4HRHA

Crystal structure of p11-annexin a2(n-terminal) fusion protein in complex with smarca3 peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
107
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQGDSTVHEILSKLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A10, Annexin A2
publication title SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 33
structure length 107
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4hrhA00
1QIWA 1V1FA 1R2UA 3TS5C 1JUOA 1XFWO 2SASA 1FBVA 2NCOA 3KF9A 1JFKA 1S6JA 1WDCB 2K0JA 1QATA 3TDUA 1D1OA 1WDCC 3NXAA 3ZWHA 4OCIA 1AJ5A 2LUCA 5HYDA 1TCOB 2ISDA 2MRDA 3TS5B 3SIBA 1GGZA 1TOPA 1KK7Z 1K2HA 1BR4B 1J7OA 3D0YA 4DRWA 2WNDA 2BCAA 3AKAA 1ZUZA 3C1VA 3SG6A 1FF1A 1B1GA 1SRAA 3DF0B 1YURA 1DJGA 4MSPA 1M45A 1NCYA 1UHKA 3EVRA 4I5NB 1SL7A 4YGAA 3PALA 2H2KA 4MN0A 1QJTA 3AAJA 3BUWB 1K8UA 1M31A 3EKJA 5I2OA 4E68A 2F8PA 1SW8A 4CLNA 1MF8B 2KAYA 2M7LA 4D1EA 2BBMA 1CM4A 1OE9B 1SCVA 1LA3A 1TNWA 2MJWB 4P5OE 4GBAA 2TN4A 3JTDB 1WRZA 1B8RA 1L2OC 1CFDA 1TNXA 1YTZC 3EK7A 3JTDC 1N0YA 5BPJA 1F71A 1CTRA 1CNPA 1B4CA 2MHHA 4A4BA 1YVHA 1SCMB 3QRXA 4L9MA 1UHNA 1J7RA 1DMOA 1EJ3A 3VRNA 1NIWA 2PALA 1AVSA 2WCEA 1CM1A 1NYAA 1UURA 3GK1A 1XA5A 2LM5A 1CDPA 1J1DA 1MQ1A 3KO0A 1MHOA 4HREE 2L0PA 1DJWA 1YUUA 1NPQA 1KFXL 2QPTA 1UHHA 5AEQA 2QACA 2PMYA 1M63B 1PULA 2E30A 2MBXA 2ZNDA 4ICBA 1NWDA 4F0ZB 3CLNA 2JWWA 2KI6D 3A8RA 2M0RA 3O4YA 4AQIA 3LLEA 1YVLA 4N1FA 4BY5A 2LVKA 1G8IA 5D7FA 1OMDA 1CKKA 3KHEA 4Q04A 3VGOA 1TIZA 4HRHA 2M29A 1IQ5A 1KK8B 2NCPA 2V53A 3CR4X 4PE1A 1KFUS 1YRTB 4NDDA 3E3RA 4PDZA 4N5XA 3TDIA 1NX3A 5AXIA 4DUQA 1MUXA 2WCFA 4HRGA 1NCXA 2LP3A 1JBAA 2JRFA 2Y4QA 1RWYA 1PSBA 4ZCUA 2JNXA 4MZKA 4GPLB 5HLOA 2JZIA 2CNPA 3I5IB 4M2QA 1YX8A 4MLWA 1FW4A 3I5IC 3CWGA 1VRKA 1SR6B 1EXRA 2P6BB 1KWOB 5AERA 1TTXA 1SR6C 2LVIA 1KWOC 2OS8B 1BU3A 3H4SE 1C7VA 1EL4A 2LP2A 2OS8C 1G33A 4FTGA 4M2PA 3VROA 3ZNIA 4YI8A 1SPYA 3O2PA 3PATA 3SG3A 1OMRA 1G4YR 1K90D 1A2XA 2KFGA 1A4PA 3KPXA 3GK4X 4YBHB 4R1EA 1S1EA 3BOWB 2GGMA 2I7AA 2KBIA 1KSOA 4WRIA 5KTYA 1HT9A 1SK6D 1XFZO 2K2AA 1W7IB 2KGRA 2M1KB 4MEWA 5F6TA 1ZACA 4WQ3A 2FJUB 2ZRSA 1UHIA 3I5FB 4MBEA 4MRXA 1PK0D 1OZSA 1PRWA 3I5FC 1IWQA 2EHBA 2Q4UA 4GFTA 4PHNA 5I2LA 1IQ3A 1J55A 2CCMA 1S5GY 1TCFA 2M9GA 4IL1A 3FS7A 1YX7A 3LK0A 3O78A 3TUYB 1OMVA 4NDCA 4GNKB 1BOCA 1JSAA 4A4CA 3TUYC 1Y1XA 1YUTA 2KHNA 1CLBA 2CT9A 2HPSA 4YI9A 1YRUB 1EG3A 1Y1UA 3DVMA 4I5LB 1DGVA 1QLKA 2E6WA 3CGAA 1B8CA 4GGNA 2DOQA 4OVNF 1N65A 1ZOTB 2IS9A 2Y1MA 4GUKA 2B1UA 1CMGA 1QV1A 1A75B 1DVIA 1K96A 4GAOA 1DF0B 3DVEA 2PVBA 1C07A 4I5JA 4AQJA 1F4QA 3EK8A 3OX5A 3SG2A 1BODA 2KGBC 1QIVA 1QASA 1QX5B 3F45A 4TNCA 1HQVA 2L4HA 1JFJA 4C0KA 2H61C 1WRKA 1S36A 2KI4B 2KQYA 4ORCB 1J7PA 2L50A 2FCDA 2KI4C 2GGZA 4JWQA 2I2RE 1ALWA 1TN4A 4PALA 1KK7Y 2LMVA 3BUXB 3I5HB 4JQ0D 2KOTA 3RLZA 2K8MB 1SY9A 2M7NA 3BYAA 2JXCA 2F2PA 3PLFB 1B9AA 1KFUL 2MLEC 3IQOA 2LV7A 1SCMC 1B8LA 2LLUA 3EKHA 1BR1B 1BT6A 3OX6A 3SG4A 1KSMA 1R6PA 5TNCA 3OP0A 1WY9A 2CBLA 1KCYA 1OZOA 2K7CA 2FCEA 4PHJA 1FPWA 2JTTA 2A4JA 2BE6A 4DS7A 2MAZA 4YGBB 5DKRA 1SYMA 1DJIA 1LKJA 4HSZA 2WC8A 2R2IA 5B8IB 1LINA 3ICBA 2NLNA 3PN7B 1M46A 3DVKA 1MWNA 3PN7C 1NCZA 1QVIZ 3RM1A 2JT0A 1OOJA 2JC2A 1YUSA 4BY4A 1AHRA 4OKHA 1DJHA 1UWOA 2G2BA 1CLMA 5HKWA 5AFPA 3OB1B 4ETOA 2L51A 1TNQA 2BKIB 1KK8C 1NX1A 3CTNA 2HETA 3HX4A 1F8HA 1TNPA 5ER5A 1LVCD 2JQ6A 1B7TY 2ZN9A 1SKTA 4U8DA 2K7OA 2ZNEA 2M3WA 2L2EA 1K95A 1NSHA 3D10A 4YGCB 4C0LA 4XYNA 2I94A 2KYCA 1MR8A 3PFVA 3JVTB 1GGWA 4ORBB 1EG4A 2WOSA 3SJSA 2JNFA 1Q80A 2LANA 1OQPA 2KQ6A 2MA2A 1EH2A 2GV5A 2LLSA 1JF0A 1BG1A 2CTNA 2F2OA 1RJVA 1UUSA 1A75A 1V1GA 3K21A 4YGDB 1FI5A 2M97A 1DF0A 1K9PA 1FI6A 1CDMA 2LC5A 4PHKA 3DF0A 1QV0A 1IH0A 5KU1A 3WHTB 4CPVA 2PASA 1LXFC 1KFXS 1PALA 1NP8A 1TRFA 2Q91A 1CFPA 2H61A 2OTGB 2HQ8A 5CSJA 1AK8A 1J7QA 3NSOA 1S6IA 3WNXB 2LCPA 3PSRA 1YR5A 1QTXA 1U5IB 3CR5X 1XVJA 2ZKMX 1XYDA 1H4BA 4MZLA 5DKQA 1CB1A 2PSRA 1IRJA 1S26D 4PE7A 1F4OA 2AUCA 2WORA 3EVVA 2COLB 2KDHA 2Y5IA 4PE4A 1GJYA 3O6BA 1RROA 2JTZA 1CLLA 5CPVA 1S3PA 4USLA 1XFXO 4XJKB 4ZCVA 1RFJA 3WXAA 2AAOA 1SBJA 2D8NA 2LLTA 2K7DA 3EVUA 1RK9A 1OSAA 5HKYA 1S6CA 1XFVO 2ZN8A 4PCWA 5GQQC 2KFHA 2F3ZA 4MRYA 3M0WA 1DJXA 1WLZA 1SL9A 1XFYO 1PVAA 2ZRTA 2L98A 1NUBA 1Y1AA 1K94A 5CSNA 3LK1A 4ORAB 1M39A 4WQ2A 5I2QA 2JPTA 1N2DA 3MSEB 3I5HC 1BLQA 1RTP1 5HKZA 1IJ5A 1QX2A 3WHUB 1K93D 5J3XA 2L4IA 2HF5A 2LVVA 1DTLA 1LA0A 2G9BA 1GQMA 4NDBA 1F70A 4QJ4B 3IF7A 3AAKA 1C7WA 3TZ1A 1A03A 2LHLA 1W7JB 4PE0A 2KAXA 4I5KA 1QS7A 3VRRA 4GGFC 2BECA 2MLFC 1H8BA 5D69A 2NXQA 1SL8A 3IQQA 2Y1NA 1L2OB 4N1GA 4DIRA 1AJ4A 1BMOA 4FQOA 1BF5A 2BCBA 2JU0A 2F33A 2O60A 3NSIA 2BCXA 3DD4A 4CFQA 2M1UA 1Y6WA 2K7BA 3AKBA 2KYFA 5FYXA 2JULA 2LUXA 1L7ZA 3CZTX 2O5GA 5PALA 2F3YA 3D0YB 2ZFDA 3DVJA 2KBMA 4P2YB 1AP4A 3BOWA 1E8AA 2LE9B 2CXJA 1IG5A 1IJ6A 2JT3A 3OB2B 2K2FA 3BQ3A 2LAPA 3BXKA 1B7TZ 2JOJA 1NX2A 3VRPA 1WLMA 3CS1A 1CDLA 5G08A 3TDZA 1UHJA 1JF2A 2JXLA 2M8UA 2BBNA 5JOLA 1SNLA 4YGEB 2M49B 2BE4A 4OR9B 1IKUA 1RECA 4DCKA 3HCMA 1K9UA 1UP5A 1U5IA 4PHMA 3CR2A 3SG7A 3BUNB 5JJGA 2SCPA 2LHIA 4UPGA 2I18A 1QVIY 1XK4A 2KNEA 2LMTA 3NSLA 3JVTC 1DJYA 4NQGA 1BJFA 2KFFA 1CFFA 3SIAA 5HLVA 2EGDA 2NZ0A 3LCPC 4CFRA 2FOTA 1XO5A 3EK4A 5ER4X 1CDNA 2JT8A 3LL8B 5KSZA 1F54A 2L5XB 4OV2A 1B47A 4XJKA 3GOFA 2K61A 1WRLA 1JC2A 2EC6B 2LMUA 2RGIA 3NSKA 1DGUA 1F55A 1PVBA 1QX7A 2EC6C 1PSRA 3BUOB 5CSFA 3I5GB 3FIAA 2KSPA 4MVFA 1XFUO 3I5GC 1ODBA 1X02A 1ZMZA 1S5GZ 1KQMB 1IGVA 3SG5A 5CSIA 1SMGA 4YRUA 1KQMC 5K89A 1J1EA 2KAVA 2OTGC 3KEVA 4M2OA 2OPOA 5DKNA 3PM8A 4AOMA 5I8NA 2BKHB 2KI6C 5IBWA 1AUIB 1ALVA 2HQWA 2WCBA 4MZJA 4QJ5B 3A4UB 2LVJA 1A29A 1K9KA 1QXPA 1ZFSA 1DJZA 1JWDA 1CMFA 5AANA 1Y0VH 1DT7B 3FWBA 3BUMB 1CFCA 1XK4C 3GK2A 4CIDA 3OHMB 4C0JA 4QJ3B 2PRUA 1NX0A 3FWCA 2LNKA 4JPZB 2AMIA 1KQVA 2BL0B 1MXEA 1QLSA 4GGFA 1MXLC 3VRQA 2BL0C 2VRGA
chains in the Genus database with same CATH superfamily
1QIWA 1V1FA 1R2UA 3TS5C 1JUOA 3R1PA 1XFWO 2SASA 1FBVA 2NCOA 3KF9A 3DZTA 3R1VA 1JFKA 1S6JA 1WDCB 2K0JA 3V2LA 1QATA 3TDUA 1D1OA 3SS5A 1WDCC 3NXAA 3ZWHA 4OCIA 1AJ5A 2LUCA 5HYDA 1TCOB 2ISDA 2MRDA 3TS5B 3SIBA 1GGZA 1TWOA 1TOPA 1KK7Z 1K2HA 1BR4B 1OW4A 1J7OA 3D0YA 4DRWA 2WNDA 2BCAA 3AKAA 1ZUZA 3C1VA 5FI7A 3SG6A 1OOIX 1FF1A 1B1GA 1SRAA 3DF0B 1YURA 3BJHA 1DJGA 4MSPA 1M45A 1NCYA 1UHKA 3EVRA 4I5NB 1SL7A 4YGAA 3PALA 2H2KA 4MN0A 3FE6A 2YGUA 1QJTA 3AAJA 3BUWB 1K8UA 1M31A 3EKJA 5I2OA 4E68A 2F8PA 3CZ1A 1SW8A 4CLNA 1MF8B 2KAYA 2M7LA 4D1EA 2BBMA 1CM4A 1OE9B 1SCVA 1LA3A 1TNWA 2MJWB 4P5OE 4GBAA 2TN4A 1DEKA 1WRZA 3JTDB 3K1EA 3O4XA 1B8RA 1L2OC 1CFDA 1YTZC 1TNXA 3EK7A 3JTDC 1N0YA 5BPJA 1F71A 1CTRA 1CNPA 1P28A 1B4CA 2MHHA 4A4BA 1YVHA 1SCMB 3QRXA 4L9MA 1UHNA 1J7RA 1DMOA 3S0BA 1EJ3A 3VRNA 4PT1A 1NIWA 2PALA 1AVSA 3D77A 2WCEA 3DYEA 1CM1A 1NYAA 2K60A 1UURA 3GK1A 1XA5A 2LM5A 4INWA 1CDPA 1J1DA 1MQ1A 3KO0A 1MHOA 4HREE 2QEBA 2L0PA 1DJWA 1YUUA 1NPQA 1KFXL 2QPTA 1UHHA 5FI6A 5AEQA 2QACA 2PMYA 1M63B 1PULA 2E30A 2MBXA 2ZNDA 4ICBA 1NWDA 4F0ZB 3CLNA 2JWWA 2KI6D 3A8RA 2M0RA 3O4YA 4AQIA 3LLEA 1YVLA 4N1FA 4BY5A 2LVKA 1G8IA 5D7FA 1OMDA 1CKKA 3DY9A 3KHEA 3CZ2A 4Q04A 1TIZA 3VGOA 4HRHA 2M29A 1IQ5A 1KK8B 2NCPA 2V53A 3CZ0A 3CR4X 4PE1A 1KFUS 1YRTB 2QEVA 4NDDA 3E3RA 4PDZA 3RZSA 4N5XA 3TDIA 3NHTA 1NX3A 5AXIA 2JPOA 1MUXA 2WCFA 3B87A 1NCXA 2LP3A 4HRGA 4KYNA 2JRFA 4F7FA 2Y4QA 1RWYA 1PSBA 4ZCUA 1TUZA 2JNXA 4MZKA 3R1OA 4GPLB 5HLOA 2JZIA 2CNPA 3I5IB 4M2QA 1YX8A 3CABA 1FW4A 4MLWA 3B7AA 3I5IC 3CWGA 1VRKA 1SR6B 1EXRA 2KLDA 2P6BB 1KWOB 5AERA 1TTXA 1SR6C 2LVIA 1KWOC 2OS8B 1BU3A 3H4SE 1C7VA 1DQEA 1EL4A 2LP2A 2OS8C 1G33A 4FTGA 4M2PA 3VROA 3ZNIA 4YI8A 1SPYA 3O2PA 3PATA 3SG3A 1OMRA 1G4YR 1K90D 1A2XA 2KFGA 1A4PA 3KPXA 3GK4X 1Z4HA 4YBHB 4R1EA 1S1EA 3BOWB 3D75A 2GGMA 2I7AA 2KBIA 1KSOA 4WRIA 5KTYA 3FE8A 1HT9A 1SK6D 1XFZO 2K2AA 1W7IB 2KGRA 4OZDA 2M1KB 4MEWA 5F6TA 1ZACA 4WQ3A 2FJUB 2ZRSA 1UHIA 3I5FB 4MBEA 4MRXA 1PK0D 1OZSA 3EG5B 1PRWA 3I5FC 1IWQA 2EHBA 2Q4UA 4GFTA 4PHNA 5I2LA 1IQ3A 1J55A 2CCMA 1S5GY 1TCFA 2M9GA 4IL1A 3FS7A 1YX7A 3BFAA 3LK0A 3O78A 3TUYB 1OMVA 4NDCA 4GNKB 1BOCA 1JSAA 3D73A 4A4CA 3TUYC 2WCJA 1Y1XA 1YUTA 2KHNA 1CLBA 2CT9A 2HPSA 4YI9A 1YRUB 1EG3A 1Y1UA 3DVMA 4I5LB 4IJ7A 1DGVA 1QLKA 2E6WA 3CGAA 1B8CA 4GGNA 2DOQA 4OVNF 1N65A 1ZOTB 2IS9A 2Y1MA 5FI2A 4GUKA 2B1UA 1CMGA 1QV1A 1A75B 1QWVA 1DVIA 1K96A 3UO9A 4GAOA 1DF0B 3DVEA 2PVBA 2P71A 1C07A 4I5JA 4AQJA 2H8VA 1F4QA 3EK8A 3OX5A 3FE9A 3SG2A 1BODA 2KGBC 1QIVA 1QASA 1QX5B 3F45A 4TNCA 1HQVA 2L4HA 3D76A 1JFJA 4C0KA 2H61C 1WRKA 1S36A 2KI4B 2KQYA 4ORCB 1J7PA 2L50A 2FCDA 2KI4C 2GGZA 3Q8IA 4JWQA 2I2RE 1ALWA 1TN4A 2WC6A 4PALA 1KK7Y 2LMVA 3BUXB 2L5YA 3I5HB 4JQ0D 2KOTA 3RLZA 2K8MB 1SY9A 2M7NA 1ORGA 3BYAA 2JXCA 3NHIA 2F2PA 3PLFB 1B9AA 1KFUL 2ERBA 2MLEC 3IQOA 5DICA 2LV7A 1SCMC 1B8LA 2LLUA 3EKHA 1BR1B 1BT6A 3OX6A 3SG4A 1KSMA 1R6PA 5TNCA 3S0DA 3OP0A 1WY9A 2CBLA 1KCYA 1OZOA 2K7CA 2FCEA 4PHJA 1FPWA 2JTTA 2A4JA 2BE6A 4DS7A 2MAZA 2PYQA 4YGBB 2WCMA 5DKRA 1SYMA 1DJIA 1LKJA 4HSZA 2WC8A 1OOGA 2R2IA 5B8IB 1LINA 3ICBA 2NLNA 3PN7B 1M46A 1OOHA 1MWNA 3DVKA 1NCZA 1QVIZ 3PN7C 3R72A 3RM1A 2JT0A 3PM2A 1OOJA 2JC2A 1YUSA 4BY4A 1AHRA 4OKHA 1DJHA 1UWOA 2G2BA 1CLMA 5HKWA 5AFPA 3OB1B 4JD9A 4ETOA 2L51A 1TNQA 2BKIB 1KK8C 1NX1A 3CTNA 2HETA 3HX4A 1C3YA 1F8HA 1TNPA 5ER5A 1LVCD 2JQ6A 1B7TY 2ZN9A 3L47A 1SKTA 4U8DA 2K7OA 2ZNEA 2M3WA 2L2EA 1K95A 1NSHA 3D10A 4YGCB 1DELA 4C0LA 4XYNA 2I94A 2PQLA 2KYCA 1MR8A 3PFVA 3JVTB 1GGWA 2QEOA 3VB1A 4ORBB 1EG4A 2WOSA 3SJSA 2JNFA 1Q80A 2LANA 1OQPA 2KQ6A 2MA2A 1EH2A 2GV5A 2QEHA 2LLSA 1JF0A 3S0FA 1BG1A 2CTNA 2F2OA 1RJVA 1UUSA 1A75A 1V1GA 3K21A 4YGDB 1FI5A 2M97A 1DF0A 1K9PA 1FI6A 1CDMA 2LC5A 4PHKA 3DF0A 1QV0A 3B86A 1IH0A 5KU1A 3WHTB 4CPVA 2PASA 1LXFC 1KFXS 1PALA 1NP8A 1TRFA 2Q91A 1CFPA 2H61A 2OTGB 2HQ8A 5CSJA 1AK8A 1J7QA 3NSOA 1Z2CB 1S6IA 3WNXB 2LCPA 3PSRA 1YR5A 1QTXA 1U5IB 3CR5X 1XVJA 2ZKMX 1XYDA 3NGVA 3B88A 1H4BA 4MZLA 5DKQA 1CB1A 3BFHA 2PSRA 1IRJA 1S26D 5EL2A 4PE7A 1F4OA 2AUCA 2WORA 3EVVA 2COLB 2KDHA 2Y5IA 4PE4A 1GJYA 3O6BA 1RROA 2JTZA 1CLLA 5CPVA 1S3PA 4USLA 1XFXO 4XJKB 4ZCVA 1RFJA 3WXAA 2AAOA 1SBJA 2D8NA 2LLTA 2K7DA 1T14A 3EVUA 1RK9A 2QDIA 1OSAA 5HKYA 1S6CA 1XFVO 2WCHA 2ZN8A 4PCWA 5GQQC 2KFHA 2F3ZA 4MRYA 3SS4A 1JBAA 3M0WA 4INXA 1DJXA 1WLZA 1SL9A 1XFYO 1PVAA 2ZRTA 2L98A 1NUBA 1Y1AA 1K94A 3N7HA 1XFRA 5CSNA 3LK1A 1TUJA 4ORAB 1M39A 4WQ2A 3D74A 5I2QA 2JPTA 1N2DA 3MSEB 3I5HC 1BLQA 1RTP1 5HKZA 1IJ5A 3B6XA 1QX2A 1W9ZA 3IVTA 3WHUB 1K93D 3L4LA 2L4IA 5J3XA 3BFBA 2HF5A 2LVVA 1DTLA 1LA0A 2G9BA 1GQMA 4NDBA 1F70A 4QJ4B 3IF7A 3AAKA 1C7WA 3TZ1A 1A03A 2KPHA 1W7JB 2LHLA 2L2CA 4PE0A 2KAXA 3PJIA 1QS7A 4I5KA 4GGFC 2BECA 2MLFC 4FQTA 3VRRA 2P70A 5HL1A 1H8BA 5D69A 2NXQA 1SL8A 3IQQA 2Y1NA 1L2OB 4N1GA 4DIRA 1AJ4A 1BMOA 4FQOA 1BF5A 3S0AA 2BCBA 2JU0A 2F33A 2O60A 3NSIA 2BCXA 3DD4A 4CFQA 2M1UA 1Y6WA 2K7BA 3AKBA 2KYFA 5FYXA 2JULA 2LUXA 1L7ZA 3CZTX 2O5GA 5PALA 2F3YA 3D0YB 2ZFDA 3DVJA 2KBMA 4P2YB 1AP4A 3BOWA 1OOFA 1E8AA 3UNWA 2LE9B 2CXJA 1IG5A 1IJ6A 2JT3A 3OB2B 2K2FA 3BQ3A 2LAPA 3BXKA 2WCLA 1B7TZ 2JOJA 1NX2A 3VRPA 1WLMA 3CS1A 1CDLA 3OBVA 5G08A 3TDZA 1UHJA 1JF2A 3DXLA 2JXLA 2M8UA 1C3ZA 2BBNA 3L4AA 5JOLA 1SNLA 4YGEB 2M49B 2BE4A 4OR9B 1IKUA 3S0GA 1RECA 4DCKA 3SS3A 3HCMA 1K9UA 1UP5A 1U5IA 4PHMA 4DUQA 3CR2A 3SG7A 3CYZA 3BUNB 5JJGA 2SCPA 2LHIA 4UPGA 2I18A 1QVIY 1XK4A 2BAPA 2KNEA 3QMEA 2LMTA 1SSEB 3JVTC 1DJYA 3NSLA 1BJFA 2KFFA 4NQGA 3SIAA 1CFFA 3S0EA 5HLVA 2EGDA 2NZ0A 3LCPC 4CFRA 2FOTA 1XO5A 3EK4A 5ER4X 1CDNA 2JT8A 5D3OA 3LL8B 5KSZA 1F54A 2L5XB 4OV2A 1B47A 4XJKA 3GOFA 2K61A 1WRLA 1LS8A 1JC2A 2EC6B 5I94A 2LMUA 2RGIA 3NSKA 1DGUA 1F55A 1PVBA 1QX7A 2EC6C 1PSRA 3BUOB 5CSFA 3I5GB 3FIAA 2KSPA 4MVFA 1XFUO 3I5GC 1ODBA 1X02A 1ZMZA 1S5GZ 1KQMB 1IGVA 2FJYA 5CSIA 2WCKA 1SMGA 3SG5A 4YRUA 1KQMC 5K89A 1J1EA 2KAVA 2OTGC 3KEVA 4M2OA 2OPOA 5DKNA 3PM8A 4AOMA 5I8NA 2BKHB 3OGNA 2KI6C 5IBWA 1AUIB 2GTEA 3CDNA 1ALVA 2HQWA 2WCBA 4MZJA 4QJ5B 3A4UB 2LVJA 1A29A 1K9KA 1QXPA 1ZFSA 1DJZA 1JWDA 1CMFA 5AANA 1Y0VH 3D78A 1DC1A 1DT7B 2WC5A 3BUMB 3FWBA 1XK4C 2KLEA 1CFCA 3GK2A 4JKTA 1GM0A 4CIDA 3OHMB 4C0JA 4QJ3B 2PRUA 1IIOA 1NX0A 2BNXA 3FWCA 2LNKA 4JPZB 2AMIA 1KQVA 2BL0B 1MXEA 1QLSA 4GGFA 1MXLC 3VRQA 2BL0C 2VRGA
chains in the Genus database with same CATH topology
1QIWA 1V1FA 1R2UA 3TS5C 1JUOA 1XFWO 2SASA 1FBVA 2NCOA 3KF9A 1JFKA 1S6JA 1WDCB 2K0JA 1QATA 3TDUA 1D1OA 1WDCC 3NXAA 3ZWHA 4OCIA 1AJ5A 2LUCA 5HYDA 1TCOB 2ISDA 2MRDA 3TS5B 3SIBA 1GGZA 1TOPA 1KK7Z 1K2HA 1BR4B 1J7OA 3D0YA 4DRWA 2WNDA 2BCAA 3AKAA 1ZUZA 3C1VA 3SG6A 1FF1A 1B1GA 1SRAA 3DF0B 1YURA 1DJGA 4MSPA 1M45A 1NCYA 1UHKA 3EVRA 4I5NB 1SL7A 4YGAA 3PALA 2H2KA 4MN0A 1QJTA 3AAJA 3BUWB 1K8UA 1M31A 3EKJA 5I2OA 4E68A 2F8PA 1SW8A 4CLNA 1MF8B 2KAYA 2M7LA 4D1EA 2BBMA 1CM4A 1OE9B 1SCVA 1LA3A 1TNWA 2MJWB 4P5OE 4GBAA 2TN4A 3JTDB 1WRZA 1B8RA 1L2OC 1CFDA 1TNXA 1YTZC 3EK7A 3JTDC 1N0YA 5BPJA 1F71A 1CTRA 1CNPA 1B4CA 2MHHA 4A4BA 1YVHA 1SCMB 3QRXA 4L9MA 1UHNA 1J7RA 1DMOA 1EJ3A 3VRNA 1NIWA 2PALA 1AVSA 2WCEA 1CM1A 1NYAA 1UURA 3GK1A 1XA5A 2LM5A 1CDPA 1J1DA 1MQ1A 3KO0A 1MHOA 4HREE 2L0PA 1DJWA 1YUUA 1NPQA 1KFXL 2QPTA 1UHHA 5AEQA 2QACA 2PMYA 1M63B 1PULA 2E30A 2MBXA 2ZNDA 4ICBA 1NWDA 4F0ZB 3CLNA 2JWWA 2KI6D 3A8RA 2M0RA 3O4YA 4AQIA 3LLEA 1YVLA 4N1FA 4BY5A 2LVKA 1G8IA 5D7FA 1OMDA 1CKKA 3KHEA 4Q04A 3VGOA 1TIZA 4HRHA 2M29A 1IQ5A 1KK8B 2NCPA 2V53A 3CR4X 4PE1A 1KFUS 1YRTB 4NDDA 3E3RA 4PDZA 4N5XA 3TDIA 1NX3A 5AXIA 4DUQA 1MUXA 2WCFA 4HRGA 1NCXA 2LP3A 1JBAA 2JRFA 2Y4QA 1RWYA 1PSBA 4ZCUA 2JNXA 4MZKA 4GPLB 5HLOA 2JZIA 2CNPA 3I5IB 4M2QA 1YX8A 4MLWA 1FW4A 3I5IC 3CWGA 1VRKA 1SR6B 1EXRA 2P6BB 1KWOB 5AERA 1TTXA 1SR6C 2LVIA 1KWOC 2OS8B 1BU3A 3H4SE 1C7VA 1EL4A 2LP2A 2OS8C 1G33A 4FTGA 4M2PA 3VROA 3ZNIA 4YI8A 1SPYA 3O2PA 3PATA 3SG3A 1OMRA 1G4YR 1K90D 1A2XA 2KFGA 1A4PA 3KPXA 3GK4X 4YBHB 4R1EA 1S1EA 3BOWB 2GGMA 2I7AA 2KBIA 1KSOA 4WRIA 5KTYA 1HT9A 1SK6D 1XFZO 2K2AA 1W7IB 2KGRA 2M1KB 4MEWA 5F6TA 1ZACA 4WQ3A 2FJUB 2ZRSA 1UHIA 3I5FB 4MBEA 4MRXA 1PK0D 1OZSA 1PRWA 3I5FC 1IWQA 2EHBA 2Q4UA 4GFTA 4PHNA 5I2LA 1IQ3A 1J55A 2CCMA 1S5GY 1TCFA 2M9GA 4IL1A 3FS7A 1YX7A 3LK0A 3O78A 3TUYB 1OMVA 4NDCA 4GNKB 1BOCA 1JSAA 4A4CA 3TUYC 1Y1XA 1YUTA 2KHNA 1CLBA 2CT9A 2HPSA 4YI9A 1YRUB 1EG3A 1Y1UA 3DVMA 4I5LB 1DGVA 1QLKA 2E6WA 3CGAA 1B8CA 4GGNA 2DOQA 4OVNF 1N65A 1ZOTB 2IS9A 2Y1MA 4GUKA 2B1UA 1CMGA 1QV1A 1A75B 1DVIA 1K96A 4GAOA 1DF0B 3DVEA 2PVBA 1C07A 4I5JA 4AQJA 1F4QA 3EK8A 3OX5A 3SG2A 1BODA 2KGBC 1QIVA 1QASA 1QX5B 3F45A 4TNCA 1HQVA 2L4HA 1JFJA 4C0KA 2H61C 1WRKA 1S36A 2KI4B 2KQYA 4ORCB 1J7PA 2L50A 2FCDA 2KI4C 2GGZA 4JWQA 2I2RE 1ALWA 1TN4A 4PALA 1KK7Y 2LMVA 3BUXB 3I5HB 4JQ0D 2KOTA 3RLZA 2K8MB 1SY9A 2M7NA 3BYAA 2JXCA 2F2PA 3PLFB 1B9AA 1KFUL 2MLEC 3IQOA 2LV7A 1SCMC 1B8LA 2LLUA 3EKHA 1BR1B 1BT6A 3OX6A 3SG4A 1KSMA 1R6PA 5TNCA 3OP0A 1WY9A 2CBLA 1KCYA 1OZOA 2K7CA 2FCEA 4PHJA 1FPWA 2JTTA 2A4JA 2BE6A 4DS7A 2MAZA 4YGBB 5DKRA 1SYMA 1DJIA 1LKJA 4HSZA 2WC8A 2R2IA 5B8IB 1LINA 3ICBA 2NLNA 3PN7B 1M46A 3DVKA 1MWNA 3PN7C 1NCZA 1QVIZ 3RM1A 2JT0A 1OOJA 2JC2A 1YUSA 4BY4A 1AHRA 4OKHA 1DJHA 1UWOA 2G2BA 1CLMA 5HKWA 5AFPA 3OB1B 4ETOA 2L51A 1TNQA 2BKIB 1KK8C 1NX1A 3CTNA 2HETA 3HX4A 1F8HA 1TNPA 5ER5A 1LVCD 2JQ6A 1B7TY 2ZN9A 1SKTA 4U8DA 2K7OA 2ZNEA 2M3WA 2L2EA 1K95A 1NSHA 3D10A 4YGCB 4C0LA 4XYNA 2I94A 2KYCA 1MR8A 3PFVA 3JVTB 1GGWA 4ORBB 1EG4A 2WOSA 3SJSA 2JNFA 1Q80A 2LANA 1OQPA 2KQ6A 2MA2A 1EH2A 2GV5A 2LLSA 1JF0A 1BG1A 2CTNA 2F2OA 1RJVA 1UUSA 1A75A 1V1GA 3K21A 4YGDB 1FI5A 2M97A 1DF0A 1K9PA 1FI6A 1CDMA 2LC5A 4PHKA 3DF0A 1QV0A 1IH0A 5KU1A 3WHTB 4CPVA 2PASA 1LXFC 1KFXS 1PALA 1NP8A 1TRFA 2Q91A 1CFPA 2H61A 2OTGB 2HQ8A 5CSJA 1AK8A 1J7QA 3NSOA 1S6IA 3WNXB 2LCPA 3PSRA 1YR5A 1QTXA 1U5IB 3CR5X 1XVJA 2ZKMX 1XYDA 1H4BA 4MZLA 5DKQA 1CB1A 2PSRA 1IRJA 1S26D 4PE7A 1F4OA 2AUCA 2WORA 3EVVA 2COLB 2KDHA 2Y5IA 4PE4A 1GJYA 3O6BA 1RROA 2JTZA 1CLLA 5CPVA 1S3PA 4USLA 1XFXO 4XJKB 4ZCVA 1RFJA 3WXAA 2AAOA 1SBJA 2D8NA 2LLTA 2K7DA 3EVUA 1RK9A 1OSAA 5HKYA 1S6CA 1XFVO 2ZN8A 4PCWA 5GQQC 2KFHA 2F3ZA 4MRYA 3M0WA 1DJXA 1WLZA 1SL9A 1XFYO 1PVAA 2ZRTA 2L98A 1NUBA 1Y1AA 1K94A 5CSNA 3LK1A 4ORAB 1M39A 4WQ2A 5I2QA 2JPTA 1N2DA 3MSEB 3I5HC 1BLQA 1RTP1 5HKZA 1IJ5A 1QX2A 3WHUB 1K93D 5J3XA 2L4IA 2HF5A 2LVVA 1DTLA 1LA0A 2G9BA 1GQMA 4NDBA 1F70A 4QJ4B 3IF7A 3AAKA 1C7WA 3TZ1A 1A03A 2LHLA 1W7JB 4PE0A 2KAXA 4I5KA 1QS7A 3VRRA 4GGFC 2BECA 2MLFC 1H8BA 5D69A 2NXQA 1SL8A 3IQQA 2Y1NA 1L2OB 4N1GA 4DIRA 1AJ4A 1BMOA 4FQOA 1BF5A 2BCBA 2JU0A 2F33A 2O60A 3NSIA 2BCXA 3DD4A 4CFQA 2M1UA 1Y6WA 2K7BA 3AKBA 2KYFA 5FYXA 2JULA 2LUXA 1L7ZA 3CZTX 2O5GA 5PALA 2F3YA 3D0YB 2ZFDA 3DVJA 2KBMA 4P2YB 1AP4A 3BOWA 1E8AA 2LE9B 2CXJA 1IG5A 1IJ6A 2JT3A 3OB2B 2K2FA 3BQ3A 2LAPA 3BXKA 1B7TZ 2JOJA 1NX2A 3VRPA 1WLMA 3CS1A 1CDLA 5G08A 3TDZA 1UHJA 1JF2A 2JXLA 2M8UA 2BBNA 5JOLA 1SNLA 4YGEB 2M49B 2BE4A 4OR9B 1IKUA 1RECA 4DCKA 3HCMA 1K9UA 1UP5A 1U5IA 4PHMA 3CR2A 3SG7A 3BUNB 5JJGA 2SCPA 2LHIA 4UPGA 2I18A 1QVIY 1XK4A 2KNEA 2LMTA 3NSLA 3JVTC 1DJYA 4NQGA 1BJFA 2KFFA 1CFFA 3SIAA 5HLVA 2EGDA 2NZ0A 3LCPC 4CFRA 2FOTA 1XO5A 3EK4A 5ER4X 1CDNA 2JT8A 3LL8B 5KSZA 1F54A 2L5XB 4OV2A 1B47A 4XJKA 3GOFA 2K61A 1WRLA 1JC2A 2EC6B 2LMUA 2RGIA 3NSKA 1DGUA 1F55A 1PVBA 1QX7A 2EC6C 1PSRA 3BUOB 5CSFA 3I5GB 3FIAA 2KSPA 4MVFA 1XFUO 3I5GC 1ODBA 1X02A 1ZMZA 1S5GZ 1KQMB 1IGVA 3SG5A 5CSIA 1SMGA 4YRUA 1KQMC 5K89A 1J1EA 2KAVA 2OTGC 3KEVA 4M2OA 2OPOA 5DKNA 3PM8A 4AOMA 5I8NA 2BKHB 2KI6C 5IBWA 1AUIB 1ALVA 2HQWA 2WCBA 4MZJA 4QJ5B 3A4UB 2LVJA 1A29A 1K9KA 1QXPA 1ZFSA 1DJZA 1JWDA 1CMFA 5AANA 1Y0VH 1DT7B 3FWBA 3BUMB 1CFCA 1XK4C 3GK2A 4CIDA 3OHMB 4C0JA 4QJ3B 2PRUA 1NX0A 3FWCA 2LNKA 4JPZB 2AMIA 1KQVA 2BL0B 1MXEA 1QLSA 4GGFA 1MXLC 3VRQA 2BL0C 2VRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QIW A;  1V1F A;  1R2U A;  3TS5 C;  1JUO A;  1XFW O;  2SAS A;  1FBV A;  2NCO A;  3KF9 A;  1JFK A;  1S6J A;  1WDC B;  2K0J A;  1QAT A;  3TDU A;  1D1O A;  1WDC C;  3NXA A;  3ZWH A;  4OCI A;  1AJ5 A;  2LUC A;  5HYD A;  1TCO B;  2ISD A;  2MRD A;  3TS5 B;  3SIB A;  1GGZ A;  1TOP A;  1KK7 Z;  1K2H A;  1BR4 B;  1J7O A;  3D0Y A;  4DRW A;  2WND A;  2BCA A;  3AKA A;  1ZUZ A;  3C1V A;  3SG6 A;  1FF1 A;  1B1G A;  1SRA A;  3DF0 B;  1YUR A;  1DJG A;  4MSP A;  1M45 A;  1NCY A;  1UHK A;  3EVR A;  4I5N B;  1SL7 A;  4YGA A;  3PAL A;  2H2K A;  4MN0 A;  1QJT A;  3AAJ A;  3BUW B;  1K8U A;  1M31 A;  3EKJ A;  5I2O A;  4E68 A;  2F8P A;  1SW8 A;  4CLN A;  1MF8 B;  2KAY A;  2M7L A;  4D1E A;  2BBM A;  1CM4 A;  1OE9 B;  1SCV A;  1LA3 A;  1TNW A;  2MJW B;  4P5O E;  4GBA A;  2TN4 A;  3JTD B;  1WRZ A;  1B8R A;  1L2O C;  1CFD A;  1TNX A;  1YTZ C;  3EK7 A;  3JTD C;  1N0Y A;  5BPJ A;  1F71 A;  1CTR A;  1CNP A;  1B4C A;  2MHH A;  4A4B A;  1YVH A;  1SCM B;  3QRX A;  4L9M A;  1UHN A;  1J7R A;  1DMO A;  1EJ3 A;  3VRN A;  1NIW A;  2PAL A;  1AVS A;  2WCE A;  1CM1 A;  1NYA A;  1UUR A;  3GK1 A;  1XA5 A;  2LM5 A;  1CDP A;  1J1D A;  1MQ1 A;  3KO0 A;  1MHO A;  4HRE E;  2L0P A;  1DJW A;  1YUU A;  1NPQ A;  1KFX L;  2QPT A;  1UHH A;  5AEQ A;  2QAC A;  2PMY A;  1M63 B;  1PUL A;  2E30 A;  2MBX A;  2ZND A;  4ICB A;  1NWD A;  4F0Z B;  3CLN A;  2JWW A;  2KI6 D;  3A8R A;  2M0R A;  3O4Y A;  4AQI A;  3LLE A;  1YVL A;  4N1F A;  4BY5 A;  2LVK A;  1G8I A;  5D7F A;  1OMD A;  1CKK A;  3KHE A;  4Q04 A;  3VGO A;  1TIZ A;  4HRH A;  2M29 A;  1IQ5 A;  1KK8 B;  2NCP A;  2V53 A;  3CR4 X;  4PE1 A;  1KFU S;  1YRT B;  4NDD A;  3E3R A;  4PDZ A;  4N5X A;  3TDI A;  1NX3 A;  5AXI A;  4DUQ A;  1MUX A;  2WCF A;  4HRG A;  1NCX A;  2LP3 A;  1JBA A;  2JRF A;  2Y4Q A;  1RWY A;  1PSB A;  4ZCU A;  2JNX A;  4MZK A;  4GPL B;  5HLO A;  2JZI A;  2CNP A;  3I5I B;  4M2Q A;  1YX8 A;  4MLW A;  1FW4 A;  3I5I C;  3CWG A;  1VRK A;  1SR6 B;  1EXR A;  2P6B B;  1KWO B;  5AER A;  1TTX A;  1SR6 C;  2LVI A;  1KWO C;  2OS8 B;  1BU3 A;  3H4S E;  1C7V A;  1EL4 A;  2LP2 A;  2OS8 C;  1G33 A;  4FTG A;  4M2P A;  3VRO A;  3ZNI A;  4YI8 A;  1SPY A;  3O2P A;  3PAT A;  3SG3 A;  1OMR A;  1G4Y R;  1K90 D;  1A2X A;  2KFG A;  1A4P A;  3KPX A;  3GK4 X;  4YBH B;  4R1E A;  1S1E A;  3BOW B;  2GGM A;  2I7A A;  2KBI A;  1KSO A;  4WRI A;  5KTY A;  1HT9 A;  1SK6 D;  1XFZ O;  2K2A A;  1W7I B;  2KGR A;  2M1K B;  4MEW A;  5F6T A;  1ZAC A;  4WQ3 A;  2FJU B;  2ZRS A;  1UHI A;  3I5F B;  4MBE A;  4MRX A;  1PK0 D;  1OZS A;  1PRW A;  3I5F C;  1IWQ A;  2EHB A;  2Q4U A;  4GFT A;  4PHN A;  5I2L A;  1IQ3 A;  1J55 A;  2CCM A;  1S5G Y;  1TCF A;  2M9G A;  4IL1 A;  3FS7 A;  1YX7 A;  3LK0 A;  3O78 A;  3TUY B;  1OMV A;  4NDC A;  4GNK B;  1BOC A;  1JSA A;  4A4C A;  3TUY C;  1Y1X A;  1YUT A;  2KHN A;  1CLB A;  2CT9 A;  2HPS A;  4YI9 A;  1YRU B;  1EG3 A;  1Y1U A;  3DVM A;  4I5L B;  1DGV A;  1QLK A;  2E6W A;  3CGA A;  1B8C A;  4GGN A;  2DOQ A;  4OVN F;  1N65 A;  1ZOT B;  2IS9 A;  2Y1M A;  4GUK A;  2B1U A;  1CMG A;  1QV1 A;  1A75 B;  1DVI A;  1K96 A;  4GAO A;  1DF0 B;  3DVE A;  2PVB A;  1C07 A;  4I5J A;  4AQJ A;  1F4Q A;  3EK8 A;  3OX5 A;  3SG2 A;  1BOD A;  2KGB C;  1QIV A;  1QAS A;  1QX5 B;  3F45 A;  4TNC A;  1HQV A;  2L4H A;  1JFJ A;  4C0K A;  2H61 C;  1WRK A;  1S36 A;  2KI4 B;  2KQY A;  4ORC B;  1J7P A;  2L50 A;  2FCD A;  2KI4 C;  2GGZ A;  4JWQ A;  2I2R E;  1ALW A;  1TN4 A;  4PAL A;  1KK7 Y;  2LMV A;  3BUX B;  3I5H B;  4JQ0 D;  2KOT A;  3RLZ A;  2K8M B;  1SY9 A;  2M7N A;  3BYA A;  2JXC A;  2F2P A;  3PLF B;  1B9A A;  1KFU L;  2MLE C;  3IQO A;  2LV7 A;  1SCM C;  1B8L A;  2LLU A;  3EKH A;  1BR1 B;  1BT6 A;  3OX6 A;  3SG4 A;  1KSM A;  1R6P A;  5TNC A;  3OP0 A;  1WY9 A;  2CBL A;  1KCY A;  1OZO A;  2K7C A;  2FCE A;  4PHJ A;  1FPW A;  2JTT A;  2A4J A;  2BE6 A;  4DS7 A;  2MAZ A;  4YGB B;  5DKR A;  1SYM A;  1DJI A;  1LKJ A;  4HSZ A;  2WC8 A;  2R2I A;  5B8I B;  1LIN A;  3ICB A;  2NLN A;  3PN7 B;  1M46 A;  3DVK A;  1MWN A;  3PN7 C;  1NCZ A;  1QVI Z;  3RM1 A;  2JT0 A;  1OOJ A;  2JC2 A;  1YUS A;  4BY4 A;  1AHR A;  4OKH A;  1DJH A;  1UWO A;  2G2B A;  1CLM A;  5HKW A;  5AFP A;  3OB1 B;  4ETO A;  2L51 A;  1TNQ A;  2BKI B;  1KK8 C;  1NX1 A;  3CTN A;  2HET A;  3HX4 A;  1F8H A;  1TNP A;  5ER5 A;  1LVC D;  2JQ6 A;  1B7T Y;  2ZN9 A;  1SKT A;  4U8D A;  2K7O A;  2ZNE A;  2M3W A;  2L2E A;  1K95 A;  1NSH A;  3D10 A;  4YGC B;  4C0L A;  4XYN A;  2I94 A;  2KYC A;  1MR8 A;  3PFV A;  3JVT B;  1GGW A;  4ORB B;  1EG4 A;  2WOS A;  3SJS A;  2JNF A;  1Q80 A;  2LAN A;  1OQP A;  2KQ6 A;  2MA2 A;  1EH2 A;  2GV5 A;  2LLS A;  1JF0 A;  1BG1 A;  2CTN A;  2F2O A;  1RJV A;  1UUS A;  1A75 A;  1V1G A;  3K21 A;  4YGD B;  1FI5 A;  2M97 A;  1DF0 A;  1K9P A;  1FI6 A;  1CDM A;  2LC5 A;  4PHK A;  3DF0 A;  1QV0 A;  1IH0 A;  5KU1 A;  3WHT B;  4CPV A;  2PAS A;  1LXF C;  1KFX S;  1PAL A;  1NP8 A;  1TRF A;  2Q91 A;  1CFP A;  2H61 A;  2OTG B;  2HQ8 A;  5CSJ A;  1AK8 A;  1J7Q A;  3NSO A;  1S6I A;  3WNX B;  2LCP A;  3PSR A;  1YR5 A;  1QTX A;  1U5I B;  3CR5 X;  1XVJ A;  2ZKM X;  1XYD A;  1H4B A;  4MZL A;  5DKQ A;  1CB1 A;  2PSR A;  1IRJ A;  1S26 D;  4PE7 A;  1F4O A;  2AUC A;  2WOR A;  3EVV A;  2COL B;  2KDH A;  2Y5I A;  4PE4 A;  1GJY A;  3O6B A;  1RRO A;  2JTZ A;  1CLL A;  5CPV A;  1S3P A;  4USL A;  1XFX O;  4XJK B;  4ZCV A;  1RFJ A;  3WXA A;  2AAO A;  1SBJ A;  2D8N A;  2LLT A;  2K7D A;  3EVU A;  1RK9 A;  1OSA A;  5HKY A;  1S6C A;  1XFV O;  2ZN8 A;  4PCW A;  5GQQ C;  2KFH A;  2F3Z A;  4MRY A;  3M0W A;  1DJX A;  1WLZ A;  1SL9 A;  1XFY O;  1PVA A;  2ZRT A;  2L98 A;  1NUB A;  1Y1A A;  1K94 A;  5CSN A;  3LK1 A;  4ORA B;  1M39 A;  4WQ2 A;  5I2Q A;  2JPT A;  1N2D A;  3MSE B;  3I5H C;  1BLQ A;  1RTP 1;  5HKZ A;  1IJ5 A;  1QX2 A;  3WHU B;  1K93 D;  5J3X A;  2L4I A;  2HF5 A;  2LVV A;  1DTL A;  1LA0 A;  2G9B A;  1GQM A;  4NDB A;  1F70 A;  4QJ4 B;  3IF7 A;  3AAK A;  1C7W A;  3TZ1 A;  1A03 A;  2LHL A;  1W7J B;  4PE0 A;  2KAX A;  4I5K A;  1QS7 A;  3VRR A;  4GGF C;  2BEC A;  2MLF C;  1H8B A;  5D69 A;  2NXQ A;  1SL8 A;  3IQQ A;  2Y1N A;  1L2O B;  4N1G A;  4DIR A;  1AJ4 A;  1BMO A;  4FQO A;  1BF5 A;  2BCB A;  2JU0 A;  2F33 A;  2O60 A;  3NSI A;  2BCX A;  3DD4 A;  4CFQ A;  2M1U A;  1Y6W A;  2K7B A;  3AKB A;  2KYF A;  5FYX A;  2JUL A;  2LUX A;  1L7Z A;  3CZT X;  2O5G A;  5PAL A;  2F3Y A;  3D0Y B;  2ZFD A;  3DVJ A;  2KBM A;  4P2Y B;  1AP4 A;  3BOW A;  1E8A A;  2LE9 B;  2CXJ A;  1IG5 A;  1IJ6 A;  2JT3 A;  3OB2 B;  2K2F A;  3BQ3 A;  2LAP A;  3BXK A;  1B7T Z;  2JOJ A;  1NX2 A;  3VRP A;  1WLM A;  3CS1 A;  1CDL A;  5G08 A;  3TDZ A;  1UHJ A;  1JF2 A;  2JXL A;  2M8U A;  2BBN A;  5JOL A;  1SNL A;  4YGE B;  2M49 B;  2BE4 A;  4OR9 B;  1IKU A;  1REC A;  4DCK A;  3HCM A;  1K9U A;  1UP5 A;  1U5I A;  4PHM A;  3CR2 A;  3SG7 A;  3BUN B;  5JJG A;  2SCP A;  2LHI A;  4UPG A;  2I18 A;  1QVI Y;  1XK4 A;  2KNE A;  2LMT A;  3NSL A;  3JVT C;  1DJY A;  4NQG A;  1BJF A;  2KFF A;  1CFF A;  3SIA A;  5HLV A;  2EGD A;  2NZ0 A;  3LCP C;  4CFR A;  2FOT A;  1XO5 A;  3EK4 A;  5ER4 X;  1CDN A;  2JT8 A;  3LL8 B;  5KSZ A;  1F54 A;  2L5X B;  4OV2 A;  1B47 A;  4XJK A;  3GOF A;  2K61 A;  1WRL A;  1JC2 A;  2EC6 B;  2LMU A;  2RGI A;  3NSK A;  1DGU A;  1F55 A;  1PVB A;  1QX7 A;  2EC6 C;  1PSR A;  3BUO B;  5CSF A;  3I5G B;  3FIA A;  2KSP A;  4MVF A;  1XFU O;  3I5G C;  1ODB A;  1X02 A;  1ZMZ A;  1S5G Z;  1KQM B;  1IGV A;  3SG5 A;  5CSI A;  1SMG A;  4YRU A;  1KQM C;  5K89 A;  1J1E A;  2KAV A;  2OTG C;  3KEV A;  4M2O A;  2OPO A;  5DKN A;  3PM8 A;  4AOM A;  5I8N A;  2BKH B;  2KI6 C;  5IBW A;  1AUI B;  1ALV A;  2HQW A;  2WCB A;  4MZJ A;  4QJ5 B;  3A4U B;  2LVJ A;  1A29 A;  1K9K A;  1QXP A;  1ZFS A;  1DJZ A;  1JWD A;  1CMF A;  5AAN A;  1Y0V H;  1DT7 B;  3FWB A;  3BUM B;  1CFC A;  1XK4 C;  3GK2 A;  4CID A;  3OHM B;  4C0J A;  4QJ3 B;  2PRU A;  1NX0 A;  3FWC A;  2LNK A;  4JPZ B;  2AMI A;  1KQV A;  2BL0 B;  1MXE A;  1QLS A;  4GGF A;  1MXL C;  3VRQ A;  2BL0 C;  2VRG A; 
#chains in the Genus database with same CATH topology
 1QIW A;  1V1F A;  1R2U A;  3TS5 C;  1JUO A;  3R1P A;  1XFW O;  2SAS A;  1FBV A;  2NCO A;  3KF9 A;  3DZT A;  3R1V A;  1JFK A;  1S6J A;  1WDC B;  2K0J A;  3V2L A;  1QAT A;  3TDU A;  1D1O A;  3SS5 A;  1WDC C;  3NXA A;  3ZWH A;  4OCI A;  1AJ5 A;  2LUC A;  5HYD A;  1TCO B;  2ISD A;  2MRD A;  3TS5 B;  3SIB A;  1GGZ A;  1TWO A;  1TOP A;  1KK7 Z;  1K2H A;  1BR4 B;  1OW4 A;  1J7O A;  3D0Y A;  4DRW A;  2WND A;  2BCA A;  3AKA A;  1ZUZ A;  3C1V A;  5FI7 A;  3SG6 A;  1OOI X;  1FF1 A;  1B1G A;  1SRA A;  3DF0 B;  1YUR A;  3BJH A;  1DJG A;  4MSP A;  1M45 A;  1NCY A;  1UHK A;  3EVR A;  4I5N B;  1SL7 A;  4YGA A;  3PAL A;  2H2K A;  4MN0 A;  3FE6 A;  2YGU A;  1QJT A;  3AAJ A;  3BUW B;  1K8U A;  1M31 A;  3EKJ A;  5I2O A;  4E68 A;  2F8P A;  3CZ1 A;  1SW8 A;  4CLN A;  1MF8 B;  2KAY A;  2M7L A;  4D1E A;  2BBM A;  1CM4 A;  1OE9 B;  1SCV A;  1LA3 A;  1TNW A;  2MJW B;  4P5O E;  4GBA A;  2TN4 A;  1DEK A;  1WRZ A;  3JTD B;  3K1E A;  3O4X A;  1B8R A;  1L2O C;  1CFD A;  1YTZ C;  1TNX A;  3EK7 A;  3JTD C;  1N0Y A;  5BPJ A;  1F71 A;  1CTR A;  1CNP A;  1P28 A;  1B4C A;  2MHH A;  4A4B A;  1YVH A;  1SCM B;  3QRX A;  4L9M A;  1UHN A;  1J7R A;  1DMO A;  3S0B A;  1EJ3 A;  3VRN A;  4PT1 A;  1NIW A;  2PAL A;  1AVS A;  3D77 A;  2WCE A;  3DYE A;  1CM1 A;  1NYA A;  2K60 A;  1UUR A;  3GK1 A;  1XA5 A;  2LM5 A;  4INW A;  1CDP A;  1J1D A;  1MQ1 A;  3KO0 A;  1MHO A;  4HRE E;  2QEB A;  2L0P A;  1DJW A;  1YUU A;  1NPQ A;  1KFX L;  2QPT A;  1UHH A;  5FI6 A;  5AEQ A;  2QAC A;  2PMY A;  1M63 B;  1PUL A;  2E30 A;  2MBX A;  2ZND A;  4ICB A;  1NWD A;  4F0Z B;  3CLN A;  2JWW A;  2KI6 D;  3A8R A;  2M0R A;  3O4Y A;  4AQI A;  3LLE A;  1YVL A;  4N1F A;  4BY5 A;  2LVK A;  1G8I A;  5D7F A;  1OMD A;  1CKK A;  3DY9 A;  3KHE A;  3CZ2 A;  4Q04 A;  1TIZ A;  3VGO A;  4HRH A;  2M29 A;  1IQ5 A;  1KK8 B;  2NCP A;  2V53 A;  3CZ0 A;  3CR4 X;  4PE1 A;  1KFU S;  1YRT B;  2QEV A;  4NDD A;  3E3R A;  4PDZ A;  3RZS A;  4N5X A;  3TDI A;  3NHT A;  1NX3 A;  5AXI A;  2JPO A;  1MUX A;  2WCF A;  3B87 A;  1NCX A;  2LP3 A;  4HRG A;  4KYN A;  2JRF A;  4F7F A;  2Y4Q A;  1RWY A;  1PSB A;  4ZCU A;  1TUZ A;  2JNX A;  4MZK A;  3R1O A;  4GPL B;  5HLO A;  2JZI A;  2CNP A;  3I5I B;  4M2Q A;  1YX8 A;  3CAB A;  1FW4 A;  4MLW A;  3B7A A;  3I5I C;  3CWG A;  1VRK A;  1SR6 B;  1EXR A;  2KLD A;  2P6B B;  1KWO B;  5AER A;  1TTX A;  1SR6 C;  2LVI A;  1KWO C;  2OS8 B;  1BU3 A;  3H4S E;  1C7V A;  1DQE A;  1EL4 A;  2LP2 A;  2OS8 C;  1G33 A;  4FTG A;  4M2P A;  3VRO A;  3ZNI A;  4YI8 A;  1SPY A;  3O2P A;  3PAT A;  3SG3 A;  1OMR A;  1G4Y R;  1K90 D;  1A2X A;  2KFG A;  1A4P A;  3KPX A;  3GK4 X;  1Z4H A;  4YBH B;  4R1E A;  1S1E A;  3BOW B;  3D75 A;  2GGM A;  2I7A A;  2KBI A;  1KSO A;  4WRI A;  5KTY A;  3FE8 A;  1HT9 A;  1SK6 D;  1XFZ O;  2K2A A;  1W7I B;  2KGR A;  4OZD A;  2M1K B;  4MEW A;  5F6T A;  1ZAC A;  4WQ3 A;  2FJU B;  2ZRS A;  1UHI A;  3I5F B;  4MBE A;  4MRX A;  1PK0 D;  1OZS A;  3EG5 B;  1PRW A;  3I5F C;  1IWQ A;  2EHB A;  2Q4U A;  4GFT A;  4PHN A;  5I2L A;  1IQ3 A;  1J55 A;  2CCM A;  1S5G Y;  1TCF A;  2M9G A;  4IL1 A;  3FS7 A;  1YX7 A;  3BFA A;  3LK0 A;  3O78 A;  3TUY B;  1OMV A;  4NDC A;  4GNK B;  1BOC A;  1JSA A;  3D73 A;  4A4C A;  3TUY C;  2WCJ A;  1Y1X A;  1YUT A;  2KHN A;  1CLB A;  2CT9 A;  2HPS A;  4YI9 A;  1YRU B;  1EG3 A;  1Y1U A;  3DVM A;  4I5L B;  4IJ7 A;  1DGV A;  1QLK A;  2E6W A;  3CGA A;  1B8C A;  4GGN A;  2DOQ A;  4OVN F;  1N65 A;  1ZOT B;  2IS9 A;  2Y1M A;  5FI2 A;  4GUK A;  2B1U A;  1CMG A;  1QV1 A;  1A75 B;  1QWV A;  1DVI A;  1K96 A;  3UO9 A;  4GAO A;  1DF0 B;  3DVE A;  2PVB A;  2P71 A;  1C07 A;  4I5J A;  4AQJ A;  2H8V A;  1F4Q A;  3EK8 A;  3OX5 A;  3FE9 A;  3SG2 A;  1BOD A;  2KGB C;  1QIV A;  1QAS A;  1QX5 B;  3F45 A;  4TNC A;  1HQV A;  2L4H A;  3D76 A;  1JFJ A;  4C0K A;  2H61 C;  1WRK A;  1S36 A;  2KI4 B;  2KQY A;  4ORC B;  1J7P A;  2L50 A;  2FCD A;  2KI4 C;  2GGZ A;  3Q8I A;  4JWQ A;  2I2R E;  1ALW A;  1TN4 A;  2WC6 A;  4PAL A;  1KK7 Y;  2LMV A;  3BUX B;  2L5Y A;  3I5H B;  4JQ0 D;  2KOT A;  3RLZ A;  2K8M B;  1SY9 A;  2M7N A;  1ORG A;  3BYA A;  2JXC A;  3NHI A;  2F2P A;  3PLF B;  1B9A A;  1KFU L;  2ERB A;  2MLE C;  3IQO A;  5DIC A;  2LV7 A;  1SCM C;  1B8L A;  2LLU A;  3EKH A;  1BR1 B;  1BT6 A;  3OX6 A;  3SG4 A;  1KSM A;  1R6P A;  5TNC A;  3S0D A;  3OP0 A;  1WY9 A;  2CBL A;  1KCY A;  1OZO A;  2K7C A;  2FCE A;  4PHJ A;  1FPW A;  2JTT A;  2A4J A;  2BE6 A;  4DS7 A;  2MAZ A;  2PYQ A;  4YGB B;  2WCM A;  5DKR A;  1SYM A;  1DJI A;  1LKJ A;  4HSZ A;  2WC8 A;  1OOG A;  2R2I A;  5B8I B;  1LIN A;  3ICB A;  2NLN A;  3PN7 B;  1M46 A;  1OOH A;  1MWN A;  3DVK A;  1NCZ A;  1QVI Z;  3PN7 C;  3R72 A;  3RM1 A;  2JT0 A;  3PM2 A;  1OOJ A;  2JC2 A;  1YUS A;  4BY4 A;  1AHR A;  4OKH A;  1DJH A;  1UWO A;  2G2B A;  1CLM A;  5HKW A;  5AFP A;  3OB1 B;  4JD9 A;  4ETO A;  2L51 A;  1TNQ A;  2BKI B;  1KK8 C;  1NX1 A;  3CTN A;  2HET A;  3HX4 A;  1C3Y A;  1F8H A;  1TNP A;  5ER5 A;  1LVC D;  2JQ6 A;  1B7T Y;  2ZN9 A;  3L47 A;  1SKT A;  4U8D A;  2K7O A;  2ZNE A;  2M3W A;  2L2E A;  1K95 A;  1NSH A;  3D10 A;  4YGC B;  1DEL A;  4C0L A;  4XYN A;  2I94 A;  2PQL A;  2KYC A;  1MR8 A;  3PFV A;  3JVT B;  1GGW A;  2QEO A;  3VB1 A;  4ORB B;  1EG4 A;  2WOS A;  3SJS A;  2JNF A;  1Q80 A;  2LAN A;  1OQP A;  2KQ6 A;  2MA2 A;  1EH2 A;  2GV5 A;  2QEH A;  2LLS A;  1JF0 A;  3S0F A;  1BG1 A;  2CTN A;  2F2O A;  1RJV A;  1UUS A;  1A75 A;  1V1G A;  3K21 A;  4YGD B;  1FI5 A;  2M97 A;  1DF0 A;  1K9P A;  1FI6 A;  1CDM A;  2LC5 A;  4PHK A;  3DF0 A;  1QV0 A;  3B86 A;  1IH0 A;  5KU1 A;  3WHT B;  4CPV A;  2PAS A;  1LXF C;  1KFX S;  1PAL A;  1NP8 A;  1TRF A;  2Q91 A;  1CFP A;  2H61 A;  2OTG B;  2HQ8 A;  5CSJ A;  1AK8 A;  1J7Q A;  3NSO A;  1Z2C B;  1S6I A;  3WNX B;  2LCP A;  3PSR A;  1YR5 A;  1QTX A;  1U5I B;  3CR5 X;  1XVJ A;  2ZKM X;  1XYD A;  3NGV A;  3B88 A;  1H4B A;  4MZL A;  5DKQ A;  1CB1 A;  3BFH A;  2PSR A;  1IRJ A;  1S26 D;  5EL2 A;  4PE7 A;  1F4O A;  2AUC A;  2WOR A;  3EVV A;  2COL B;  2KDH A;  2Y5I A;  4PE4 A;  1GJY A;  3O6B A;  1RRO A;  2JTZ A;  1CLL A;  5CPV A;  1S3P A;  4USL A;  1XFX O;  4XJK B;  4ZCV A;  1RFJ A;  3WXA A;  2AAO A;  1SBJ A;  2D8N A;  2LLT A;  2K7D A;  1T14 A;  3EVU A;  1RK9 A;  2QDI A;  1OSA A;  5HKY A;  1S6C A;  1XFV O;  2WCH A;  2ZN8 A;  4PCW A;  5GQQ C;  2KFH A;  2F3Z A;  4MRY A;  3SS4 A;  1JBA A;  3M0W A;  4INX A;  1DJX A;  1WLZ A;  1SL9 A;  1XFY O;  1PVA A;  2ZRT A;  2L98 A;  1NUB A;  1Y1A A;  1K94 A;  3N7H A;  1XFR A;  5CSN A;  3LK1 A;  1TUJ A;  4ORA B;  1M39 A;  4WQ2 A;  3D74 A;  5I2Q A;  2JPT A;  1N2D A;  3MSE B;  3I5H C;  1BLQ A;  1RTP 1;  5HKZ A;  1IJ5 A;  3B6X A;  1QX2 A;  1W9Z A;  3IVT A;  3WHU B;  1K93 D;  3L4L A;  2L4I A;  5J3X A;  3BFB A;  2HF5 A;  2LVV A;  1DTL A;  1LA0 A;  2G9B A;  1GQM A;  4NDB A;  1F70 A;  4QJ4 B;  3IF7 A;  3AAK A;  1C7W A;  3TZ1 A;  1A03 A;  2KPH A;  1W7J B;  2LHL A;  2L2C A;  4PE0 A;  2KAX A;  3PJI A;  1QS7 A;  4I5K A;  4GGF C;  2BEC A;  2MLF C;  4FQT A;  3VRR A;  2P70 A;  5HL1 A;  1H8B A;  5D69 A;  2NXQ A;  1SL8 A;  3IQQ A;  2Y1N A;  1L2O B;  4N1G A;  4DIR A;  1AJ4 A;  1BMO A;  4FQO A;  1BF5 A;  3S0A A;  2BCB A;  2JU0 A;  2F33 A;  2O60 A;  3NSI A;  2BCX A;  3DD4 A;  4CFQ A;  2M1U A;  1Y6W A;  2K7B A;  3AKB A;  2KYF A;  5FYX A;  2JUL A;  2LUX A;  1L7Z A;  3CZT X;  2O5G A;  5PAL A;  2F3Y A;  3D0Y B;  2ZFD A;  3DVJ A;  2KBM A;  4P2Y B;  1AP4 A;  3BOW A;  1OOF A;  1E8A A;  3UNW A;  2LE9 B;  2CXJ A;  1IG5 A;  1IJ6 A;  2JT3 A;  3OB2 B;  2K2F A;  3BQ3 A;  2LAP A;  3BXK A;  2WCL A;  1B7T Z;  2JOJ A;  1NX2 A;  3VRP A;  1WLM A;  3CS1 A;  1CDL A;  3OBV A;  5G08 A;  3TDZ A;  1UHJ A;  1JF2 A;  3DXL A;  2JXL A;  2M8U A;  1C3Z A;  2BBN A;  3L4A A;  5JOL A;  1SNL A;  4YGE B;  2M49 B;  2BE4 A;  4OR9 B;  1IKU A;  3S0G A;  1REC A;  4DCK A;  3SS3 A;  3HCM A;  1K9U A;  1UP5 A;  1U5I A;  4PHM A;  4DUQ A;  3CR2 A;  3SG7 A;  3CYZ A;  3BUN B;  5JJG A;  2SCP A;  2LHI A;  4UPG A;  2I18 A;  1QVI Y;  1XK4 A;  2BAP A;  2KNE A;  3QME A;  2LMT A;  1SSE B;  3JVT C;  1DJY A;  3NSL A;  1BJF A;  2KFF A;  4NQG A;  3SIA A;  1CFF A;  3S0E A;  5HLV A;  2EGD A;  2NZ0 A;  3LCP C;  4CFR A;  2FOT A;  1XO5 A;  3EK4 A;  5ER4 X;  1CDN A;  2JT8 A;  5D3O A;  3LL8 B;  5KSZ A;  1F54 A;  2L5X B;  4OV2 A;  1B47 A;  4XJK A;  3GOF A;  2K61 A;  1WRL A;  1LS8 A;  1JC2 A;  2EC6 B;  5I94 A;  2LMU A;  2RGI A;  3NSK A;  1DGU A;  1F55 A;  1PVB A;  1QX7 A;  2EC6 C;  1PSR A;  3BUO B;  5CSF A;  3I5G B;  3FIA A;  2KSP A;  4MVF A;  1XFU O;  3I5G C;  1ODB A;  1X02 A;  1ZMZ A;  1S5G Z;  1KQM B;  1IGV A;  2FJY A;  5CSI A;  2WCK A;  1SMG A;  3SG5 A;  4YRU A;  1KQM C;  5K89 A;  1J1E A;  2KAV A;  2OTG C;  3KEV A;  4M2O A;  2OPO A;  5DKN A;  3PM8 A;  4AOM A;  5I8N A;  2BKH B;  3OGN A;  2KI6 C;  5IBW A;  1AUI B;  2GTE A;  3CDN A;  1ALV A;  2HQW A;  2WCB A;  4MZJ A;  4QJ5 B;  3A4U B;  2LVJ A;  1A29 A;  1K9K A;  1QXP A;  1ZFS A;  1DJZ A;  1JWD A;  1CMF A;  5AAN A;  1Y0V H;  3D78 A;  1DC1 A;  1DT7 B;  2WC5 A;  3BUM B;  3FWB A;  1XK4 C;  2KLE A;  1CFC A;  3GK2 A;  4JKT A;  1GM0 A;  4CID A;  3OHM B;  4C0J A;  4QJ3 B;  2PRU A;  1IIO A;  1NX0 A;  2BNX A;  3FWC A;  2LNK A;  4JPZ B;  2AMI A;  1KQV A;  2BL0 B;  1MXE A;  1QLS A;  4GGF A;  1MXL C;  3VRQ A;  2BL0 C;  2VRG A; 
#chains in the Genus database with same CATH homology
 1QIW A;  1V1F A;  1R2U A;  3TS5 C;  1JUO A;  1XFW O;  2SAS A;  1FBV A;  2NCO A;  3KF9 A;  1JFK A;  1S6J A;  1WDC B;  2K0J A;  1QAT A;  3TDU A;  1D1O A;  1WDC C;  3NXA A;  3ZWH A;  4OCI A;  1AJ5 A;  2LUC A;  5HYD A;  1TCO B;  2ISD A;  2MRD A;  3TS5 B;  3SIB A;  1GGZ A;  1TOP A;  1KK7 Z;  1K2H A;  1BR4 B;  1J7O A;  3D0Y A;  4DRW A;  2WND A;  2BCA A;  3AKA A;  1ZUZ A;  3C1V A;  3SG6 A;  1FF1 A;  1B1G A;  1SRA A;  3DF0 B;  1YUR A;  1DJG A;  4MSP A;  1M45 A;  1NCY A;  1UHK A;  3EVR A;  4I5N B;  1SL7 A;  4YGA A;  3PAL A;  2H2K A;  4MN0 A;  1QJT A;  3AAJ A;  3BUW B;  1K8U A;  1M31 A;  3EKJ A;  5I2O A;  4E68 A;  2F8P A;  1SW8 A;  4CLN A;  1MF8 B;  2KAY A;  2M7L A;  4D1E A;  2BBM A;  1CM4 A;  1OE9 B;  1SCV A;  1LA3 A;  1TNW A;  2MJW B;  4P5O E;  4GBA A;  2TN4 A;  3JTD B;  1WRZ A;  1B8R A;  1L2O C;  1CFD A;  1TNX A;  1YTZ C;  3EK7 A;  3JTD C;  1N0Y A;  5BPJ A;  1F71 A;  1CTR A;  1CNP A;  1B4C A;  2MHH A;  4A4B A;  1YVH A;  1SCM B;  3QRX A;  4L9M A;  1UHN A;  1J7R A;  1DMO A;  1EJ3 A;  3VRN A;  1NIW A;  2PAL A;  1AVS A;  2WCE A;  1CM1 A;  1NYA A;  1UUR A;  3GK1 A;  1XA5 A;  2LM5 A;  1CDP A;  1J1D A;  1MQ1 A;  3KO0 A;  1MHO A;  4HRE E;  2L0P A;  1DJW A;  1YUU A;  1NPQ A;  1KFX L;  2QPT A;  1UHH A;  5AEQ A;  2QAC A;  2PMY A;  1M63 B;  1PUL A;  2E30 A;  2MBX A;  2ZND A;  4ICB A;  1NWD A;  4F0Z B;  3CLN A;  2JWW A;  2KI6 D;  3A8R A;  2M0R A;  3O4Y A;  4AQI A;  3LLE A;  1YVL A;  4N1F A;  4BY5 A;  2LVK A;  1G8I A;  5D7F A;  1OMD A;  1CKK A;  3KHE A;  4Q04 A;  3VGO A;  1TIZ A;  4HRH A;  2M29 A;  1IQ5 A;  1KK8 B;  2NCP A;  2V53 A;  3CR4 X;  4PE1 A;  1KFU S;  1YRT B;  4NDD A;  3E3R A;  4PDZ A;  4N5X A;  3TDI A;  1NX3 A;  5AXI A;  4DUQ A;  1MUX A;  2WCF A;  4HRG A;  1NCX A;  2LP3 A;  1JBA A;  2JRF A;  2Y4Q A;  1RWY A;  1PSB A;  4ZCU A;  2JNX A;  4MZK A;  4GPL B;  5HLO A;  2JZI A;  2CNP A;  3I5I B;  4M2Q A;  1YX8 A;  4MLW A;  1FW4 A;  3I5I C;  3CWG A;  1VRK A;  1SR6 B;  1EXR A;  2P6B B;  1KWO B;  5AER A;  1TTX A;  1SR6 C;  2LVI A;  1KWO C;  2OS8 B;  1BU3 A;  3H4S E;  1C7V A;  1EL4 A;  2LP2 A;  2OS8 C;  1G33 A;  4FTG A;  4M2P A;  3VRO A;  3ZNI A;  4YI8 A;  1SPY A;  3O2P A;  3PAT A;  3SG3 A;  1OMR A;  1G4Y R;  1K90 D;  1A2X A;  2KFG A;  1A4P A;  3KPX A;  3GK4 X;  4YBH B;  4R1E A;  1S1E A;  3BOW B;  2GGM A;  2I7A A;  2KBI A;  1KSO A;  4WRI A;  5KTY A;  1HT9 A;  1SK6 D;  1XFZ O;  2K2A A;  1W7I B;  2KGR A;  2M1K B;  4MEW A;  5F6T A;  1ZAC A;  4WQ3 A;  2FJU B;  2ZRS A;  1UHI A;  3I5F B;  4MBE A;  4MRX A;  1PK0 D;  1OZS A;  1PRW A;  3I5F C;  1IWQ A;  2EHB A;  2Q4U A;  4GFT A;  4PHN A;  5I2L A;  1IQ3 A;  1J55 A;  2CCM A;  1S5G Y;  1TCF A;  2M9G A;  4IL1 A;  3FS7 A;  1YX7 A;  3LK0 A;  3O78 A;  3TUY B;  1OMV A;  4NDC A;  4GNK B;  1BOC A;  1JSA A;  4A4C A;  3TUY C;  1Y1X A;  1YUT A;  2KHN A;  1CLB A;  2CT9 A;  2HPS A;  4YI9 A;  1YRU B;  1EG3 A;  1Y1U A;  3DVM A;  4I5L B;  1DGV A;  1QLK A;  2E6W A;  3CGA A;  1B8C A;  4GGN A;  2DOQ A;  4OVN F;  1N65 A;  1ZOT B;  2IS9 A;  2Y1M A;  4GUK A;  2B1U A;  1CMG A;  1QV1 A;  1A75 B;  1DVI A;  1K96 A;  4GAO A;  1DF0 B;  3DVE A;  2PVB A;  1C07 A;  4I5J A;  4AQJ A;  1F4Q A;  3EK8 A;  3OX5 A;  3SG2 A;  1BOD A;  2KGB C;  1QIV A;  1QAS A;  1QX5 B;  3F45 A;  4TNC A;  1HQV A;  2L4H A;  1JFJ A;  4C0K A;  2H61 C;  1WRK A;  1S36 A;  2KI4 B;  2KQY A;  4ORC B;  1J7P A;  2L50 A;  2FCD A;  2KI4 C;  2GGZ A;  4JWQ A;  2I2R E;  1ALW A;  1TN4 A;  4PAL A;  1KK7 Y;  2LMV A;  3BUX B;  3I5H B;  4JQ0 D;  2KOT A;  3RLZ A;  2K8M B;  1SY9 A;  2M7N A;  3BYA A;  2JXC A;  2F2P A;  3PLF B;  1B9A A;  1KFU L;  2MLE C;  3IQO A;  2LV7 A;  1SCM C;  1B8L A;  2LLU A;  3EKH A;  1BR1 B;  1BT6 A;  3OX6 A;  3SG4 A;  1KSM A;  1R6P A;  5TNC A;  3OP0 A;  1WY9 A;  2CBL A;  1KCY A;  1OZO A;  2K7C A;  2FCE A;  4PHJ A;  1FPW A;  2JTT A;  2A4J A;  2BE6 A;  4DS7 A;  2MAZ A;  4YGB B;  5DKR A;  1SYM A;  1DJI A;  1LKJ A;  4HSZ A;  2WC8 A;  2R2I A;  5B8I B;  1LIN A;  3ICB A;  2NLN A;  3PN7 B;  1M46 A;  3DVK A;  1MWN A;  3PN7 C;  1NCZ A;  1QVI Z;  3RM1 A;  2JT0 A;  1OOJ A;  2JC2 A;  1YUS A;  4BY4 A;  1AHR A;  4OKH A;  1DJH A;  1UWO A;  2G2B A;  1CLM A;  5HKW A;  5AFP A;  3OB1 B;  4ETO A;  2L51 A;  1TNQ A;  2BKI B;  1KK8 C;  1NX1 A;  3CTN A;  2HET A;  3HX4 A;  1F8H A;  1TNP A;  5ER5 A;  1LVC D;  2JQ6 A;  1B7T Y;  2ZN9 A;  1SKT A;  4U8D A;  2K7O A;  2ZNE A;  2M3W A;  2L2E A;  1K95 A;  1NSH A;  3D10 A;  4YGC B;  4C0L A;  4XYN A;  2I94 A;  2KYC A;  1MR8 A;  3PFV A;  3JVT B;  1GGW A;  4ORB B;  1EG4 A;  2WOS A;  3SJS A;  2JNF A;  1Q80 A;  2LAN A;  1OQP A;  2KQ6 A;  2MA2 A;  1EH2 A;  2GV5 A;  2LLS A;  1JF0 A;  1BG1 A;  2CTN A;  2F2O A;  1RJV A;  1UUS A;  1A75 A;  1V1G A;  3K21 A;  4YGD B;  1FI5 A;  2M97 A;  1DF0 A;  1K9P A;  1FI6 A;  1CDM A;  2LC5 A;  4PHK A;  3DF0 A;  1QV0 A;  1IH0 A;  5KU1 A;  3WHT B;  4CPV A;  2PAS A;  1LXF C;  1KFX S;  1PAL A;  1NP8 A;  1TRF A;  2Q91 A;  1CFP A;  2H61 A;  2OTG B;  2HQ8 A;  5CSJ A;  1AK8 A;  1J7Q A;  3NSO A;  1S6I A;  3WNX B;  2LCP A;  3PSR A;  1YR5 A;  1QTX A;  1U5I B;  3CR5 X;  1XVJ A;  2ZKM X;  1XYD A;  1H4B A;  4MZL A;  5DKQ A;  1CB1 A;  2PSR A;  1IRJ A;  1S26 D;  4PE7 A;  1F4O A;  2AUC A;  2WOR A;  3EVV A;  2COL B;  2KDH A;  2Y5I A;  4PE4 A;  1GJY A;  3O6B A;  1RRO A;  2JTZ A;  1CLL A;  5CPV A;  1S3P A;  4USL A;  1XFX O;  4XJK B;  4ZCV A;  1RFJ A;  3WXA A;  2AAO A;  1SBJ A;  2D8N A;  2LLT A;  2K7D A;  3EVU A;  1RK9 A;  1OSA A;  5HKY A;  1S6C A;  1XFV O;  2ZN8 A;  4PCW A;  5GQQ C;  2KFH A;  2F3Z A;  4MRY A;  3M0W A;  1DJX A;  1WLZ A;  1SL9 A;  1XFY O;  1PVA A;  2ZRT A;  2L98 A;  1NUB A;  1Y1A A;  1K94 A;  5CSN A;  3LK1 A;  4ORA B;  1M39 A;  4WQ2 A;  5I2Q A;  2JPT A;  1N2D A;  3MSE B;  3I5H C;  1BLQ A;  1RTP 1;  5HKZ A;  1IJ5 A;  1QX2 A;  3WHU B;  1K93 D;  5J3X A;  2L4I A;  2HF5 A;  2LVV A;  1DTL A;  1LA0 A;  2G9B A;  1GQM A;  4NDB A;  1F70 A;  4QJ4 B;  3IF7 A;  3AAK A;  1C7W A;  3TZ1 A;  1A03 A;  2LHL A;  1W7J B;  4PE0 A;  2KAX A;  4I5K A;  1QS7 A;  3VRR A;  4GGF C;  2BEC A;  2MLF C;  1H8B A;  5D69 A;  2NXQ A;  1SL8 A;  3IQQ A;  2Y1N A;  1L2O B;  4N1G A;  4DIR A;  1AJ4 A;  1BMO A;  4FQO A;  1BF5 A;  2BCB A;  2JU0 A;  2F33 A;  2O60 A;  3NSI A;  2BCX A;  3DD4 A;  4CFQ A;  2M1U A;  1Y6W A;  2K7B A;  3AKB A;  2KYF A;  5FYX A;  2JUL A;  2LUX A;  1L7Z A;  3CZT X;  2O5G A;  5PAL A;  2F3Y A;  3D0Y B;  2ZFD A;  3DVJ A;  2KBM A;  4P2Y B;  1AP4 A;  3BOW A;  1E8A A;  2LE9 B;  2CXJ A;  1IG5 A;  1IJ6 A;  2JT3 A;  3OB2 B;  2K2F A;  3BQ3 A;  2LAP A;  3BXK A;  1B7T Z;  2JOJ A;  1NX2 A;  3VRP A;  1WLM A;  3CS1 A;  1CDL A;  5G08 A;  3TDZ A;  1UHJ A;  1JF2 A;  2JXL A;  2M8U A;  2BBN A;  5JOL A;  1SNL A;  4YGE B;  2M49 B;  2BE4 A;  4OR9 B;  1IKU A;  1REC A;  4DCK A;  3HCM A;  1K9U A;  1UP5 A;  1U5I A;  4PHM A;  3CR2 A;  3SG7 A;  3BUN B;  5JJG A;  2SCP A;  2LHI A;  4UPG A;  2I18 A;  1QVI Y;  1XK4 A;  2KNE A;  2LMT A;  3NSL A;  3JVT C;  1DJY A;  4NQG A;  1BJF A;  2KFF A;  1CFF A;  3SIA A;  5HLV A;  2EGD A;  2NZ0 A;  3LCP C;  4CFR A;  2FOT A;  1XO5 A;  3EK4 A;  5ER4 X;  1CDN A;  2JT8 A;  3LL8 B;  5KSZ A;  1F54 A;  2L5X B;  4OV2 A;  1B47 A;  4XJK A;  3GOF A;  2K61 A;  1WRL A;  1JC2 A;  2EC6 B;  2LMU A;  2RGI A;  3NSK A;  1DGU A;  1F55 A;  1PVB A;  1QX7 A;  2EC6 C;  1PSR A;  3BUO B;  5CSF A;  3I5G B;  3FIA A;  2KSP A;  4MVF A;  1XFU O;  3I5G C;  1ODB A;  1X02 A;  1ZMZ A;  1S5G Z;  1KQM B;  1IGV A;  3SG5 A;  5CSI A;  1SMG A;  4YRU A;  1KQM C;  5K89 A;  1J1E A;  2KAV A;  2OTG C;  3KEV A;  4M2O A;  2OPO A;  5DKN A;  3PM8 A;  4AOM A;  5I8N A;  2BKH B;  2KI6 C;  5IBW A;  1AUI B;  1ALV A;  2HQW A;  2WCB A;  4MZJ A;  4QJ5 B;  3A4U B;  2LVJ A;  1A29 A;  1K9K A;  1QXP A;  1ZFS A;  1DJZ A;  1JWD A;  1CMF A;  5AAN A;  1Y0V H;  1DT7 B;  3FWB A;  3BUM B;  1CFC A;  1XK4 C;  3GK2 A;  4CID A;  3OHM B;  4C0J A;  4QJ3 B;  2PRU A;  1NX0 A;  3FWC A;  2LNK A;  4JPZ B;  2AMI A;  1KQV A;  2BL0 B;  1MXE A;  1QLS A;  4GGF A;  1MXL C;  3VRQ A;  2BL0 C;  2VRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...