1PSRA

Human psoriasin (s100a7)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
100
structure length
100
Chain Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ef-hand protein
molecule keywords PSORIASIN
publication title EF-hands at atomic resolution: the structure of human psoriasin (S100A7) solved by MAD phasing.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1psrA00
3EKJA 4YGAA 1LINA 4DCKA 2K7BA 1Q80A 1BOCA 4OR9B 5PALA 4CLNA 1G8IA 1YRUB 1IQ3A 4XYNA 4PHMA 1BMOA 2EGDA 1K95A 3BXKA 3O6BA 5I8NA 1EL4A 2K2FA 4HRHA 3MSEB 1CDMA 2JT3A 3RM1A 2LVIA 3VRQA 5CPVA 1UHKA 1A4PA 3H4SE 3WNXB 1SL8A 2LMUA 2Y1MA 1J1DA 3NSLA 3ZWHA 2FCEA 2NZ0A 3PLFB 1QATA 4MLWA 1JF2A 2WCBA 1Y0VH 1J7RA 2SASA 3LK0A 2I94A 4DRWA 2G2BA 4I5JA 1KK8C 1M31A 4I5NB 1QS7A 2NCPA 1KFXL 1RROA 2Q4UA 1IRJA 1A29A 1TCFA 2GV5A 2ZN9A 4YGEB 2ZRSA 1LA3A 1BT6A 1OSAA 3CGAA 5FYXA 1WDCB 3GK4X 2WCFA 3O4YA 1IJ6A 3M0WA 4PE7A 4UPGA 2WCEA 2KQ6A 2HQ8A 1MXLC 1KQVA 1J55A 1TTXA 1SW8A 2BCXA 1KK7Z 3BUWB 3VRNA 1K8UA 1J7QA 1BG1A 3BUXB 2CBLA 4D1EA 1PVBA 1S1EA 5CSJA 3PFVA 3CLNA 2KFHA 4YI8A 1QXPA 1TNQA 2LP2A 2M8UA 2BE6A 2JXCA 1BODA 1GGZA 4JWQA 2F3YA 4MN0A 1SCVA 1S6CA 4DS7A 1OZSA 3FS7A 4JQ0D 3I5IB 1NX0A 1JF0A 1F70A 4GFTA 1Y1UA 3SIAA 1DJXA 1M63B 2KHNA 4WRIA 1CDLA 1RWYA 2ZN8A 4M2PA 2JU0A 1QLKA 1A75B 5AFPA 4I5LB 2KAYA 2FCDA 4N1GA 1L2OC 2LLTA 2LMTA 1EG4A 1QJTA 3AAKA 3DF0B 3C1VA 1L7ZA 3PN7C 4PHJA 3DVEA 2KBMA 1ALVA 2M1KB 4YGBB 3TUYC 3K21A 1B8RA 1SMGA 2KI4B 1SR6B 2HETA 2JTZA 2JNXA 1UHJA 2MRDA 4AOMA 1F4OA 3WXAA 1R2UA 1YUTA 1C7VA 1S5GY 2H61A 2TN4A 2G9BA 1S26D 2LLUA 2MAZA 3JTDB 2LVVA 2PASA 4I5KA 1JFKA 2K2AA 4M2OA 4MRYA 3LCPC 1N2DA 3I5GC 2JOJA 2M0RA 1DJYA 3PALA 1N0YA 4C0LA 4OCIA 1CFDA 3BUNB 3AAJA 1NUBA 1EJ3A 1F55A 1BR4B 1DT7B 5HLVA 4YBHB 3KPXA 3IQOA 3OX5A 2JT8A 1IG5A 4HRGA 2OPOA 1WY9A 4ZCVA 1H4BA 5I2QA 1J7PA 1TNXA 2FOTA 1XVJA 2I7AA 1M45A 3EVRA 1CLBA 1G4YR 5AXIA 2KNEA 2BL0C 1B47A 3OB1B 2Y5IA 2F33A 5CSIA 5D7FA 2LCPA 1ZFSA 1YTZC 1IQ5A 2HF5A 1NYAA 2KI6C 1UUSA 1IGVA 4ZCUA 3SG2A 2O60A 1R6PA 2ZFDA 4USLA 1SYMA 1IH0A 1B9AA 1DJWA 4N5XA 3A4UB 3O78A 1F4QA 4QJ4B 1KWOB 2CTNA 4ETOA 1BU3A 4L9MA 5AERA 1B1GA 1TIZA 1GQMA 3KO0A 1FI6A 3CR2A 1BLQA 1K96A 1SL7A 1D1OA 4QJ3B 2L4IA 4YI9A 1IKUA 1JC2A 3CTNA 3TDZA 2OTGB 3EK4A 1PALA 2L0PA 1KSMA 4P5OE 1S3PA 2M7LA 1Y1AA 1ZACA 2D8NA 3BUMB 3BOWA 3IF7A 1KK8B 3KHEA 2QACA 4GGNA 2JPTA 1AUIB 3TDIA 2DOQA 2E6WA 3I5HB 2AAOA 4AQIA 1XFYO 1PRWA 1SCMC 1W7IB 1LXFC 1V1FA 1SK6D 2L5XB 4U8DA 1JSAA 3LK1A 1PVAA 3BQ3A 3NSOA 3PSRA 3EK8A 1NCYA 2P6BB 2PMYA 3SG3A 5HKYA 1OZOA 1MF8B 1S5GZ 2LHLA 5GQQC 2RGIA 2KAVA 2PSRA 3JVTC 5AANA 3HX4A 1F54A 5KTYA 3CWGA 1E8AA 4XJKB 1YUUA 3OB2B 1BF5A 2CCMA 1YVHA 1YVLA 2L4HA 2O5GA 4MZKA 3ZNIA 3A8RA 4PDZA 2LLSA 4XJKA 1NX1A 2NCOA 1CTRA 1K2HA 1YR5A 1SKTA 2MA2A 1MQ1A 2M1UA 4MZJA 4E68A 2L98A 3IQQA 4MSPA 1QX7A 1FF1A 1LVCD 1HQVA 1WLZA 1NPQA 4F0ZB 1UP5A 2JTTA 2EC6C 1PK0D 1UWOA 1J1EA 3I5FC 4TNCA 1A2XA 1OOJA 2SCPA 4A4CA 1CB1A 4AQJA 5KSZA 1OQPA 1ZOTB 4PE1A 1EG3A 3E3RA 3GK1A 1CM4A 1QV1A 3KF9A 1SNLA 3NSKA 1CMGA 2KBIA 1B7TY 1CNPA 1Y6WA 3PM8A 1PSBA 1H8BA 3VGOA 1L2OB 2MLEC 1CKKA 3ICBA 2WNDA 3QRXA 1U5IA 2K61A 3PN7B 2PALA 2GGZA 3TS5B 2JRFA 3CS1A 5JJGA 2M3WA 2BECA 1F8HA 2LANA 2KYCA 3TUYB 2LC5A 4CFRA 2KFGA 1NSHA 2CXJA 2KI6D 3FIAA 3CR5X 3WHUB 1CMFA 2PRUA 5KU1A 1SBJA 3LLEA 1YURA 1QIWA 5B8IB 3NSIA 3BUOB 5HLOA 3I5GB 4CFQA 1TCOB 3OX6A 4MBEA 1CLMA 1M46A 2KOTA 5CSFA 4WQ2A 1DGUA 4GAOA 4DIRA 1SR6C 3VRPA 3VRRA 2MLFC 4WQ3A 1KQMC 2BE4A 1K94A 5AEQA 3D10A 1S6IA 1SPYA 2HPSA 4GBAA 1KSOA 5I2OA 4CPVA 3F45A 1DMOA 1PULA 1FPWA 2LVKA 1C7WA 1ZMZA 2BL0B 3OP0A 4N1FA 4YGDB 5DKNA 2ZNEA 2VRGA 1A03A 2KQYA 1SL9A 2OS8C 1AVSA 4GGFC 1XFWO 1ZUZA 2LAPA 2LHIA 5TNCA 1ODBA 3HCMA 4DUQA 3PATA 5JOLA 1TNWA 2BBMA 2I18A 2F8PA 4GGFA 1XK4C 2HQWA 2Y1NA 2FJUB 2CNPA 2JWWA 4NDBA 5D69A 1QTXA 3CR4X 3EVUA 4BY4A 4C0JA 1AHRA 1JUOA 2LE9B 4OVNF 1UHIA 1MXEA 4HSZA 1XK4A 3NXAA 1NCXA 3DD4A 4OKHA 5DKQA 5IBWA 1GGWA 2M29A 1NX2A 1MUXA 1DJGA 2LP3A 3O2PA 1C07A 1FBVA 1MHOA 2KAXA 1NWDA 1FI5A 1VRKA 4GUKA 3SG7A 1DGVA 3BOWB 2ZNDA 1B7TZ 1KWOC 4BY5A 2Q91A 4NDCA 2JQ6A 1DJHA 1ALWA 1V1GA 2KSPA 1XYDA 3TDUA 1UHNA 3D0YB 4P2YB 4PCWA 1QX2A 3EVVA 3DVKA 1JBAA 1K9UA 3D0YA 3LL8B 1KFXS 5G08A 2WOSA 1YX8A 1KFUS 2GGMA 1SCMB 2OTGC 3FWBA 4R1EA 1X02A 2F2PA 2NXQA 2NLNA 2E30A 1AJ5A 5DKRA 2A4JA 4IL1A 1XFZO 2K7OA 1NIWA 1WRKA 1XO5A 3JVTB 1SY9A 4M2QA 2CT9A 1IJ5A 4MZLA 1KFUL 1DTLA 3I5HC 1K93D 4PHNA 2K8MB 3AKAA 1WDCC 4PE0A 1RTP1 3WHTB 1S36A 1QX5B 4HREE 5ER4X 5CSNA 2WORA 1M39A 2KDHA 5HKZA 1RFJA 2BCAA 3SG5A 3AKBA 3GK2A 4FQOA 1LKJA 3EK7A 1DJIA 2I2RE 3TZ1A 1AJ4A 4MVFA 1QLSA 3CZTX 1F71A 1QV0A 3DVJA 3SJSA 1HT9A 1PSRA 2EC6B 5F6TA 2EHBA 5J3XA 2BKHB 3I5FB 3VROA 1XA5A 1QVIZ 1BJFA 3SG4A 1NP8A 2JZIA 4MEWA 1KCYA 1WRZA 1TRFA 2R2IA 1RK9A 1JFJA 1CFFA 2L50A 2L2EA 2JNFA 1K9KA 1CM1A 1U5IB 1RECA 1FW4A 4Q04A 2M9GA 1CDNA 1CDPA 1S6JA 4NDDA 4JPZB 3I5IC 1K90D 2JT0A 3OHMB 2LM5A 4A4BA 1DF0B 2F3ZA 5K89A 1NCZA 2JXLA 3DVMA 1Y1XA 2ISDA 1N65A 1DF0A 1XFXO 2ZKMX 1CLLA 2AUCA 2M7NA 1OMVA 1YUSA 4ORCB 2PVBA 2IS9A 1A75A 2KGBC 1QASA 4ORBB 1RJVA 1OMRA 4FTGA 1BR1B 2K7CA 2ZRTA 2L51A 3RLZA 2M97A 1WRLA 2KFFA 3TS5C 2LNKA 1J7OA 2KI4C 1SRAA 1UURA 3DF0A 1AP4A 1CFCA 1B4CA 2AMIA 4GNKB 2H61C 4YRUA 2F2OA 4OV2A 4MRXA 2MBXA 1KQMB 3SG6A 4QJ5B 1TOPA 1WLMA 3JTDC 2WC8A 1MR8A 1KK7Y 4CIDA 5I2LA 1DJZA 1NX3A 1XFUO 3GOFA 5ER5A 4C0KA 1EXRA 2MJWB 2JC2A 2K7DA 1QVIY 4PALA 1K9PA 2K0JA 2LV7A 4ICBA 5HKWA 1B8CA 2H2KA 3SIBA 2BCBA 1DVIA 1MWNA 1OMDA 1OE9B 2LUCA 1W7JB 2Y4QA 2BKIB 2OS8B 4NQGA 4ORAB 1AK8A 2B1UA 1B8LA 1UHHA 2MHHA 2KYFA 3FWCA 2COLB 2LUXA 3BYAA 1YRTB 3KEVA 4PHKA 1G33A 2V53A 5BPJA 1LA0A 4YGCB 1QIVA 1JWDA 1YX7A 4PE4A 1TN4A 4GPLB 1CFPA 1IWQA 1GJYA 2LVJA 5HYDA 2KGRA 2LMVA 2QPTA 1EH2A 3EKHA 2M49B 1TNPA 1XFVO 2JULA 2BBNA
chains in the Genus database with same CATH superfamily
3EKJA 4YGAA 1LINA 4DCKA 2K7BA 2QEVA 1Q80A 1BOCA 4OR9B 2H8VA 5PALA 4CLNA 1G8IA 1YRUB 1IQ3A 4XYNA 4INWA 1BMOA 2EGDA 4PHMA 1K95A 3BXKA 3O6BA 1OOIX 5I8NA 4I5KA 1EL4A 2K2FA 4HRHA 3MSEB 1DELA 5I94A 1CDMA 2JT3A 3RM1A 3BFBA 2LVIA 3VRQA 5CPVA 1UHKA 1A4PA 3H4SE 3WNXB 1SL8A 2LMUA 2Y1MA 1J1DA 2WCKA 3OGNA 3NSLA 3ZWHA 2FCEA 2NZ0A 3PLFB 1QATA 4MLWA 1JF2A 2WCBA 1Y0VH 1J7RA 2SASA 2P71A 2I94A 3LK0A 4DRWA 2G2BA 4I5JA 1KK8C 1M31A 4I5NB 1QS7A 1Z4HA 1KFXL 2NCPA 1RROA 2Q4UA 1IRJA 3SS5A 1A29A 1TCFA 2GV5A 2ZN9A 4YGEB 2ZRSA 1LA3A 1BT6A 1OSAA 3CGAA 5FYXA 1WDCB 3GK4X 2WCFA 3O4YA 1IJ6A 3M0WA 4PE7A 1DC1A 4UPGA 2WCEA 2KQ6A 2HQ8A 1MXLC 3NGVA 3DXLA 1KQVA 1J55A 1TTXA 2L2CA 1SW8A 2BCXA 1KK7Z 3BUWB 1W9ZA 3VRNA 1K8UA 1J7QA 1BG1A 3BUXB 2CBLA 4D1EA 1PVBA 1S1EA 5CSJA 3PFVA 2YGUA 3CLNA 1OOHA 2KFHA 3NHIA 4YI8A 1QXPA 1TNQA 2LP2A 4JD9A 2M8UA 2BE6A 2JXCA 1BODA 1GGZA 4JWQA 2F3YA 3B88A 4MN0A 1SCVA 1S6CA 1XFRA 4DS7A 1OZSA 3CZ1A 3FS7A 3PM2A 4JQ0D 3UNWA 1OW4A 3I5IB 1NX0A 1JF0A 1F70A 4GFTA 1Y1UA 3SIAA 1DJXA 1M63B 2KHNA 4WRIA 2WCHA 1CDLA 1RWYA 2ZN8A 4M2PA 2JU0A 1QLKA 1A75B 2ERBA 5AFPA 4I5LB 2KAYA 2FCDA 4N1GA 1L2OC 2LLTA 2LMTA 1EG4A 1QJTA 3AAKA 3DF0B 3C1VA 1L7ZA 3PN7C 4PHJA 3DVEA 2KBMA 2PQLA 1ALVA 2M1KB 3R1OA 4YGBB 3TUYC 3K21A 1B8RA 1SMGA 2KI4B 1SR6B 2PYQA 3RZSA 2HETA 2JTZA 2JNXA 1UHJA 2MRDA 4AOMA 1F4OA 3WXAA 1R2UA 3QMEA 1YUTA 1C7VA 1S5GY 2H61A 2TN4A 2G9BA 1S26D 2LLUA 2MAZA 3CZ0A 2LVVA 2PASA 3JTDB 1JFKA 2K2AA 4M2OA 4MRYA 3LCPC 1N2DA 1OOGA 3Q8IA 3I5GC 2JOJA 2M0RA 1DJYA 3L4AA 1DQEA 1N0YA 3PALA 4C0LA 2BNXA 4OCIA 1CFDA 3BUNB 3AAJA 1NUBA 1EJ3A 1F55A 1BR4B 1DT7B 5HLVA 4YBHB 3KPXA 3IQOA 3OX5A 2JT8A 2FJYA 1IG5A 4HRGA 2OPOA 1WY9A 4ZCVA 1H4BA 5I2QA 1J7PA 1C3ZA 1TNXA 1XVJA 2FOTA 3DYEA 2I7AA 1M45A 3EVRA 1CLBA 1G4YR 5AXIA 2KNEA 2BL0C 1B47A 3OB1B 2Y5IA 2F33A 2K60A 5CSIA 2JPOA 5D7FA 5FI7A 2LCPA 1ZFSA 1YTZC 1IQ5A 2HF5A 1NYAA 2KI6C 1UUSA 1IGVA 4ZCUA 3SG2A 2O60A 1R6PA 2ZFDA 4USLA 5EL2A 1SYMA 3B6XA 1B9AA 1IH0A 1DJWA 4N5XA 3A4UB 4OZDA 3O78A 1F4QA 4QJ4B 3IVTA 1KWOB 3S0FA 2CTNA 4ETOA 1BU3A 4L9MA 5AERA 1B1GA 1QWVA 1TIZA 1LS8A 1Z2CB 1GQMA 3KO0A 1FI6A 3CR2A 1BLQA 1K96A 1SL7A 3NHTA 2QEOA 1D1OA 4QJ3B 2L4IA 4YI9A 1IKUA 1JC2A 3CTNA 1TUZA 3TDZA 2OTGB 3EK4A 2KLEA 1PALA 2L0PA 1KSMA 4P5OE 1S3PA 2BAPA 2M7LA 3SS3A 1Y1AA 1ZACA 3D74A 2D8NA 3BUMB 3BOWA 3IF7A 5FI2A 2WCJA 1KK8B 3KHEA 2QACA 4GGNA 2JPTA 1AUIB 3TDIA 2WC6A 2DOQA 2E6WA 3I5HB 2AAOA 4AQIA 1XFYO 1PRWA 1SCMC 1W7IB 1LXFC 1V1FA 1SK6D 2L5XB 4U8DA 1JSAA 3LK1A 1PVAA 3BQ3A 3NSOA 3PSRA 3EK8A 4KYNA 1NCYA 2P6BB 2PMYA 3SG3A 5HKYA 1OZOA 1MF8B 1S5GZ 2LHLA 5GQQC 2RGIA 2KAVA 2PSRA 3JVTC 5AANA 3HX4A 1F54A 5KTYA 3CWGA 1E8AA 4XJKB 1YUUA 3OB2B 1BF5A 2CCMA 1YVHA 1YVLA 2L4HA 2O5GA 4IJ7A 4MZKA 3ZNIA 3A8RA 4PDZA 2LLSA 4XJKA 1NX1A 2NCOA 1CTRA 1K2HA 1YR5A 1SKTA 2MA2A 3D76A 1MQ1A 2M1UA 4MZJA 2QEBA 4E68A 2L98A 3IQQA 4MSPA 1QX7A 1FF1A 1LVCD 1GM0A 3B7AA 3CYZA 1HQVA 1WLZA 3BJHA 1NPQA 4F0ZB 1UP5A 2JTTA 2EC6C 3S0DA 2L5YA 1PK0D 1UWOA 1J1EA 3I5FC 4TNCA 1A2XA 1OOJA 2SCPA 4A4CA 1CB1A 1IIOA 4AQJA 5KSZA 1OQPA 3K1EA 1ZOTB 4PE1A 1EG3A 3E3RA 3GK1A 1CM4A 1QV1A 4FQTA 3KF9A 1SNLA 3NSKA 1CMGA 2KBIA 1B7TY 1CNPA 1Y6WA 1ORGA 3PM8A 5FI6A 1PSBA 1H8BA 3VGOA 1L2OB 2MLEC 1CKKA 3ICBA 2WNDA 3FE6A 3QRXA 1U5IA 2K61A 3PN7B 2PALA 2GGZA 3TS5B 2JRFA 3CS1A 5JJGA 2M3WA 2BECA 1F8HA 2LANA 2KYCA 3TUYB 2LC5A 3R72A 4CFRA 2KFGA 1NSHA 3DY9A 2CXJA 2KI6D 3FIAA 2KLDA 3CR5X 4JKTA 3WHUB 1CMFA 2PRUA 5KU1A 1SBJA 3LLEA 1YURA 1QIWA 5B8IB 3NSIA 3BUOB 5HLOA 3I5GB 4CFQA 1TCOB 3OX6A 4MBEA 1CLMA 1M46A 2KOTA 5CSFA 4F7FA 4WQ2A 1DGUA 4GAOA 4DIRA 1SR6C 3VRPA 3VRRA 2MLFC 4WQ3A 1KQMC 2BE4A 1K94A 5AEQA 3D10A 1C3YA 1S6IA 1SPYA 2HPSA 4GBAA 1KSOA 5I2OA 4CPVA 3F45A 3FE9A 1PULA 1DMOA 1FPWA 2LVKA 1C7WA 1ZMZA 2BL0B 3OP0A 4N1FA 4YGDB 5DKNA 2ZNEA 2VRGA 1A03A 2KQYA 1SL9A 1SSEB 2OS8C 1AVSA 3N7HA 4PT1A 4GGFC 1XFWO 1ZUZA 2LAPA 2LHIA 3PJIA 1ODBA 3HCMA 5TNCA 4DUQA 3PATA 5JOLA 1TNWA 2BBMA 2I18A 3VB1A 2F8PA 4GGFA 1XK4C 3UO9A 2HQWA 2Y1NA 2FJUB 2CNPA 2JWWA 4NDBA 5D69A 1QTXA 2QDIA 3CR4X 3EVUA 4BY4A 4C0JA 1AHRA 1JUOA 2QEHA 2LE9B 4OVNF 1UHIA 1MXEA 4HSZA 1XK4A 3NXAA 1NCXA 2P70A 3DD4A 4OKHA 1DEKA 5DKQA 5IBWA 1GGWA 2M29A 1NX2A 1MUXA 1DJGA 2LP3A 3O2PA 1C07A 5DICA 1FBVA 1MHOA 2KAXA 1NWDA 1FI5A 1VRKA 4GUKA 3SG7A 1DGVA 3BOWB 2ZNDA 1T14A 1B7TZ 1KWOC 4BY5A 2WC5A 2Q91A 2WCMA 4NDCA 2JQ6A 1DJHA 1ALWA 1V1GA 2KSPA 1XYDA 3TDUA 1UHNA 3D0YB 4P2YB 3S0AA 4PCWA 1QX2A 3EVVA 3DVKA 3EG5B 1JBAA 1K9UA 3D0YA 3D78A 3LL8B 1KFXS 3S0EA 5D3OA 5G08A 2WOSA 1YX8A 1KFUS 2GGMA 1SCMB 2OTGC 3FWBA 4R1EA 1X02A 2F2PA 2NXQA 2NLNA 2E30A 1AJ5A 3S0GA 5DKRA 2A4JA 4IL1A 1XFZO 2K7OA 1NIWA 1WRKA 1XO5A 3JVTB 1SY9A 3B86A 2CT9A 4M2QA 1IJ5A 4MZLA 1KFUL 2WCLA 1DTLA 3I5HC 1K93D 4PHNA 2K8MB 3AKAA 1WDCC 4PE0A 1RTP1 3WHTB 1S36A 1QX5B 4HREE 5ER4X 5CSNA 2WORA 3CABA 1M39A 2KDHA 5HKZA 1RFJA 2BCAA 3SG5A 3AKBA 3GK2A 4FQOA 1LKJA 3EK7A 1DJIA 2I2RE 3CZ2A 3TZ1A 5HL1A 1AJ4A 4MVFA 1QLSA 3CZTX 1F71A 1QV0A 3FE8A 1TWOA 3DVJA 3SJSA 1TUJA 1HT9A 1PSRA 2EC6B 3L47A 5F6TA 2EHBA 3BFAA 5J3XA 2BKHB 3I5FB 3VROA 1XA5A 1QVIZ 1BJFA 3SG4A 1NP8A 2JZIA 4MEWA 1KCYA 1WRZA 1TRFA 2R2IA 1RK9A 1JFJA 1CFFA 2L50A 2L2EA 2JNFA 1K9KA 1CM1A 1U5IB 1RECA 1FW4A 4Q04A 2M9GA 1CDNA 3O4XA 1CDPA 1S6JA 3BFHA 4NDDA 4JPZB 3I5IC 1K90D 2JT0A 3L4LA 3OHMB 2LM5A 4A4BA 1DF0B 2F3ZA 5K89A 1NCZA 2JXLA 3DVMA 1Y1XA 2ISDA 1N65A 1DF0A 1XFXO 2ZKMX 1CLLA 2AUCA 2M7NA 1OMVA 3D77A 1YUSA 3OBVA 4ORCB 2PVBA 2IS9A 1A75A 3S0BA 2KGBC 1QASA 4ORBB 1RJVA 1OMRA 4FTGA 1BR1B 2K7CA 2ZRTA 2L51A 3RLZA 2M97A 1WRLA 2KFFA 3TS5C 2LNKA 1J7OA 3D73A 2KI4C 1SRAA 1UURA 3DF0A 3R1PA 1AP4A 1CFCA 1B4CA 2AMIA 4GNKB 2H61C 4YRUA 2F2OA 2GTEA 3B87A 4OV2A 4MRXA 4INXA 1KQMB 2MBXA 3SG6A 3CDNA 4QJ5B 1TOPA 1WLMA 3JTDC 2WC8A 1MR8A 1KK7Y 4CIDA 5I2LA 1DJZA 1NX3A 1XFUO 3GOFA 3R1VA 5ER5A 1EXRA 4C0KA 2MJWB 2JC2A 2K7DA 1QVIY 4PALA 1K9PA 2K0JA 2LV7A 4ICBA 5HKWA 3V2LA 1B8CA 2H2KA 3SIBA 2BCBA 1DVIA 1MWNA 1OMDA 1OE9B 2LUCA 1W7JB 2Y4QA 2BKIB 2OS8B 4NQGA 4ORAB 1AK8A 2B1UA 1B8LA 1UHHA 2MHHA 2KYFA 3FWCA 2COLB 2LUXA 2KPHA 3BYAA 1YRTB 3KEVA 4PHKA 1G33A 2V53A 5BPJA 1LA0A 4YGCB 1QIVA 1JWDA 1OOFA 1YX7A 4PE4A 1TN4A 4GPLB 1CFPA 1IWQA 3D75A 1GJYA 2LVJA 5HYDA 2KGRA 2LMVA 2QPTA 1EH2A 1P28A 3EKHA 3SS4A 2M49B 1TNPA 1XFVO 2JULA 2BBNA 3DZTA
chains in the Genus database with same CATH topology
3EKJA 4YGAA 1LINA 4DCKA 2K7BA 1Q80A 1BOCA 4OR9B 5PALA 4CLNA 1G8IA 1YRUB 1IQ3A 4XYNA 4PHMA 1BMOA 2EGDA 1K95A 3BXKA 3O6BA 5I8NA 1EL4A 2K2FA 4HRHA 3MSEB 1CDMA 2JT3A 3RM1A 2LVIA 3VRQA 5CPVA 1UHKA 1A4PA 3H4SE 3WNXB 1SL8A 2LMUA 2Y1MA 1J1DA 3NSLA 3ZWHA 2FCEA 2NZ0A 3PLFB 1QATA 4MLWA 1JF2A 2WCBA 1Y0VH 1J7RA 2SASA 3LK0A 2I94A 4DRWA 2G2BA 4I5JA 1KK8C 1M31A 4I5NB 1QS7A 2NCPA 1KFXL 1RROA 2Q4UA 1IRJA 1A29A 1TCFA 2GV5A 2ZN9A 4YGEB 2ZRSA 1LA3A 1BT6A 1OSAA 3CGAA 5FYXA 1WDCB 3GK4X 2WCFA 3O4YA 1IJ6A 3M0WA 4PE7A 4UPGA 2WCEA 2KQ6A 2HQ8A 1MXLC 1KQVA 1J55A 1TTXA 1SW8A 2BCXA 1KK7Z 3BUWB 3VRNA 1K8UA 1J7QA 1BG1A 3BUXB 2CBLA 4D1EA 1PVBA 1S1EA 5CSJA 3PFVA 3CLNA 2KFHA 4YI8A 1QXPA 1TNQA 2LP2A 2M8UA 2BE6A 2JXCA 1BODA 1GGZA 4JWQA 2F3YA 4MN0A 1SCVA 1S6CA 4DS7A 1OZSA 3FS7A 4JQ0D 3I5IB 1NX0A 1JF0A 1F70A 4GFTA 1Y1UA 3SIAA 1DJXA 1M63B 2KHNA 4WRIA 1CDLA 1RWYA 2ZN8A 4M2PA 2JU0A 1QLKA 1A75B 5AFPA 4I5LB 2KAYA 2FCDA 4N1GA 1L2OC 2LLTA 2LMTA 1EG4A 1QJTA 3AAKA 3DF0B 3C1VA 1L7ZA 3PN7C 4PHJA 3DVEA 2KBMA 1ALVA 2M1KB 4YGBB 3TUYC 3K21A 1B8RA 1SMGA 2KI4B 1SR6B 2HETA 2JTZA 2JNXA 1UHJA 2MRDA 4AOMA 1F4OA 3WXAA 1R2UA 1YUTA 1C7VA 1S5GY 2H61A 2TN4A 2G9BA 1S26D 2LLUA 2MAZA 3JTDB 2LVVA 2PASA 4I5KA 1JFKA 2K2AA 4M2OA 4MRYA 3LCPC 1N2DA 3I5GC 2JOJA 2M0RA 1DJYA 3PALA 1N0YA 4C0LA 4OCIA 1CFDA 3BUNB 3AAJA 1NUBA 1EJ3A 1F55A 1BR4B 1DT7B 5HLVA 4YBHB 3KPXA 3IQOA 3OX5A 2JT8A 1IG5A 4HRGA 2OPOA 1WY9A 4ZCVA 1H4BA 5I2QA 1J7PA 1TNXA 2FOTA 1XVJA 2I7AA 1M45A 3EVRA 1CLBA 1G4YR 5AXIA 2KNEA 2BL0C 1B47A 3OB1B 2Y5IA 2F33A 5CSIA 5D7FA 2LCPA 1ZFSA 1YTZC 1IQ5A 2HF5A 1NYAA 2KI6C 1UUSA 1IGVA 4ZCUA 3SG2A 2O60A 1R6PA 2ZFDA 4USLA 1SYMA 1IH0A 1B9AA 1DJWA 4N5XA 3A4UB 3O78A 1F4QA 4QJ4B 1KWOB 2CTNA 4ETOA 1BU3A 4L9MA 5AERA 1B1GA 1TIZA 1GQMA 3KO0A 1FI6A 3CR2A 1BLQA 1K96A 1SL7A 1D1OA 4QJ3B 2L4IA 4YI9A 1IKUA 1JC2A 3CTNA 3TDZA 2OTGB 3EK4A 1PALA 2L0PA 1KSMA 4P5OE 1S3PA 2M7LA 1Y1AA 1ZACA 2D8NA 3BUMB 3BOWA 3IF7A 1KK8B 3KHEA 2QACA 4GGNA 2JPTA 1AUIB 3TDIA 2DOQA 2E6WA 3I5HB 2AAOA 4AQIA 1XFYO 1PRWA 1SCMC 1W7IB 1LXFC 1V1FA 1SK6D 2L5XB 4U8DA 1JSAA 3LK1A 1PVAA 3BQ3A 3NSOA 3PSRA 3EK8A 1NCYA 2P6BB 2PMYA 3SG3A 5HKYA 1OZOA 1MF8B 1S5GZ 2LHLA 5GQQC 2RGIA 2KAVA 2PSRA 3JVTC 5AANA 3HX4A 1F54A 5KTYA 3CWGA 1E8AA 4XJKB 1YUUA 3OB2B 1BF5A 2CCMA 1YVHA 1YVLA 2L4HA 2O5GA 4MZKA 3ZNIA 3A8RA 4PDZA 2LLSA 4XJKA 1NX1A 2NCOA 1CTRA 1K2HA 1YR5A 1SKTA 2MA2A 1MQ1A 2M1UA 4MZJA 4E68A 2L98A 3IQQA 4MSPA 1QX7A 1FF1A 1LVCD 1HQVA 1WLZA 1NPQA 4F0ZB 1UP5A 2JTTA 2EC6C 1PK0D 1UWOA 1J1EA 3I5FC 4TNCA 1A2XA 1OOJA 2SCPA 4A4CA 1CB1A 4AQJA 5KSZA 1OQPA 1ZOTB 4PE1A 1EG3A 3E3RA 3GK1A 1CM4A 1QV1A 3KF9A 1SNLA 3NSKA 1CMGA 2KBIA 1B7TY 1CNPA 1Y6WA 3PM8A 1PSBA 1H8BA 3VGOA 1L2OB 2MLEC 1CKKA 3ICBA 2WNDA 3QRXA 1U5IA 2K61A 3PN7B 2PALA 2GGZA 3TS5B 2JRFA 3CS1A 5JJGA 2M3WA 2BECA 1F8HA 2LANA 2KYCA 3TUYB 2LC5A 4CFRA 2KFGA 1NSHA 2CXJA 2KI6D 3FIAA 3CR5X 3WHUB 1CMFA 2PRUA 5KU1A 1SBJA 3LLEA 1YURA 1QIWA 5B8IB 3NSIA 3BUOB 5HLOA 3I5GB 4CFQA 1TCOB 3OX6A 4MBEA 1CLMA 1M46A 2KOTA 5CSFA 4WQ2A 1DGUA 4GAOA 4DIRA 1SR6C 3VRPA 3VRRA 2MLFC 4WQ3A 1KQMC 2BE4A 1K94A 5AEQA 3D10A 1S6IA 1SPYA 2HPSA 4GBAA 1KSOA 5I2OA 4CPVA 3F45A 1DMOA 1PULA 1FPWA 2LVKA 1C7WA 1ZMZA 2BL0B 3OP0A 4N1FA 4YGDB 5DKNA 2ZNEA 2VRGA 1A03A 2KQYA 1SL9A 2OS8C 1AVSA 4GGFC 1XFWO 1ZUZA 2LAPA 2LHIA 5TNCA 1ODBA 3HCMA 4DUQA 3PATA 5JOLA 1TNWA 2BBMA 2I18A 2F8PA 4GGFA 1XK4C 2HQWA 2Y1NA 2FJUB 2CNPA 2JWWA 4NDBA 5D69A 1QTXA 3CR4X 3EVUA 4BY4A 4C0JA 1AHRA 1JUOA 2LE9B 4OVNF 1UHIA 1MXEA 4HSZA 1XK4A 3NXAA 1NCXA 3DD4A 4OKHA 5DKQA 5IBWA 1GGWA 2M29A 1NX2A 1MUXA 1DJGA 2LP3A 3O2PA 1C07A 1FBVA 1MHOA 2KAXA 1NWDA 1FI5A 1VRKA 4GUKA 3SG7A 1DGVA 3BOWB 2ZNDA 1B7TZ 1KWOC 4BY5A 2Q91A 4NDCA 2JQ6A 1DJHA 1ALWA 1V1GA 2KSPA 1XYDA 3TDUA 1UHNA 3D0YB 4P2YB 4PCWA 1QX2A 3EVVA 3DVKA 1JBAA 1K9UA 3D0YA 3LL8B 1KFXS 5G08A 2WOSA 1YX8A 1KFUS 2GGMA 1SCMB 2OTGC 3FWBA 4R1EA 1X02A 2F2PA 2NXQA 2NLNA 2E30A 1AJ5A 5DKRA 2A4JA 4IL1A 1XFZO 2K7OA 1NIWA 1WRKA 1XO5A 3JVTB 1SY9A 4M2QA 2CT9A 1IJ5A 4MZLA 1KFUL 1DTLA 3I5HC 1K93D 4PHNA 2K8MB 3AKAA 1WDCC 4PE0A 1RTP1 3WHTB 1S36A 1QX5B 4HREE 5ER4X 5CSNA 2WORA 1M39A 2KDHA 5HKZA 1RFJA 2BCAA 3SG5A 3AKBA 3GK2A 4FQOA 1LKJA 3EK7A 1DJIA 2I2RE 3TZ1A 1AJ4A 4MVFA 1QLSA 3CZTX 1F71A 1QV0A 3DVJA 3SJSA 1HT9A 1PSRA 2EC6B 5F6TA 2EHBA 5J3XA 2BKHB 3I5FB 3VROA 1XA5A 1QVIZ 1BJFA 3SG4A 1NP8A 2JZIA 4MEWA 1KCYA 1WRZA 1TRFA 2R2IA 1RK9A 1JFJA 1CFFA 2L50A 2L2EA 2JNFA 1K9KA 1CM1A 1U5IB 1RECA 1FW4A 4Q04A 2M9GA 1CDNA 1CDPA 1S6JA 4NDDA 4JPZB 3I5IC 1K90D 2JT0A 3OHMB 2LM5A 4A4BA 1DF0B 2F3ZA 5K89A 1NCZA 2JXLA 3DVMA 1Y1XA 2ISDA 1N65A 1DF0A 1XFXO 2ZKMX 1CLLA 2AUCA 2M7NA 1OMVA 1YUSA 4ORCB 2PVBA 2IS9A 1A75A 2KGBC 1QASA 4ORBB 1RJVA 1OMRA 4FTGA 1BR1B 2K7CA 2ZRTA 2L51A 3RLZA 2M97A 1WRLA 2KFFA 3TS5C 2LNKA 1J7OA 2KI4C 1SRAA 1UURA 3DF0A 1AP4A 1CFCA 1B4CA 2AMIA 4GNKB 2H61C 4YRUA 2F2OA 4OV2A 4MRXA 2MBXA 1KQMB 3SG6A 4QJ5B 1TOPA 1WLMA 3JTDC 2WC8A 1MR8A 1KK7Y 4CIDA 5I2LA 1DJZA 1NX3A 1XFUO 3GOFA 5ER5A 4C0KA 1EXRA 2MJWB 2JC2A 2K7DA 1QVIY 4PALA 1K9PA 2K0JA 2LV7A 4ICBA 5HKWA 1B8CA 2H2KA 3SIBA 2BCBA 1DVIA 1MWNA 1OMDA 1OE9B 2LUCA 1W7JB 2Y4QA 2BKIB 2OS8B 4NQGA 4ORAB 1AK8A 2B1UA 1B8LA 1UHHA 2MHHA 2KYFA 3FWCA 2COLB 2LUXA 3BYAA 1YRTB 3KEVA 4PHKA 1G33A 2V53A 5BPJA 1LA0A 4YGCB 1QIVA 1JWDA 1YX7A 4PE4A 1TN4A 4GPLB 1CFPA 1IWQA 1GJYA 2LVJA 5HYDA 2KGRA 2LMVA 2QPTA 1EH2A 3EKHA 2M49B 1TNPA 1XFVO 2JULA 2BBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKJ A;  4YGA A;  1LIN A;  4DCK A;  2K7B A;  1Q80 A;  1BOC A;  4OR9 B;  5PAL A;  4CLN A;  1G8I A;  1YRU B;  1IQ3 A;  4XYN A;  4PHM A;  1BMO A;  2EGD A;  1K95 A;  3BXK A;  3O6B A;  5I8N A;  1EL4 A;  2K2F A;  4HRH A;  3MSE B;  1CDM A;  2JT3 A;  3RM1 A;  2LVI A;  3VRQ A;  5CPV A;  1UHK A;  1A4P A;  3H4S E;  3WNX B;  1SL8 A;  2LMU A;  2Y1M A;  1J1D A;  3NSL A;  3ZWH A;  2FCE A;  2NZ0 A;  3PLF B;  1QAT A;  4MLW A;  1JF2 A;  2WCB A;  1Y0V H;  1J7R A;  2SAS A;  3LK0 A;  2I94 A;  4DRW A;  2G2B A;  4I5J A;  1KK8 C;  1M31 A;  4I5N B;  1QS7 A;  2NCP A;  1KFX L;  1RRO A;  2Q4U A;  1IRJ A;  1A29 A;  1TCF A;  2GV5 A;  2ZN9 A;  4YGE B;  2ZRS A;  1LA3 A;  1BT6 A;  1OSA A;  3CGA A;  5FYX A;  1WDC B;  3GK4 X;  2WCF A;  3O4Y A;  1IJ6 A;  3M0W A;  4PE7 A;  4UPG A;  2WCE A;  2KQ6 A;  2HQ8 A;  1MXL C;  1KQV A;  1J55 A;  1TTX A;  1SW8 A;  2BCX A;  1KK7 Z;  3BUW B;  3VRN A;  1K8U A;  1J7Q A;  1BG1 A;  3BUX B;  2CBL A;  4D1E A;  1PVB A;  1S1E A;  5CSJ A;  3PFV A;  3CLN A;  2KFH A;  4YI8 A;  1QXP A;  1TNQ A;  2LP2 A;  2M8U A;  2BE6 A;  2JXC A;  1BOD A;  1GGZ A;  4JWQ A;  2F3Y A;  4MN0 A;  1SCV A;  1S6C A;  4DS7 A;  1OZS A;  3FS7 A;  4JQ0 D;  3I5I B;  1NX0 A;  1JF0 A;  1F70 A;  4GFT A;  1Y1U A;  3SIA A;  1DJX A;  1M63 B;  2KHN A;  4WRI A;  1CDL A;  1RWY A;  2ZN8 A;  4M2P A;  2JU0 A;  1QLK A;  1A75 B;  5AFP A;  4I5L B;  2KAY A;  2FCD A;  4N1G A;  1L2O C;  2LLT A;  2LMT A;  1EG4 A;  1QJT A;  3AAK A;  3DF0 B;  3C1V A;  1L7Z A;  3PN7 C;  4PHJ A;  3DVE A;  2KBM A;  1ALV A;  2M1K B;  4YGB B;  3TUY C;  3K21 A;  1B8R A;  1SMG A;  2KI4 B;  1SR6 B;  2HET A;  2JTZ A;  2JNX A;  1UHJ A;  2MRD A;  4AOM A;  1F4O A;  3WXA A;  1R2U A;  1YUT A;  1C7V A;  1S5G Y;  2H61 A;  2TN4 A;  2G9B A;  1S26 D;  2LLU A;  2MAZ A;  3JTD B;  2LVV A;  2PAS A;  4I5K A;  1JFK A;  2K2A A;  4M2O A;  4MRY A;  3LCP C;  1N2D A;  3I5G C;  2JOJ A;  2M0R A;  1DJY A;  3PAL A;  1N0Y A;  4C0L A;  4OCI A;  1CFD A;  3BUN B;  3AAJ A;  1NUB A;  1EJ3 A;  1F55 A;  1BR4 B;  1DT7 B;  5HLV A;  4YBH B;  3KPX A;  3IQO A;  3OX5 A;  2JT8 A;  1IG5 A;  4HRG A;  2OPO A;  1WY9 A;  4ZCV A;  1H4B A;  5I2Q A;  1J7P A;  1TNX A;  2FOT A;  1XVJ A;  2I7A A;  1M45 A;  3EVR A;  1CLB A;  1G4Y R;  5AXI A;  2KNE A;  2BL0 C;  1B47 A;  3OB1 B;  2Y5I A;  2F33 A;  5CSI A;  5D7F A;  2LCP A;  1ZFS A;  1YTZ C;  1IQ5 A;  2HF5 A;  1NYA A;  2KI6 C;  1UUS A;  1IGV A;  4ZCU A;  3SG2 A;  2O60 A;  1R6P A;  2ZFD A;  4USL A;  1SYM A;  1IH0 A;  1B9A A;  1DJW A;  4N5X A;  3A4U B;  3O78 A;  1F4Q A;  4QJ4 B;  1KWO B;  2CTN A;  4ETO A;  1BU3 A;  4L9M A;  5AER A;  1B1G A;  1TIZ A;  1GQM A;  3KO0 A;  1FI6 A;  3CR2 A;  1BLQ A;  1K96 A;  1SL7 A;  1D1O A;  4QJ3 B;  2L4I A;  4YI9 A;  1IKU A;  1JC2 A;  3CTN A;  3TDZ A;  2OTG B;  3EK4 A;  1PAL A;  2L0P A;  1KSM A;  4P5O E;  1S3P A;  2M7L A;  1Y1A A;  1ZAC A;  2D8N A;  3BUM B;  3BOW A;  3IF7 A;  1KK8 B;  3KHE A;  2QAC A;  4GGN A;  2JPT A;  1AUI B;  3TDI A;  2DOQ A;  2E6W A;  3I5H B;  2AAO A;  4AQI A;  1XFY O;  1PRW A;  1SCM C;  1W7I B;  1LXF C;  1V1F A;  1SK6 D;  2L5X B;  4U8D A;  1JSA A;  3LK1 A;  1PVA A;  3BQ3 A;  3NSO A;  3PSR A;  3EK8 A;  1NCY A;  2P6B B;  2PMY A;  3SG3 A;  5HKY A;  1OZO A;  1MF8 B;  1S5G Z;  2LHL A;  5GQQ C;  2RGI A;  2KAV A;  2PSR A;  3JVT C;  5AAN A;  3HX4 A;  1F54 A;  5KTY A;  3CWG A;  1E8A A;  4XJK B;  1YUU A;  3OB2 B;  1BF5 A;  2CCM A;  1YVH A;  1YVL A;  2L4H A;  2O5G A;  4MZK A;  3ZNI A;  3A8R A;  4PDZ A;  2LLS A;  4XJK A;  1NX1 A;  2NCO A;  1CTR A;  1K2H A;  1YR5 A;  1SKT A;  2MA2 A;  1MQ1 A;  2M1U A;  4MZJ A;  4E68 A;  2L98 A;  3IQQ A;  4MSP A;  1QX7 A;  1FF1 A;  1LVC D;  1HQV A;  1WLZ A;  1NPQ A;  4F0Z B;  1UP5 A;  2JTT A;  2EC6 C;  1PK0 D;  1UWO A;  1J1E A;  3I5F C;  4TNC A;  1A2X A;  1OOJ A;  2SCP A;  4A4C A;  1CB1 A;  4AQJ A;  5KSZ A;  1OQP A;  1ZOT B;  4PE1 A;  1EG3 A;  3E3R A;  3GK1 A;  1CM4 A;  1QV1 A;  3KF9 A;  1SNL A;  3NSK A;  1CMG A;  2KBI A;  1B7T Y;  1CNP A;  1Y6W A;  3PM8 A;  1PSB A;  1H8B A;  3VGO A;  1L2O B;  2MLE C;  1CKK A;  3ICB A;  2WND A;  3QRX A;  1U5I A;  2K61 A;  3PN7 B;  2PAL A;  2GGZ A;  3TS5 B;  2JRF A;  3CS1 A;  5JJG A;  2M3W A;  2BEC A;  1F8H A;  2LAN A;  2KYC A;  3TUY B;  2LC5 A;  4CFR A;  2KFG A;  1NSH A;  2CXJ A;  2KI6 D;  3FIA A;  3CR5 X;  3WHU B;  1CMF A;  2PRU A;  5KU1 A;  1SBJ A;  3LLE A;  1YUR A;  1QIW A;  5B8I B;  3NSI A;  3BUO B;  5HLO A;  3I5G B;  4CFQ A;  1TCO B;  3OX6 A;  4MBE A;  1CLM A;  1M46 A;  2KOT A;  5CSF A;  4WQ2 A;  1DGU A;  4GAO A;  4DIR A;  1SR6 C;  3VRP A;  3VRR A;  2MLF C;  4WQ3 A;  1KQM C;  2BE4 A;  1K94 A;  5AEQ A;  3D10 A;  1S6I A;  1SPY A;  2HPS A;  4GBA A;  1KSO A;  5I2O A;  4CPV A;  3F45 A;  1DMO A;  1PUL A;  1FPW A;  2LVK A;  1C7W A;  1ZMZ A;  2BL0 B;  3OP0 A;  4N1F A;  4YGD B;  5DKN A;  2ZNE A;  2VRG A;  1A03 A;  2KQY A;  1SL9 A;  2OS8 C;  1AVS A;  4GGF C;  1XFW O;  1ZUZ A;  2LAP A;  2LHI A;  5TNC A;  1ODB A;  3HCM A;  4DUQ A;  3PAT A;  5JOL A;  1TNW A;  2BBM A;  2I18 A;  2F8P A;  4GGF A;  1XK4 C;  2HQW A;  2Y1N A;  2FJU B;  2CNP A;  2JWW A;  4NDB A;  5D69 A;  1QTX A;  3CR4 X;  3EVU A;  4BY4 A;  4C0J A;  1AHR A;  1JUO A;  2LE9 B;  4OVN F;  1UHI A;  1MXE A;  4HSZ A;  1XK4 A;  3NXA A;  1NCX A;  3DD4 A;  4OKH A;  5DKQ A;  5IBW A;  1GGW A;  2M29 A;  1NX2 A;  1MUX A;  1DJG A;  2LP3 A;  3O2P A;  1C07 A;  1FBV A;  1MHO A;  2KAX A;  1NWD A;  1FI5 A;  1VRK A;  4GUK A;  3SG7 A;  1DGV A;  3BOW B;  2ZND A;  1B7T Z;  1KWO C;  4BY5 A;  2Q91 A;  4NDC A;  2JQ6 A;  1DJH A;  1ALW A;  1V1G A;  2KSP A;  1XYD A;  3TDU A;  1UHN A;  3D0Y B;  4P2Y B;  4PCW A;  1QX2 A;  3EVV A;  3DVK A;  1JBA A;  1K9U A;  3D0Y A;  3LL8 B;  1KFX S;  5G08 A;  2WOS A;  1YX8 A;  1KFU S;  2GGM A;  1SCM B;  2OTG C;  3FWB A;  4R1E A;  1X02 A;  2F2P A;  2NXQ A;  2NLN A;  2E30 A;  1AJ5 A;  5DKR A;  2A4J A;  4IL1 A;  1XFZ O;  2K7O A;  1NIW A;  1WRK A;  1XO5 A;  3JVT B;  1SY9 A;  4M2Q A;  2CT9 A;  1IJ5 A;  4MZL A;  1KFU L;  1DTL A;  3I5H C;  1K93 D;  4PHN A;  2K8M B;  3AKA A;  1WDC C;  4PE0 A;  1RTP 1;  3WHT B;  1S36 A;  1QX5 B;  4HRE E;  5ER4 X;  5CSN A;  2WOR A;  1M39 A;  2KDH A;  5HKZ A;  1RFJ A;  2BCA A;  3SG5 A;  3AKB A;  3GK2 A;  4FQO A;  1LKJ A;  3EK7 A;  1DJI A;  2I2R E;  3TZ1 A;  1AJ4 A;  4MVF A;  1QLS A;  3CZT X;  1F71 A;  1QV0 A;  3DVJ A;  3SJS A;  1HT9 A;  1PSR A;  2EC6 B;  5F6T A;  2EHB A;  5J3X A;  2BKH B;  3I5F B;  3VRO A;  1XA5 A;  1QVI Z;  1BJF A;  3SG4 A;  1NP8 A;  2JZI A;  4MEW A;  1KCY A;  1WRZ A;  1TRF A;  2R2I A;  1RK9 A;  1JFJ A;  1CFF A;  2L50 A;  2L2E A;  2JNF A;  1K9K A;  1CM1 A;  1U5I B;  1REC A;  1FW4 A;  4Q04 A;  2M9G A;  1CDN A;  1CDP A;  1S6J A;  4NDD A;  4JPZ B;  3I5I C;  1K90 D;  2JT0 A;  3OHM B;  2LM5 A;  4A4B A;  1DF0 B;  2F3Z A;  5K89 A;  1NCZ A;  2JXL A;  3DVM A;  1Y1X A;  2ISD A;  1N65 A;  1DF0 A;  1XFX O;  2ZKM X;  1CLL A;  2AUC A;  2M7N A;  1OMV A;  1YUS A;  4ORC B;  2PVB A;  2IS9 A;  1A75 A;  2KGB C;  1QAS A;  4ORB B;  1RJV A;  1OMR A;  4FTG A;  1BR1 B;  2K7C A;  2ZRT A;  2L51 A;  3RLZ A;  2M97 A;  1WRL A;  2KFF A;  3TS5 C;  2LNK A;  1J7O A;  2KI4 C;  1SRA A;  1UUR A;  3DF0 A;  1AP4 A;  1CFC A;  1B4C A;  2AMI A;  4GNK B;  2H61 C;  4YRU A;  2F2O A;  4OV2 A;  4MRX A;  2MBX A;  1KQM B;  3SG6 A;  4QJ5 B;  1TOP A;  1WLM A;  3JTD C;  2WC8 A;  1MR8 A;  1KK7 Y;  4CID A;  5I2L A;  1DJZ A;  1NX3 A;  1XFU O;  3GOF A;  5ER5 A;  4C0K A;  1EXR A;  2MJW B;  2JC2 A;  2K7D A;  1QVI Y;  4PAL A;  1K9P A;  2K0J A;  2LV7 A;  4ICB A;  5HKW A;  1B8C A;  2H2K A;  3SIB A;  2BCB A;  1DVI A;  1MWN A;  1OMD A;  1OE9 B;  2LUC A;  1W7J B;  2Y4Q A;  2BKI B;  2OS8 B;  4NQG A;  4ORA B;  1AK8 A;  2B1U A;  1B8L A;  1UHH A;  2MHH A;  2KYF A;  3FWC A;  2COL B;  2LUX A;  3BYA A;  1YRT B;  3KEV A;  4PHK A;  1G33 A;  2V53 A;  5BPJ A;  1LA0 A;  4YGC B;  1QIV A;  1JWD A;  1YX7 A;  4PE4 A;  1TN4 A;  4GPL B;  1CFP A;  1IWQ A;  1GJY A;  2LVJ A;  5HYD A;  2KGR A;  2LMV A;  2QPT A;  1EH2 A;  3EKH A;  2M49 B;  1TNP A;  1XFV O;  2JUL A;  2BBN A; 
#chains in the Genus database with same CATH topology
 3EKJ A;  4YGA A;  1LIN A;  4DCK A;  2K7B A;  2QEV A;  1Q80 A;  1BOC A;  4OR9 B;  2H8V A;  5PAL A;  4CLN A;  1G8I A;  1YRU B;  1IQ3 A;  4XYN A;  4INW A;  1BMO A;  2EGD A;  4PHM A;  1K95 A;  3BXK A;  3O6B A;  1OOI X;  5I8N A;  4I5K A;  1EL4 A;  2K2F A;  4HRH A;  3MSE B;  1DEL A;  5I94 A;  1CDM A;  2JT3 A;  3RM1 A;  3BFB A;  2LVI A;  3VRQ A;  5CPV A;  1UHK A;  1A4P A;  3H4S E;  3WNX B;  1SL8 A;  2LMU A;  2Y1M A;  1J1D A;  2WCK A;  3OGN A;  3NSL A;  3ZWH A;  2FCE A;  2NZ0 A;  3PLF B;  1QAT A;  4MLW A;  1JF2 A;  2WCB A;  1Y0V H;  1J7R A;  2SAS A;  2P71 A;  2I94 A;  3LK0 A;  4DRW A;  2G2B A;  4I5J A;  1KK8 C;  1M31 A;  4I5N B;  1QS7 A;  1Z4H A;  1KFX L;  2NCP A;  1RRO A;  2Q4U A;  1IRJ A;  3SS5 A;  1A29 A;  1TCF A;  2GV5 A;  2ZN9 A;  4YGE B;  2ZRS A;  1LA3 A;  1BT6 A;  1OSA A;  3CGA A;  5FYX A;  1WDC B;  3GK4 X;  2WCF A;  3O4Y A;  1IJ6 A;  3M0W A;  4PE7 A;  1DC1 A;  4UPG A;  2WCE A;  2KQ6 A;  2HQ8 A;  1MXL C;  3NGV A;  3DXL A;  1KQV A;  1J55 A;  1TTX A;  2L2C A;  1SW8 A;  2BCX A;  1KK7 Z;  3BUW B;  1W9Z A;  3VRN A;  1K8U A;  1J7Q A;  1BG1 A;  3BUX B;  2CBL A;  4D1E A;  1PVB A;  1S1E A;  5CSJ A;  3PFV A;  2YGU A;  3CLN A;  1OOH A;  2KFH A;  3NHI A;  4YI8 A;  1QXP A;  1TNQ A;  2LP2 A;  4JD9 A;  2M8U A;  2BE6 A;  2JXC A;  1BOD A;  1GGZ A;  4JWQ A;  2F3Y A;  3B88 A;  4MN0 A;  1SCV A;  1S6C A;  1XFR A;  4DS7 A;  1OZS A;  3CZ1 A;  3FS7 A;  3PM2 A;  4JQ0 D;  3UNW A;  1OW4 A;  3I5I B;  1NX0 A;  1JF0 A;  1F70 A;  4GFT A;  1Y1U A;  3SIA A;  1DJX A;  1M63 B;  2KHN A;  4WRI A;  2WCH A;  1CDL A;  1RWY A;  2ZN8 A;  4M2P A;  2JU0 A;  1QLK A;  1A75 B;  2ERB A;  5AFP A;  4I5L B;  2KAY A;  2FCD A;  4N1G A;  1L2O C;  2LLT A;  2LMT A;  1EG4 A;  1QJT A;  3AAK A;  3DF0 B;  3C1V A;  1L7Z A;  3PN7 C;  4PHJ A;  3DVE A;  2KBM A;  2PQL A;  1ALV A;  2M1K B;  3R1O A;  4YGB B;  3TUY C;  3K21 A;  1B8R A;  1SMG A;  2KI4 B;  1SR6 B;  2PYQ A;  3RZS A;  2HET A;  2JTZ A;  2JNX A;  1UHJ A;  2MRD A;  4AOM A;  1F4O A;  3WXA A;  1R2U A;  3QME A;  1YUT A;  1C7V A;  1S5G Y;  2H61 A;  2TN4 A;  2G9B A;  1S26 D;  2LLU A;  2MAZ A;  3CZ0 A;  2LVV A;  2PAS A;  3JTD B;  1JFK A;  2K2A A;  4M2O A;  4MRY A;  3LCP C;  1N2D A;  1OOG A;  3Q8I A;  3I5G C;  2JOJ A;  2M0R A;  1DJY A;  3L4A A;  1DQE A;  1N0Y A;  3PAL A;  4C0L A;  2BNX A;  4OCI A;  1CFD A;  3BUN B;  3AAJ A;  1NUB A;  1EJ3 A;  1F55 A;  1BR4 B;  1DT7 B;  5HLV A;  4YBH B;  3KPX A;  3IQO A;  3OX5 A;  2JT8 A;  2FJY A;  1IG5 A;  4HRG A;  2OPO A;  1WY9 A;  4ZCV A;  1H4B A;  5I2Q A;  1J7P A;  1C3Z A;  1TNX A;  1XVJ A;  2FOT A;  3DYE A;  2I7A A;  1M45 A;  3EVR A;  1CLB A;  1G4Y R;  5AXI A;  2KNE A;  2BL0 C;  1B47 A;  3OB1 B;  2Y5I A;  2F33 A;  2K60 A;  5CSI A;  2JPO A;  5D7F A;  5FI7 A;  2LCP A;  1ZFS A;  1YTZ C;  1IQ5 A;  2HF5 A;  1NYA A;  2KI6 C;  1UUS A;  1IGV A;  4ZCU A;  3SG2 A;  2O60 A;  1R6P A;  2ZFD A;  4USL A;  5EL2 A;  1SYM A;  3B6X A;  1B9A A;  1IH0 A;  1DJW A;  4N5X A;  3A4U B;  4OZD A;  3O78 A;  1F4Q A;  4QJ4 B;  3IVT A;  1KWO B;  3S0F A;  2CTN A;  4ETO A;  1BU3 A;  4L9M A;  5AER A;  1B1G A;  1QWV A;  1TIZ A;  1LS8 A;  1Z2C B;  1GQM A;  3KO0 A;  1FI6 A;  3CR2 A;  1BLQ A;  1K96 A;  1SL7 A;  3NHT A;  2QEO A;  1D1O A;  4QJ3 B;  2L4I A;  4YI9 A;  1IKU A;  1JC2 A;  3CTN A;  1TUZ A;  3TDZ A;  2OTG B;  3EK4 A;  2KLE A;  1PAL A;  2L0P A;  1KSM A;  4P5O E;  1S3P A;  2BAP A;  2M7L A;  3SS3 A;  1Y1A A;  1ZAC A;  3D74 A;  2D8N A;  3BUM B;  3BOW A;  3IF7 A;  5FI2 A;  2WCJ A;  1KK8 B;  3KHE A;  2QAC A;  4GGN A;  2JPT A;  1AUI B;  3TDI A;  2WC6 A;  2DOQ A;  2E6W A;  3I5H B;  2AAO A;  4AQI A;  1XFY O;  1PRW A;  1SCM C;  1W7I B;  1LXF C;  1V1F A;  1SK6 D;  2L5X B;  4U8D A;  1JSA A;  3LK1 A;  1PVA A;  3BQ3 A;  3NSO A;  3PSR A;  3EK8 A;  4KYN A;  1NCY A;  2P6B B;  2PMY A;  3SG3 A;  5HKY A;  1OZO A;  1MF8 B;  1S5G Z;  2LHL A;  5GQQ C;  2RGI A;  2KAV A;  2PSR A;  3JVT C;  5AAN A;  3HX4 A;  1F54 A;  5KTY A;  3CWG A;  1E8A A;  4XJK B;  1YUU A;  3OB2 B;  1BF5 A;  2CCM A;  1YVH A;  1YVL A;  2L4H A;  2O5G A;  4IJ7 A;  4MZK A;  3ZNI A;  3A8R A;  4PDZ A;  2LLS A;  4XJK A;  1NX1 A;  2NCO A;  1CTR A;  1K2H A;  1YR5 A;  1SKT A;  2MA2 A;  3D76 A;  1MQ1 A;  2M1U A;  4MZJ A;  2QEB A;  4E68 A;  2L98 A;  3IQQ A;  4MSP A;  1QX7 A;  1FF1 A;  1LVC D;  1GM0 A;  3B7A A;  3CYZ A;  1HQV A;  1WLZ A;  3BJH A;  1NPQ A;  4F0Z B;  1UP5 A;  2JTT A;  2EC6 C;  3S0D A;  2L5Y A;  1PK0 D;  1UWO A;  1J1E A;  3I5F C;  4TNC A;  1A2X A;  1OOJ A;  2SCP A;  4A4C A;  1CB1 A;  1IIO A;  4AQJ A;  5KSZ A;  1OQP A;  3K1E A;  1ZOT B;  4PE1 A;  1EG3 A;  3E3R A;  3GK1 A;  1CM4 A;  1QV1 A;  4FQT A;  3KF9 A;  1SNL A;  3NSK A;  1CMG A;  2KBI A;  1B7T Y;  1CNP A;  1Y6W A;  1ORG A;  3PM8 A;  5FI6 A;  1PSB A;  1H8B A;  3VGO A;  1L2O B;  2MLE C;  1CKK A;  3ICB A;  2WND A;  3FE6 A;  3QRX A;  1U5I A;  2K61 A;  3PN7 B;  2PAL A;  2GGZ A;  3TS5 B;  2JRF A;  3CS1 A;  5JJG A;  2M3W A;  2BEC A;  1F8H A;  2LAN A;  2KYC A;  3TUY B;  2LC5 A;  3R72 A;  4CFR A;  2KFG A;  1NSH A;  3DY9 A;  2CXJ A;  2KI6 D;  3FIA A;  2KLD A;  3CR5 X;  4JKT A;  3WHU B;  1CMF A;  2PRU A;  5KU1 A;  1SBJ A;  3LLE A;  1YUR A;  1QIW A;  5B8I B;  3NSI A;  3BUO B;  5HLO A;  3I5G B;  4CFQ A;  1TCO B;  3OX6 A;  4MBE A;  1CLM A;  1M46 A;  2KOT A;  5CSF A;  4F7F A;  4WQ2 A;  1DGU A;  4GAO A;  4DIR A;  1SR6 C;  3VRP A;  3VRR A;  2MLF C;  4WQ3 A;  1KQM C;  2BE4 A;  1K94 A;  5AEQ A;  3D10 A;  1C3Y A;  1S6I A;  1SPY A;  2HPS A;  4GBA A;  1KSO A;  5I2O A;  4CPV A;  3F45 A;  3FE9 A;  1PUL A;  1DMO A;  1FPW A;  2LVK A;  1C7W A;  1ZMZ A;  2BL0 B;  3OP0 A;  4N1F A;  4YGD B;  5DKN A;  2ZNE A;  2VRG A;  1A03 A;  2KQY A;  1SL9 A;  1SSE B;  2OS8 C;  1AVS A;  3N7H A;  4PT1 A;  4GGF C;  1XFW O;  1ZUZ A;  2LAP A;  2LHI A;  3PJI A;  1ODB A;  3HCM A;  5TNC A;  4DUQ A;  3PAT A;  5JOL A;  1TNW A;  2BBM A;  2I18 A;  3VB1 A;  2F8P A;  4GGF A;  1XK4 C;  3UO9 A;  2HQW A;  2Y1N A;  2FJU B;  2CNP A;  2JWW A;  4NDB A;  5D69 A;  1QTX A;  2QDI A;  3CR4 X;  3EVU A;  4BY4 A;  4C0J A;  1AHR A;  1JUO A;  2QEH A;  2LE9 B;  4OVN F;  1UHI A;  1MXE A;  4HSZ A;  1XK4 A;  3NXA A;  1NCX A;  2P70 A;  3DD4 A;  4OKH A;  1DEK A;  5DKQ A;  5IBW A;  1GGW A;  2M29 A;  1NX2 A;  1MUX A;  1DJG A;  2LP3 A;  3O2P A;  1C07 A;  5DIC A;  1FBV A;  1MHO A;  2KAX A;  1NWD A;  1FI5 A;  1VRK A;  4GUK A;  3SG7 A;  1DGV A;  3BOW B;  2ZND A;  1T14 A;  1B7T Z;  1KWO C;  4BY5 A;  2WC5 A;  2Q91 A;  2WCM A;  4NDC A;  2JQ6 A;  1DJH A;  1ALW A;  1V1G A;  2KSP A;  1XYD A;  3TDU A;  1UHN A;  3D0Y B;  4P2Y B;  3S0A A;  4PCW A;  1QX2 A;  3EVV A;  3DVK A;  3EG5 B;  1JBA A;  1K9U A;  3D0Y A;  3D78 A;  3LL8 B;  1KFX S;  3S0E A;  5D3O A;  5G08 A;  2WOS A;  1YX8 A;  1KFU S;  2GGM A;  1SCM B;  2OTG C;  3FWB A;  4R1E A;  1X02 A;  2F2P A;  2NXQ A;  2NLN A;  2E30 A;  1AJ5 A;  3S0G A;  5DKR A;  2A4J A;  4IL1 A;  1XFZ O;  2K7O A;  1NIW A;  1WRK A;  1XO5 A;  3JVT B;  1SY9 A;  3B86 A;  2CT9 A;  4M2Q A;  1IJ5 A;  4MZL A;  1KFU L;  2WCL A;  1DTL A;  3I5H C;  1K93 D;  4PHN A;  2K8M B;  3AKA A;  1WDC C;  4PE0 A;  1RTP 1;  3WHT B;  1S36 A;  1QX5 B;  4HRE E;  5ER4 X;  5CSN A;  2WOR A;  3CAB A;  1M39 A;  2KDH A;  5HKZ A;  1RFJ A;  2BCA A;  3SG5 A;  3AKB A;  3GK2 A;  4FQO A;  1LKJ A;  3EK7 A;  1DJI A;  2I2R E;  3CZ2 A;  3TZ1 A;  5HL1 A;  1AJ4 A;  4MVF A;  1QLS A;  3CZT X;  1F71 A;  1QV0 A;  3FE8 A;  1TWO A;  3DVJ A;  3SJS A;  1TUJ A;  1HT9 A;  1PSR A;  2EC6 B;  3L47 A;  5F6T A;  2EHB A;  3BFA A;  5J3X A;  2BKH B;  3I5F B;  3VRO A;  1XA5 A;  1QVI Z;  1BJF A;  3SG4 A;  1NP8 A;  2JZI A;  4MEW A;  1KCY A;  1WRZ A;  1TRF A;  2R2I A;  1RK9 A;  1JFJ A;  1CFF A;  2L50 A;  2L2E A;  2JNF A;  1K9K A;  1CM1 A;  1U5I B;  1REC A;  1FW4 A;  4Q04 A;  2M9G A;  1CDN A;  3O4X A;  1CDP A;  1S6J A;  3BFH A;  4NDD A;  4JPZ B;  3I5I C;  1K90 D;  2JT0 A;  3L4L A;  3OHM B;  2LM5 A;  4A4B A;  1DF0 B;  2F3Z A;  5K89 A;  1NCZ A;  2JXL A;  3DVM A;  1Y1X A;  2ISD A;  1N65 A;  1DF0 A;  1XFX O;  2ZKM X;  1CLL A;  2AUC A;  2M7N A;  1OMV A;  3D77 A;  1YUS A;  3OBV A;  4ORC B;  2PVB A;  2IS9 A;  1A75 A;  3S0B A;  2KGB C;  1QAS A;  4ORB B;  1RJV A;  1OMR A;  4FTG A;  1BR1 B;  2K7C A;  2ZRT A;  2L51 A;  3RLZ A;  2M97 A;  1WRL A;  2KFF A;  3TS5 C;  2LNK A;  1J7O A;  3D73 A;  2KI4 C;  1SRA A;  1UUR A;  3DF0 A;  3R1P A;  1AP4 A;  1CFC A;  1B4C A;  2AMI A;  4GNK B;  2H61 C;  4YRU A;  2F2O A;  2GTE A;  3B87 A;  4OV2 A;  4MRX A;  4INX A;  1KQM B;  2MBX A;  3SG6 A;  3CDN A;  4QJ5 B;  1TOP A;  1WLM A;  3JTD C;  2WC8 A;  1MR8 A;  1KK7 Y;  4CID A;  5I2L A;  1DJZ A;  1NX3 A;  1XFU O;  3GOF A;  3R1V A;  5ER5 A;  1EXR A;  4C0K A;  2MJW B;  2JC2 A;  2K7D A;  1QVI Y;  4PAL A;  1K9P A;  2K0J A;  2LV7 A;  4ICB A;  5HKW A;  3V2L A;  1B8C A;  2H2K A;  3SIB A;  2BCB A;  1DVI A;  1MWN A;  1OMD A;  1OE9 B;  2LUC A;  1W7J B;  2Y4Q A;  2BKI B;  2OS8 B;  4NQG A;  4ORA B;  1AK8 A;  2B1U A;  1B8L A;  1UHH A;  2MHH A;  2KYF A;  3FWC A;  2COL B;  2LUX A;  2KPH A;  3BYA A;  1YRT B;  3KEV A;  4PHK A;  1G33 A;  2V53 A;  5BPJ A;  1LA0 A;  4YGC B;  1QIV A;  1JWD A;  1OOF A;  1YX7 A;  4PE4 A;  1TN4 A;  4GPL B;  1CFP A;  1IWQ A;  3D75 A;  1GJY A;  2LVJ A;  5HYD A;  2KGR A;  2LMV A;  2QPT A;  1EH2 A;  1P28 A;  3EKH A;  3SS4 A;  2M49 B;  1TNP A;  1XFV O;  2JUL A;  2BBN A;  3DZT A; 
#chains in the Genus database with same CATH homology
 3EKJ A;  4YGA A;  1LIN A;  4DCK A;  2K7B A;  1Q80 A;  1BOC A;  4OR9 B;  5PAL A;  4CLN A;  1G8I A;  1YRU B;  1IQ3 A;  4XYN A;  4PHM A;  1BMO A;  2EGD A;  1K95 A;  3BXK A;  3O6B A;  5I8N A;  1EL4 A;  2K2F A;  4HRH A;  3MSE B;  1CDM A;  2JT3 A;  3RM1 A;  2LVI A;  3VRQ A;  5CPV A;  1UHK A;  1A4P A;  3H4S E;  3WNX B;  1SL8 A;  2LMU A;  2Y1M A;  1J1D A;  3NSL A;  3ZWH A;  2FCE A;  2NZ0 A;  3PLF B;  1QAT A;  4MLW A;  1JF2 A;  2WCB A;  1Y0V H;  1J7R A;  2SAS A;  3LK0 A;  2I94 A;  4DRW A;  2G2B A;  4I5J A;  1KK8 C;  1M31 A;  4I5N B;  1QS7 A;  2NCP A;  1KFX L;  1RRO A;  2Q4U A;  1IRJ A;  1A29 A;  1TCF A;  2GV5 A;  2ZN9 A;  4YGE B;  2ZRS A;  1LA3 A;  1BT6 A;  1OSA A;  3CGA A;  5FYX A;  1WDC B;  3GK4 X;  2WCF A;  3O4Y A;  1IJ6 A;  3M0W A;  4PE7 A;  4UPG A;  2WCE A;  2KQ6 A;  2HQ8 A;  1MXL C;  1KQV A;  1J55 A;  1TTX A;  1SW8 A;  2BCX A;  1KK7 Z;  3BUW B;  3VRN A;  1K8U A;  1J7Q A;  1BG1 A;  3BUX B;  2CBL A;  4D1E A;  1PVB A;  1S1E A;  5CSJ A;  3PFV A;  3CLN A;  2KFH A;  4YI8 A;  1QXP A;  1TNQ A;  2LP2 A;  2M8U A;  2BE6 A;  2JXC A;  1BOD A;  1GGZ A;  4JWQ A;  2F3Y A;  4MN0 A;  1SCV A;  1S6C A;  4DS7 A;  1OZS A;  3FS7 A;  4JQ0 D;  3I5I B;  1NX0 A;  1JF0 A;  1F70 A;  4GFT A;  1Y1U A;  3SIA A;  1DJX A;  1M63 B;  2KHN A;  4WRI A;  1CDL A;  1RWY A;  2ZN8 A;  4M2P A;  2JU0 A;  1QLK A;  1A75 B;  5AFP A;  4I5L B;  2KAY A;  2FCD A;  4N1G A;  1L2O C;  2LLT A;  2LMT A;  1EG4 A;  1QJT A;  3AAK A;  3DF0 B;  3C1V A;  1L7Z A;  3PN7 C;  4PHJ A;  3DVE A;  2KBM A;  1ALV A;  2M1K B;  4YGB B;  3TUY C;  3K21 A;  1B8R A;  1SMG A;  2KI4 B;  1SR6 B;  2HET A;  2JTZ A;  2JNX A;  1UHJ A;  2MRD A;  4AOM A;  1F4O A;  3WXA A;  1R2U A;  1YUT A;  1C7V A;  1S5G Y;  2H61 A;  2TN4 A;  2G9B A;  1S26 D;  2LLU A;  2MAZ A;  3JTD B;  2LVV A;  2PAS A;  4I5K A;  1JFK A;  2K2A A;  4M2O A;  4MRY A;  3LCP C;  1N2D A;  3I5G C;  2JOJ A;  2M0R A;  1DJY A;  3PAL A;  1N0Y A;  4C0L A;  4OCI A;  1CFD A;  3BUN B;  3AAJ A;  1NUB A;  1EJ3 A;  1F55 A;  1BR4 B;  1DT7 B;  5HLV A;  4YBH B;  3KPX A;  3IQO A;  3OX5 A;  2JT8 A;  1IG5 A;  4HRG A;  2OPO A;  1WY9 A;  4ZCV A;  1H4B A;  5I2Q A;  1J7P A;  1TNX A;  2FOT A;  1XVJ A;  2I7A A;  1M45 A;  3EVR A;  1CLB A;  1G4Y R;  5AXI A;  2KNE A;  2BL0 C;  1B47 A;  3OB1 B;  2Y5I A;  2F33 A;  5CSI A;  5D7F A;  2LCP A;  1ZFS A;  1YTZ C;  1IQ5 A;  2HF5 A;  1NYA A;  2KI6 C;  1UUS A;  1IGV A;  4ZCU A;  3SG2 A;  2O60 A;  1R6P A;  2ZFD A;  4USL A;  1SYM A;  1IH0 A;  1B9A A;  1DJW A;  4N5X A;  3A4U B;  3O78 A;  1F4Q A;  4QJ4 B;  1KWO B;  2CTN A;  4ETO A;  1BU3 A;  4L9M A;  5AER A;  1B1G A;  1TIZ A;  1GQM A;  3KO0 A;  1FI6 A;  3CR2 A;  1BLQ A;  1K96 A;  1SL7 A;  1D1O A;  4QJ3 B;  2L4I A;  4YI9 A;  1IKU A;  1JC2 A;  3CTN A;  3TDZ A;  2OTG B;  3EK4 A;  1PAL A;  2L0P A;  1KSM A;  4P5O E;  1S3P A;  2M7L A;  1Y1A A;  1ZAC A;  2D8N A;  3BUM B;  3BOW A;  3IF7 A;  1KK8 B;  3KHE A;  2QAC A;  4GGN A;  2JPT A;  1AUI B;  3TDI A;  2DOQ A;  2E6W A;  3I5H B;  2AAO A;  4AQI A;  1XFY O;  1PRW A;  1SCM C;  1W7I B;  1LXF C;  1V1F A;  1SK6 D;  2L5X B;  4U8D A;  1JSA A;  3LK1 A;  1PVA A;  3BQ3 A;  3NSO A;  3PSR A;  3EK8 A;  1NCY A;  2P6B B;  2PMY A;  3SG3 A;  5HKY A;  1OZO A;  1MF8 B;  1S5G Z;  2LHL A;  5GQQ C;  2RGI A;  2KAV A;  2PSR A;  3JVT C;  5AAN A;  3HX4 A;  1F54 A;  5KTY A;  3CWG A;  1E8A A;  4XJK B;  1YUU A;  3OB2 B;  1BF5 A;  2CCM A;  1YVH A;  1YVL A;  2L4H A;  2O5G A;  4MZK A;  3ZNI A;  3A8R A;  4PDZ A;  2LLS A;  4XJK A;  1NX1 A;  2NCO A;  1CTR A;  1K2H A;  1YR5 A;  1SKT A;  2MA2 A;  1MQ1 A;  2M1U A;  4MZJ A;  4E68 A;  2L98 A;  3IQQ A;  4MSP A;  1QX7 A;  1FF1 A;  1LVC D;  1HQV A;  1WLZ A;  1NPQ A;  4F0Z B;  1UP5 A;  2JTT A;  2EC6 C;  1PK0 D;  1UWO A;  1J1E A;  3I5F C;  4TNC A;  1A2X A;  1OOJ A;  2SCP A;  4A4C A;  1CB1 A;  4AQJ A;  5KSZ A;  1OQP A;  1ZOT B;  4PE1 A;  1EG3 A;  3E3R A;  3GK1 A;  1CM4 A;  1QV1 A;  3KF9 A;  1SNL A;  3NSK A;  1CMG A;  2KBI A;  1B7T Y;  1CNP A;  1Y6W A;  3PM8 A;  1PSB A;  1H8B A;  3VGO A;  1L2O B;  2MLE C;  1CKK A;  3ICB A;  2WND A;  3QRX A;  1U5I A;  2K61 A;  3PN7 B;  2PAL A;  2GGZ A;  3TS5 B;  2JRF A;  3CS1 A;  5JJG A;  2M3W A;  2BEC A;  1F8H A;  2LAN A;  2KYC A;  3TUY B;  2LC5 A;  4CFR A;  2KFG A;  1NSH A;  2CXJ A;  2KI6 D;  3FIA A;  3CR5 X;  3WHU B;  1CMF A;  2PRU A;  5KU1 A;  1SBJ A;  3LLE A;  1YUR A;  1QIW A;  5B8I B;  3NSI A;  3BUO B;  5HLO A;  3I5G B;  4CFQ A;  1TCO B;  3OX6 A;  4MBE A;  1CLM A;  1M46 A;  2KOT A;  5CSF A;  4WQ2 A;  1DGU A;  4GAO A;  4DIR A;  1SR6 C;  3VRP A;  3VRR A;  2MLF C;  4WQ3 A;  1KQM C;  2BE4 A;  1K94 A;  5AEQ A;  3D10 A;  1S6I A;  1SPY A;  2HPS A;  4GBA A;  1KSO A;  5I2O A;  4CPV A;  3F45 A;  1DMO A;  1PUL A;  1FPW A;  2LVK A;  1C7W A;  1ZMZ A;  2BL0 B;  3OP0 A;  4N1F A;  4YGD B;  5DKN A;  2ZNE A;  2VRG A;  1A03 A;  2KQY A;  1SL9 A;  2OS8 C;  1AVS A;  4GGF C;  1XFW O;  1ZUZ A;  2LAP A;  2LHI A;  5TNC A;  1ODB A;  3HCM A;  4DUQ A;  3PAT A;  5JOL A;  1TNW A;  2BBM A;  2I18 A;  2F8P A;  4GGF A;  1XK4 C;  2HQW A;  2Y1N A;  2FJU B;  2CNP A;  2JWW A;  4NDB A;  5D69 A;  1QTX A;  3CR4 X;  3EVU A;  4BY4 A;  4C0J A;  1AHR A;  1JUO A;  2LE9 B;  4OVN F;  1UHI A;  1MXE A;  4HSZ A;  1XK4 A;  3NXA A;  1NCX A;  3DD4 A;  4OKH A;  5DKQ A;  5IBW A;  1GGW A;  2M29 A;  1NX2 A;  1MUX A;  1DJG A;  2LP3 A;  3O2P A;  1C07 A;  1FBV A;  1MHO A;  2KAX A;  1NWD A;  1FI5 A;  1VRK A;  4GUK A;  3SG7 A;  1DGV A;  3BOW B;  2ZND A;  1B7T Z;  1KWO C;  4BY5 A;  2Q91 A;  4NDC A;  2JQ6 A;  1DJH A;  1ALW A;  1V1G A;  2KSP A;  1XYD A;  3TDU A;  1UHN A;  3D0Y B;  4P2Y B;  4PCW A;  1QX2 A;  3EVV A;  3DVK A;  1JBA A;  1K9U A;  3D0Y A;  3LL8 B;  1KFX S;  5G08 A;  2WOS A;  1YX8 A;  1KFU S;  2GGM A;  1SCM B;  2OTG C;  3FWB A;  4R1E A;  1X02 A;  2F2P A;  2NXQ A;  2NLN A;  2E30 A;  1AJ5 A;  5DKR A;  2A4J A;  4IL1 A;  1XFZ O;  2K7O A;  1NIW A;  1WRK A;  1XO5 A;  3JVT B;  1SY9 A;  4M2Q A;  2CT9 A;  1IJ5 A;  4MZL A;  1KFU L;  1DTL A;  3I5H C;  1K93 D;  4PHN A;  2K8M B;  3AKA A;  1WDC C;  4PE0 A;  1RTP 1;  3WHT B;  1S36 A;  1QX5 B;  4HRE E;  5ER4 X;  5CSN A;  2WOR A;  1M39 A;  2KDH A;  5HKZ A;  1RFJ A;  2BCA A;  3SG5 A;  3AKB A;  3GK2 A;  4FQO A;  1LKJ A;  3EK7 A;  1DJI A;  2I2R E;  3TZ1 A;  1AJ4 A;  4MVF A;  1QLS A;  3CZT X;  1F71 A;  1QV0 A;  3DVJ A;  3SJS A;  1HT9 A;  1PSR A;  2EC6 B;  5F6T A;  2EHB A;  5J3X A;  2BKH B;  3I5F B;  3VRO A;  1XA5 A;  1QVI Z;  1BJF A;  3SG4 A;  1NP8 A;  2JZI A;  4MEW A;  1KCY A;  1WRZ A;  1TRF A;  2R2I A;  1RK9 A;  1JFJ A;  1CFF A;  2L50 A;  2L2E A;  2JNF A;  1K9K A;  1CM1 A;  1U5I B;  1REC A;  1FW4 A;  4Q04 A;  2M9G A;  1CDN A;  1CDP A;  1S6J A;  4NDD A;  4JPZ B;  3I5I C;  1K90 D;  2JT0 A;  3OHM B;  2LM5 A;  4A4B A;  1DF0 B;  2F3Z A;  5K89 A;  1NCZ A;  2JXL A;  3DVM A;  1Y1X A;  2ISD A;  1N65 A;  1DF0 A;  1XFX O;  2ZKM X;  1CLL A;  2AUC A;  2M7N A;  1OMV A;  1YUS A;  4ORC B;  2PVB A;  2IS9 A;  1A75 A;  2KGB C;  1QAS A;  4ORB B;  1RJV A;  1OMR A;  4FTG A;  1BR1 B;  2K7C A;  2ZRT A;  2L51 A;  3RLZ A;  2M97 A;  1WRL A;  2KFF A;  3TS5 C;  2LNK A;  1J7O A;  2KI4 C;  1SRA A;  1UUR A;  3DF0 A;  1AP4 A;  1CFC A;  1B4C A;  2AMI A;  4GNK B;  2H61 C;  4YRU A;  2F2O A;  4OV2 A;  4MRX A;  2MBX A;  1KQM B;  3SG6 A;  4QJ5 B;  1TOP A;  1WLM A;  3JTD C;  2WC8 A;  1MR8 A;  1KK7 Y;  4CID A;  5I2L A;  1DJZ A;  1NX3 A;  1XFU O;  3GOF A;  5ER5 A;  4C0K A;  1EXR A;  2MJW B;  2JC2 A;  2K7D A;  1QVI Y;  4PAL A;  1K9P A;  2K0J A;  2LV7 A;  4ICB A;  5HKW A;  1B8C A;  2H2K A;  3SIB A;  2BCB A;  1DVI A;  1MWN A;  1OMD A;  1OE9 B;  2LUC A;  1W7J B;  2Y4Q A;  2BKI B;  2OS8 B;  4NQG A;  4ORA B;  1AK8 A;  2B1U A;  1B8L A;  1UHH A;  2MHH A;  2KYF A;  3FWC A;  2COL B;  2LUX A;  3BYA A;  1YRT B;  3KEV A;  4PHK A;  1G33 A;  2V53 A;  5BPJ A;  1LA0 A;  4YGC B;  1QIV A;  1JWD A;  1YX7 A;  4PE4 A;  1TN4 A;  4GPL B;  1CFP A;  1IWQ A;  1GJY A;  2LVJ A;  5HYD A;  2KGR A;  2LMV A;  2QPT A;  1EH2 A;  3EKH A;  2M49 B;  1TNP A;  1XFV O;  2JUL A;  2BBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...