A;  4I5K A;  5FYX A;  1S5G Z;  1ORG A;  3BFH A;  2BKH B;  1IIO A;  3BUN B;  2WOR A;  1A03 A;  4GGN A;  1RK9 A;  2OPO A;  4NDD A;  4I5N B;  1OOF A;  2BCX A;  3SG6 A;  2JXC A;  2JQ6 A;  1KK7 Y;  1Y0V H;  3BUO B;  1NIW A;  3EKH A;  1QVI Z;  3B86 A;  2BE6 A;  2HQW A;  3CR4 X;  1OE9 B;  2QEV A;  1XYD A;  2BBN A;  1E8A A;  3B7A A;  3D0Y A;  1CLB A;  4OR9 B;  2ERB A;  1DC1 A;  2JPT A;  3S0B A;  2LHL A;  2JTZ A;  2JC2 A;  2JWW A;  5JOL A;  1SMG A;  1DMO A;  1HT9 A;  4ORA B;  2WC8 A;  1LA3 A;  2A4J A;  1R2U A;  4JWQ A;  1YVH A;  1EH2 A;  1D1O A;  1CDM A;  3KO0 A;  1SCM C;  4YI9 A;  4F7F A;  1EG3 A;  1JC2 A;  2CNP A;  2WC5 A;  3CR2 A;  1OOG A;  1UHJ A;  2LC5 A;  1SRA A;  1PSB A;  1L2O B;  3FIA A;  3PAL A;  2VRG A;  1QTX A;  5D69 A;  5I2O A;  2KYF A;  4MLW A;  2BKI B;  2LCP A;  3CGA A;  5F6T A;  3CZ0 A;  1CFF A;  5JJG A;  1N0Y A;  3SG2 A;  4PDZ A;  1SR6 B;  1S6J A;  3WHU B;  1OMV A;  3VRR A;  1SSE B;  2CTN A;  3BQ3 A;  3DF0 A;  2HQ8 A;  3DYE A;  1UUR A;  1AK8 A;  1J55 A;  3OP0 A;  4OKH A;  1F4O A;  1XK4 A;  2CXJ A;  1Q80 A;  2ZNE A;  5D7F A;  2MJW B;  1PVA A;  5ER5 A;  4MBE A;  4R1E A;  2M29 A;  4DCK A;  2BBM A;  5GQQ C;  1MXL C;  1KWO B;  3CS1 A;  2LVI A;  2WCB A;  3NHT A;  5CSF A;  1A75 B;  3KHE A;  1HQV A;  4N1F A;  4YGB B;  1KK8 C;  1B8C A;  1S36 A;  1KFU L;  5DKR A;  3TDI A;  1M45 A;  2SAS A;  3D78 A;  1NUB A;  1OOH A;  3EVV A;  3BFA A;  3NSL A;  1ZUZ A;  2PVB A;  4DRW A;  3O78 A;  1OOJ A;  2M7L A;  3UO9 A;  3AAJ A;  2KI6 C;  3JVT B;  1IGV A;  1RJV A;  2PQL A;  3KPX A;  3IQO A;  3VRQ A;  4PE1 A;  2KI6 D;  5AXI A;  1WRK A;  1CMF A;  5DIC A;  2DOQ A;  2KFG A;  4MZK A;  3OB1 B;  4P5O E;  1S3P A;  1F8H A;  4MEW A;  2JOJ A;  3CZ1 A;  4OV2 A;  1NX3 A;  1QV0 A;  3I5H B;  1BR4 B;  3OB2 B;  2EHB A;  4AQJ A;  1BOD A;  5HLV A;  2Y4Q A;  4USL A;  5HYD A;  5IBW A;  5CSJ A;  1V1F A;  3D0Y B;  1QAT A;  2ZND A;  4DUQ A;  1MUX A;  1XFW O;  3I5I C;  1XFZ O;  1OSA A;  3L47 A;  5I94 A;  3SS5 A;  1DEK A;  3R1P A;  1M63 B;  4XYN A;  5TNC A;  1DF0 A;  2M8U A;  4YGC B;  3SS4 A;  1KQM C;  2ZN8 A;  2K61 A;  1NSH A;  2LNK A;  2JT3 A;  1FI6 A;  1FBV A;  5KSZ A;  1ALW A;  2KHN A;  3CYZ A;  5B8I B;  1C7V A;  1DJY A;  2KDH A;  1RFJ A;  1JFK A;  1WY9 A;  3JTD C;  2GGM A;  4U8D A;  1EL4 A;  1ZAC A;  1CDP A;  1Y1X A;  4GAO A;  1C7W A;  3O6B A;  4A4C A;  1B7T Z;  1H4B A;  1REC A;  3BOW B;  1PK0 D;  5I2L A;  1JSA A;  3LL8 B;  4MZL A;  1V1G A;  1RRO A;  1AVS A;  2LMT A;  1XA5 A;  1YUT A;  5AFP A; 
#chains in the Genus database with same CATH homology
 1AJ4 A;  4DIR A;  4E68 A;  1SYM A;  1YUU A;  2ZKM X;  3RLZ A;  2L51 A;  4WQ2 A;  2M9G A;  3C1V A;  4MRY A;  3DVJ A;  1BT6 A;  1YVL A;  1DJX A;  2FCE A;  2F33 A;  2K7D A;  2D8N A;  1QS7 A;  1PRW A;  1LVC D;  2IS9 A;  2Y5I A;  3EK7 A;  3TZ1 A;  3CR5 X;  1GGZ A;  3IF7 A;  3KF9 A;  2EC6 C;  1FI5 A;  3ZNI A;  1ALV A;  1UWO A;  4PCW A;  1JF2 A;  4PHK A;  1L7Z A;  4YI8 A;  2M97 A;  3RM1 A;  1AUI B;  4ICB A;  3I5G C;  3BUX B;  1TIZ A;  4PE4 A;  3TS5 C;  2KFF A;  4HSZ A;  2LV7 A;  2MBX A;  3OHM B;  2LLS A;  1IG5 A;  1IH0 A;  4NQG A;  4GNK B;  4L9M A;  2L0P A;  5AAN A;  2OS8 B;  3F45 A;  2L4H A;  2KFH A;  1UHI A;  1WDC C;  1AP4 A;  3DVK A;  1F71 A;  1K95 A;  1NCX A;  2MHH A;  2BCB A;  3SJS A;  5I8N A;  3BXK A;  1TTX A;  4PHM A;  1J7O A;  2WND A;  1TNP A;  4HRG A;  2MRD A;  3PM8 A;  1U5I A;  2HPS A;  1G4Y R;  3A8R A;  1OZS A;  2MAZ A;  1YRT B;  1GGW A;  1JUO A;  1F4Q A;  4GPL B;  2L2E A;  3NSI A;  1KK7 Z;  4CFR A;  1ODB A;  2F3Y A;  3BUM B;  1B47 A;  1YTZ C;  2NCP A;  1KFX L;  2ZRT A;  3TDU A;  2CCM A;  2RGI A;  2JTT A;  1SBJ A;  2F2P A;  1SL9 A;  3EVU A;  1JF0 A;  1VRK A;  4PE0 A;  1TNQ A;  5HKZ A;  2M0R A;  1ZMZ A;  1K9U A;  4BY5 A;  3FS7 A;  1J7R A;  1DTL A;  4N1G A;  3LK1 A;  1G8I A;  1SCM B;  1BMO A;  1NCZ A;  4FTG A;  1TOP A;  2LVV A;  4PHN A;  3EVR A;  1TCF A;  2KNE A;  2K0J A;  4YGD B;  1GJY A;  3PFV A;  2CT9 A;  4PHJ A;  3D10 A;  3NSO A;  1MHO A;  2M49 B;  1KSM A;  2LUC A;  2L5X B;  1XFV O;  1AHR A;  2KI4 C;  1NCY A;  3O4Y A;  2JZI A;  4YRU A;  3TUY C;  1WLM A;  2ISD A;  2LMV A;  2F3Z A;  1NX1 A;  1DJZ A;  4D1E A;  2MA2 A;  2K2F A;  1J1E A;  4AQI A;  3AKB A;  2K7B A;  1JWD A;  1SCV A;  2WOS A;  1OZO A;  5ER4 X;  4C0L A;  1KK8 B;  3GK2 A;  4OVN F;  4UPG A;  3SG4 A;  4P2Y B;  1MR8 A;  5CSN A;  1TNW A;  3LLE A;  1SL8 A;  3MSE B;  1TN4 A;  2I7A A;  4OCI A;  3WNX B;  1J7P A;  1CDL A;  4TNC A;  2KBM A;  3WXA A;  2O60 A;  2EGD A;  2LAP A;  2L4I A;  2V53 A;  1Y1A A;  1SKT A;  1CM4 A;  1XO5 A;  2BCA A;  3DD4 A;  3I5F C;  3DVE A;  3IQQ A;  4YBH B;  5KU1 A;  1CLM A;  1U5I B;  4GGF A;  1CMG A;  3TUY B;  1K94 A;  1SK6 D;  2QAC A;  1CFC A;  3NXA A;  2BL0 C;  2H61 A;  4C0J A;  1CKK A;  4GUK A;  3HCM A;  1KFU S;  1F70 A;  2M1U A;  3WHT B;  4QJ4 B;  3KEV A;  3ICB A;  3AAK A;  1QX2 A;  2QPT A;  3EK8 A;  4WQ3 A;  1B8R A;  2OTG C;  3I5I B;  3DF0 B;  1B1G A;  1XFY O;  2NZ0 A;  2E30 A;  1XVJ A;  1S26 D;  1K9K A;  2LHI A;  2K7O A;  3K21 A;  5J3X A;  1FW4 A;  1LKJ A;  1SNL A;  1KQM B;  1K8U A;  1TCO B;  3EK4 A;  1BLQ A;  4I5J A;  1B8L A;  4NDC A;  1WRL A;  1QAS A;  2BE4 A;  2Q91 A;  3JTD B;  3TDZ A;  2R2I A;  5HKW A;  1K96 A;  1A75 A;  2JU0 A;  4ORC B;  5HKY A;  1MWN A;  5CPV A;  2GGZ A;  3PAT A;  2E6W A;  4MVF A;  2PAS A;  2CBL A;  3O2P A;  4AOM A;  4I5L B;  1UHH A;  3H4S E;  1CLL A;  2KAY A;  3SIA A;  1RWY A;  2L98 A;  3LCP C;  3OX6 A;  5DKQ A;  1CNP A;  4MN0 A;  1PSR A;  2KOT A;  2K2A A;  2KAX A;  3PN7 C;  4GGF C;  4N5X A;  1M31 A;  2I2R E;  2GV5 A;  1N65 A;  2H61 C;  1YR5 A;  2MLE C;  2F8P A;  2L50 A;  1FF1 A;  1L2O C;  2LUX A;  2I94 A;  1MQ1 A;  1SY9 A;  1K93 D;  3AKA A;  1IKU A;  1DJG A;  3CLN A;  5AEQ A;  1PVB A;  2NLN A;  2P6B B;  2G9B A;  2Y1N A;  1EXR A;  1YX8 A;  2LLU A;  3VRO A;  1SR6 C;  1MF8 B;  1R6P A;  1BJF A;  1IJ5 A;  2EC6 B;  5PAL A;  3FWC A;  3CTN A;  1LIN A;  4M2O A;  1DF0 B;  1CFD A;  1LA0 A;  5I2Q A;  4PAL A;  3VRN A;  3SG5 A;  1OMR A;  1YX7 A;  2PAL A;  1KSO A;  1JFJ A;  2JXL A;  4JQ0 D;  1KCY A;  1BF5 A;  3I5G B;  1CTR A;  2KGB C;  1W7J B;  3DVM A;  1A2X A;  4JPZ B;  1YUR A;  2G2B A;  3GK1 A;  1WLZ A;  1B9A A;  3TS5 B;  1KWO C;  1YUS A;  1OMD A;  1Y6W A;  1NX2 A;  2JUL A;  3PN7 B;  1TRF A;  1J7Q A;  4XJK A;  1EJ3 A;  1IQ5 A;  3FWB A;  4HRE E;  4CID A;  1WRZ A;  2TN4 A;  2Y1M A;  3SIB A;  1UHK A;  1WDC B;  1XFX O;  3EKJ A;  2BEC A;  4M2P A;  4A4B A;  4QJ5 B;  1EG4 A;  1OQP A;  4GFT A;  3NSK A;  2JT0 A;  1SW8 A;  1QLK A;  3BOW A;  4HRH A;  2FJU B;  2KAV A;  5G08 A;  5HLO A;  1NYA A;  2LP3 A;  1C07 A;  4ETO A;  1H8B A;  3JVT C;  3VGO A;  4F0Z B;  1A4P A;  1DGV A;  2LM5 A;  2LVK A;  1M39 A;  1QXP A;  2HF5 A;  3OX5 A;  1K9P A;  4BY4 A;  1RTP 1;  1ZOT B;  2LE9 B;  3PSR A;  5AER A;  2LMU A;  4CLN A;  1UUS A;  3VRP A;  3I5H C;  1JBA A;  1FPW A;  1DJW A;  1PAL A;  1IWQ A;  1K90 D;  2LAN A;  2NCO A;  1IRJ A;  3SG7 A;  2FCD A;  1KQV A;  1DGU A;  1NPQ A;  2KSP A;  1G33 A;  3BYA A;  3LK0 A;  2MLF C;  1NWD A;  1DJH A;  1S6I A;  2K7C A;  1UHN A;  1K2H A;  1NP8 A;  3CZT X;  2NXQ A;  1QLS A;  3QRX A;  4IL1 A;  2M7N A;  2LVJ A;  2FOT A;  4FQO A;  5KTY A;  2F2O A;  1DT7 B;  1B7T Y;  1KFX S;  1CDN A;  1BR1 B;  1XFU O;  1QIV A;  3SG3 A;  1YRU B;  2B1U A;  2JNF A;  4WRI A;  1CB1 A;  4CFQ A;  3PLF B;  1J1D A;  1W7I B;  2COL B;  2KI4 B;  1Y1U A;  1SL7 A;  2KBI A;  2M1K B;  4ZCU A;  1N2D A;  1QV1 A;  2JNX A;  4MZJ A;  4QJ3 B;  1LXF C;  4CPV A;  4ORB B;  1DJI A;  5BPJ A;  2LP2 A;  2I18 A;  2JT8 A;  1GQM A;  2AAO A;  2H2K A;  1XK4 C;  1CFP A;  1S5G Y;  2K8M B;  4C0K A;  1DVI A;  1BG1 A;  3CWG A;  2PSR A;  4MSP A;  1IQ3 A;  3GK4 X;  2JRF A;  2WCF A;  1X02 A;  1UP5 A;  3ZWH A;  3E3R A;  1QX7 A;  2KGR A;  4GBA A;  4YGA A;  4XJK B;  1CM1 A;  1TNX A;  1F55 A;  1QJT A;  1AJ5 A;  1QIW A;  1QVI Y;  4M2Q A;  1F54 A;  2AMI A;  4MRX A;  2HET A;  1IJ6 A;  5DKN A;  1QX5 B;  4NDB A;  2AUC A;  1M46 A;  2KQY A;  4PE7 A;  2PRU A;  1S6C A;  4YGE B;  1BOC A;  3I5F B;  2WCE A;  2ZN9 A;  2ZFD A;  2SCP A;  1SPY A;  1MXE A;  2O5G A;  2BL0 B;  5CSI A;  4Q04 A;  2KQ6 A;  2LLT A;  1BU3 A;  3A4U B;  4ZCV A;  3M0W A;  2OS8 C;  2KYC A;  3BUW B;  1ZFS A;  3GOF A;  3HX4 A;  1B4C A;  2OTG B;  1NX0 A;  1S1E A;  1A29 A;  2PMY A;  2ZRS A;  4DS7 A;  1PUL A;  2M3W A;  5K89 A;  2Q4U A;  4I5K A;  5FYX A;  1S5G Z;  2BKH B;  3BUN B;  2WOR A;  1A03 A;  4GGN A;  1RK9 A;  2OPO A;  4NDD A;  4I5N B;  2BCX A;  3SG6 A;  2JXC A;  2JQ6 A;  1KK7 Y;  1Y0V H;  3BUO B;  1NIW A;  3EKH A;  1QVI Z;  2BE6 A;  2HQW A;  3CR4 X;  1OE9 B;  1XYD A;  2BBN A;  1E8A A;  3D0Y A;  1CLB A;  4OR9 B;  2JPT A;  2LHL A;  2JTZ A;  2JC2 A;  2JWW A;  5JOL A;  1SMG A;  1DMO A;  1HT9 A;  4ORA B;  2WC8 A;  1LA3 A;  2A4J A;  1R2U A;  4JWQ A;  1YVH A;  1EH2 A;  1D1O A;  1CDM A;  3KO0 A;  1SCM C;  4YI9 A;  1JC2 A;  1EG3 A;  2CNP A;  3CR2 A;  3PAL A;  1UHJ A;  2LC5 A;  1SRA A;  1PSB A;  1L2O B;  3FIA A;  5D69 A;  2VRG A;  1QTX A;  5I2O A;  2KYF A;  4MLW A;  2BKI B;  2LCP A;  3CGA A;  5F6T A;  1CFF A;  5JJG A;  1N0Y A;  3SG2 A;  4PDZ A;  1SR6 B;  1S6J A;  3WHU B;  1OMV A;  3VRR A;  2CTN A;  3BQ3 A;  3DF0 A;  2HQ8 A;  1AK8 A;  1UUR A;  1J55 A;  3OP0 A;  4OKH A;  1F4O A;  1XK4 A;  2CXJ A;  1Q80 A;  2ZNE A;  5D7F A;  2MJW B;  1PVA A;  5ER5 A;  4MBE A;  4R1E A;  2M29 A;  4DCK A;  2BBM A;  5GQQ C;  1MXL C;  1KWO B;  3CS1 A;  2LVI A;  2WCB A;  5CSF A;  1A75 B;  3KHE A;  1HQV A;  4N1F A;  4YGB B;  1KK8 C;  1B8C A;  1S36 A;  1KFU L;  5DKR A;  3TDI A;  1M45 A;  2SAS A;  1NUB A;  3EVV A;  3NSL A;  1ZUZ A;  2PVB A;  4DRW A;  3O78 A;  1OOJ A;  2M7L A;  3AAJ A;  2KI6 C;  3JVT B;  1IGV A;  1RJV A;  3KPX A;  3IQO A;  3VRQ A;  4PE1 A;  2KI6 D;  5AXI A;  1WRK A;  1CMF A;  2DOQ A;  2KFG A;  4MZK A;  3OB1 B;  4P5O E;  1S3P A;  1F8H A;  4MEW A;  2JOJ A;  4OV2 A;  1NX3 A;  1QV0 A;  3I5H B;  1BR4 B;  3OB2 B;  2EHB A;  4AQJ A;  1BOD A;  5HLV A;  2Y4Q A;  4USL A;  5HYD A;  5IBW A;  5CSJ A;  1V1F A;  3D0Y B;  1QAT A;  2ZND A;  4DUQ A;  1MUX A;  1XFW O;  3I5I C;  1XFZ O;  1OSA A;  1M63 B;  4XYN A;  5TNC A;  1DF0 A;  2M8U A;  4YGC B;  1KQM C;  2ZN8 A;  2K61 A;  1NSH A;  2LNK A;  2JT3 A;  1FI6 A;  1FBV A;  5KSZ A;  1ALW A;  2KHN A;  5B8I B;  1C7V A;  1DJY A;  2KDH A;  1RFJ A;  1JFK A;  1WY9 A;  3JTD C;  2GGM A;  4U8D A;  1EL4 A;  1ZAC A;  1CDP A;  1Y1X A;  4GAO A;  1C7W A;  3O6B A;  4A4C A;  1B7T Z;  1H4B A;  1REC A;  3BOW B;  1PK0 D;  5I2L A;  1JSA A;  3LL8 B;  4MZL A;  1V1G A;  1RRO A;  1AVS A;  2LMT A;  1XA5 A;  1YUT A;  5AFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...