3I5GB

Crystal structure of rigor-like squid myosin s1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
145
structure length
145
Chain Sequence
RVKLSQRQMQELKEAFTMIDQDRDGFIGMEDLKDMFSSLGRVPPDDELNAMLKECPGQLNFTAFLTLFGEKVSGTDPEDALRNAFSMFDEDGQGFIPEDYLKDLLENMGDNFSKEEIKNVWKDAPLKNKQFNYNKMVDIKGKAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain isoform A
publication title Rigor-like structures from muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor.
pubmed doi rcsb
total genus 29
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2009-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5gB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3i5gB01
1NWDA 1QIVA 3NSOA 3PSRA 2JU0A 1QV0A 2F2PA 3A4UB 4GAOA 4WQ3A 3SIBA 1IJ5A 1UHNA 1WY9A 2KQ6A 1K2HA 4XYNA 1KK8C 1KSOA 3O6BA 1KK8B 4FTGA 1QJTA 4OVNF 4F0ZB 2WCBA 1B1GA 1ZOTB 3EKHA 1JSAA 1SNLA 2ZNEA 2K7CA 2KFGA 1CKKA 1LINA 2ISDA 3EK4A 2EC6C 1WLZA 2EC6B 1KFXS 2Y5IA 4PE4A 1QLKA 3I5IB 2CTNA 2O60A 1DMOA 5F6TA 3RLZA 4PHMA 2LM5A 3PN7C 2K7OA 4GNKB 1S6JA 2KAXA 1GGWA 2HQWA 3OX6A 1AJ4A 1CDLA 1Y0VH 5HKYA 1A75A 2M1KB 1DF0B 1TIZA 3TUYB 2BBNA 1YUSA 2L51A 4HSZA 2AMIA 4MVFA 2NCPA 1F55A 4CLNA 2LP3A 4JPZB 4UPGA 1MXLC 2OTGB 4QJ4B 1C07A 1B4CA 1FBVA 1KK7Y 1A75B 5CSFA 1J7PA 2K8MB 1LKJA 1HT9A 2EGDA 4DIRA 1NX3A 1RWYA 3CLNA 1SY9A 2CNPA 1B7TY 2LUXA 2MA2A 4QJ3B 1OE9B 2WNDA 1SMGA 3BUNB 2M7LA 2CCMA 4GBAA 2KQYA 4GUKA 3LLEA 1ZMZA 1JUOA 1DGUA 1IGVA 1WDCB 1RECA 3E3RA 2KYFA 1K95A 2BE6A 1DVIA 1ZACA 1IWQA 2WCFA 3FIAA 2LMUA 5I2LA 3KO0A 1EG4A 2F8PA 1QX2A 2PMYA 2PSRA 1K9UA 2LMVA 1XFWO 1GQMA 1SCMB 2IS9A 4FQOA 2H2KA 1UP5A 4R1EA 2JTTA 3VRQA 4GGFA 1U5IB 1SR6B 2BL0C 1DJXA 2RGIA 2I7AA 1J7QA 1MQ1A 1MR8A 2E30A 2COLB 5HKWA 2PALA 1KFXL 2QPTA 3BUXB 1N2DA 2WOSA 3BUOB 4MEWA 1M31A 4YI9A 4DUQA 3PALA 1G8IA 1HQVA 4PE7A 4A4CA 4DCKA 4GPLB 1X02A 4GGFC 1A03A 2JC2A 1OZOA 1YURA 1CFDA 4YGAA 2K0JA 1UUSA 3K21A 1YX8A 1N65A 4U8DA 1Y6WA 3SG4A 2Q91A 2L5XB 1A4PA 1J1DA 2MJWB 1QVIY 2WCEA 3BUWB 4I5KA 1XFVO 2K2FA 5AERA 1RJVA 3GK2A 2JT0A 2L50A 1S3PA 3IF7A 3DVEA 2M9GA 5IBWA 2B1UA 4BY5A 4MBEA 4OKHA 1Y1UA 1F4OA 2KHNA 1K9KA 2KYCA 3I5HC 1BMOA 2LCPA 2CBLA 3DVJA 4M2QA 1BR4B 1K9PA 1Y1XA 2JXLA 2ZN8A 2M29A 3SG3A 1K94A 1MHOA 4MZKA 2M1UA 3M0WA 2M49B 3EVRA 1NYAA 1CLBA 3AAJA 1MF8B 4A4BA 4YGBB 3KEVA 1DJWA 1AP4A 2I2RE 1BLQA 1M39A 2HF5A 2OS8B 1ODBA 2BE4A 4YRUA 3SG7A 1CFCA 4NDDA 1JFKA 3JVTB 2JULA 4MRXA 1FW4A 2ZNDA 1Y1AA 4N5XA 1F4QA 4GGNA 4PALA 2LVJA 4C0JA 2LAPA 1TN4A 1W7JB 1DGVA 1JC2A 1PK0D 2M8UA 2FCDA 2PRUA 3TDIA 2Y1MA 1IQ5A 1S6CA 1SL8A 1WRLA 1TNWA 3DF0B 2JNXA 2LHIA 4PE1A 2I94A 4Q04A 1W7IB 2Y1NA 2CXJA 4CIDA 1IH0A 1G4YR 2ZN9A 3EK7A 1J55A 1QIWA 1CNPA 3AKAA 2BCBA 3BOWA 1DF0A 5CPVA 3DVMA 4MRYA 2KAYA 2VRGA 3O78A 1CM4A 3I5IC 2ZRTA 3EVUA 1QASA 3H4SE 3CR4X 1UURA 3D10A 1XA5A 5CSJA 3FWCA 2D8NA 1QLSA 2L2EA 3A8RA 1DTLA 1XVJA 3BOWB 3CS1A 3VGOA 3TUYC 4PHJA 4PCWA 1S5GZ 1TCFA 1RFJA 1CDMA 2KSPA 4JWQA 3VRNA 3SIAA 1C7WA 1ALWA 2LE9B 1BODA 2AUCA 1K93D 2GV5A 2LNKA 2OTGC 5I2OA 1V1GA 3I5FB 2JQ6A 5AANA 2V53A 1WRKA 3OX5A 1CDPA 3NSKA 3ZWHA 1M46A 3QRXA 1TNPA 3F45A 3OB2B 1NP8A 4ORBB 2WC8A 4M2OA 1SBJA 2FOTA 3LK0A 1LXFC 2JT8A 1WDCC 1IRJA 2FJUB 5G08A 1UWOA 1PSRA 1BR1B 4USLA 4C0LA 1U5IA 2PASA 2G9BA 3SG5A 1XYDA 4NDBA 4XJKA 1QX7A 4QJ5B 1PVAA 1SCMC 2KNEA 4I5LB 3ZNIA 4MSPA 1OMDA 1PSBA 1R2UA 1NCXA 4N1GA 4P2YB 3OB1B 5HLOA 1SK6D 2G2BA 1KCYA 2K7DA 1SR6C 3WHTB 5I2QA 3BXKA 1XK4A 1CLLA 3PLFB 1KFUS 1BOCA 3HCMA 4GFTA 1F8HA 1BF5A 4XJKB 4PHKA 4OR9B 1XO5A 1FI5A 1F70A 1M45A 1TRFA 3DVKA 4HRGA 2GGZA 3TDZA 2JXCA 2LV7A 2K7BA 4I5NB 5TNCA 3CWGA 2NXQA 1DJYA 4YBHB 3FS7A 4NDCA 1KQVA 1OMRA 2LMTA 2F3ZA 4YGCB 2LVKA 2KAVA 2KBMA 1EXRA 4PDZA 1S5GY 5I8NA 1S1EA 1YX7A 2BBMA 2M7NA 1K96A 2Y4QA 1EL4A 4DS7A 1SCVA 1KQMB 2E6WA 3KHEA 2KDHA 1TCOB 3SJSA 1UHHA 3RM1A 3AKBA 1CM1A 2BKHB 1BT6A 5AXIA 1XFYO 4JQ0D 1QATA 3KF9A 1DJHA 2A4JA 3WHUB 2JRFA 1XFXO 3EVVA 1F54A 1DJGA 1R6PA 1JFJA 2QACA 4I5JA 3WXAA 4MZLA 2JT3A 5GQQC 1CMFA 3CR5X 1OMVA 3SG6A 1MXEA 1KWOC 2H61A 2L98A 1KWOB 1GJYA 4YGEB 5DKQA 2MHHA 2HPSA 1AVSA 1G33A 1LA3A 5KU1A 4ORCB 1YRUB 3TDUA 2ZFDA 4HREE 2KFFA 1UHKA 2OS8C 2NCOA 2I18A 3DF0A 1M63B 1B9AA 1B8LA 1OSAA 3JVTC 3LL8B 1JBAA 4ETOA 2LP2A 2H61C 1IG5A 2CT9A 3LK1A 1KK7Z 1L2OC 2EHBA 1YVLA 5D7FA 1L2OB 3GK4X 1QV1A 1DT7B 3I5GB 4NQGA 1BU3A 5JOLA 3ICBA 2BCXA 3OHMB 5CSIA 2MBXA 2MLEC 1FF1A 4L9MA 2NZ0A 1WLMA 1EH2A 3SG2A 1E8AA 1CB1A 1XFUO 2PVBA 2BCAA 1EJ3A 4PE0A 4MZJA 1RK9A 1K90D 1FPWA 1JF2A 3PM8A 1OQPA 2JTZA 2NLNA 3IQQA 5AEQA 1AJ5A 3O2PA 2OPOA 4BY4A 2LUCA 1UHIA 3TZ1A 1JF0A 3VRRA 1FI6A 3VRPA 2FCEA 1RROA 2TN4A 1A2XA 3CTNA 2DOQA 3BQ3A 2LC5A 4E68A 1NSHA 1DJZA 1NCYA 4CFRA 1MUXA 1S6IA 1PRWA 2KI4C 1YRTB 2KI4B 2KFHA 5PALA 1L7ZA 1SW8A 3I5FC 1AUIB 1S26D 1H4BA 1YUTA 1PALA 3PATA 4ZCVA 1DJIA 5DKNA 1QXPA 2MRDA 5K89A 3PN7B 4ZCUA 2KI6C 1CTRA 3TS5C 1LA0A 3CGAA 3TS5B 2BKIB 2L0PA 3LCPC 1CDNA 1J7RA 1SL9A 1IKUA 4YGDB 1SYMA 1QVIZ 1JWDA 1ZUZA 1BJFA 4WQ2A 3O4YA 4DRWA 4ICBA 1Q80A 5HYDA 2L4IA 1IQ3A 4AQIA 2LLSA 1YR5A 2KBIA 5HLVA 4C0KA 5DKRA 1CFFA 5CSNA 3BYAA 1SRAA 2Q4UA 3FWBA 1CLMA 1SKTA 4OV2A 2F3YA 1TTXA 4CPVA 2JWWA 2M0RA 3OP0A 4MN0A 5BPJA 5D69A 2MLFC 3BUMB 1F71A 2JZIA 3AAKA 4MLWA 1C7VA 3GOFA 1PULA 1UHJA 1XK4C 1TNXA 2ZRSA 2M97A 4AQJA 1QS7A 1YUUA 1B8RA 1B8CA 1XFZO 1OZSA 4TNCA 2MAZA 5AFPA 1H8BA 4D1EA 3C1VA 5KSZA 2M3WA 2JOJA 1J7OA 1D1OA 1KQMC 2BL0B 2ZKMX 3WNXB 3IQOA 1TOPA 4ORAB 1A29A 3NSIA 2GGMA 3MSEB 1ZFSA 1QTXA 1EG3A 2JPTA 2SASA 1AK8A 5B8IB 1LVCD 1NUBA 1B47A 2KOTA 1NX2A 1NCZA 2LANA 4YI8A 4WRIA 3NXAA 1RTP1 1NPQA 1QX5B 3VROA 5J3XA 2F2OA 2SCPA 5HKZA 1GGZA 1ALVA 1WRZA 3EKJA 3KPXA 2K2AA 2L4HA 3DD4A 2R2IA 1NX1A 2KGBC 1SPYA 5ER4X 5FYXA 3GK1A 1N0YA 1J1EA 4IL1A 2P6BB 1V1FA 2LLUA 3EK8A 4P5OE 1VRKA 1OOJA 2JNFA 2KI6D 1TNQA 1NX0A 2F33A 3D0YA 4PHNA 1MWNA 2O5GA 3HX4A 4OCIA 4CFQA 1NIWA 3CZTX 1AHRA 3NSLA 2BECA 2HQ8A 2LHLA 3CR2A 2K61A 3JTDC 2LLTA 3JTDB 1SL7A 3I5HB 1YVHA 4AOMA 4N1FA 5KTYA 3I5GC 1K8UA 2WORA 1S36A 1KFUL 1CFPA 1PVBA 3D0YB 1YTZC 1B7TZ 2KGRA 4HRHA 1KSMA 2LVVA 1BG1A 1CMGA 1IJ6A 2HETA 4M2PA 5ER5A 3PFVA 5JJGA 2AAOA 2LVIA
chains in the Genus database with same CATH superfamily
1NWDA 1QIVA 3NSOA 3S0DA 3PSRA 3L4AA 2JU0A 1QV0A 2F2PA 2KPHA 3A4UB 4GAOA 4WQ3A 3SIBA 1IJ5A 4INXA 1UHNA 1WY9A 2KQ6A 3EG5B 1K2HA 4XYNA 1KK8C 1KSOA 3O6BA 1KK8B 4FTGA 1QJTA 4OVNF 4F0ZB 2WCBA 1B1GA 1ZOTB 3EKHA 1JSAA 1SNLA 2ZNEA 2K7CA 2KFGA 1CKKA 2WCMA 1LINA 2ISDA 3R1PA 3EK4A 2EC6C 2QEOA 3PM2A 1WLZA 2EC6B 1KFXS 2Y5IA 3VB1A 4PE4A 1QLKA 3B86A 3UNWA 3I5IB 2CTNA 2O60A 1DMOA 5F6TA 3RLZA 4PHMA 2LM5A 3PN7C 2K7OA 4GNKB 1S6JA 2QEVA 2KAXA 1GGWA 2HQWA 3OX6A 1AJ4A 1CDLA 1Y0VH 5HKYA 1A75A 2KLEA 2M1KB 1DF0B 1TIZA 3TUYB 2BBNA 1YUSA 2L51A 4HSZA 2AMIA 4MVFA 2NCPA 3BFBA 4CLNA 1F55A 2LP3A 4JPZB 3B87A 4UPGA 1MXLC 3D73A 2OTGB 4QJ4B 1C07A 3CABA 1B4CA 1FBVA 1KK7Y 1A75B 2GTEA 5CSFA 1J7PA 2K8MB 1LKJA 3R1OA 1HT9A 2EGDA 1ORGA 4DIRA 1NX3A 1RWYA 3CLNA 1SY9A 2CNPA 1B7TY 2L5YA 2LUXA 2MA2A 1OE9B 2QDIA 4QJ3B 2WNDA 1GM0A 3BJHA 1SMGA 3BUNB 2M7LA 2CCMA 4GBAA 2KQYA 4GUKA 3LLEA 1ZMZA 1T14A 1JUOA 1DGUA 1IGVA 1WDCB 1RECA 2FJYA 3E3RA 2KYFA 4JD9A 1K95A 2BE6A 4JKTA 1DVIA 1ZACA 1OW4A 1IWQA 1OOIX 2WCFA 3FIAA 2LMUA 5I2LA 3KO0A 1EG4A 3FE8A 2F8PA 3R1VA 1QX2A 2PMYA 2PSRA 1K9UA 2LMVA 1XFWO 1OOHA 1GQMA 1SCMB 2IS9A 3SS4A 3BFAA 4FQOA 2H2KA 2WCHA 1UP5A 2BNXA 2JPOA 4R1EA 2JTTA 3VRQA 3S0AA 5DICA 4GGFA 1U5IB 1SR6B 2BL0C 1DJXA 2RGIA 2I7AA 1J7QA 1MQ1A 1MR8A 2E30A 2COLB 5HKWA 2PALA 5EL2A 1KFXL 2QPTA 3BUXB 1N2DA 2WOSA 3BUOB 4MEWA 1M31A 4YI9A 4DUQA 3PALA 1G8IA 1HQVA 4PE7A 4A4CA 4DCKA 4GPLB 1X02A 3CZ1A 4GGFC 1A03A 2YGUA 2JC2A 1YURA 1OZOA 1CFDA 4YGAA 2K0JA 1UUSA 3K21A 1YX8A 1N65A 4U8DA 1Y6WA 3SG4A 2Q91A 2L5XB 1A4PA 1J1DA 2MJWB 1QVIY 2WCEA 3UO9A 3BUWB 4I5KA 1XFVO 2K2FA 1Z2CB 5AERA 1RJVA 3GK2A 2JT0A 3D76A 2L50A 1S3PA 2WC6A 3IF7A 1OOGA 3DVEA 2M9GA 5IBWA 3OBVA 2B1UA 4BY5A 4MBEA 4OKHA 1Y1UA 1F4OA 2KHNA 1K9KA 2KYCA 3I5HC 1BMOA 2LCPA 1LS8A 2CBLA 3DVJA 4M2QA 1BR4B 1K9PA 1Y1XA 2JXLA 4FQTA 2ZN8A 4IJ7A 2M29A 3SG3A 1K94A 1MHOA 4MZKA 2M1UA 3M0WA 2WCJA 2M49B 3EVRA 1NYAA 3B7AA 1CLBA 3AAJA 1MF8B 1W9ZA 4A4BA 4YGBB 3KEVA 1DJWA 1AP4A 2I2RE 1BLQA 1M39A 2HF5A 2OS8B 3SS3A 1ODBA 2BE4A 4YRUA 3SG7A 1CFCA 4NDDA 1JFKA 3JVTB 2JULA 4MRXA 1FW4A 2ZNDA 1Y1AA 4N5XA 1F4QA 4GGNA 4PALA 2LVJA 4C0JA 2LAPA 1TN4A 1W7JB 1DGVA 1JC2A 1PK0D 2M8UA 2FCDA 2PRUA 3TDIA 2Y1MA 1IQ5A 1S6CA 1SL8A 1WRLA 1TNWA 3DF0B 2JNXA 2LHIA 3DYEA 4PE1A 2I94A 4Q04A 2BAPA 1W7IB 2Y1NA 2CXJA 4CIDA 3D77A 1G4YR 2ZN9A 3EK7A 1J55A 1QIWA 1CNPA 1IH0A 3AKAA 2BCBA 3BOWA 1DF0A 5CPVA 3DVMA 4MRYA 2KAYA 2VRGA 3R72A 3O78A 1CM4A 3I5IC 2ZRTA 3EVUA 1QASA 3H4SE 3CR4X 1UURA 3D10A 1XA5A 3S0EA 5CSJA 3FWCA 2D8NA 1QLSA 2L2EA 3A8RA 3DXLA 1DTLA 1XVJA 3BOWB 3CS1A 3VGOA 2P71A 4PHJA 3TUYC 4PCWA 1S5GZ 1TCFA 1RFJA 1CDMA 2KSPA 4JWQA 3O4XA 3SIAA 3VRNA 1C7WA 4INWA 1ALWA 2LE9B 1BODA 2AUCA 1K93D 2GV5A 2LNKA 2OTGC 5I2OA 2H8VA 3L4LA 1V1GA 4PT1A 3I5FB 2WCLA 1IIOA 2JQ6A 5AANA 2V53A 1WRKA 3OX5A 1CDPA 3NSKA 3ZWHA 1M46A 3QRXA 1TNPA 3F45A 3OB2B 1NP8A 4ORBB 2WC8A 4M2OA 1SBJA 2FOTA 3LK0A 1LXFC 2JT8A 1WDCC 1IRJA 2FJUB 5G08A 1UWOA 1PSRA 1BR1B 4USLA 4C0LA 1U5IA 2PASA 3D74A 2G9BA 3SG5A 1XYDA 4NDBA 2ERBA 3OGNA 4XJKA 1QX7A 4QJ5B 1PVAA 1SCMC 2KNEA 4I5LB 3ZNIA 4MSPA 3S0GA 1OMDA 1PSBA 1R2UA 1NCXA 4N1GA 4P2YB 3OB1B 5HLOA 1SK6D 2G2BA 1KCYA 2K7DA 2PQLA 1SR6C 2K60A 3WHTB 5I2QA 3BXKA 1XK4A 1CLLA 3PLFB 3BFHA 1KFUS 1BOCA 3HCMA 4GFTA 1F8HA 1BF5A 3FE9A 4PHKA 4OR9B 1XO5A 4XJKB 1FI5A 1F70A 5FI2A 1M45A 1TRFA 3DVKA 3B88A 4HRGA 2GGZA 3S0BA 3TDZA 2JXCA 2LV7A 2K7BA 4I5NB 5TNCA 3CWGA 2NXQA 1DJYA 4YBHB 3FS7A 4NDCA 3CDNA 1KQVA 3V2LA 1OMRA 2LMTA 2F3ZA 4YGCB 2LVKA 2KAVA 2KBMA 1EXRA 4PDZA 1S5GY 5I8NA 1S1EA 1XFRA 1YX7A 2BBMA 2M7NA 1K96A 2Y4QA 1EL4A 4DS7A 1SCVA 1KQMB 2E6WA 3KHEA 2KDHA 3NGVA 1TCOB 3SJSA 1UHHA 3RM1A 3AKBA 1CM1A 2BKHB 1BT6A 5AXIA 1XFYO 4JQ0D 1QATA 3KF9A 1DJHA 2A4JA 1SSEB 2JRFA 1XFXO 3EVVA 3WHUB 1F54A 1DJGA 1R6PA 1JFJA 2QACA 4I5JA 3NHTA 3CZ0A 3WXAA 4MZLA 2JT3A 5FI6A 2L2CA 5GQQC 3S0FA 1CMFA 3CR5X 1OMVA 3SG6A 1MXEA 1KWOC 2H61A 2L98A 2KLDA 1KWOB 1GJYA 3QMEA 4YGEB 5DKQA 2MHHA 2HPSA 1DC1A 1AVSA 1G33A 1LA3A 5KU1A 4ORCB 1YRUB 3TDUA 2ZFDA 2P70A 4HREE 2KFFA 1UHKA 2OS8C 2NCOA 2I18A 3DF0A 1M63B 1B9AA 1B8LA 1OSAA 3JVTC 3LL8B 1JBAA 4ETOA 2LP2A 2H61C 1IG5A 2CT9A 3LK1A 1KK7Z 1L2OC 2EHBA 1YVLA 3DY9A 5D7FA 1L2OB 3GK4X 1QV1A 3SS5A 1DT7B 3I5GB 5D3OA 4NQGA 1BU3A 5JOLA 3ICBA 2BCXA 3OHMB 5CSIA 2MBXA 2MLEC 1FF1A 5FI7A 3N7HA 4L9MA 2NZ0A 1WLMA 1EH2A 3SG2A 1E8AA 1CB1A 1XFUO 2PVBA 2BCAA 1EJ3A 4PE0A 4MZJA 1RK9A 1K90D 1FPWA 1JF2A 3PM8A 1OQPA 1DQEA 2JTZA 2NLNA 3IQQA 5AEQA 2PYQA 1AJ5A 3O2PA 2OPOA 4KYNA 4BY4A 2LUCA 1UHIA 3TZ1A 3D78A 1JF0A 3VRRA 1FI6A 3VRPA 2FCEA 1RROA 2TN4A 1C3ZA 1A2XA 1TUZA 3CTNA 1P28A 2DOQA 3B6XA 3BQ3A 2LC5A 4E68A 1NSHA 1DJZA 1NCYA 4CFRA 1MUXA 1S6IA 1PRWA 2KI4C 1YRTB 2KI4B 2KFHA 5PALA 3RZSA 1L7ZA 1SW8A 3I5FC 1AUIB 1S26D 1H4BA 1YUTA 1PALA 3PATA 4ZCVA 1DJIA 5DKNA 1QXPA 2MRDA 5K89A 3PN7B 4ZCUA 2KI6C 1CTRA 3TS5C 1LA0A 3CGAA 1DELA 2BKIB 3TS5B 2L0PA 3LCPC 1CDNA 3D75A 1J7RA 1SL9A 1IKUA 4YGDB 1OOFA 1QVIZ 1SYMA 1JWDA 1ZUZA 1BJFA 4WQ2A 3O4YA 2QEHA 4DRWA 4ICBA 1Q80A 5HYDA 2L4IA 1IQ3A 4AQIA 2LLSA 1YR5A 2KBIA 1QWVA 5HLVA 4C0KA 3CZ2A 5DKRA 1CFFA 5CSNA 3BYAA 1SRAA 2Q4UA 3FWBA 1CLMA 1SKTA 1Z4HA 4OV2A 2F3YA 1TTXA 4CPVA 2JWWA 2M0RA 3OP0A 4MN0A 3PJIA 5D69A 2MLFC 5BPJA 3BUMB 1F71A 2JZIA 3AAKA 4MLWA 1C7VA 3GOFA 1PULA 4OZDA 1UHJA 1XK4C 1TNXA 2ZRSA 2M97A 4AQJA 1QS7A 1YUUA 1B8RA 1B8CA 1XFZO 2WC5A 1OZSA 4TNCA 2MAZA 5AFPA 1H8BA 4D1EA 3C1VA 5KSZA 2M3WA 2JOJA 1J7OA 2QEBA 1D1OA 1KQMC 2BL0B 2ZKMX 3WNXB 3IQOA 1TOPA 4ORAB 1A29A 3NSIA 2GGMA 3MSEB 1ZFSA 1QTXA 1EG3A 2JPTA 2SASA 1AK8A 5B8IB 1LVCD 1NUBA 1B47A 2KOTA 1NX2A 1NCZA 2LANA 3NHIA 3DZTA 4WRIA 4YI8A 3NXAA 1RTP1 1NPQA 1QX5B 3VROA 5J3XA 3FE6A 2F2OA 2SCPA 5HKZA 3CYZA 1GGZA 1ALVA 1WRZA 3EKJA 3IVTA 3KPXA 1TWOA 3L47A 2K2AA 2L4HA 3DD4A 2R2IA 1NX1A 2KGBC 1SPYA 5ER4X 5FYXA 3GK1A 1N0YA 1J1EA 4IL1A 2P6BB 1V1FA 2LLUA 3Q8IA 3EK8A 4P5OE 1VRKA 1OOJA 2JNFA 2KI6D 1TNQA 1NX0A 2F33A 3D0YA 4PHNA 1MWNA 2O5GA 3HX4A 4OCIA 4CFQA 1NIWA 3CZTX 1AHRA 3K1EA 3NSLA 5I94A 2WCKA 1C3YA 2BECA 2HQ8A 2LHLA 3CR2A 2K61A 3JTDC 2LLTA 3JTDB 1SL7A 3I5HB 1YVHA 1DEKA 4N1FA 4AOMA 5KTYA 3I5GC 1K8UA 1TUJA 2WORA 1S36A 1KFUL 5HL1A 1CFPA 1PVBA 3D0YB 1YTZC 1B7TZ 2KGRA 4HRHA 1KSMA 2LVVA 1BG1A 1CMGA 1IJ6A 2HETA 4M2PA 5ER5A 3PFVA 5JJGA 4F7FA 2AAOA 2LVIA
chains in the Genus database with same CATH topology
1NWDA 1QIVA 3NSOA 3PSRA 2JU0A 1QV0A 2F2PA 3A4UB 4GAOA 4WQ3A 3SIBA 1IJ5A 1UHNA 1WY9A 2KQ6A 1K2HA 4XYNA 1KK8C 1KSOA 3O6BA 1KK8B 4FTGA 1QJTA 4OVNF 4F0ZB 2WCBA 1B1GA 1ZOTB 3EKHA 1JSAA 1SNLA 2ZNEA 2K7CA 2KFGA 1CKKA 1LINA 2ISDA 3EK4A 2EC6C 1WLZA 2EC6B 1KFXS 2Y5IA 4PE4A 1QLKA 3I5IB 2CTNA 2O60A 1DMOA 5F6TA 3RLZA 4PHMA 2LM5A 3PN7C 2K7OA 4GNKB 1S6JA 2KAXA 1GGWA 2HQWA 3OX6A 1AJ4A 1CDLA 1Y0VH 5HKYA 1A75A 2M1KB 1DF0B 1TIZA 3TUYB 2BBNA 1YUSA 2L51A 4HSZA 2AMIA 4MVFA 2NCPA 1F55A 4CLNA 2LP3A 4JPZB 4UPGA 1MXLC 2OTGB 4QJ4B 1C07A 1B4CA 1FBVA 1KK7Y 1A75B 5CSFA 1J7PA 2K8MB 1LKJA 1HT9A 2EGDA 4DIRA 1NX3A 1RWYA 3CLNA 1SY9A 2CNPA 1B7TY 2LUXA 2MA2A 4QJ3B 1OE9B 2WNDA 1SMGA 3BUNB 2M7LA 2CCMA 4GBAA 2KQYA 4GUKA 3LLEA 1ZMZA 1JUOA 1DGUA 1IGVA 1WDCB 1RECA 3E3RA 2KYFA 1K95A 2BE6A 1DVIA 1ZACA 1IWQA 2WCFA 3FIAA 2LMUA 5I2LA 3KO0A 1EG4A 2F8PA 1QX2A 2PMYA 2PSRA 1K9UA 2LMVA 1XFWO 1GQMA 1SCMB 2IS9A 4FQOA 2H2KA 1UP5A 4R1EA 2JTTA 3VRQA 4GGFA 1U5IB 1SR6B 2BL0C 1DJXA 2RGIA 2I7AA 1J7QA 1MQ1A 1MR8A 2E30A 2COLB 5HKWA 2PALA 1KFXL 2QPTA 3BUXB 1N2DA 2WOSA 3BUOB 4MEWA 1M31A 4YI9A 4DUQA 3PALA 1G8IA 1HQVA 4PE7A 4A4CA 4DCKA 4GPLB 1X02A 4GGFC 1A03A 2JC2A 1OZOA 1YURA 1CFDA 4YGAA 2K0JA 1UUSA 3K21A 1YX8A 1N65A 4U8DA 1Y6WA 3SG4A 2Q91A 2L5XB 1A4PA 1J1DA 2MJWB 1QVIY 2WCEA 3BUWB 4I5KA 1XFVO 2K2FA 5AERA 1RJVA 3GK2A 2JT0A 2L50A 1S3PA 3IF7A 3DVEA 2M9GA 5IBWA 2B1UA 4BY5A 4MBEA 4OKHA 1Y1UA 1F4OA 2KHNA 1K9KA 2KYCA 3I5HC 1BMOA 2LCPA 2CBLA 3DVJA 4M2QA 1BR4B 1K9PA 1Y1XA 2JXLA 2ZN8A 2M29A 3SG3A 1K94A 1MHOA 4MZKA 2M1UA 3M0WA 2M49B 3EVRA 1NYAA 1CLBA 3AAJA 1MF8B 4A4BA 4YGBB 3KEVA 1DJWA 1AP4A 2I2RE 1BLQA 1M39A 2HF5A 2OS8B 1ODBA 2BE4A 4YRUA 3SG7A 1CFCA 4NDDA 1JFKA 3JVTB 2JULA 4MRXA 1FW4A 2ZNDA 1Y1AA 4N5XA 1F4QA 4GGNA 4PALA 2LVJA 4C0JA 2LAPA 1TN4A 1W7JB 1DGVA 1JC2A 1PK0D 2M8UA 2FCDA 2PRUA 3TDIA 2Y1MA 1IQ5A 1S6CA 1SL8A 1WRLA 1TNWA 3DF0B 2JNXA 2LHIA 4PE1A 2I94A 4Q04A 1W7IB 2Y1NA 2CXJA 4CIDA 1IH0A 1G4YR 2ZN9A 3EK7A 1J55A 1QIWA 1CNPA 3AKAA 2BCBA 3BOWA 1DF0A 5CPVA 3DVMA 4MRYA 2KAYA 2VRGA 3O78A 1CM4A 3I5IC 2ZRTA 3EVUA 1QASA 3H4SE 3CR4X 1UURA 3D10A 1XA5A 5CSJA 3FWCA 2D8NA 1QLSA 2L2EA 3A8RA 1DTLA 1XVJA 3BOWB 3CS1A 3VGOA 3TUYC 4PHJA 4PCWA 1S5GZ 1TCFA 1RFJA 1CDMA 2KSPA 4JWQA 3VRNA 3SIAA 1C7WA 1ALWA 2LE9B 1BODA 2AUCA 1K93D 2GV5A 2LNKA 2OTGC 5I2OA 1V1GA 3I5FB 2JQ6A 5AANA 2V53A 1WRKA 3OX5A 1CDPA 3NSKA 3ZWHA 1M46A 3QRXA 1TNPA 3F45A 3OB2B 1NP8A 4ORBB 2WC8A 4M2OA 1SBJA 2FOTA 3LK0A 1LXFC 2JT8A 1WDCC 1IRJA 2FJUB 5G08A 1UWOA 1PSRA 1BR1B 4USLA 4C0LA 1U5IA 2PASA 2G9BA 3SG5A 1XYDA 4NDBA 4XJKA 1QX7A 4QJ5B 1PVAA 1SCMC 2KNEA 4I5LB 3ZNIA 4MSPA 1OMDA 1PSBA 1R2UA 1NCXA 4N1GA 4P2YB 3OB1B 5HLOA 1SK6D 2G2BA 1KCYA 2K7DA 1SR6C 3WHTB 5I2QA 3BXKA 1XK4A 1CLLA 3PLFB 1KFUS 1BOCA 3HCMA 4GFTA 1F8HA 1BF5A 4XJKB 4PHKA 4OR9B 1XO5A 1FI5A 1F70A 1M45A 1TRFA 3DVKA 4HRGA 2GGZA 3TDZA 2JXCA 2LV7A 2K7BA 4I5NB 5TNCA 3CWGA 2NXQA 1DJYA 4YBHB 3FS7A 4NDCA 1KQVA 1OMRA 2LMTA 2F3ZA 4YGCB 2LVKA 2KAVA 2KBMA 1EXRA 4PDZA 1S5GY 5I8NA 1S1EA 1YX7A 2BBMA 2M7NA 1K96A 2Y4QA 1EL4A 4DS7A 1SCVA 1KQMB 2E6WA 3KHEA 2KDHA 1TCOB 3SJSA 1UHHA 3RM1A 3AKBA 1CM1A 2BKHB 1BT6A 5AXIA 1XFYO 4JQ0D 1QATA 3KF9A 1DJHA 2A4JA 3WHUB 2JRFA 1XFXO 3EVVA 1F54A 1DJGA 1R6PA 1JFJA 2QACA 4I5JA 3WXAA 4MZLA 2JT3A 5GQQC 1CMFA 3CR5X 1OMVA 3SG6A 1MXEA 1KWOC 2H61A 2L98A 1KWOB 1GJYA 4YGEB 5DKQA 2MHHA 2HPSA 1AVSA 1G33A 1LA3A 5KU1A 4ORCB 1YRUB 3TDUA 2ZFDA 4HREE 2KFFA 1UHKA 2OS8C 2NCOA 2I18A 3DF0A 1M63B 1B9AA 1B8LA 1OSAA 3JVTC 3LL8B 1JBAA 4ETOA 2LP2A 2H61C 1IG5A 2CT9A 3LK1A 1KK7Z 1L2OC 2EHBA 1YVLA 5D7FA 1L2OB 3GK4X 1QV1A 1DT7B 3I5GB 4NQGA 1BU3A 5JOLA 3ICBA 2BCXA 3OHMB 5CSIA 2MBXA 2MLEC 1FF1A 4L9MA 2NZ0A 1WLMA 1EH2A 3SG2A 1E8AA 1CB1A 1XFUO 2PVBA 2BCAA 1EJ3A 4PE0A 4MZJA 1RK9A 1K90D 1FPWA 1JF2A 3PM8A 1OQPA 2JTZA 2NLNA 3IQQA 5AEQA 1AJ5A 3O2PA 2OPOA 4BY4A 2LUCA 1UHIA 3TZ1A 1JF0A 3VRRA 1FI6A 3VRPA 2FCEA 1RROA 2TN4A 1A2XA 3CTNA 2DOQA 3BQ3A 2LC5A 4E68A 1NSHA 1DJZA 1NCYA 4CFRA 1MUXA 1S6IA 1PRWA 2KI4C 1YRTB 2KI4B 2KFHA 5PALA 1L7ZA 1SW8A 3I5FC 1AUIB 1S26D 1H4BA 1YUTA 1PALA 3PATA 4ZCVA 1DJIA 5DKNA 1QXPA 2MRDA 5K89A 3PN7B 4ZCUA 2KI6C 1CTRA 3TS5C 1LA0A 3CGAA 3TS5B 2BKIB 2L0PA 3LCPC 1CDNA 1J7RA 1SL9A 1IKUA 4YGDB 1SYMA 1QVIZ 1JWDA 1ZUZA 1BJFA 4WQ2A 3O4YA 4DRWA 4ICBA 1Q80A 5HYDA 2L4IA 1IQ3A 4AQIA 2LLSA 1YR5A 2KBIA 5HLVA 4C0KA 5DKRA 1CFFA 5CSNA 3BYAA 1SRAA 2Q4UA 3FWBA 1CLMA 1SKTA 4OV2A 2F3YA 1TTXA 4CPVA 2JWWA 2M0RA 3OP0A 4MN0A 5BPJA 5D69A 2MLFC 3BUMB 1F71A 2JZIA 3AAKA 4MLWA 1C7VA 3GOFA 1PULA 1UHJA 1XK4C 1TNXA 2ZRSA 2M97A 4AQJA 1QS7A 1YUUA 1B8RA 1B8CA 1XFZO 1OZSA 4TNCA 2MAZA 5AFPA 1H8BA 4D1EA 3C1VA 5KSZA 2M3WA 2JOJA 1J7OA 1D1OA 1KQMC 2BL0B 2ZKMX 3WNXB 3IQOA 1TOPA 4ORAB 1A29A 3NSIA 2GGMA 3MSEB 1ZFSA 1QTXA 1EG3A 2JPTA 2SASA 1AK8A 5B8IB 1LVCD 1NUBA 1B47A 2KOTA 1NX2A 1NCZA 2LANA 4YI8A 4WRIA 3NXAA 1RTP1 1NPQA 1QX5B 3VROA 5J3XA 2F2OA 2SCPA 5HKZA 1GGZA 1ALVA 1WRZA 3EKJA 3KPXA 2K2AA 2L4HA 3DD4A 2R2IA 1NX1A 2KGBC 1SPYA 5ER4X 5FYXA 3GK1A 1N0YA 1J1EA 4IL1A 2P6BB 1V1FA 2LLUA 3EK8A 4P5OE 1VRKA 1OOJA 2JNFA 2KI6D 1TNQA 1NX0A 2F33A 3D0YA 4PHNA 1MWNA 2O5GA 3HX4A 4OCIA 4CFQA 1NIWA 3CZTX 1AHRA 3NSLA 2BECA 2HQ8A 2LHLA 3CR2A 2K61A 3JTDC 2LLTA 3JTDB 1SL7A 3I5HB 1YVHA 4AOMA 4N1FA 5KTYA 3I5GC 1K8UA 2WORA 1S36A 1KFUL 1CFPA 1PVBA 3D0YB 1YTZC 1B7TZ 2KGRA 4HRHA 1KSMA 2LVVA 1BG1A 1CMGA 1IJ6A 2HETA 4M2PA 5ER5A 3PFVA 5JJGA 2AAOA 2LVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWD A;  1QIV A;  3NSO A;  3PSR A;  2JU0 A;  1QV0 A;  2F2P A;  3A4U B;  4GAO A;  4WQ3 A;  3SIB A;  1IJ5 A;  1UHN A;  1WY9 A;  2KQ6 A;  1K2H A;  4XYN A;  1KK8 C;  1KSO A;  3O6B A;  1KK8 B;  4FTG A;  1QJT A;  4OVN F;  4F0Z B;  2WCB A;  1B1G A;  1ZOT B;  3EKH A;  1JSA A;  1SNL A;  2ZNE A;  2K7C A;  2KFG A;  1CKK A;  1LIN A;  2ISD A;  3EK4 A;  2EC6 C;  1WLZ A;  2EC6 B;  1KFX S;  2Y5I A;  4PE4 A;  1QLK A;  3I5I B;  2CTN A;  2O60 A;  1DMO A;  5F6T A;  3RLZ A;  4PHM A;  2LM5 A;  3PN7 C;  2K7O A;  4GNK B;  1S6J A;  2KAX A;  1GGW A;  2HQW A;  3OX6 A;  1AJ4 A;  1CDL A;  1Y0V H;  5HKY A;  1A75 A;  2M1K B;  1DF0 B;  1TIZ A;  3TUY B;  2BBN A;  1YUS A;  2L51 A;  4HSZ A;  2AMI A;  4MVF A;  2NCP A;  1F55 A;  4CLN A;  2LP3 A;  4JPZ B;  4UPG A;  1MXL C;  2OTG B;  4QJ4 B;  1C07 A;  1B4C A;  1FBV A;  1KK7 Y;  1A75 B;  5CSF A;  1J7P A;  2K8M B;  1LKJ A;  1HT9 A;  2EGD A;  4DIR A;  1NX3 A;  1RWY A;  3CLN A;  1SY9 A;  2CNP A;  1B7T Y;  2LUX A;  2MA2 A;  4QJ3 B;  1OE9 B;  2WND A;  1SMG A;  3BUN B;  2M7L A;  2CCM A;  4GBA A;  2KQY A;  4GUK A;  3LLE A;  1ZMZ A;  1JUO A;  1DGU A;  1IGV A;  1WDC B;  1REC A;  3E3R A;  2KYF A;  1K95 A;  2BE6 A;  1DVI A;  1ZAC A;  1IWQ A;  2WCF A;  3FIA A;  2LMU A;  5I2L A;  3KO0 A;  1EG4 A;  2F8P A;  1QX2 A;  2PMY A;  2PSR A;  1K9U A;  2LMV A;  1XFW O;  1GQM A;  1SCM B;  2IS9 A;  4FQO A;  2H2K A;  1UP5 A;  4R1E A;  2JTT A;  3VRQ A;  4GGF A;  1U5I B;  1SR6 B;  2BL0 C;  1DJX A;  2RGI A;  2I7A A;  1J7Q A;  1MQ1 A;  1MR8 A;  2E30 A;  2COL B;  5HKW A;  2PAL A;  1KFX L;  2QPT A;  3BUX B;  1N2D A;  2WOS A;  3BUO B;  4MEW A;  1M31 A;  4YI9 A;  4DUQ A;  3PAL A;  1G8I A;  1HQV A;  4PE7 A;  4A4C A;  4DCK A;  4GPL B;  1X02 A;  4GGF C;  1A03 A;  2JC2 A;  1OZO A;  1YUR A;  1CFD A;  4YGA A;  2K0J A;  1UUS A;  3K21 A;  1YX8 A;  1N65 A;  4U8D A;  1Y6W A;  3SG4 A;  2Q91 A;  2L5X B;  1A4P A;  1J1D A;  2MJW B;  1QVI Y;  2WCE A;  3BUW B;  4I5K A;  1XFV O;  2K2F A;  5AER A;  1RJV A;  3GK2 A;  2JT0 A;  2L50 A;  1S3P A;  3IF7 A;  3DVE A;  2M9G A;  5IBW A;  2B1U A;  4BY5 A;  4MBE A;  4OKH A;  1Y1U A;  1F4O A;  2KHN A;  1K9K A;  2KYC A;  3I5H C;  1BMO A;  2LCP A;  2CBL A;  3DVJ A;  4M2Q A;  1BR4 B;  1K9P A;  1Y1X A;  2JXL A;  2ZN8 A;  2M29 A;  3SG3 A;  1K94 A;  1MHO A;  4MZK A;  2M1U A;  3M0W A;  2M49 B;  3EVR A;  1NYA A;  1CLB A;  3AAJ A;  1MF8 B;  4A4B A;  4YGB B;  3KEV A;  1DJW A;  1AP4 A;  2I2R E;  1BLQ A;  1M39 A;  2HF5 A;  2OS8 B;  1ODB A;  2BE4 A;  4YRU A;  3SG7 A;  1CFC A;  4NDD A;  1JFK A;  3JVT B;  2JUL A;  4MRX A;  1FW4 A;  2ZND A;  1Y1A A;  4N5X A;  1F4Q A;  4GGN A;  4PAL A;  2LVJ A;  4C0J A;  2LAP A;  1TN4 A;  1W7J B;  1DGV A;  1JC2 A;  1PK0 D;  2M8U A;  2FCD A;  2PRU A;  3TDI A;  2Y1M A;  1IQ5 A;  1S6C A;  1SL8 A;  1WRL A;  1TNW A;  3DF0 B;  2JNX A;  2LHI A;  4PE1 A;  2I94 A;  4Q04 A;  1W7I B;  2Y1N A;  2CXJ A;  4CID A;  1IH0 A;  1G4Y R;  2ZN9 A;  3EK7 A;  1J55 A;  1QIW A;  1CNP A;  3AKA A;  2BCB A;  3BOW A;  1DF0 A;  5CPV A;  3DVM A;  4MRY A;  2KAY A;  2VRG A;  3O78 A;  1CM4 A;  3I5I C;  2ZRT A;  3EVU A;  1QAS A;  3H4S E;  3CR4 X;  1UUR A;  3D10 A;  1XA5 A;  5CSJ A;  3FWC A;  2D8N A;  1QLS A;  2L2E A;  3A8R A;  1DTL A;  1XVJ A;  3BOW B;  3CS1 A;  3VGO A;  3TUY C;  4PHJ A;  4PCW A;  1S5G Z;  1TCF A;  1RFJ A;  1CDM A;  2KSP A;  4JWQ A;  3VRN A;  3SIA A;  1C7W A;  1ALW A;  2LE9 B;  1BOD A;  2AUC A;  1K93 D;  2GV5 A;  2LNK A;  2OTG C;  5I2O A;  1V1G A;  3I5F B;  2JQ6 A;  5AAN A;  2V53 A;  1WRK A;  3OX5 A;  1CDP A;  3NSK A;  3ZWH A;  1M46 A;  3QRX A;  1TNP A;  3F45 A;  3OB2 B;  1NP8 A;  4ORB B;  2WC8 A;  4M2O A;  1SBJ A;  2FOT A;  3LK0 A;  1LXF C;  2JT8 A;  1WDC C;  1IRJ A;  2FJU B;  5G08 A;  1UWO A;  1PSR A;  1BR1 B;  4USL A;  4C0L A;  1U5I A;  2PAS A;  2G9B A;  3SG5 A;  1XYD A;  4NDB A;  4XJK A;  1QX7 A;  4QJ5 B;  1PVA A;  1SCM C;  2KNE A;  4I5L B;  3ZNI A;  4MSP A;  1OMD A;  1PSB A;  1R2U A;  1NCX A;  4N1G A;  4P2Y B;  3OB1 B;  5HLO A;  1SK6 D;  2G2B A;  1KCY A;  2K7D A;  1SR6 C;  3WHT B;  5I2Q A;  3BXK A;  1XK4 A;  1CLL A;  3PLF B;  1KFU S;  1BOC A;  3HCM A;  4GFT A;  1F8H A;  1BF5 A;  4XJK B;  4PHK A;  4OR9 B;  1XO5 A;  1FI5 A;  1F70 A;  1M45 A;  1TRF A;  3DVK A;  4HRG A;  2GGZ A;  3TDZ A;  2JXC A;  2LV7 A;  2K7B A;  4I5N B;  5TNC A;  3CWG A;  2NXQ A;  1DJY A;  4YBH B;  3FS7 A;  4NDC A;  1KQV A;  1OMR A;  2LMT A;  2F3Z A;  4YGC B;  2LVK A;  2KAV A;  2KBM A;  1EXR A;  4PDZ A;  1S5G Y;  5I8N A;  1S1E A;  1YX7 A;  2BBM A;  2M7N A;  1K96 A;  2Y4Q A;  1EL4 A;  4DS7 A;  1SCV A;  1KQM B;  2E6W A;  3KHE A;  2KDH A;  1TCO B;  3SJS A;  1UHH A;  3RM1 A;  3AKB A;  1CM1 A;  2BKH B;  1BT6 A;  5AXI A;  1XFY O;  4JQ0 D;  1QAT A;  3KF9 A;  1DJH A;  2A4J A;  3WHU B;  2JRF A;  1XFX O;  3EVV A;  1F54 A;  1DJG A;  1R6P A;  1JFJ A;  2QAC A;  4I5J A;  3WXA A;  4MZL A;  2JT3 A;  5GQQ C;  1CMF A;  3CR5 X;  1OMV A;  3SG6 A;  1MXE A;  1KWO C;  2H61 A;  2L98 A;  1KWO B;  1GJY A;  4YGE B;  5DKQ A;  2MHH A;  2HPS A;  1AVS A;  1G33 A;  1LA3 A;  5KU1 A;  4ORC B;  1YRU B;  3TDU A;  2ZFD A;  4HRE E;  2KFF A;  1UHK A;  2OS8 C;  2NCO A;  2I18 A;  3DF0 A;  1M63 B;  1B9A A;  1B8L A;  1OSA A;  3JVT C;  3LL8 B;  1JBA A;  4ETO A;  2LP2 A;  2H61 C;  1IG5 A;  2CT9 A;  3LK1 A;  1KK7 Z;  1L2O C;  2EHB A;  1YVL A;  5D7F A;  1L2O B;  3GK4 X;  1QV1 A;  1DT7 B;  3I5G B;  4NQG A;  1BU3 A;  5JOL A;  3ICB A;  2BCX A;  3OHM B;  5CSI A;  2MBX A;  2MLE C;  1FF1 A;  4L9M A;  2NZ0 A;  1WLM A;  1EH2 A;  3SG2 A;  1E8A A;  1CB1 A;  1XFU O;  2PVB A;  2BCA A;  1EJ3 A;  4PE0 A;  4MZJ A;  1RK9 A;  1K90 D;  1FPW A;  1JF2 A;  3PM8 A;  1OQP A;  2JTZ A;  2NLN A;  3IQQ A;  5AEQ A;  1AJ5 A;  3O2P A;  2OPO A;  4BY4 A;  2LUC A;  1UHI A;  3TZ1 A;  1JF0 A;  3VRR A;  1FI6 A;  3VRP A;  2FCE A;  1RRO A;  2TN4 A;  1A2X A;  3CTN A;  2DOQ A;  3BQ3 A;  2LC5 A;  4E68 A;  1NSH A;  1DJZ A;  1NCY A;  4CFR A;  1MUX A;  1S6I A;  1PRW A;  2KI4 C;  1YRT B;  2KI4 B;  2KFH A;  5PAL A;  1L7Z A;  1SW8 A;  3I5F C;  1AUI B;  1S26 D;  1H4B A;  1YUT A;  1PAL A;  3PAT A;  4ZCV A;  1DJI A;  5DKN A;  1QXP A;  2MRD A;  5K89 A;  3PN7 B;  4ZCU A;  2KI6 C;  1CTR A;  3TS5 C;  1LA0 A;  3CGA A;  3TS5 B;  2BKI B;  2L0P A;  3LCP C;  1CDN A;  1J7R A;  1SL9 A;  1IKU A;  4YGD B;  1SYM A;  1QVI Z;  1JWD A;  1ZUZ A;  1BJF A;  4WQ2 A;  3O4Y A;  4DRW A;  4ICB A;  1Q80 A;  5HYD A;  2L4I A;  1IQ3 A;  4AQI A;  2LLS A;  1YR5 A;  2KBI A;  5HLV A;  4C0K A;  5DKR A;  1CFF A;  5CSN A;  3BYA A;  1SRA A;  2Q4U A;  3FWB A;  1CLM A;  1SKT A;  4OV2 A;  2F3Y A;  1TTX A;  4CPV A;  2JWW A;  2M0R A;  3OP0 A;  4MN0 A;  5BPJ A;  5D69 A;  2MLF C;  3BUM B;  1F71 A;  2JZI A;  3AAK A;  4MLW A;  1C7V A;  3GOF A;  1PUL A;  1UHJ A;  1XK4 C;  1TNX A;  2ZRS A;  2M97 A;  4AQJ A;  1QS7 A;  1YUU A;  1B8R A;  1B8C A;  1XFZ O;  1OZS A;  4TNC A;  2MAZ A;  5AFP A;  1H8B A;  4D1E A;  3C1V A;  5KSZ A;  2M3W A;  2JOJ A;  1J7O A;  1D1O A;  1KQM C;  2BL0 B;  2ZKM X;  3WNX B;  3IQO A;  1TOP A;  4ORA B;  1A29 A;  3NSI A;  2GGM A;  3MSE B;  1ZFS A;  1QTX A;  1EG3 A;  2JPT A;  2SAS A;  1AK8 A;  5B8I B;  1LVC D;  1NUB A;  1B47 A;  2KOT A;  1NX2 A;  1NCZ A;  2LAN A;  4YI8 A;  4WRI A;  3NXA A;  1RTP 1;  1NPQ A;  1QX5 B;  3VRO A;  5J3X A;  2F2O A;  2SCP A;  5HKZ A;  1GGZ A;  1ALV A;  1WRZ A;  3EKJ A;  3KPX A;  2K2A A;  2L4H A;  3DD4 A;  2R2I A;  1NX1 A;  2KGB C;  1SPY A;  5ER4 X;  5FYX A;  3GK1 A;  1N0Y A;  1J1E A;  4IL1 A;  2P6B B;  1V1F A;  2LLU A;  3EK8 A;  4P5O E;  1VRK A;  1OOJ A;  2JNF A;  2KI6 D;  1TNQ A;  1NX0 A;  2F33 A;  3D0Y A;  4PHN A;  1MWN A;  2O5G A;  3HX4 A;  4OCI A;  4CFQ A;  1NIW A;  3CZT X;  1AHR A;  3NSL A;  2BEC A;  2HQ8 A;  2LHL A;  3CR2 A;  2K61 A;  3JTD C;  2LLT A;  3JTD B;  1SL7 A;  3I5H B;  1YVH A;  4AOM A;  4N1F A;  5KTY A;  3I5G C;  1K8U A;  2WOR A;  1S36 A;  1KFU L;  1CFP A;  1PVB A;  3D0Y B;  1YTZ C;  1B7T Z;  2KGR A;  4HRH A;  1KSM A;  2LVV A;  1BG1 A;  1CMG A;  1IJ6 A;  2HET A;  4M2P A;  5ER5 A;  3PFV A;  5JJG A;  2AAO A;  2LVI A; 
#chains in the Genus database with same CATH topology
 1NWD A;  1QIV A;  3NSO A;  3S0D A;  3PSR A;  3L4A A;  2JU0 A;  1QV0 A;  2F2P A;  2KPH A;  3A4U B;  4GAO A;  4WQ3 A;  3SIB A;  1IJ5 A;  4INX A;  1UHN A;  1WY9 A;  2KQ6 A;  3EG5 B;  1K2H A;  4XYN A;  1KK8 C;  1KSO A;  3O6B A;  1KK8 B;  4FTG A;  1QJT A;  4OVN F;  4F0Z B;  2WCB A;  1B1G A;  1ZOT B;  3EKH A;  1JSA A;  1SNL A;  2ZNE A;  2K7C A;  2KFG A;  1CKK A;  2WCM A;  1LIN A;  2ISD A;  3R1P A;  3EK4 A;  2EC6 C;  2QEO A;  3PM2 A;  1WLZ A;  2EC6 B;  1KFX S;  2Y5I A;  3VB1 A;  4PE4 A;  1QLK A;  3B86 A;  3UNW A;  3I5I B;  2CTN A;  2O60 A;  1DMO A;  5F6T A;  3RLZ A;  4PHM A;  2LM5 A;  3PN7 C;  2K7O A;  4GNK B;  1S6J A;  2QEV A;  2KAX A;  1GGW A;  2HQW A;  3OX6 A;  1AJ4 A;  1CDL A;  1Y0V H;  5HKY A;  1A75 A;  2KLE A;  2M1K B;  1DF0 B;  1TIZ A;  3TUY B;  2BBN A;  1YUS A;  2L51 A;  4HSZ A;  2AMI A;  4MVF A;  2NCP A;  3BFB A;  4CLN A;  1F55 A;  2LP3 A;  4JPZ B;  3B87 A;  4UPG A;  1MXL C;  3D73 A;  2OTG B;  4QJ4 B;  1C07 A;  3CAB A;  1B4C A;  1FBV A;  1KK7 Y;  1A75 B;  2GTE A;  5CSF A;  1J7P A;  2K8M B;  1LKJ A;  3R1O A;  1HT9 A;  2EGD A;  1ORG A;  4DIR A;  1NX3 A;  1RWY A;  3CLN A;  1SY9 A;  2CNP A;  1B7T Y;  2L5Y A;  2LUX A;  2MA2 A;  1OE9 B;  2QDI A;  4QJ3 B;  2WND A;  1GM0 A;  3BJH A;  1SMG A;  3BUN B;  2M7L A;  2CCM A;  4GBA A;  2KQY A;  4GUK A;  3LLE A;  1ZMZ A;  1T14 A;  1JUO A;  1DGU A;  1IGV A;  1WDC B;  1REC A;  2FJY A;  3E3R A;  2KYF A;  4JD9 A;  1K95 A;  2BE6 A;  4JKT A;  1DVI A;  1ZAC A;  1OW4 A;  1IWQ A;  1OOI X;  2WCF A;  3FIA A;  2LMU A;  5I2L A;  3KO0 A;  1EG4 A;  3FE8 A;  2F8P A;  3R1V A;  1QX2 A;  2PMY A;  2PSR A;  1K9U A;  2LMV A;  1XFW O;  1OOH A;  1GQM A;  1SCM B;  2IS9 A;  3SS4 A;  3BFA A;  4FQO A;  2H2K A;  2WCH A;  1UP5 A;  2BNX A;  2JPO A;  4R1E A;  2JTT A;  3VRQ A;  3S0A A;  5DIC A;  4GGF A;  1U5I B;  1SR6 B;  2BL0 C;  1DJX A;  2RGI A;  2I7A A;  1J7Q A;  1MQ1 A;  1MR8 A;  2E30 A;  2COL B;  5HKW A;  2PAL A;  5EL2 A;  1KFX L;  2QPT A;  3BUX B;  1N2D A;  2WOS A;  3BUO B;  4MEW A;  1M31 A;  4YI9 A;  4DUQ A;  3PAL A;  1G8I A;  1HQV A;  4PE7 A;  4A4C A;  4DCK A;  4GPL B;  1X02 A;  3CZ1 A;  4GGF C;  1A03 A;  2YGU A;  2JC2 A;  1YUR A;  1OZO A;  1CFD A;  4YGA A;  2K0J A;  1UUS A;  3K21 A;  1YX8 A;  1N65 A;  4U8D A;  1Y6W A;  3SG4 A;  2Q91 A;  2L5X B;  1A4P A;  1J1D A;  2MJW B;  1QVI Y;  2WCE A;  3UO9 A;  3BUW B;  4I5K A;  1XFV O;  2K2F A;  1Z2C B;  5AER A;  1RJV A;  3GK2 A;  2JT0 A;  3D76 A;  2L50 A;  1S3P A;  2WC6 A;  3IF7 A;  1OOG A;  3DVE A;  2M9G A;  5IBW A;  3OBV A;  2B1U A;  4BY5 A;  4MBE A;  4OKH A;  1Y1U A;  1F4O A;  2KHN A;  1K9K A;  2KYC A;  3I5H C;  1BMO A;  2LCP A;  1LS8 A;  2CBL A;  3DVJ A;  4M2Q A;  1BR4 B;  1K9P A;  1Y1X A;  2JXL A;  4FQT A;  2ZN8 A;  4IJ7 A;  2M29 A;  3SG3 A;  1K94 A;  1MHO A;  4MZK A;  2M1U A;  3M0W A;  2WCJ A;  2M49 B;  3EVR A;  1NYA A;  3B7A A;  1CLB A;  3AAJ A;  1MF8 B;  1W9Z A;  4A4B A;  4YGB B;  3KEV A;  1DJW A;  1AP4 A;  2I2R E;  1BLQ A;  1M39 A;  2HF5 A;  2OS8 B;  3SS3 A;  1ODB A;  2BE4 A;  4YRU A;  3SG7 A;  1CFC A;  4NDD A;  1JFK A;  3JVT B;  2JUL A;  4MRX A;  1FW4 A;  2ZND A;  1Y1A A;  4N5X A;  1F4Q A;  4GGN A;  4PAL A;  2LVJ A;  4C0J A;  2LAP A;  1TN4 A;  1W7J B;  1DGV A;  1JC2 A;  1PK0 D;  2M8U A;  2FCD A;  2PRU A;  3TDI A;  2Y1M A;  1IQ5 A;  1S6C A;  1SL8 A;  1WRL A;  1TNW A;  3DF0 B;  2JNX A;  2LHI A;  3DYE A;  4PE1 A;  2I94 A;  4Q04 A;  2BAP A;  1W7I B;  2Y1N A;  2CXJ A;  4CID A;  3D77 A;  1G4Y R;  2ZN9 A;  3EK7 A;  1J55 A;  1QIW A;  1CNP A;  1IH0 A;  3AKA A;  2BCB A;  3BOW A;  1DF0 A;  5CPV A;  3DVM A;  4MRY A;  2KAY A;  2VRG A;  3R72 A;  3O78 A;  1CM4 A;  3I5I C;  2ZRT A;  3EVU A;  1QAS A;  3H4S E;  3CR4 X;  1UUR A;  3D10 A;  1XA5 A;  3S0E A;  5CSJ A;  3FWC A;  2D8N A;  1QLS A;  2L2E A;  3A8R A;  3DXL A;  1DTL A;  1XVJ A;  3BOW B;  3CS1 A;  3VGO A;  2P71 A;  4PHJ A;  3TUY C;  4PCW A;  1S5G Z;  1TCF A;  1RFJ A;  1CDM A;  2KSP A;  4JWQ A;  3O4X A;  3SIA A;  3VRN A;  1C7W A;  4INW A;  1ALW A;  2LE9 B;  1BOD A;  2AUC A;  1K93 D;  2GV5 A;  2LNK A;  2OTG C;  5I2O A;  2H8V A;  3L4L A;  1V1G A;  4PT1 A;  3I5F B;  2WCL A;  1IIO A;  2JQ6 A;  5AAN A;  2V53 A;  1WRK A;  3OX5 A;  1CDP A;  3NSK A;  3ZWH A;  1M46 A;  3QRX A;  1TNP A;  3F45 A;  3OB2 B;  1NP8 A;  4ORB B;  2WC8 A;  4M2O A;  1SBJ A;  2FOT A;  3LK0 A;  1LXF C;  2JT8 A;  1WDC C;  1IRJ A;  2FJU B;  5G08 A;  1UWO A;  1PSR A;  1BR1 B;  4USL A;  4C0L A;  1U5I A;  2PAS A;  3D74 A;  2G9B A;  3SG5 A;  1XYD A;  4NDB A;  2ERB A;  3OGN A;  4XJK A;  1QX7 A;  4QJ5 B;  1PVA A;  1SCM C;  2KNE A;  4I5L B;  3ZNI A;  4MSP A;  3S0G A;  1OMD A;  1PSB A;  1R2U A;  1NCX A;  4N1G A;  4P2Y B;  3OB1 B;  5HLO A;  1SK6 D;  2G2B A;  1KCY A;  2K7D A;  2PQL A;  1SR6 C;  2K60 A;  3WHT B;  5I2Q A;  3BXK A;  1XK4 A;  1CLL A;  3PLF B;  3BFH A;  1KFU S;  1BOC A;  3HCM A;  4GFT A;  1F8H A;  1BF5 A;  3FE9 A;  4PHK A;  4OR9 B;  1XO5 A;  4XJK B;  1FI5 A;  1F70 A;  5FI2 A;  1M45 A;  1TRF A;  3DVK A;  3B88 A;  4HRG A;  2GGZ A;  3S0B A;  3TDZ A;  2JXC A;  2LV7 A;  2K7B A;  4I5N B;  5TNC A;  3CWG A;  2NXQ A;  1DJY A;  4YBH B;  3FS7 A;  4NDC A;  3CDN A;  1KQV A;  3V2L A;  1OMR A;  2LMT A;  2F3Z A;  4YGC B;  2LVK A;  2KAV A;  2KBM A;  1EXR A;  4PDZ A;  1S5G Y;  5I8N A;  1S1E A;  1XFR A;  1YX7 A;  2BBM A;  2M7N A;  1K96 A;  2Y4Q A;  1EL4 A;  4DS7 A;  1SCV A;  1KQM B;  2E6W A;  3KHE A;  2KDH A;  3NGV A;  1TCO B;  3SJS A;  1UHH A;  3RM1 A;  3AKB A;  1CM1 A;  2BKH B;  1BT6 A;  5AXI A;  1XFY O;  4JQ0 D;  1QAT A;  3KF9 A;  1DJH A;  2A4J A;  1SSE B;  2JRF A;  1XFX O;  3EVV A;  3WHU B;  1F54 A;  1DJG A;  1R6P A;  1JFJ A;  2QAC A;  4I5J A;  3NHT A;  3CZ0 A;  3WXA A;  4MZL A;  2JT3 A;  5FI6 A;  2L2C A;  5GQQ C;  3S0F A;  1CMF A;  3CR5 X;  1OMV A;  3SG6 A;  1MXE A;  1KWO C;  2H61 A;  2L98 A;  2KLD A;  1KWO B;  1GJY A;  3QME A;  4YGE B;  5DKQ A;  2MHH A;  2HPS A;  1DC1 A;  1AVS A;  1G33 A;  1LA3 A;  5KU1 A;  4ORC B;  1YRU B;  3TDU A;  2ZFD A;  2P70 A;  4HRE E;  2KFF A;  1UHK A;  2OS8 C;  2NCO A;  2I18 A;  3DF0 A;  1M63 B;  1B9A A;  1B8L A;  1OSA A;  3JVT C;  3LL8 B;  1JBA A;  4ETO A;  2LP2 A;  2H61 C;  1IG5 A;  2CT9 A;  3LK1 A;  1KK7 Z;  1L2O C;  2EHB A;  1YVL A;  3DY9 A;  5D7F A;  1L2O B;  3GK4 X;  1QV1 A;  3SS5 A;  1DT7 B;  3I5G B;  5D3O A;  4NQG A;  1BU3 A;  5JOL A;  3ICB A;  2BCX A;  3OHM B;  5CSI A;  2MBX A;  2MLE C;  1FF1 A;  5FI7 A;  3N7H A;  4L9M A;  2NZ0 A;  1WLM A;  1EH2 A;  3SG2 A;  1E8A A;  1CB1 A;  1XFU O;  2PVB A;  2BCA A;  1EJ3 A;  4PE0 A;  4MZJ A;  1RK9 A;  1K90 D;  1FPW A;  1JF2 A;  3PM8 A;  1OQP A;  1DQE A;  2JTZ A;  2NLN A;  3IQQ A;  5AEQ A;  2PYQ A;  1AJ5 A;  3O2P A;  2OPO A;  4KYN A;  4BY4 A;  2LUC A;  1UHI A;  3TZ1 A;  3D78 A;  1JF0 A;  3VRR A;  1FI6 A;  3VRP A;  2FCE A;  1RRO A;  2TN4 A;  1C3Z A;  1A2X A;  1TUZ A;  3CTN A;  1P28 A;  2DOQ A;  3B6X A;  3BQ3 A;  2LC5 A;  4E68 A;  1NSH A;  1DJZ A;  1NCY A;  4CFR A;  1MUX A;  1S6I A;  1PRW A;  2KI4 C;  1YRT B;  2KI4 B;  2KFH A;  5PAL A;  3RZS A;  1L7Z A;  1SW8 A;  3I5F C;  1AUI B;  1S26 D;  1H4B A;  1YUT A;  1PAL A;  3PAT A;  4ZCV A;  1DJI A;  5DKN A;  1QXP A;  2MRD A;  5K89 A;  3PN7 B;  4ZCU A;  2KI6 C;  1CTR A;  3TS5 C;  1LA0 A;  3CGA A;  1DEL A;  2BKI B;  3TS5 B;  2L0P A;  3LCP C;  1CDN A;  3D75 A;  1J7R A;  1SL9 A;  1IKU A;  4YGD B;  1OOF A;  1QVI Z;  1SYM A;  1JWD A;  1ZUZ A;  1BJF A;  4WQ2 A;  3O4Y A;  2QEH A;  4DRW A;  4ICB A;  1Q80 A;  5HYD A;  2L4I A;  1IQ3 A;  4AQI A;  2LLS A;  1YR5 A;  2KBI A;  1QWV A;  5HLV A;  4C0K A;  3CZ2 A;  5DKR A;  1CFF A;  5CSN A;  3BYA A;  1SRA A;  2Q4U A;  3FWB A;  1CLM A;  1SKT A;  1Z4H A;  4OV2 A;  2F3Y A;  1TTX A;  4CPV A;  2JWW A;  2M0R A;  3OP0 A;  4MN0 A;  3PJI A;  5D69 A;  2MLF C;  5BPJ A;  3BUM B;  1F71 A;  2JZI A;  3AAK A;  4MLW A;  1C7V A;  3GOF A;  1PUL A;  4OZD A;  1UHJ A;  1XK4 C;  1TNX A;  2ZRS A;  2M97 A;  4AQJ A;  1QS7 A;  1YUU A;  1B8R A;  1B8C A;  1XFZ O;  2WC5 A;  1OZS A;  4TNC A;  2MAZ A;  5AFP A;  1H8B A;  4D1E A;  3C1V A;  5KSZ A;  2M3W A;  2JOJ A;  1J7O A;  2QEB A;  1D1O A;  1KQM C;  2BL0 B;  2ZKM X;  3WNX B;  3IQO A;  1TOP A;  4ORA B;  1A29 A;  3NSI A;  2GGM A;  3MSE B;  1ZFS A;  1QTX A;  1EG3 A;  2JPT A;  2SAS A;  1AK8 A;  5B8I B;  1LVC D;  1NUB A;  1B47 A;  2KOT A;  1NX2 A;  1NCZ A;  2LAN A;  3NHI A;  3DZT A;  4WRI A;  4YI8 A;  3NXA A;  1RTP 1;  1NPQ A;  1QX5 B;  3VRO A;  5J3X A;  3FE6 A;  2F2O A;  2SCP A;  5HKZ A;  3CYZ A;  1GGZ A;  1ALV A;  1WRZ A;  3EKJ A;  3IVT A;  3KPX A;  1TWO A;  3L47 A;  2K2A A;  2L4H A;  3DD4 A;  2R2I A;  1NX1 A;  2KGB C;  1SPY A;  5ER4 X;  5FYX A;  3GK1 A;  1N0Y A;  1J1E A;  4IL1 A;  2P6B B;  1V1F A;  2LLU A;  3Q8I A;  3EK8 A;  4P5O E;  1VRK A;  1OOJ A;  2JNF A;  2KI6 D;  1TNQ A;  1NX0 A;  2F33 A;  3D0Y A;  4PHN A;  1MWN A;  2O5G A;  3HX4 A;  4OCI A;  4CFQ A;  1NIW A;  3CZT X;  1AHR A;  3K1E A;  3NSL A;  5I94 A;  2WCK A;  1C3Y A;  2BEC A;  2HQ8 A;  2LHL A;  3CR2 A;  2K61 A;  3JTD C;  2LLT A;  3JTD B;  1SL7 A;  3I5H B;  1YVH A;  1DEK A;  4N1F A;  4AOM A;  5KTY A;  3I5G C;  1K8U A;  1TUJ A;  2WOR A;  1S36 A;  1KFU L;  5HL1 A;  1CFP A;  1PVB A;  3D0Y B;  1YTZ C;  1B7T Z;  2KGR A;  4HRH A;  1KSM A;  2LVV A;  1BG1 A;  1CMG A;  1IJ6 A;  2HET A;  4M2P A;  5ER5 A;  3PFV A;  5JJG A;  4F7F A;  2AAO A;  2LVI A; 
#chains in the Genus database with same CATH homology
 1NWD A;  1QIV A;  3NSO A;  3PSR A;  2JU0 A;  1QV0 A;  2F2P A;  3A4U B;  4GAO A;  4WQ3 A;  3SIB A;  1IJ5 A;  1UHN A;  1WY9 A;  2KQ6 A;  1K2H A;  4XYN A;  1KK8 C;  1KSO A;  3O6B A;  1KK8 B;  4FTG A;  1QJT A;  4OVN F;  4F0Z B;  2WCB A;  1B1G A;  1ZOT B;  3EKH A;  1JSA A;  1SNL A;  2ZNE A;  2K7C A;  2KFG A;  1CKK A;  1LIN A;  2ISD A;  3EK4 A;  2EC6 C;  1WLZ A;  2EC6 B;  1KFX S;  2Y5I A;  4PE4 A;  1QLK A;  3I5I B;  2CTN A;  2O60 A;  1DMO A;  5F6T A;  3RLZ A;  4PHM A;  2LM5 A;  3PN7 C;  2K7O A;  4GNK B;  1S6J A;  2KAX A;  1GGW A;  2HQW A;  3OX6 A;  1AJ4 A;  1CDL A;  1Y0V H;  5HKY A;  1A75 A;  2M1K B;  1DF0 B;  1TIZ A;  3TUY B;  2BBN A;  1YUS A;  2L51 A;  4HSZ A;  2AMI A;  4MVF A;  2NCP A;  1F55 A;  4CLN A;  2LP3 A;  4JPZ B;  4UPG A;  1MXL C;  2OTG B;  4QJ4 B;  1C07 A;  1B4C A;  1FBV A;  1KK7 Y;  1A75 B;  5CSF A;  1J7P A;  2K8M B;  1LKJ A;  1HT9 A;  2EGD A;  4DIR A;  1NX3 A;  1RWY A;  3CLN A;  1SY9 A;  2CNP A;  1B7T Y;  2LUX A;  2MA2 A;  4QJ3 B;  1OE9 B;  2WND A;  1SMG A;  3BUN B;  2M7L A;  2CCM A;  4GBA A;  2KQY A;  4GUK A;  3LLE A;  1ZMZ A;  1JUO A;  1DGU A;  1IGV A;  1WDC B;  1REC A;  3E3R A;  2KYF A;  1K95 A;  2BE6 A;  1DVI A;  1ZAC A;  1IWQ A;  2WCF A;  3FIA A;  2LMU A;  5I2L A;  3KO0 A;  1EG4 A;  2F8P A;  1QX2 A;  2PMY A;  2PSR A;  1K9U A;  2LMV A;  1XFW O;  1GQM A;  1SCM B;  2IS9 A;  4FQO A;  2H2K A;  1UP5 A;  4R1E A;  2JTT A;  3VRQ A;  4GGF A;  1U5I B;  1SR6 B;  2BL0 C;  1DJX A;  2RGI A;  2I7A A;  1J7Q A;  1MQ1 A;  1MR8 A;  2E30 A;  2COL B;  5HKW A;  2PAL A;  1KFX L;  2QPT A;  3BUX B;  1N2D A;  2WOS A;  3BUO B;  4MEW A;  1M31 A;  4YI9 A;  4DUQ A;  3PAL A;  1G8I A;  1HQV A;  4PE7 A;  4A4C A;  4DCK A;  4GPL B;  1X02 A;  4GGF C;  1A03 A;  2JC2 A;  1OZO A;  1YUR A;  1CFD A;  4YGA A;  2K0J A;  1UUS A;  3K21 A;  1YX8 A;  1N65 A;  4U8D A;  1Y6W A;  3SG4 A;  2Q91 A;  2L5X B;  1A4P A;  1J1D A;  2MJW B;  1QVI Y;  2WCE A;  3BUW B;  4I5K A;  1XFV O;  2K2F A;  5AER A;  1RJV A;  3GK2 A;  2JT0 A;  2L50 A;  1S3P A;  3IF7 A;  3DVE A;  2M9G A;  5IBW A;  2B1U A;  4BY5 A;  4MBE A;  4OKH A;  1Y1U A;  1F4O A;  2KHN A;  1K9K A;  2KYC A;  3I5H C;  1BMO A;  2LCP A;  2CBL A;  3DVJ A;  4M2Q A;  1BR4 B;  1K9P A;  1Y1X A;  2JXL A;  2ZN8 A;  2M29 A;  3SG3 A;  1K94 A;  1MHO A;  4MZK A;  2M1U A;  3M0W A;  2M49 B;  3EVR A;  1NYA A;  1CLB A;  3AAJ A;  1MF8 B;  4A4B A;  4YGB B;  3KEV A;  1DJW A;  1AP4 A;  2I2R E;  1BLQ A;  1M39 A;  2HF5 A;  2OS8 B;  1ODB A;  2BE4 A;  4YRU A;  3SG7 A;  1CFC A;  4NDD A;  1JFK A;  3JVT B;  2JUL A;  4MRX A;  1FW4 A;  2ZND A;  1Y1A A;  4N5X A;  1F4Q A;  4GGN A;  4PAL A;  2LVJ A;  4C0J A;  2LAP A;  1TN4 A;  1W7J B;  1DGV A;  1JC2 A;  1PK0 D;  2M8U A;  2FCD A;  2PRU A;  3TDI A;  2Y1M A;  1IQ5 A;  1S6C A;  1SL8 A;  1WRL A;  1TNW A;  3DF0 B;  2JNX A;  2LHI A;  4PE1 A;  2I94 A;  4Q04 A;  1W7I B;  2Y1N A;  2CXJ A;  4CID A;  1IH0 A;  1G4Y R;  2ZN9 A;  3EK7 A;  1J55 A;  1QIW A;  1CNP A;  3AKA A;  2BCB A;  3BOW A;  1DF0 A;  5CPV A;  3DVM A;  4MRY A;  2KAY A;  2VRG A;  3O78 A;  1CM4 A;  3I5I C;  2ZRT A;  3EVU A;  1QAS A;  3H4S E;  3CR4 X;  1UUR A;  3D10 A;  1XA5 A;  5CSJ A;  3FWC A;  2D8N A;  1QLS A;  2L2E A;  3A8R A;  1DTL A;  1XVJ A;  3BOW B;  3CS1 A;  3VGO A;  3TUY C;  4PHJ A;  4PCW A;  1S5G Z;  1TCF A;  1RFJ A;  1CDM A;  2KSP A;  4JWQ A;  3VRN A;  3SIA A;  1C7W A;  1ALW A;  2LE9 B;  1BOD A;  2AUC A;  1K93 D;  2GV5 A;  2LNK A;  2OTG C;  5I2O A;  1V1G A;  3I5F B;  2JQ6 A;  5AAN A;  2V53 A;  1WRK A;  3OX5 A;  1CDP A;  3NSK A;  3ZWH A;  1M46 A;  3QRX A;  1TNP A;  3F45 A;  3OB2 B;  1NP8 A;  4ORB B;  2WC8 A;  4M2O A;  1SBJ A;  2FOT A;  3LK0 A;  1LXF C;  2JT8 A;  1WDC C;  1IRJ A;  2FJU B;  5G08 A;  1UWO A;  1PSR A;  1BR1 B;  4USL A;  4C0L A;  1U5I A;  2PAS A;  2G9B A;  3SG5 A;  1XYD A;  4NDB A;  4XJK A;  1QX7 A;  4QJ5 B;  1PVA A;  1SCM C;  2KNE A;  4I5L B;  3ZNI A;  4MSP A;  1OMD A;  1PSB A;  1R2U A;  1NCX A;  4N1G A;  4P2Y B;  3OB1 B;  5HLO A;  1SK6 D;  2G2B A;  1KCY A;  2K7D A;  1SR6 C;  3WHT B;  5I2Q A;  3BXK A;  1XK4 A;  1CLL A;  3PLF B;  1KFU S;  1BOC A;  3HCM A;  4GFT A;  1F8H A;  1BF5 A;  4XJK B;  4PHK A;  4OR9 B;  1XO5 A;  1FI5 A;  1F70 A;  1M45 A;  1TRF A;  3DVK A;  4HRG A;  2GGZ A;  3TDZ A;  2JXC A;  2LV7 A;  2K7B A;  4I5N B;  5TNC A;  3CWG A;  2NXQ A;  1DJY A;  4YBH B;  3FS7 A;  4NDC A;  1KQV A;  1OMR A;  2LMT A;  2F3Z A;  4YGC B;  2LVK A;  2KAV A;  2KBM A;  1EXR A;  4PDZ A;  1S5G Y;  5I8N A;  1S1E A;  1YX7 A;  2BBM A;  2M7N A;  1K96 A;  2Y4Q A;  1EL4 A;  4DS7 A;  1SCV A;  1KQM B;  2E6W A;  3KHE A;  2KDH A;  1TCO B;  3SJS A;  1UHH A;  3RM1 A;  3AKB A;  1CM1 A;  2BKH B;  1BT6 A;  5AXI A;  1XFY O;  4JQ0 D;  1QAT A;  3KF9 A;  1DJH A;  2A4J A;  3WHU B;  2JRF A;  1XFX O;  3EVV A;  1F54 A;  1DJG A;  1R6P A;  1JFJ A;  2QAC A;  4I5J A;  3WXA A;  4MZL A;  2JT3 A;  5GQQ C;  1CMF A;  3CR5 X;  1OMV A;  3SG6 A;  1MXE A;  1KWO C;  2H61 A;  2L98 A;  1KWO B;  1GJY A;  4YGE B;  5DKQ A;  2MHH A;  2HPS A;  1AVS A;  1G33 A;  1LA3 A;  5KU1 A;  4ORC B;  1YRU B;  3TDU A;  2ZFD A;  4HRE E;  2KFF A;  1UHK A;  2OS8 C;  2NCO A;  2I18 A;  3DF0 A;  1M63 B;  1B9A A;  1B8L A;  1OSA A;  3JVT C;  3LL8 B;  1JBA A;  4ETO A;  2LP2 A;  2H61 C;  1IG5 A;  2CT9 A;  3LK1 A;  1KK7 Z;  1L2O C;  2EHB A;  1YVL A;  5D7F A;  1L2O B;  3GK4 X;  1QV1 A;  1DT7 B;  3I5G B;  4NQG A;  1BU3 A;  5JOL A;  3ICB A;  2BCX A;  3OHM B;  5CSI A;  2MBX A;  2MLE C;  1FF1 A;  4L9M A;  2NZ0 A;  1WLM A;  1EH2 A;  3SG2 A;  1E8A A;  1CB1 A;  1XFU O;  2PVB A;  2BCA A;  1EJ3 A;  4PE0 A;  4MZJ A;  1RK9 A;  1K90 D;  1FPW A;  1JF2 A;  3PM8 A;  1OQP A;  2JTZ A;  2NLN A;  3IQQ A;  5AEQ A;  1AJ5 A;  3O2P A;  2OPO A;  4BY4 A;  2LUC A;  1UHI A;  3TZ1 A;  1JF0 A;  3VRR A;  1FI6 A;  3VRP A;  2FCE A;  1RRO A;  2TN4 A;  1A2X A;  3CTN A;  2DOQ A;  3BQ3 A;  2LC5 A;  4E68 A;  1NSH A;  1DJZ A;  1NCY A;  4CFR A;  1MUX A;  1S6I A;  1PRW A;  2KI4 C;  1YRT B;  2KI4 B;  2KFH A;  5PAL A;  1L7Z A;  1SW8 A;  3I5F C;  1AUI B;  1S26 D;  1H4B A;  1YUT A;  1PAL A;  3PAT A;  4ZCV A;  1DJI A;  5DKN A;  1QXP A;  2MRD A;  5K89 A;  3PN7 B;  4ZCU A;  2KI6 C;  1CTR A;  3TS5 C;  1LA0 A;  3CGA A;  3TS5 B;  2BKI B;  2L0P A;  3LCP C;  1CDN A;  1J7R A;  1SL9 A;  1IKU A;  4YGD B;  1SYM A;  1QVI Z;  1JWD A;  1ZUZ A;  1BJF A;  4WQ2 A;  3O4Y A;  4DRW A;  4ICB A;  1Q80 A;  5HYD A;  2L4I A;  1IQ3 A;  4AQI A;  2LLS A;  1YR5 A;  2KBI A;  5HLV A;  4C0K A;  5DKR A;  1CFF A;  5CSN A;  3BYA A;  1SRA A;  2Q4U A;  3FWB A;  1CLM A;  1SKT A;  4OV2 A;  2F3Y A;  1TTX A;  4CPV A;  2JWW A;  2M0R A;  3OP0 A;  4MN0 A;  5BPJ A;  5D69 A;  2MLF C;  3BUM B;  1F71 A;  2JZI A;  3AAK A;  4MLW A;  1C7V A;  3GOF A;  1PUL A;  1UHJ A;  1XK4 C;  1TNX A;  2ZRS A;  2M97 A;  4AQJ A;  1QS7 A;  1YUU A;  1B8R A;  1B8C A;  1XFZ O;  1OZS A;  4TNC A;  2MAZ A;  5AFP A;  1H8B A;  4D1E A;  3C1V A;  5KSZ A;  2M3W A;  2JOJ A;  1J7O A;  1D1O A;  1KQM C;  2BL0 B;  2ZKM X;  3WNX B;  3IQO A;  1TOP A;  4ORA B;  1A29 A;  3NSI A;  2GGM A;  3MSE B;  1ZFS A;  1QTX A;  1EG3 A;  2JPT A;  2SAS A;  1AK8 A;  5B8I B;  1LVC D;  1NUB A;  1B47 A;  2KOT A;  1NX2 A;  1NCZ A;  2LAN A;  4YI8 A;  4WRI A;  3NXA A;  1RTP 1;  1NPQ A;  1QX5 B;  3VRO A;  5J3X A;  2F2O A;  2SCP A;  5HKZ A;  1GGZ A;  1ALV A;  1WRZ A;  3EKJ A;  3KPX A;  2K2A A;  2L4H A;  3DD4 A;  2R2I A;  1NX1 A;  2KGB C;  1SPY A;  5ER4 X;  5FYX A;  3GK1 A;  1N0Y A;  1J1E A;  4IL1 A;  2P6B B;  1V1F A;  2LLU A;  3EK8 A;  4P5O E;  1VRK A;  1OOJ A;  2JNF A;  2KI6 D;  1TNQ A;  1NX0 A;  2F33 A;  3D0Y A;  4PHN A;  1MWN A;  2O5G A;  3HX4 A;  4OCI A;  4CFQ A;  1NIW A;  3CZT X;  1AHR A;  3NSL A;  2BEC A;  2HQ8 A;  2LHL A;  3CR2 A;  2K61 A;  3JTD C;  2LLT A;  3JTD B;  1SL7 A;  3I5H B;  1YVH A;  4AOM A;  4N1F A;  5KTY A;  3I5G C;  1K8U A;  2WOR A;  1S36 A;  1KFU L;  1CFP A;  1PVB A;  3D0Y B;  1YTZ C;  1B7T Z;  2KGR A;  4HRH A;  1KSM A;  2LVV A;  1BG1 A;  1CMG A;  1IJ6 A;  2HET A;  4M2P A;  5ER5 A;  3PFV A;  5JJG A;  2AAO A;  2LVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...