4HRHA

Crystal structure of p11-annexin a2(n-terminal) fusion protein in complex with smarca3 peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
107
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQGDSTVHEILSKLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords Protein S100-A10, Annexin A2
publication title SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 107
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4hrhA00
4CIDA 1S6CA 2RGIA 1W7JB 2MAZA 2JRFA 2K7DA 4YGEB 2LLTA 2MLFC 3SG2A 3OX5A 2LMVA 4ETOA 2LV7A 1XO5A 2BCBA 2OTGC 4I5JA 5HKYA 2CBLA 3D0YB 2HQWA 2EGDA 2WCBA 3CWGA 2MA2A 1SCVA 3BXKA 3NSLA 4MBEA 3EK4A 3EK8A 5DKQA 1RECA 3D10A 4ORAB 3OHMB 4JWQA 1UUSA 3BUXB 3BUMB 3JVTB 1RROA 1XFZO 3D0YA 1DJIA 1UHNA 2JXLA 3LL8B 2L51A 3SG3A 2NXQA 2F33A 3WXAA 1AJ5A 3AAJA 4FQOA 5CSFA 1CFDA 1SW8A 1OOJA 2M3WA 1GQMA 3BYAA 1U5IB 2M8UA 2Q91A 1BF5A 4OKHA 4C0JA 1YURA 1KK8B 4UPGA 2LC5A 4TNCA 2KSPA 1OE9B 3OB2B 5HLVA 2MHHA 5I2LA 1U5IA 4PALA 1SYMA 2Y1NA 3K21A 1KQVA 1A03A 4C0KA 2LUCA 4F0ZB 3NSIA 3CTNA 5PALA 2LLSA 2NCPA 1IG5A 5IBWA 2AUCA 1HT9A 1JC2A 3KO0A 4MZKA 4NDBA 1TNQA 4PDZA 5I8NA 2ZN8A 2OS8C 2KQYA 2PVBA 4MZJA 1EJ3A 1B4CA 3ZNIA 2CT9A 1NWDA 1SPYA 1J1EA 4PHJA 1KCYA 4MEWA 3PN7C 2Y1MA 5AEQA 5CSIA 2K2FA 1PVBA 4YGCB 4AQJA 2I18A 2Y4QA 4QJ4B 1K9PA 4M2QA 2LNKA 1SY9A 1QVIY 2BBNA 2BKHB 2KAVA 3O78A 4USLA 4ZCUA 2F3YA 1D1OA 1YUUA 1G8IA 1OQPA 3H4SE 2Q4UA 2EC6B 1SK6D 5ER5A 1TNPA 1MWNA 1CKKA 2JNXA 1CLMA 3VGOA 1NYAA 4NDCA 2FJUB 3LK0A 4DIRA 2KBIA 4FTGA 1DJXA 4I5KA 1IKUA 1QLSA 1G33A 4N5XA 1M63B 1CLBA 1UP5A 2BL0C 4MSPA 1F55A 1JFKA 1G4YR 1A2XA 3SJSA 2ZFDA 2L5XB 1C7VA 3BUWB 4AQIA 3EKHA 4N1FA 1CFCA 1RFJA 2FCEA 4MRXA 3WHTB 1DJZA 2PALA 1QATA 1S1EA 2BCXA 1OSAA 2DOQA 1H8BA 1TN4A 1F70A 1FBVA 3CZTX 4ORBB 2M0RA 3PFVA 2LVJA 4PE1A 1QXPA 1XFVO 4DRWA 3BQ3A 2BKIB 1Y1XA 1EXRA 2KYCA 3JVTC 3VRPA 1XVJA 4PCWA 1AVSA 1WLZA 2V53A 1F4QA 1JFJA 3PATA 1K9UA 3VRRA 1IH0A 3CS1A 5F6TA 3SG4A 2K61A 1B7TY 1LVCD 2WORA 2M7LA 1KK8C 4GPLB 2K7CA 4OR9B 1NUBA 2HETA 2K8MB 1DF0B 1NX2A 4WQ2A 3ZWHA 1DMOA 2JXCA 2L50A 3SG7A 2MLEC 1F4OA 1CB1A 4P5OE 3E3RA 4PHKA 5AANA 2P6BB 2KAYA 1FW4A 1KK7Y 2QACA 4JPZB 1FI5A 4C0LA 5HKZA 1QVIZ 3A8RA 3O4YA 1RTP1 1SRAA 1BU3A 1DF0A 1KFXS 3EK7A 2B1UA 3GK4X 1J7OA 1IJ6A 3RM1A 4DUQA 1N65A 3SIBA 2GGMA 3FS7A 2NZ0A 3TZ1A 1BOCA 2L2EA 1NX3A 1OMDA 1F71A 2ZNDA 4YI9A 2MBXA 4YRUA 1QV0A 2K7BA 1CDNA 3SG5A 1KSMA 1S5GY 1EG4A 2WOSA 3HX4A 4DS7A 1NIWA 2IS9A 5BPJA 2O60A 1SL9A 2LHLA 3DVKA 4R1EA 4OCIA 1MUXA 5B8IB 1B1GA 1UWOA 4L9MA 2AMIA 2CCMA 2EC6C 2K0JA 4NQGA 1EG3A 1SR6B 4CFQA 4GNKB 3VROA 1CM4A 2KFGA 2G2BA 2COLB 2NCOA 1WDCB 1OMVA 2WCEA 1YR5A 3TS5C 1YRTB 4AOMA 1M31A 3WHUB 4GGFA 1BR1B 2KFHA 2ZN9A 2KDHA 2LAPA 3EVVA 3TDIA 1LA3A 1GGWA 1UHHA 2A4JA 3PM8A 3VRQA 3M0WA 4Q04A 1CMGA 4OV2A 3DD4A 1M39A 1XFWO 2JU0A 1J7RA 1F8HA 1B7TZ 4M2OA 2M49B 2I94A 3TUYC 3IQOA 1B8LA 2GV5A 2K2AA 2CNPA 2JT3A 2JWWA 2SCPA 1TNXA 1CNPA 1MF8B 1NCXA 4XYNA 2VRGA 1SL8A 1CTRA 1QX7A 1BLQA 4JQ0D 1ZMZA 2PSRA 2MJWB 1KK7Z 2KBMA 3NSOA 2LE9B 3GOFA 5I2QA 1ALWA 1ZUZA 3EVUA 4PHNA 1IQ3A 1YUSA 2JT8A 1DJYA 1PSRA 1BT6A 1TCOB 1AJ4A 3TS5B 1QX5B 3KEVA 4MLWA 1LXFC 3CR5X 1R2UA 1IWQA 3CR2A 3KF9A 1DGVA 1Y6WA 1CLLA 4MVFA 1WRLA 1Y0VH 4OVNF 2BCAA 2KI4C 1QTXA 4MRYA 1E8AA 3PLFB 5JJGA 2JQ6A 4ORCB 3QRXA 4XJKB 1CMFA 4HRHA 3O2PA 1ZACA 4M2PA 2JTZA 2H61A 2LVVA 4BY5A 1NSHA 2LLUA 1S5GZ 3TUYB 4PHMA 1A4PA 2KFFA 4WRIA 5G08A 1JF2A 2G9BA 2KI6C 4HRGA 1BMOA 2HPSA 2M97A 2H2KA 2OPOA 4XJKA 5D69A 5D7FA 3I5FB 1WRKA 2L4HA 1J1DA 2F2PA 1DT7B 4U8DA 3CLNA 1S6IA 1JBAA 1K96A 2M7NA 2BE4A 2WNDA 1XFXO 3SIAA 1DVIA 2EHBA 4N1GA 4NDDA 2JT0A 2M1KB 2PMYA 1B47A 5CSNA 1TTXA 1M45A 2F3ZA 2O5GA 1V1GA 1SBJA 1ODBA 4PE4A 2LMUA 5K89A 2L4IA 2ZRTA 1N2DA 1L2OB 5KSZA 2WC8A 2ZRSA 2KI4B 1CFFA 4YGAA 1KFUS 1BR4B 1N0YA 3BUOB 2I2RE 3DF0B 1QS7A 4GUKA 3I5HB 1PALA 5DKRA 4YBHB 2JC2A 1SR6C 4GGFC 3CR4X 1TCFA 1MQ1A 3KHEA 3I5GB 1WDCC 1A29A 5AFPA 2TN4A 2LMTA 2KOTA 1QIVA 2BE6A 1S36A 1ZOTB 3DF0A 3GK1A 4I5NB 1S3PA 2Y5IA 2JOJA 2KQ6A 1XK4C 1LKJA 1X02A 2SASA 2CXJA 5CSJA 2M9GA 2MRDA 1DJWA 1MXLC 1Q80A 4HSZA 1B8CA 2LCPA 1ALVA 1XFUO 4PE7A 3I5IB 4WQ3A 3AAKA 4A4BA 2BECA 1OZOA 3ICBA 3DVEA 1CM1A 1C07A 1YUTA 1DJGA 3IF7A 1B8RA 1RWYA 1KSOA 3VRNA 1JF0A 1DGUA 2JULA 1K94A 2LANA 1OMRA 4GFTA 1H4BA 2WCFA 4CLNA 1LA0A 2LVIA 1SCMB 2GGZA 3C1VA 1Y1UA 1YX7A 1QJTA 3IQQA 1QX2A 1LINA 1WRZA 1PULA 4HREE 3FIAA 1S6JA 1QV1A 2F2OA 3RLZA 2HF5A 1TIZA 5FYXA 2H61C 1R6PA 2JZIA 2ZNEA 5ER4X 3A4UB 1GGZA 1KWOC 1MR8A 1PSBA 5KU1A 1C7WA 4QJ5B 2R2IA 3OB1B 1AP4A 3LLEA 1KQMB 3DVJA 3WNXB 1K2HA 1CDLA 1XFYO 1YVHA 1XYDA 1W7IB 3KPXA 4YGDB 1JWDA 1UURA 4CPVA 1QASA 1B9AA 2E6WA 5TNCA 1SL7A 1JUOA 3OP0A 1QIWA 1XK4A 2FOTA 3LK1A 1XA5A 2OTGB 1MHOA 2JNFA 1NP8A 4GGNA 2L98A 2BBMA 3FWCA 1IJ5A 3SG6A 3I5FC 1CDPA 5KTYA 3F45A 4QJ3B 3PALA 4MN0A 1FF1A 4GBAA 2LHIA 4DCKA 2LP2A 2QPTA 1VRKA 2M29A 1EH2A 1M46A 2ZKMX 1K9KA 2LP3A 1HQVA 1A75B 1OZSA 1K8UA 1SMGA 3BOWB 4YI8A 5HLOA 1UHKA 1UHJA 1EL4A 5CPVA 1QLKA 1L2OC 1KWOB 1RK9A 1F54A 5HYDA 2PRUA 1AK8A 1A75A 2JPTA 1J7QA 1RJVA 1WLMA 1ZFSA 2KYFA 3CGAA 3JTDC 1IQ5A 2KAXA 3BOWA 3I5HC 1FI6A 3AKBA 1UHIA 1BJFA 2KI6D 2F8PA 2AAOA 2K7OA 1DTLA 3I5GC 3NSKA 1KFUL 2CTNA 3FWBA 2E30A 2PASA 5JOLA 5HKWA 1YX8A 1BODA 1PVAA 1S26D 2JTTA 4GAOA 4D1EA 2KGRA 1BG1A 1J55A 5AERA 1J7PA 1V1FA 2M1UA 1KFXL 2OS8B 1NX1A 5DKNA 4ICBA 2L0PA 3TDZA 3I5IC 1Y1AA 3LCPC 1TRFA 3HCMA 4ZCVA 1AHRA 2LVKA 3PN7B 1NCYA 1SNLA 4MZLA 2KNEA 4IL1A 2HQ8A 3EKJA 3MSEB 3GK2A 5J3XA 1GJYA 3EVRA 2LM5A 4E68A 5AXIA 1TNWA 1JSAA 1AUIB 3BUNB 3JTDB 3AKAA 3OX6A 1SKTA 5I2OA 4BY4A 4PE0A 1YVLA 1TOPA 3O6BA 1NPQA 1SCMC 3NXAA 1YTZC 1K93D 2D8NA 1IRJA 4P2YB 1CFPA 1NCZA 1CDMA 3TDUA 1MXEA 2ISDA 5GQQC 2I7AA 2NLNA 1PK0D 1DJHA 1PRWA 1YRUB 2KHNA 1K90D 4YGBB 4I5LB 4A4CA 2BL0B 1K95A 1WY9A 2KGBC 3PSRA 1FPWA 3DVMA 4CFRA 1L7ZA 2FCDA 2LUXA 1NX0A 1KQMC 1IGVA
chains in the Genus database with same CATH superfamily
4CIDA 1S6CA 2RGIA 1W7JB 2MAZA 4PT1A 2JRFA 2K7DA 4YGEB 2LLTA 2MLFC 3SG2A 2KPHA 3OX5A 2LMVA 4ETOA 2LV7A 1XO5A 2BCBA 2OTGC 4I5JA 5HKYA 2CBLA 3D0YB 2HQWA 3R1VA 2EGDA 2WCBA 3CWGA 3CZ1A 2MA2A 1SCVA 3BXKA 3NSLA 4MBEA 3EK4A 5I94A 2WCHA 3EK8A 5DKQA 1RECA 3D10A 3EG5B 4ORAB 3OHMB 4JWQA 1UUSA 3BUXB 4KYNA 3BUMB 3JVTB 1RROA 1XFZO 3D0YA 1DJIA 1UHNA 2JXLA 3LL8B 2WCLA 2L51A 3SG3A 2NXQA 2F33A 3WXAA 1AJ5A 3AAJA 3D76A 4FQOA 1CFDA 5CSFA 1SW8A 1OOJA 2M3WA 1GQMA 3BYAA 1U5IB 1C3ZA 2M8UA 2Q91A 1BF5A 4OKHA 4C0JA 1YURA 1KK8B 4UPGA 2LC5A 4TNCA 2KSPA 1OE9B 3OB2B 5HLVA 2MHHA 5I2LA 1U5IA 2QEHA 4PALA 1SYMA 2Y1NA 3K21A 1KQVA 1A03A 4C0KA 2LUCA 4F0ZB 2WCJA 3NSIA 3CTNA 5PALA 2LLSA 1XFRA 2QDIA 2NCPA 1IG5A 3O4XA 5IBWA 1OOGA 2AUCA 3B86A 1HT9A 2KLDA 1JC2A 3KO0A 4MZKA 4NDBA 1TNQA 4PDZA 5I8NA 2ZN8A 2OS8C 2KQYA 3B87A 2PVBA 4MZJA 1EJ3A 1B4CA 3ZNIA 2CT9A 1NWDA 1SPYA 1J1EA 4PHJA 1KCYA 4MEWA 3PN7C 2Y1MA 5AEQA 5CSIA 2K2FA 1PVBA 4YGCB 4AQJA 2I18A 2Y4QA 4QJ4B 1K9PA 4M2QA 2LNKA 1SY9A 1QVIY 2L2CA 2BBNA 2BKHB 2KAVA 3O78A 4USLA 4ZCUA 2F3YA 1D1OA 3FE8A 1YUUA 1G8IA 1OQPA 3H4SE 2Q4UA 4OZDA 2EC6B 1SK6D 5ER5A 1TNPA 1MWNA 1CKKA 2JNXA 1CLMA 3VGOA 1NYAA 4NDCA 2FJUB 3LK0A 4DIRA 2KBIA 4FTGA 1DJXA 4I5KA 1IKUA 1QLSA 1G33A 4N5XA 1M63B 4FQTA 1UP5A 1CLBA 1DQEA 1DC1A 2QEVA 2BL0C 3CDNA 3D78A 4MSPA 1F55A 1JFKA 1G4YR 2WCKA 1A2XA 3SJSA 2ZFDA 2L5XB 1C7VA 3BUWB 4AQIA 3EKHA 4N1FA 1CFCA 1RFJA 2FCEA 4MRXA 3WHTB 1DJZA 2PALA 5HL1A 1QATA 1S1EA 2BCXA 1OSAA 2DOQA 3B88A 1TN4A 1H8BA 1F70A 1FBVA 3CZTX 4ORBB 2M0RA 3PFVA 2LVJA 4PE1A 1QXPA 1XFVO 4DRWA 3BQ3A 2BKIB 1Y1XA 1EXRA 2KYCA 3JVTC 3VRPA 1XVJA 4PCWA 1AVSA 1WLZA 2V53A 1F4QA 1JFJA 3PATA 3S0EA 1K9UA 3VRRA 3UNWA 3N7HA 5D3OA 1IH0A 3CS1A 5F6TA 3CABA 3SG4A 2K61A 2GTEA 1B7TY 3Q8IA 1LVCD 2WORA 2M7LA 1KK8C 4GPLB 1OOHA 2K7CA 4OR9B 1NUBA 2HETA 2K8MB 3DZTA 1DF0B 1NX2A 4WQ2A 2BAPA 3ZWHA 1LS8A 2JXCA 2L50A 3SG7A 1DMOA 2MLEC 1F4OA 3BFHA 1CB1A 4P5OE 3E3RA 4PHKA 5AANA 2P6BB 2KAYA 1FW4A 1KK7Y 2QACA 4JPZB 1FI5A 4IJ7A 4C0LA 5HKZA 1QVIZ 3A8RA 3O4YA 1RTP1 1SRAA 1BU3A 3L4AA 1DF0A 1KFXS 3S0FA 3EK7A 2B1UA 3GK4X 4JKTA 3PJIA 1J7OA 1IJ6A 3RM1A 4DUQA 1C3YA 1N65A 3SS3A 3SIBA 2GGMA 3FS7A 2NZ0A 3TZ1A 3BJHA 1BOCA 2WCMA 3B6XA 1TUJA 2L2EA 1NX3A 1OMDA 1F71A 2ZNDA 3L4LA 3L47A 4YI9A 2MBXA 4YRUA 1QV0A 4JD9A 2K7BA 1CDNA 3SG5A 1KSMA 2YGUA 1S5GY 1EG4A 2WOSA 3HX4A 4DS7A 1NIWA 2IS9A 5BPJA 2O60A 1SL9A 2LHLA 3D77A 3DVKA 4R1EA 4OCIA 1MUXA 2BNXA 5B8IB 1B1GA 1UWOA 4L9MA 2AMIA 1TUZA 2CCMA 2EC6C 2K0JA 4NQGA 1EG3A 5EL2A 1SR6B 4CFQA 4GNKB 3VROA 3S0AA 1CM4A 2KFGA 2G2BA 2COLB 2NCOA 1WDCB 1OMVA 2WCEA 1YR5A 3TS5C 1YRTB 4AOMA 1T14A 1M31A 3WHUB 3DYEA 2P71A 3S0GA 4GGFA 1BR1B 2KFHA 2ZN9A 2KDHA 2LAPA 3EVVA 3TDIA 1LA3A 1GGWA 1UHHA 2A4JA 3PM8A 3VRQA 3M0WA 4Q04A 1CMGA 4OV2A 2PQLA 1M39A 3DD4A 1XFWO 2JU0A 1J7RA 1F8HA 1B7TZ 4M2OA 2M49B 2I94A 3TUYC 3IQOA 1B8LA 2GV5A 2K2AA 2CNPA 2JT3A 2JWWA 2SCPA 1TNXA 1CNPA 1MF8B 1NCXA 4XYNA 2L5YA 1SL8A 2VRGA 1CTRA 1QX7A 1BLQA 4JQ0D 1ZMZA 2PSRA 2MJWB 1KK7Z 2KBMA 3NSOA 2LE9B 3GOFA 5I2QA 3VB1A 1ALWA 1ZUZA 3EVUA 4PHNA 1IQ3A 1YUSA 1QWVA 2JT8A 1DJYA 1PSRA 2P70A 3R1OA 1BT6A 1TCOB 1AJ4A 3TS5B 1QX5B 3KEVA 4MLWA 1LXFC 3CR5X 1R2UA 1IWQA 3CR2A 3KF9A 1DGVA 1Y6WA 1CLLA 4MVFA 1WRLA 1Y0VH 2JPOA 4OVNF 2BCAA 2KI4C 1QTXA 4MRYA 1E8AA 3PLFB 5JJGA 2JQ6A 4ORCB 3QRXA 4XJKB 1OW4A 1CMFA 4HRHA 3O2PA 1ZACA 4M2PA 2JTZA 2H61A 3OGNA 2LVVA 4BY5A 1NSHA 2LLUA 1S5GZ 3TUYB 2H8VA 4PHMA 1A4PA 2KFFA 4WRIA 5G08A 2K60A 1JF2A 2G9BA 2KI6C 4HRGA 1BMOA 2HPSA 2M97A 2H2KA 2OPOA 3PM2A 4XJKA 5D69A 5D7FA 3I5FB 1ORGA 1WRKA 2L4HA 1J1DA 2F2PA 1DT7B 4U8DA 3IVTA 3CLNA 1S6IA 1JBAA 1K96A 1P28A 2M7NA 2BE4A 3DY9A 2WNDA 1XFXO 3SIAA 1DVIA 2EHBA 1W9ZA 4N1GA 4NDDA 2JT0A 2M1KB 2PMYA 1B47A 5CSNA 1TTXA 1M45A 2F3ZA 2O5GA 1V1GA 1SBJA 1ODBA 3NHIA 2LMUA 4PE4A 5K89A 2L4IA 2ZRTA 1N2DA 1DEKA 1L2OB 2WC8A 2ZRSA 5KSZA 3SS5A 2KI4B 3D73A 1CFFA 4YGAA 2ERBA 1KFUS 1BR4B 1N0YA 3BUOB 2I2RE 3DF0B 1QS7A 4GUKA 3I5HB 5FI2A 1PALA 5DKRA 4YBHB 1GM0A 2JC2A 1SR6C 3DXLA 4GGFC 3CR4X 1TCFA 2QEOA 1MQ1A 3KHEA 3I5GB 1WDCC 1A29A 5AFPA 2TN4A 2LMTA 2KOTA 1QIVA 4INWA 2BE6A 1S36A 1ZOTB 3DF0A 3GK1A 4I5NB 1S3PA 2Y5IA 2JOJA 1DELA 2KQ6A 1XK4C 1LKJA 1X02A 2SASA 2CXJA 3CYZA 5CSJA 2M9GA 2KLEA 2MRDA 1DJWA 1MXLC 1Q80A 4HSZA 1B8CA 2LCPA 1ALVA 1XFUO 4PE7A 3I5IB 4WQ3A 3AAKA 2WC6A 4A4BA 2BECA 3QMEA 1OZOA 3ICBA 3DVEA 1CM1A 1C07A 1YUTA 1DJGA 3FE6A 3IF7A 1B8RA 1RWYA 3NHTA 1KSOA 3VRNA 1JF0A 1DGUA 2JULA 1K94A 2LANA 1OMRA 4GFTA 1H4BA 2WCFA 4CLNA 1LA0A 2LVIA 1SCMB 2GGZA 3NGVA 3C1VA 1Y1UA 1YX7A 1QJTA 3IQQA 5FI7A 1QX2A 1LINA 1WRZA 3RZSA 1PULA 4HREE 5FI6A 3FIAA 1S6JA 1QV1A 2F2OA 3RLZA 2HF5A 4F7FA 1TIZA 5FYXA 2H61C 1R6PA 2JZIA 2ZNEA 5ER4X 3A4UB 1GGZA 1KWOC 1MR8A 1PSBA 5KU1A 1C7WA 4QJ5B 2R2IA 3OB1B 1AP4A 3LLEA 1KQMB 1SSEB 3DVJA 3WNXB 1K2HA 1CDLA 1XFYO 1YVHA 1XYDA 1W7IB 3KPXA 4YGDB 3CZ0A 1JWDA 1UURA 4CPVA 1QASA 1B9AA 2E6WA 5TNCA 1SL7A 1JUOA 3OP0A 1QIWA 1XK4A 2FOTA 3LK1A 1XA5A 2OTGB 1MHOA 2JNFA 1NP8A 3S0DA 1TWOA 4GGNA 2L98A 2BBMA 3FWCA 1IJ5A 3SG6A 1Z4HA 3I5FC 3OBVA 1CDPA 5KTYA 3F45A 3BFAA 4QJ3B 3PALA 4MN0A 3CZ2A 1FF1A 4GBAA 2LHIA 4DCKA 2LP2A 2QPTA 1VRKA 2M29A 1OOFA 1EH2A 1M46A 2ZKMX 1K9KA 2LP3A 1HQVA 1A75B 1OZSA 1Z2CB 2QEBA 1K8UA 1SMGA 3BOWB 2WC5A 4YI8A 5HLOA 1UHKA 1UHJA 1EL4A 5CPVA 1QLKA 1L2OC 1KWOB 1RK9A 1F54A 5HYDA 2PRUA 1AK8A 1A75A 2JPTA 1J7QA 1RJVA 1WLMA 1ZFSA 2KYFA 3CGAA 3JTDC 1IQ5A 2KAXA 3BOWA 3I5HC 1FI6A 3AKBA 3BFBA 1UHIA 1BJFA 2FJYA 2KI6D 2F8PA 2AAOA 2K7OA 1DTLA 3I5GC 3NSKA 1KFUL 2CTNA 3FWBA 2E30A 2PASA 3R72A 5JOLA 5HKWA 1YX8A 1BODA 1PVAA 1S26D 2JTTA 4GAOA 4D1EA 4INXA 2KGRA 1BG1A 1J55A 3K1EA 5AERA 1J7PA 1V1FA 2M1UA 1KFXL 2OS8B 3D75A 1NX1A 5DKNA 4ICBA 2L0PA 3TDZA 3I5IC 1Y1AA 3LCPC 1TRFA 3HCMA 3R1PA 4ZCVA 1AHRA 2LVKA 3PN7B 1NCYA 1SNLA 4MZLA 3SS4A 2KNEA 1OOIX 4IL1A 2HQ8A 3EKJA 3MSEB 1IIOA 3S0BA 3FE9A 3GK2A 5J3XA 1GJYA 3V2LA 3EVRA 2LM5A 4E68A 5AXIA 1TNWA 1JSAA 5DICA 1AUIB 3BUNB 3JTDB 3AKAA 3OX6A 1SKTA 5I2OA 4BY4A 4PE0A 1YVLA 1TOPA 3O6BA 1NPQA 1SCMC 3NXAA 1YTZC 1K93D 2D8NA 1IRJA 4P2YB 1CFPA 1NCZA 1CDMA 3D74A 3TDUA 1MXEA 2ISDA 5GQQC 2I7AA 2NLNA 3B7AA 1PK0D 1DJHA 1PRWA 1YRUB 2KHNA 1K90D 4YGBB 4I5LB 4A4CA 2BL0B 1K95A 1WY9A 2KGBC 3PSRA 1FPWA 3DVMA 4CFRA 2PYQA 3UO9A 1L7ZA 2FCDA 2LUXA 1NX0A 1KQMC 1IGVA
chains in the Genus database with same CATH topology
4CIDA 1S6CA 2RGIA 1W7JB 2MAZA 2JRFA 2K7DA 4YGEB 2LLTA 2MLFC 3SG2A 3OX5A 2LMVA 4ETOA 2LV7A 1XO5A 2BCBA 2OTGC 4I5JA 5HKYA 2CBLA 3D0YB 2HQWA 2EGDA 2WCBA 3CWGA 2MA2A 1SCVA 3BXKA 3NSLA 4MBEA 3EK4A 3EK8A 5DKQA 1RECA 3D10A 4ORAB 3OHMB 4JWQA 1UUSA 3BUXB 3BUMB 3JVTB 1RROA 1XFZO 3D0YA 1DJIA 1UHNA 2JXLA 3LL8B 2L51A 3SG3A 2NXQA 2F33A 3WXAA 1AJ5A 3AAJA 4FQOA 5CSFA 1CFDA 1SW8A 1OOJA 2M3WA 1GQMA 3BYAA 1U5IB 2M8UA 2Q91A 1BF5A 4OKHA 4C0JA 1YURA 1KK8B 4UPGA 2LC5A 4TNCA 2KSPA 1OE9B 3OB2B 5HLVA 2MHHA 5I2LA 1U5IA 4PALA 1SYMA 2Y1NA 3K21A 1KQVA 1A03A 4C0KA 2LUCA 4F0ZB 3NSIA 3CTNA 5PALA 2LLSA 2NCPA 1IG5A 5IBWA 2AUCA 1HT9A 1JC2A 3KO0A 4MZKA 4NDBA 1TNQA 4PDZA 5I8NA 2ZN8A 2OS8C 2KQYA 2PVBA 4MZJA 1EJ3A 1B4CA 3ZNIA 2CT9A 1NWDA 1SPYA 1J1EA 4PHJA 1KCYA 4MEWA 3PN7C 2Y1MA 5AEQA 5CSIA 2K2FA 1PVBA 4YGCB 4AQJA 2I18A 2Y4QA 4QJ4B 1K9PA 4M2QA 2LNKA 1SY9A 1QVIY 2BBNA 2BKHB 2KAVA 3O78A 4USLA 4ZCUA 2F3YA 1D1OA 1YUUA 1G8IA 1OQPA 3H4SE 2Q4UA 2EC6B 1SK6D 5ER5A 1TNPA 1MWNA 1CKKA 2JNXA 1CLMA 3VGOA 1NYAA 4NDCA 2FJUB 3LK0A 4DIRA 2KBIA 4FTGA 1DJXA 4I5KA 1IKUA 1QLSA 1G33A 4N5XA 1M63B 1CLBA 1UP5A 2BL0C 4MSPA 1F55A 1JFKA 1G4YR 1A2XA 3SJSA 2ZFDA 2L5XB 1C7VA 3BUWB 4AQIA 3EKHA 4N1FA 1CFCA 1RFJA 2FCEA 4MRXA 3WHTB 1DJZA 2PALA 1QATA 1S1EA 2BCXA 1OSAA 2DOQA 1H8BA 1TN4A 1F70A 1FBVA 3CZTX 4ORBB 2M0RA 3PFVA 2LVJA 4PE1A 1QXPA 1XFVO 4DRWA 3BQ3A 2BKIB 1Y1XA 1EXRA 2KYCA 3JVTC 3VRPA 1XVJA 4PCWA 1AVSA 1WLZA 2V53A 1F4QA 1JFJA 3PATA 1K9UA 3VRRA 1IH0A 3CS1A 5F6TA 3SG4A 2K61A 1B7TY 1LVCD 2WORA 2M7LA 1KK8C 4GPLB 2K7CA 4OR9B 1NUBA 2HETA 2K8MB 1DF0B 1NX2A 4WQ2A 3ZWHA 1DMOA 2JXCA 2L50A 3SG7A 2MLEC 1F4OA 1CB1A 4P5OE 3E3RA 4PHKA 5AANA 2P6BB 2KAYA 1FW4A 1KK7Y 2QACA 4JPZB 1FI5A 4C0LA 5HKZA 1QVIZ 3A8RA 3O4YA 1RTP1 1SRAA 1BU3A 1DF0A 1KFXS 3EK7A 2B1UA 3GK4X 1J7OA 1IJ6A 3RM1A 4DUQA 1N65A 3SIBA 2GGMA 3FS7A 2NZ0A 3TZ1A 1BOCA 2L2EA 1NX3A 1OMDA 1F71A 2ZNDA 4YI9A 2MBXA 4YRUA 1QV0A 2K7BA 1CDNA 3SG5A 1KSMA 1S5GY 1EG4A 2WOSA 3HX4A 4DS7A 1NIWA 2IS9A 5BPJA 2O60A 1SL9A 2LHLA 3DVKA 4R1EA 4OCIA 1MUXA 5B8IB 1B1GA 1UWOA 4L9MA 2AMIA 2CCMA 2EC6C 2K0JA 4NQGA 1EG3A 1SR6B 4CFQA 4GNKB 3VROA 1CM4A 2KFGA 2G2BA 2COLB 2NCOA 1WDCB 1OMVA 2WCEA 1YR5A 3TS5C 1YRTB 4AOMA 1M31A 3WHUB 4GGFA 1BR1B 2KFHA 2ZN9A 2KDHA 2LAPA 3EVVA 3TDIA 1LA3A 1GGWA 1UHHA 2A4JA 3PM8A 3VRQA 3M0WA 4Q04A 1CMGA 4OV2A 3DD4A 1M39A 1XFWO 2JU0A 1J7RA 1F8HA 1B7TZ 4M2OA 2M49B 2I94A 3TUYC 3IQOA 1B8LA 2GV5A 2K2AA 2CNPA 2JT3A 2JWWA 2SCPA 1TNXA 1CNPA 1MF8B 1NCXA 4XYNA 2VRGA 1SL8A 1CTRA 1QX7A 1BLQA 4JQ0D 1ZMZA 2PSRA 2MJWB 1KK7Z 2KBMA 3NSOA 2LE9B 3GOFA 5I2QA 1ALWA 1ZUZA 3EVUA 4PHNA 1IQ3A 1YUSA 2JT8A 1DJYA 1PSRA 1BT6A 1TCOB 1AJ4A 3TS5B 1QX5B 3KEVA 4MLWA 1LXFC 3CR5X 1R2UA 1IWQA 3CR2A 3KF9A 1DGVA 1Y6WA 1CLLA 4MVFA 1WRLA 1Y0VH 4OVNF 2BCAA 2KI4C 1QTXA 4MRYA 1E8AA 3PLFB 5JJGA 2JQ6A 4ORCB 3QRXA 4XJKB 1CMFA 4HRHA 3O2PA 1ZACA 4M2PA 2JTZA 2H61A 2LVVA 4BY5A 1NSHA 2LLUA 1S5GZ 3TUYB 4PHMA 1A4PA 2KFFA 4WRIA 5G08A 1JF2A 2G9BA 2KI6C 4HRGA 1BMOA 2HPSA 2M97A 2H2KA 2OPOA 4XJKA 5D69A 5D7FA 3I5FB 1WRKA 2L4HA 1J1DA 2F2PA 1DT7B 4U8DA 3CLNA 1S6IA 1JBAA 1K96A 2M7NA 2BE4A 2WNDA 1XFXO 3SIAA 1DVIA 2EHBA 4N1GA 4NDDA 2JT0A 2M1KB 2PMYA 1B47A 5CSNA 1TTXA 1M45A 2F3ZA 2O5GA 1V1GA 1SBJA 1ODBA 4PE4A 2LMUA 5K89A 2L4IA 2ZRTA 1N2DA 1L2OB 5KSZA 2WC8A 2ZRSA 2KI4B 1CFFA 4YGAA 1KFUS 1BR4B 1N0YA 3BUOB 2I2RE 3DF0B 1QS7A 4GUKA 3I5HB 1PALA 5DKRA 4YBHB 2JC2A 1SR6C 4GGFC 3CR4X 1TCFA 1MQ1A 3KHEA 3I5GB 1WDCC 1A29A 5AFPA 2TN4A 2LMTA 2KOTA 1QIVA 2BE6A 1S36A 1ZOTB 3DF0A 3GK1A 4I5NB 1S3PA 2Y5IA 2JOJA 2KQ6A 1XK4C 1LKJA 1X02A 2SASA 2CXJA 5CSJA 2M9GA 2MRDA 1DJWA 1MXLC 1Q80A 4HSZA 1B8CA 2LCPA 1ALVA 1XFUO 4PE7A 3I5IB 4WQ3A 3AAKA 4A4BA 2BECA 1OZOA 3ICBA 3DVEA 1CM1A 1C07A 1YUTA 1DJGA 3IF7A 1B8RA 1RWYA 1KSOA 3VRNA 1JF0A 1DGUA 2JULA 1K94A 2LANA 1OMRA 4GFTA 1H4BA 2WCFA 4CLNA 1LA0A 2LVIA 1SCMB 2GGZA 3C1VA 1Y1UA 1YX7A 1QJTA 3IQQA 1QX2A 1LINA 1WRZA 1PULA 4HREE 3FIAA 1S6JA 1QV1A 2F2OA 3RLZA 2HF5A 1TIZA 5FYXA 2H61C 1R6PA 2JZIA 2ZNEA 5ER4X 3A4UB 1GGZA 1KWOC 1MR8A 1PSBA 5KU1A 1C7WA 4QJ5B 2R2IA 3OB1B 1AP4A 3LLEA 1KQMB 3DVJA 3WNXB 1K2HA 1CDLA 1XFYO 1YVHA 1XYDA 1W7IB 3KPXA 4YGDB 1JWDA 1UURA 4CPVA 1QASA 1B9AA 2E6WA 5TNCA 1SL7A 1JUOA 3OP0A 1QIWA 1XK4A 2FOTA 3LK1A 1XA5A 2OTGB 1MHOA 2JNFA 1NP8A 4GGNA 2L98A 2BBMA 3FWCA 1IJ5A 3SG6A 3I5FC 1CDPA 5KTYA 3F45A 4QJ3B 3PALA 4MN0A 1FF1A 4GBAA 2LHIA 4DCKA 2LP2A 2QPTA 1VRKA 2M29A 1EH2A 1M46A 2ZKMX 1K9KA 2LP3A 1HQVA 1A75B 1OZSA 1K8UA 1SMGA 3BOWB 4YI8A 5HLOA 1UHKA 1UHJA 1EL4A 5CPVA 1QLKA 1L2OC 1KWOB 1RK9A 1F54A 5HYDA 2PRUA 1AK8A 1A75A 2JPTA 1J7QA 1RJVA 1WLMA 1ZFSA 2KYFA 3CGAA 3JTDC 1IQ5A 2KAXA 3BOWA 3I5HC 1FI6A 3AKBA 1UHIA 1BJFA 2KI6D 2F8PA 2AAOA 2K7OA 1DTLA 3I5GC 3NSKA 1KFUL 2CTNA 3FWBA 2E30A 2PASA 5JOLA 5HKWA 1YX8A 1BODA 1PVAA 1S26D 2JTTA 4GAOA 4D1EA 2KGRA 1BG1A 1J55A 5AERA 1J7PA 1V1FA 2M1UA 1KFXL 2OS8B 1NX1A 5DKNA 4ICBA 2L0PA 3TDZA 3I5IC 1Y1AA 3LCPC 1TRFA 3HCMA 4ZCVA 1AHRA 2LVKA 3PN7B 1NCYA 1SNLA 4MZLA 2KNEA 4IL1A 2HQ8A 3EKJA 3MSEB 3GK2A 5J3XA 1GJYA 3EVRA 2LM5A 4E68A 5AXIA 1TNWA 1JSAA 1AUIB 3BUNB 3JTDB 3AKAA 3OX6A 1SKTA 5I2OA 4BY4A 4PE0A 1YVLA 1TOPA 3O6BA 1NPQA 1SCMC 3NXAA 1YTZC 1K93D 2D8NA 1IRJA 4P2YB 1CFPA 1NCZA 1CDMA 3TDUA 1MXEA 2ISDA 5GQQC 2I7AA 2NLNA 1PK0D 1DJHA 1PRWA 1YRUB 2KHNA 1K90D 4YGBB 4I5LB 4A4CA 2BL0B 1K95A 1WY9A 2KGBC 3PSRA 1FPWA 3DVMA 4CFRA 1L7ZA 2FCDA 2LUXA 1NX0A 1KQMC 1IGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CID A;  1S6C A;  2RGI A;  1W7J B;  2MAZ A;  2JRF A;  2K7D A;  4YGE B;  2LLT A;  2MLF C;  3SG2 A;  3OX5 A;  2LMV A;  4ETO A;  2LV7 A;  1XO5 A;  2BCB A;  2OTG C;  4I5J A;  5HKY A;  2CBL A;  3D0Y B;  2HQW A;  2EGD A;  2WCB A;  3CWG A;  2MA2 A;  1SCV A;  3BXK A;  3NSL A;  4MBE A;  3EK4 A;  3EK8 A;  5DKQ A;  1REC A;  3D10 A;  4ORA B;  3OHM B;  4JWQ A;  1UUS A;  3BUX B;  3BUM B;  3JVT B;  1RRO A;  1XFZ O;  3D0Y A;  1DJI A;  1UHN A;  2JXL A;  3LL8 B;  2L51 A;  3SG3 A;  2NXQ A;  2F33 A;  3WXA A;  1AJ5 A;  3AAJ A;  4FQO A;  5CSF A;  1CFD A;  1SW8 A;  1OOJ A;  2M3W A;  1GQM A;  3BYA A;  1U5I B;  2M8U A;  2Q91 A;  1BF5 A;  4OKH A;  4C0J A;  1YUR A;  1KK8 B;  4UPG A;  2LC5 A;  4TNC A;  2KSP A;  1OE9 B;  3OB2 B;  5HLV A;  2MHH A;  5I2L A;  1U5I A;  4PAL A;  1SYM A;  2Y1N A;  3K21 A;  1KQV A;  1A03 A;  4C0K A;  2LUC A;  4F0Z B;  3NSI A;  3CTN A;  5PAL A;  2LLS A;  2NCP A;  1IG5 A;  5IBW A;  2AUC A;  1HT9 A;  1JC2 A;  3KO0 A;  4MZK A;  4NDB A;  1TNQ A;  4PDZ A;  5I8N A;  2ZN8 A;  2OS8 C;  2KQY A;  2PVB A;  4MZJ A;  1EJ3 A;  1B4C A;  3ZNI A;  2CT9 A;  1NWD A;  1SPY A;  1J1E A;  4PHJ A;  1KCY A;  4MEW A;  3PN7 C;  2Y1M A;  5AEQ A;  5CSI A;  2K2F A;  1PVB A;  4YGC B;  4AQJ A;  2I18 A;  2Y4Q A;  4QJ4 B;  1K9P A;  4M2Q A;  2LNK A;  1SY9 A;  1QVI Y;  2BBN A;  2BKH B;  2KAV A;  3O78 A;  4USL A;  4ZCU A;  2F3Y A;  1D1O A;  1YUU A;  1G8I A;  1OQP A;  3H4S E;  2Q4U A;  2EC6 B;  1SK6 D;  5ER5 A;  1TNP A;  1MWN A;  1CKK A;  2JNX A;  1CLM A;  3VGO A;  1NYA A;  4NDC A;  2FJU B;  3LK0 A;  4DIR A;  2KBI A;  4FTG A;  1DJX A;  4I5K A;  1IKU A;  1QLS A;  1G33 A;  4N5X A;  1M63 B;  1CLB A;  1UP5 A;  2BL0 C;  4MSP A;  1F55 A;  1JFK A;  1G4Y R;  1A2X A;  3SJS A;  2ZFD A;  2L5X B;  1C7V A;  3BUW B;  4AQI A;  3EKH A;  4N1F A;  1CFC A;  1RFJ A;  2FCE A;  4MRX A;  3WHT B;  1DJZ A;  2PAL A;  1QAT A;  1S1E A;  2BCX A;  1OSA A;  2DOQ A;  1H8B A;  1TN4 A;  1F70 A;  1FBV A;  3CZT X;  4ORB B;  2M0R A;  3PFV A;  2LVJ A;  4PE1 A;  1QXP A;  1XFV O;  4DRW A;  3BQ3 A;  2BKI B;  1Y1X A;  1EXR A;  2KYC A;  3JVT C;  3VRP A;  1XVJ A;  4PCW A;  1AVS A;  1WLZ A;  2V53 A;  1F4Q A;  1JFJ A;  3PAT A;  1K9U A;  3VRR A;  1IH0 A;  3CS1 A;  5F6T A;  3SG4 A;  2K61 A;  1B7T Y;  1LVC D;  2WOR A;  2M7L A;  1KK8 C;  4GPL B;  2K7C A;  4OR9 B;  1NUB A;  2HET A;  2K8M B;  1DF0 B;  1NX2 A;  4WQ2 A;  3ZWH A;  1DMO A;  2JXC A;  2L50 A;  3SG7 A;  2MLE C;  1F4O A;  1CB1 A;  4P5O E;  3E3R A;  4PHK A;  5AAN A;  2P6B B;  2KAY A;  1FW4 A;  1KK7 Y;  2QAC A;  4JPZ B;  1FI5 A;  4C0L A;  5HKZ A;  1QVI Z;  3A8R A;  3O4Y A;  1RTP 1;  1SRA A;  1BU3 A;  1DF0 A;  1KFX S;  3EK7 A;  2B1U A;  3GK4 X;  1J7O A;  1IJ6 A;  3RM1 A;  4DUQ A;  1N65 A;  3SIB A;  2GGM A;  3FS7 A;  2NZ0 A;  3TZ1 A;  1BOC A;  2L2E A;  1NX3 A;  1OMD A;  1F71 A;  2ZND A;  4YI9 A;  2MBX A;  4YRU A;  1QV0 A;  2K7B A;  1CDN A;  3SG5 A;  1KSM A;  1S5G Y;  1EG4 A;  2WOS A;  3HX4 A;  4DS7 A;  1NIW A;  2IS9 A;  5BPJ A;  2O60 A;  1SL9 A;  2LHL A;  3DVK A;  4R1E A;  4OCI A;  1MUX A;  5B8I B;  1B1G A;  1UWO A;  4L9M A;  2AMI A;  2CCM A;  2EC6 C;  2K0J A;  4NQG A;  1EG3 A;  1SR6 B;  4CFQ A;  4GNK B;  3VRO A;  1CM4 A;  2KFG A;  2G2B A;  2COL B;  2NCO A;  1WDC B;  1OMV A;  2WCE A;  1YR5 A;  3TS5 C;  1YRT B;  4AOM A;  1M31 A;  3WHU B;  4GGF A;  1BR1 B;  2KFH A;  2ZN9 A;  2KDH A;  2LAP A;  3EVV A;  3TDI A;  1LA3 A;  1GGW A;  1UHH A;  2A4J A;  3PM8 A;  3VRQ A;  3M0W A;  4Q04 A;  1CMG A;  4OV2 A;  3DD4 A;  1M39 A;  1XFW O;  2JU0 A;  1J7R A;  1F8H A;  1B7T Z;  4M2O A;  2M49 B;  2I94 A;  3TUY C;  3IQO A;  1B8L A;  2GV5 A;  2K2A A;  2CNP A;  2JT3 A;  2JWW A;  2SCP A;  1TNX A;  1CNP A;  1MF8 B;  1NCX A;  4XYN A;  2VRG A;  1SL8 A;  1CTR A;  1QX7 A;  1BLQ A;  4JQ0 D;  1ZMZ A;  2PSR A;  2MJW B;  1KK7 Z;  2KBM A;  3NSO A;  2LE9 B;  3GOF A;  5I2Q A;  1ALW A;  1ZUZ A;  3EVU A;  4PHN A;  1IQ3 A;  1YUS A;  2JT8 A;  1DJY A;  1PSR A;  1BT6 A;  1TCO B;  1AJ4 A;  3TS5 B;  1QX5 B;  3KEV A;  4MLW A;  1LXF C;  3CR5 X;  1R2U A;  1IWQ A;  3CR2 A;  3KF9 A;  1DGV A;  1Y6W A;  1CLL A;  4MVF A;  1WRL A;  1Y0V H;  4OVN F;  2BCA A;  2KI4 C;  1QTX A;  4MRY A;  1E8A A;  3PLF B;  5JJG A;  2JQ6 A;  4ORC B;  3QRX A;  4XJK B;  1CMF A;  4HRH A;  3O2P A;  1ZAC A;  4M2P A;  2JTZ A;  2H61 A;  2LVV A;  4BY5 A;  1NSH A;  2LLU A;  1S5G Z;  3TUY B;  4PHM A;  1A4P A;  2KFF A;  4WRI A;  5G08 A;  1JF2 A;  2G9B A;  2KI6 C;  4HRG A;  1BMO A;  2HPS A;  2M97 A;  2H2K A;  2OPO A;  4XJK A;  5D69 A;  5D7F A;  3I5F B;  1WRK A;  2L4H A;  1J1D A;  2F2P A;  1DT7 B;  4U8D A;  3CLN A;  1S6I A;  1JBA A;  1K96 A;  2M7N A;  2BE4 A;  2WND A;  1XFX O;  3SIA A;  1DVI A;  2EHB A;  4N1G A;  4NDD A;  2JT0 A;  2M1K B;  2PMY A;  1B47 A;  5CSN A;  1TTX A;  1M45 A;  2F3Z A;  2O5G A;  1V1G A;  1SBJ A;  1ODB A;  4PE4 A;  2LMU A;  5K89 A;  2L4I A;  2ZRT A;  1N2D A;  1L2O B;  5KSZ A;  2WC8 A;  2ZRS A;  2KI4 B;  1CFF A;  4YGA A;  1KFU S;  1BR4 B;  1N0Y A;  3BUO B;  2I2R E;  3DF0 B;  1QS7 A;  4GUK A;  3I5H B;  1PAL A;  5DKR A;  4YBH B;  2JC2 A;  1SR6 C;  4GGF C;  3CR4 X;  1TCF A;  1MQ1 A;  3KHE A;  3I5G B;  1WDC C;  1A29 A;  5AFP A;  2TN4 A;  2LMT A;  2KOT A;  1QIV A;  2BE6 A;  1S36 A;  1ZOT B;  3DF0 A;  3GK1 A;  4I5N B;  1S3P A;  2Y5I A;  2JOJ A;  2KQ6 A;  1XK4 C;  1LKJ A;  1X02 A;  2SAS A;  2CXJ A;  5CSJ A;  2M9G A;  2MRD A;  1DJW A;  1MXL C;  1Q80 A;  4HSZ A;  1B8C A;  2LCP A;  1ALV A;  1XFU O;  4PE7 A;  3I5I B;  4WQ3 A;  3AAK A;  4A4B A;  2BEC A;  1OZO A;  3ICB A;  3DVE A;  1CM1 A;  1C07 A;  1YUT A;  1DJG A;  3IF7 A;  1B8R A;  1RWY A;  1KSO A;  3VRN A;  1JF0 A;  1DGU A;  2JUL A;  1K94 A;  2LAN A;  1OMR A;  4GFT A;  1H4B A;  2WCF A;  4CLN A;  1LA0 A;  2LVI A;  1SCM B;  2GGZ A;  3C1V A;  1Y1U A;  1YX7 A;  1QJT A;  3IQQ A;  1QX2 A;  1LIN A;  1WRZ A;  1PUL A;  4HRE E;  3FIA A;  1S6J A;  1QV1 A;  2F2O A;  3RLZ A;  2HF5 A;  1TIZ A;  5FYX A;  2H61 C;  1R6P A;  2JZI A;  2ZNE A;  5ER4 X;  3A4U B;  1GGZ A;  1KWO C;  1MR8 A;  1PSB A;  5KU1 A;  1C7W A;  4QJ5 B;  2R2I A;  3OB1 B;  1AP4 A;  3LLE A;  1KQM B;  3DVJ A;  3WNX B;  1K2H A;  1CDL A;  1XFY O;  1YVH A;  1XYD A;  1W7I B;  3KPX A;  4YGD B;  1JWD A;  1UUR A;  4CPV A;  1QAS A;  1B9A A;  2E6W A;  5TNC A;  1SL7 A;  1JUO A;  3OP0 A;  1QIW A;  1XK4 A;  2FOT A;  3LK1 A;  1XA5 A;  2OTG B;  1MHO A;  2JNF A;  1NP8 A;  4GGN A;  2L98 A;  2BBM A;  3FWC A;  1IJ5 A;  3SG6 A;  3I5F C;  1CDP A;  5KTY A;  3F45 A;  4QJ3 B;  3PAL A;  4MN0 A;  1FF1 A;  4GBA A;  2LHI A;  4DCK A;  2LP2 A;  2QPT A;  1VRK A;  2M29 A;  1EH2 A;  1M46 A;  2ZKM X;  1K9K A;  2LP3 A;  1HQV A;  1A75 B;  1OZS A;  1K8U A;  1SMG A;  3BOW B;  4YI8 A;  5HLO A;  1UHK A;  1UHJ A;  1EL4 A;  5CPV A;  1QLK A;  1L2O C;  1KWO B;  1RK9 A;  1F54 A;  5HYD A;  2PRU A;  1AK8 A;  1A75 A;  2JPT A;  1J7Q A;  1RJV A;  1WLM A;  1ZFS A;  2KYF A;  3CGA A;  3JTD C;  1IQ5 A;  2KAX A;  3BOW A;  3I5H C;  1FI6 A;  3AKB A;  1UHI A;  1BJF A;  2KI6 D;  2F8P A;  2AAO A;  2K7O A;  1DTL A;  3I5G C;  3NSK A;  1KFU L;  2CTN A;  3FWB A;  2E30 A;  2PAS A;  5JOL A;  5HKW A;  1YX8 A;  1BOD A;  1PVA A;  1S26 D;  2JTT A;  4GAO A;  4D1E A;  2KGR A;  1BG1 A;  1J55 A;  5AER A;  1J7P A;  1V1F A;  2M1U A;  1KFX L;  2OS8 B;  1NX1 A;  5DKN A;  4ICB A;  2L0P A;  3TDZ A;  3I5I C;  1Y1A A;  3LCP C;  1TRF A;  3HCM A;  4ZCV A;  1AHR A;  2LVK A;  3PN7 B;  1NCY A;  1SNL A;  4MZL A;  2KNE A;  4IL1 A;  2HQ8 A;  3EKJ A;  3MSE B;  3GK2 A;  5J3X A;  1GJY A;  3EVR A;  2LM5 A;  4E68 A;  5AXI A;  1TNW A;  1JSA A;  1AUI B;  3BUN B;  3JTD B;  3AKA A;  3OX6 A;  1SKT A;  5I2O A;  4BY4 A;  4PE0 A;  1YVL A;  1TOP A;  3O6B A;  1NPQ A;  1SCM C;  3NXA A;  1YTZ C;  1K93 D;  2D8N A;  1IRJ A;  4P2Y B;  1CFP A;  1NCZ A;  1CDM A;  3TDU A;  1MXE A;  2ISD A;  5GQQ C;  2I7A A;  2NLN A;  1PK0 D;  1DJH A;  1PRW A;  1YRU B;  2KHN A;  1K90 D;  4YGB B;  4I5L B;  4A4C A;  2BL0 B;  1K95 A;  1WY9 A;  2KGB C;  3PSR A;  1FPW A;  3DVM A;  4CFR A;  1L7Z A;  2FCD A;  2LUX A;  1NX0 A;  1KQM C;  1IGV A; 
#chains in the Genus database with same CATH topology
 4CID A;  1S6C A;  2RGI A;  1W7J B;  2MAZ A;  4PT1 A;  2JRF A;  2K7D A;  4YGE B;  2LLT A;  2MLF C;  3SG2 A;  2KPH A;  3OX5 A;  2LMV A;  4ETO A;  2LV7 A;  1XO5 A;  2BCB A;  2OTG C;  4I5J A;  5HKY A;  2CBL A;  3D0Y B;  2HQW A;  3R1V A;  2EGD A;  2WCB A;  3CWG A;  3CZ1 A;  2MA2 A;  1SCV A;  3BXK A;  3NSL A;  4MBE A;  3EK4 A;  5I94 A;  2WCH A;  3EK8 A;  5DKQ A;  1REC A;  3D10 A;  3EG5 B;  4ORA B;  3OHM B;  4JWQ A;  1UUS A;  3BUX B;  4KYN A;  3BUM B;  3JVT B;  1RRO A;  1XFZ O;  3D0Y A;  1DJI A;  1UHN A;  2JXL A;  3LL8 B;  2WCL A;  2L51 A;  3SG3 A;  2NXQ A;  2F33 A;  3WXA A;  1AJ5 A;  3AAJ A;  3D76 A;  4FQO A;  1CFD A;  5CSF A;  1SW8 A;  1OOJ A;  2M3W A;  1GQM A;  3BYA A;  1U5I B;  1C3Z A;  2M8U A;  2Q91 A;  1BF5 A;  4OKH A;  4C0J A;  1YUR A;  1KK8 B;  4UPG A;  2LC5 A;  4TNC A;  2KSP A;  1OE9 B;  3OB2 B;  5HLV A;  2MHH A;  5I2L A;  1U5I A;  2QEH A;  4PAL A;  1SYM A;  2Y1N A;  3K21 A;  1KQV A;  1A03 A;  4C0K A;  2LUC A;  4F0Z B;  2WCJ A;  3NSI A;  3CTN A;  5PAL A;  2LLS A;  1XFR A;  2QDI A;  2NCP A;  1IG5 A;  3O4X A;  5IBW A;  1OOG A;  2AUC A;  3B86 A;  1HT9 A;  2KLD A;  1JC2 A;  3KO0 A;  4MZK A;  4NDB A;  1TNQ A;  4PDZ A;  5I8N A;  2ZN8 A;  2OS8 C;  2KQY A;  3B87 A;  2PVB A;  4MZJ A;  1EJ3 A;  1B4C A;  3ZNI A;  2CT9 A;  1NWD A;  1SPY A;  1J1E A;  4PHJ A;  1KCY A;  4MEW A;  3PN7 C;  2Y1M A;  5AEQ A;  5CSI A;  2K2F A;  1PVB A;  4YGC B;  4AQJ A;  2I18 A;  2Y4Q A;  4QJ4 B;  1K9P A;  4M2Q A;  2LNK A;  1SY9 A;  1QVI Y;  2L2C A;  2BBN A;  2BKH B;  2KAV A;  3O78 A;  4USL A;  4ZCU A;  2F3Y A;  1D1O A;  3FE8 A;  1YUU A;  1G8I A;  1OQP A;  3H4S E;  2Q4U A;  4OZD A;  2EC6 B;  1SK6 D;  5ER5 A;  1TNP A;  1MWN A;  1CKK A;  2JNX A;  1CLM A;  3VGO A;  1NYA A;  4NDC A;  2FJU B;  3LK0 A;  4DIR A;  2KBI A;  4FTG A;  1DJX A;  4I5K A;  1IKU A;  1QLS A;  1G33 A;  4N5X A;  1M63 B;  4FQT A;  1UP5 A;  1CLB A;  1DQE A;  1DC1 A;  2QEV A;  2BL0 C;  3CDN A;  3D78 A;  4MSP A;  1F55 A;  1JFK A;  1G4Y R;  2WCK A;  1A2X A;  3SJS A;  2ZFD A;  2L5X B;  1C7V A;  3BUW B;  4AQI A;  3EKH A;  4N1F A;  1CFC A;  1RFJ A;  2FCE A;  4MRX A;  3WHT B;  1DJZ A;  2PAL A;  5HL1 A;  1QAT A;  1S1E A;  2BCX A;  1OSA A;  2DOQ A;  3B88 A;  1TN4 A;  1H8B A;  1F70 A;  1FBV A;  3CZT X;  4ORB B;  2M0R A;  3PFV A;  2LVJ A;  4PE1 A;  1QXP A;  1XFV O;  4DRW A;  3BQ3 A;  2BKI B;  1Y1X A;  1EXR A;  2KYC A;  3JVT C;  3VRP A;  1XVJ A;  4PCW A;  1AVS A;  1WLZ A;  2V53 A;  1F4Q A;  1JFJ A;  3PAT A;  3S0E A;  1K9U A;  3VRR A;  3UNW A;  3N7H A;  5D3O A;  1IH0 A;  3CS1 A;  5F6T A;  3CAB A;  3SG4 A;  2K61 A;  2GTE A;  1B7T Y;  3Q8I A;  1LVC D;  2WOR A;  2M7L A;  1KK8 C;  4GPL B;  1OOH A;  2K7C A;  4OR9 B;  1NUB A;  2HET A;  2K8M B;  3DZT A;  1DF0 B;  1NX2 A;  4WQ2 A;  2BAP A;  3ZWH A;  1LS8 A;  2JXC A;  2L50 A;  3SG7 A;  1DMO A;  2MLE C;  1F4O A;  3BFH A;  1CB1 A;  4P5O E;  3E3R A;  4PHK A;  5AAN A;  2P6B B;  2KAY A;  1FW4 A;  1KK7 Y;  2QAC A;  4JPZ B;  1FI5 A;  4IJ7 A;  4C0L A;  5HKZ A;  1QVI Z;  3A8R A;  3O4Y A;  1RTP 1;  1SRA A;  1BU3 A;  3L4A A;  1DF0 A;  1KFX S;  3S0F A;  3EK7 A;  2B1U A;  3GK4 X;  4JKT A;  3PJI A;  1J7O A;  1IJ6 A;  3RM1 A;  4DUQ A;  1C3Y A;  1N65 A;  3SS3 A;  3SIB A;  2GGM A;  3FS7 A;  2NZ0 A;  3TZ1 A;  3BJH A;  1BOC A;  2WCM A;  3B6X A;  1TUJ A;  2L2E A;  1NX3 A;  1OMD A;  1F71 A;  2ZND A;  3L4L A;  3L47 A;  4YI9 A;  2MBX A;  4YRU A;  1QV0 A;  4JD9 A;  2K7B A;  1CDN A;  3SG5 A;  1KSM A;  2YGU A;  1S5G Y;  1EG4 A;  2WOS A;  3HX4 A;  4DS7 A;  1NIW A;  2IS9 A;  5BPJ A;  2O60 A;  1SL9 A;  2LHL A;  3D77 A;  3DVK A;  4R1E A;  4OCI A;  1MUX A;  2BNX A;  5B8I B;  1B1G A;  1UWO A;  4L9M A;  2AMI A;  1TUZ A;  2CCM A;  2EC6 C;  2K0J A;  4NQG A;  1EG3 A;  5EL2 A;  1SR6 B;  4CFQ A;  4GNK B;  3VRO A;  3S0A A;  1CM4 A;  2KFG A;  2G2B A;  2COL B;  2NCO A;  1WDC B;  1OMV A;  2WCE A;  1YR5 A;  3TS5 C;  1YRT B;  4AOM A;  1T14 A;  1M31 A;  3WHU B;  3DYE A;  2P71 A;  3S0G A;  4GGF A;  1BR1 B;  2KFH A;  2ZN9 A;  2KDH A;  2LAP A;  3EVV A;  3TDI A;  1LA3 A;  1GGW A;  1UHH A;  2A4J A;  3PM8 A;  3VRQ A;  3M0W A;  4Q04 A;  1CMG A;  4OV2 A;  2PQL A;  1M39 A;  3DD4 A;  1XFW O;  2JU0 A;  1J7R A;  1F8H A;  1B7T Z;  4M2O A;  2M49 B;  2I94 A;  3TUY C;  3IQO A;  1B8L A;  2GV5 A;  2K2A A;  2CNP A;  2JT3 A;  2JWW A;  2SCP A;  1TNX A;  1CNP A;  1MF8 B;  1NCX A;  4XYN A;  2L5Y A;  1SL8 A;  2VRG A;  1CTR A;  1QX7 A;  1BLQ A;  4JQ0 D;  1ZMZ A;  2PSR A;  2MJW B;  1KK7 Z;  2KBM A;  3NSO A;  2LE9 B;  3GOF A;  5I2Q A;  3VB1 A;  1ALW A;  1ZUZ A;  3EVU A;  4PHN A;  1IQ3 A;  1YUS A;  1QWV A;  2JT8 A;  1DJY A;  1PSR A;  2P70 A;  3R1O A;  1BT6 A;  1TCO B;  1AJ4 A;  3TS5 B;  1QX5 B;  3KEV A;  4MLW A;  1LXF C;  3CR5 X;  1R2U A;  1IWQ A;  3CR2 A;  3KF9 A;  1DGV A;  1Y6W A;  1CLL A;  4MVF A;  1WRL A;  1Y0V H;  2JPO A;  4OVN F;  2BCA A;  2KI4 C;  1QTX A;  4MRY A;  1E8A A;  3PLF B;  5JJG A;  2JQ6 A;  4ORC B;  3QRX A;  4XJK B;  1OW4 A;  1CMF A;  4HRH A;  3O2P A;  1ZAC A;  4M2P A;  2JTZ A;  2H61 A;  3OGN A;  2LVV A;  4BY5 A;  1NSH A;  2LLU A;  1S5G Z;  3TUY B;  2H8V A;  4PHM A;  1A4P A;  2KFF A;  4WRI A;  5G08 A;  2K60 A;  1JF2 A;  2G9B A;  2KI6 C;  4HRG A;  1BMO A;  2HPS A;  2M97 A;  2H2K A;  2OPO A;  3PM2 A;  4XJK A;  5D69 A;  5D7F A;  3I5F B;  1ORG A;  1WRK A;  2L4H A;  1J1D A;  2F2P A;  1DT7 B;  4U8D A;  3IVT A;  3CLN A;  1S6I A;  1JBA A;  1K96 A;  1P28 A;  2M7N A;  2BE4 A;  3DY9 A;  2WND A;  1XFX O;  3SIA A;  1DVI A;  2EHB A;  1W9Z A;  4N1G A;  4NDD A;  2JT0 A;  2M1K B;  2PMY A;  1B47 A;  5CSN A;  1TTX A;  1M45 A;  2F3Z A;  2O5G A;  1V1G A;  1SBJ A;  1ODB A;  3NHI A;  2LMU A;  4PE4 A;  5K89 A;  2L4I A;  2ZRT A;  1N2D A;  1DEK A;  1L2O B;  2WC8 A;  2ZRS A;  5KSZ A;  3SS5 A;  2KI4 B;  3D73 A;  1CFF A;  4YGA A;  2ERB A;  1KFU S;  1BR4 B;  1N0Y A;  3BUO B;  2I2R E;  3DF0 B;  1QS7 A;  4GUK A;  3I5H B;  5FI2 A;  1PAL A;  5DKR A;  4YBH B;  1GM0 A;  2JC2 A;  1SR6 C;  3DXL A;  4GGF C;  3CR4 X;  1TCF A;  2QEO A;  1MQ1 A;  3KHE A;  3I5G B;  1WDC C;  1A29 A;  5AFP A;  2TN4 A;  2LMT A;  2KOT A;  1QIV A;  4INW A;  2BE6 A;  1S36 A;  1ZOT B;  3DF0 A;  3GK1 A;  4I5N B;  1S3P A;  2Y5I A;  2JOJ A;  1DEL A;  2KQ6 A;  1XK4 C;  1LKJ A;  1X02 A;  2SAS A;  2CXJ A;  3CYZ A;  5CSJ A;  2M9G A;  2KLE A;  2MRD A;  1DJW A;  1MXL C;  1Q80 A;  4HSZ A;  1B8C A;  2LCP A;  1ALV A;  1XFU O;  4PE7 A;  3I5I B;  4WQ3 A;  3AAK A;  2WC6 A;  4A4B A;  2BEC A;  3QME A;  1OZO A;  3ICB A;  3DVE A;  1CM1 A;  1C07 A;  1YUT A;  1DJG A;  3FE6 A;  3IF7 A;  1B8R A;  1RWY A;  3NHT A;  1KSO A;  3VRN A;  1JF0 A;  1DGU A;  2JUL A;  1K94 A;  2LAN A;  1OMR A;  4GFT A;  1H4B A;  2WCF A;  4CLN A;  1LA0 A;  2LVI A;  1SCM B;  2GGZ A;  3NGV A;  3C1V A;  1Y1U A;  1YX7 A;  1QJT A;  3IQQ A;  5FI7 A;  1QX2 A;  1LIN A;  1WRZ A;  3RZS A;  1PUL A;  4HRE E;  5FI6 A;  3FIA A;  1S6J A;  1QV1 A;  2F2O A;  3RLZ A;  2HF5 A;  4F7F A;  1TIZ A;  5FYX A;  2H61 C;  1R6P A;  2JZI A;  2ZNE A;  5ER4 X;  3A4U B;  1GGZ A;  1KWO C;  1MR8 A;  1PSB A;  5KU1 A;  1C7W A;  4QJ5 B;  2R2I A;  3OB1 B;  1AP4 A;  3LLE A;  1KQM B;  1SSE B;  3DVJ A;  3WNX B;  1K2H A;  1CDL A;  1XFY O;  1YVH A;  1XYD A;  1W7I B;  3KPX A;  4YGD B;  3CZ0 A;  1JWD A;  1UUR A;  4CPV A;  1QAS A;  1B9A A;  2E6W A;  5TNC A;  1SL7 A;  1JUO A;  3OP0 A;  1QIW A;  1XK4 A;  2FOT A;  3LK1 A;  1XA5 A;  2OTG B;  1MHO A;  2JNF A;  1NP8 A;  3S0D A;  1TWO A;  4GGN A;  2L98 A;  2BBM A;  3FWC A;  1IJ5 A;  3SG6 A;  1Z4H A;  3I5F C;  3OBV A;  1CDP A;  5KTY A;  3F45 A;  3BFA A;  4QJ3 B;  3PAL A;  4MN0 A;  3CZ2 A;  1FF1 A;  4GBA A;  2LHI A;  4DCK A;  2LP2 A;  2QPT A;  1VRK A;  2M29 A;  1OOF A;  1EH2 A;  1M46 A;  2ZKM X;  1K9K A;  2LP3 A;  1HQV A;  1A75 B;  1OZS A;  1Z2C B;  2QEB A;  1K8U A;  1SMG A;  3BOW B;  2WC5 A;  4YI8 A;  5HLO A;  1UHK A;  1UHJ A;  1EL4 A;  5CPV A;  1QLK A;  1L2O C;  1KWO B;  1RK9 A;  1F54 A;  5HYD A;  2PRU A;  1AK8 A;  1A75 A;  2JPT A;  1J7Q A;  1RJV A;  1WLM A;  1ZFS A;  2KYF A;  3CGA A;  3JTD C;  1IQ5 A;  2KAX A;  3BOW A;  3I5H C;  1FI6 A;  3AKB A;  3BFB A;  1UHI A;  1BJF A;  2FJY A;  2KI6 D;  2F8P A;  2AAO A;  2K7O A;  1DTL A;  3I5G C;  3NSK A;  1KFU L;  2CTN A;  3FWB A;  2E30 A;  2PAS A;  3R72 A;  5JOL A;  5HKW A;  1YX8 A;  1BOD A;  1PVA A;  1S26 D;  2JTT A;  4GAO A;  4D1E A;  4INX A;  2KGR A;  1BG1 A;  1J55 A;  3K1E A;  5AER A;  1J7P A;  1V1F A;  2M1U A;  1KFX L;  2OS8 B;  3D75 A;  1NX1 A;  5DKN A;  4ICB A;  2L0P A;  3TDZ A;  3I5I C;  1Y1A A;  3LCP C;  1TRF A;  3HCM A;  3R1P A;  4ZCV A;  1AHR A;  2LVK A;  3PN7 B;  1NCY A;  1SNL A;  4MZL A;  3SS4 A;  2KNE A;  1OOI X;  4IL1 A;  2HQ8 A;  3EKJ A;  3MSE B;  1IIO A;  3S0B A;  3FE9 A;  3GK2 A;  5J3X A;  1GJY A;  3V2L A;  3EVR A;  2LM5 A;  4E68 A;  5AXI A;  1TNW A;  1JSA A;  5DIC A;  1AUI B;  3BUN B;  3JTD B;  3AKA A;  3OX6 A;  1SKT A;  5I2O A;  4BY4 A;  4PE0 A;  1YVL A;  1TOP A;  3O6B A;  1NPQ A;  1SCM C;  3NXA A;  1YTZ C;  1K93 D;  2D8N A;  1IRJ A;  4P2Y B;  1CFP A;  1NCZ A;  1CDM A;  3D74 A;  3TDU A;  1MXE A;  2ISD A;  5GQQ C;  2I7A A;  2NLN A;  3B7A A;  1PK0 D;  1DJH A;  1PRW A;  1YRU B;  2KHN A;  1K90 D;  4YGB B;  4I5L B;  4A4C A;  2BL0 B;  1K95 A;  1WY9 A;  2KGB C;  3PSR A;  1FPW A;  3DVM A;  4CFR A;  2PYQ A;  3UO9 A;  1L7Z A;  2FCD A;  2LUX A;  1NX0 A;  1KQM C;  1IGV A; 
#chains in the Genus database with same CATH homology
 4CID A;  1S6C A;  2RGI A;  1W7J B;  2MAZ A;  2JRF A;  2K7D A;  4YGE B;  2LLT A;  2MLF C;  3SG2 A;  3OX5 A;  2LMV A;  4ETO A;  2LV7 A;  1XO5 A;  2BCB A;  2OTG C;  4I5J A;  5HKY A;  2CBL A;  3D0Y B;  2HQW A;  2EGD A;  2WCB A;  3CWG A;  2MA2 A;  1SCV A;  3BXK A;  3NSL A;  4MBE A;  3EK4 A;  3EK8 A;  5DKQ A;  1REC A;  3D10 A;  4ORA B;  3OHM B;  4JWQ A;  1UUS A;  3BUX B;  3BUM B;  3JVT B;  1RRO A;  1XFZ O;  3D0Y A;  1DJI A;  1UHN A;  2JXL A;  3LL8 B;  2L51 A;  3SG3 A;  2NXQ A;  2F33 A;  3WXA A;  1AJ5 A;  3AAJ A;  4FQO A;  5CSF A;  1CFD A;  1SW8 A;  1OOJ A;  2M3W A;  1GQM A;  3BYA A;  1U5I B;  2M8U A;  2Q91 A;  1BF5 A;  4OKH A;  4C0J A;  1YUR A;  1KK8 B;  4UPG A;  2LC5 A;  4TNC A;  2KSP A;  1OE9 B;  3OB2 B;  5HLV A;  2MHH A;  5I2L A;  1U5I A;  4PAL A;  1SYM A;  2Y1N A;  3K21 A;  1KQV A;  1A03 A;  4C0K A;  2LUC A;  4F0Z B;  3NSI A;  3CTN A;  5PAL A;  2LLS A;  2NCP A;  1IG5 A;  5IBW A;  2AUC A;  1HT9 A;  1JC2 A;  3KO0 A;  4MZK A;  4NDB A;  1TNQ A;  4PDZ A;  5I8N A;  2ZN8 A;  2OS8 C;  2KQY A;  2PVB A;  4MZJ A;  1EJ3 A;  1B4C A;  3ZNI A;  2CT9 A;  1NWD A;  1SPY A;  1J1E A;  4PHJ A;  1KCY A;  4MEW A;  3PN7 C;  2Y1M A;  5AEQ A;  5CSI A;  2K2F A;  1PVB A;  4YGC B;  4AQJ A;  2I18 A;  2Y4Q A;  4QJ4 B;  1K9P A;  4M2Q A;  2LNK A;  1SY9 A;  1QVI Y;  2BBN A;  2BKH B;  2KAV A;  3O78 A;  4USL A;  4ZCU A;  2F3Y A;  1D1O A;  1YUU A;  1G8I A;  1OQP A;  3H4S E;  2Q4U A;  2EC6 B;  1SK6 D;  5ER5 A;  1TNP A;  1MWN A;  1CKK A;  2JNX A;  1CLM A;  3VGO A;  1NYA A;  4NDC A;  2FJU B;  3LK0 A;  4DIR A;  2KBI A;  4FTG A;  1DJX A;  4I5K A;  1IKU A;  1QLS A;  1G33 A;  4N5X A;  1M63 B;  1CLB A;  1UP5 A;  2BL0 C;  4MSP A;  1F55 A;  1JFK A;  1G4Y R;  1A2X A;  3SJS A;  2ZFD A;  2L5X B;  1C7V A;  3BUW B;  4AQI A;  3EKH A;  4N1F A;  1CFC A;  1RFJ A;  2FCE A;  4MRX A;  3WHT B;  1DJZ A;  2PAL A;  1QAT A;  1S1E A;  2BCX A;  1OSA A;  2DOQ A;  1H8B A;  1TN4 A;  1F70 A;  1FBV A;  3CZT X;  4ORB B;  2M0R A;  3PFV A;  2LVJ A;  4PE1 A;  1QXP A;  1XFV O;  4DRW A;  3BQ3 A;  2BKI B;  1Y1X A;  1EXR A;  2KYC A;  3JVT C;  3VRP A;  1XVJ A;  4PCW A;  1AVS A;  1WLZ A;  2V53 A;  1F4Q A;  1JFJ A;  3PAT A;  1K9U A;  3VRR A;  1IH0 A;  3CS1 A;  5F6T A;  3SG4 A;  2K61 A;  1B7T Y;  1LVC D;  2WOR A;  2M7L A;  1KK8 C;  4GPL B;  2K7C A;  4OR9 B;  1NUB A;  2HET A;  2K8M B;  1DF0 B;  1NX2 A;  4WQ2 A;  3ZWH A;  1DMO A;  2JXC A;  2L50 A;  3SG7 A;  2MLE C;  1F4O A;  1CB1 A;  4P5O E;  3E3R A;  4PHK A;  5AAN A;  2P6B B;  2KAY A;  1FW4 A;  1KK7 Y;  2QAC A;  4JPZ B;  1FI5 A;  4C0L A;  5HKZ A;  1QVI Z;  3A8R A;  3O4Y A;  1RTP 1;  1SRA A;  1BU3 A;  1DF0 A;  1KFX S;  3EK7 A;  2B1U A;  3GK4 X;  1J7O A;  1IJ6 A;  3RM1 A;  4DUQ A;  1N65 A;  3SIB A;  2GGM A;  3FS7 A;  2NZ0 A;  3TZ1 A;  1BOC A;  2L2E A;  1NX3 A;  1OMD A;  1F71 A;  2ZND A;  4YI9 A;  2MBX A;  4YRU A;  1QV0 A;  2K7B A;  1CDN A;  3SG5 A;  1KSM A;  1S5G Y;  1EG4 A;  2WOS A;  3HX4 A;  4DS7 A;  1NIW A;  2IS9 A;  5BPJ A;  2O60 A;  1SL9 A;  2LHL A;  3DVK A;  4R1E A;  4OCI A;  1MUX A;  5B8I B;  1B1G A;  1UWO A;  4L9M A;  2AMI A;  2CCM A;  2EC6 C;  2K0J A;  4NQG A;  1EG3 A;  1SR6 B;  4CFQ A;  4GNK B;  3VRO A;  1CM4 A;  2KFG A;  2G2B A;  2COL B;  2NCO A;  1WDC B;  1OMV A;  2WCE A;  1YR5 A;  3TS5 C;  1YRT B;  4AOM A;  1M31 A;  3WHU B;  4GGF A;  1BR1 B;  2KFH A;  2ZN9 A;  2KDH A;  2LAP A;  3EVV A;  3TDI A;  1LA3 A;  1GGW A;  1UHH A;  2A4J A;  3PM8 A;  3VRQ A;  3M0W A;  4Q04 A;  1CMG A;  4OV2 A;  3DD4 A;  1M39 A;  1XFW O;  2JU0 A;  1J7R A;  1F8H A;  1B7T Z;  4M2O A;  2M49 B;  2I94 A;  3TUY C;  3IQO A;  1B8L A;  2GV5 A;  2K2A A;  2CNP A;  2JT3 A;  2JWW A;  2SCP A;  1TNX A;  1CNP A;  1MF8 B;  1NCX A;  4XYN A;  2VRG A;  1SL8 A;  1CTR A;  1QX7 A;  1BLQ A;  4JQ0 D;  1ZMZ A;  2PSR A;  2MJW B;  1KK7 Z;  2KBM A;  3NSO A;  2LE9 B;  3GOF A;  5I2Q A;  1ALW A;  1ZUZ A;  3EVU A;  4PHN A;  1IQ3 A;  1YUS A;  2JT8 A;  1DJY A;  1PSR A;  1BT6 A;  1TCO B;  1AJ4 A;  3TS5 B;  1QX5 B;  3KEV A;  4MLW A;  1LXF C;  3CR5 X;  1R2U A;  1IWQ A;  3CR2 A;  3KF9 A;  1DGV A;  1Y6W A;  1CLL A;  4MVF A;  1WRL A;  1Y0V H;  4OVN F;  2BCA A;  2KI4 C;  1QTX A;  4MRY A;  1E8A A;  3PLF B;  5JJG A;  2JQ6 A;  4ORC B;  3QRX A;  4XJK B;  1CMF A;  4HRH A;  3O2P A;  1ZAC A;  4M2P A;  2JTZ A;  2H61 A;  2LVV A;  4BY5 A;  1NSH A;  2LLU A;  1S5G Z;  3TUY B;  4PHM A;  1A4P A;  2KFF A;  4WRI A;  5G08 A;  1JF2 A;  2G9B A;  2KI6 C;  4HRG A;  1BMO A;  2HPS A;  2M97 A;  2H2K A;  2OPO A;  4XJK A;  5D69 A;  5D7F A;  3I5F B;  1WRK A;  2L4H A;  1J1D A;  2F2P A;  1DT7 B;  4U8D A;  3CLN A;  1S6I A;  1JBA A;  1K96 A;  2M7N A;  2BE4 A;  2WND A;  1XFX O;  3SIA A;  1DVI A;  2EHB A;  4N1G A;  4NDD A;  2JT0 A;  2M1K B;  2PMY A;  1B47 A;  5CSN A;  1TTX A;  1M45 A;  2F3Z A;  2O5G A;  1V1G A;  1SBJ A;  1ODB A;  4PE4 A;  2LMU A;  5K89 A;  2L4I A;  2ZRT A;  1N2D A;  1L2O B;  5KSZ A;  2WC8 A;  2ZRS A;  2KI4 B;  1CFF A;  4YGA A;  1KFU S;  1BR4 B;  1N0Y A;  3BUO B;  2I2R E;  3DF0 B;  1QS7 A;  4GUK A;  3I5H B;  1PAL A;  5DKR A;  4YBH B;  2JC2 A;  1SR6 C;  4GGF C;  3CR4 X;  1TCF A;  1MQ1 A;  3KHE A;  3I5G B;  1WDC C;  1A29 A;  5AFP A;  2TN4 A;  2LMT A;  2KOT A;  1QIV A;  2BE6 A;  1S36 A;  1ZOT B;  3DF0 A;  3GK1 A;  4I5N B;  1S3P A;  2Y5I A;  2JOJ A;  2KQ6 A;  1XK4 C;  1LKJ A;  1X02 A;  2SAS A;  2CXJ A;  5CSJ A;  2M9G A;  2MRD A;  1DJW A;  1MXL C;  1Q80 A;  4HSZ A;  1B8C A;  2LCP A;  1ALV A;  1XFU O;  4PE7 A;  3I5I B;  4WQ3 A;  3AAK A;  4A4B A;  2BEC A;  1OZO A;  3ICB A;  3DVE A;  1CM1 A;  1C07 A;  1YUT A;  1DJG A;  3IF7 A;  1B8R A;  1RWY A;  1KSO A;  3VRN A;  1JF0 A;  1DGU A;  2JUL A;  1K94 A;  2LAN A;  1OMR A;  4GFT A;  1H4B A;  2WCF A;  4CLN A;  1LA0 A;  2LVI A;  1SCM B;  2GGZ A;  3C1V A;  1Y1U A;  1YX7 A;  1QJT A;  3IQQ A;  1QX2 A;  1LIN A;  1WRZ A;  1PUL A;  4HRE E;  3FIA A;  1S6J A;  1QV1 A;  2F2O A;  3RLZ A;  2HF5 A;  1TIZ A;  5FYX A;  2H61 C;  1R6P A;  2JZI A;  2ZNE A;  5ER4 X;  3A4U B;  1GGZ A;  1KWO C;  1MR8 A;  1PSB A;  5KU1 A;  1C7W A;  4QJ5 B;  2R2I A;  3OB1 B;  1AP4 A;  3LLE A;  1KQM B;  3DVJ A;  3WNX B;  1K2H A;  1CDL A;  1XFY O;  1YVH A;  1XYD A;  1W7I B;  3KPX A;  4YGD B;  1JWD A;  1UUR A;  4CPV A;  1QAS A;  1B9A A;  2E6W A;  5TNC A;  1SL7 A;  1JUO A;  3OP0 A;  1QIW A;  1XK4 A;  2FOT A;  3LK1 A;  1XA5 A;  2OTG B;  1MHO A;  2JNF A;  1NP8 A;  4GGN A;  2L98 A;  2BBM A;  3FWC A;  1IJ5 A;  3SG6 A;  3I5F C;  1CDP A;  5KTY A;  3F45 A;  4QJ3 B;  3PAL A;  4MN0 A;  1FF1 A;  4GBA A;  2LHI A;  4DCK A;  2LP2 A;  2QPT A;  1VRK A;  2M29 A;  1EH2 A;  1M46 A;  2ZKM X;  1K9K A;  2LP3 A;  1HQV A;  1A75 B;  1OZS A;  1K8U A;  1SMG A;  3BOW B;  4YI8 A;  5HLO A;  1UHK A;  1UHJ A;  1EL4 A;  5CPV A;  1QLK A;  1L2O C;  1KWO B;  1RK9 A;  1F54 A;  5HYD A;  2PRU A;  1AK8 A;  1A75 A;  2JPT A;  1J7Q A;  1RJV A;  1WLM A;  1ZFS A;  2KYF A;  3CGA A;  3JTD C;  1IQ5 A;  2KAX A;  3BOW A;  3I5H C;  1FI6 A;  3AKB A;  1UHI A;  1BJF A;  2KI6 D;  2F8P A;  2AAO A;  2K7O A;  1DTL A;  3I5G C;  3NSK A;  1KFU L;  2CTN A;  3FWB A;  2E30 A;  2PAS A;  5JOL A;  5HKW A;  1YX8 A;  1BOD A;  1PVA A;  1S26 D;  2JTT A;  4GAO A;  4D1E A;  2KGR A;  1BG1 A;  1J55 A;  5AER A;  1J7P A;  1V1F A;  2M1U A;  1KFX L;  2OS8 B;  1NX1 A;  5DKN A;  4ICB A;  2L0P A;  3TDZ A;  3I5I C;  1Y1A A;  3LCP C;  1TRF A;  3HCM A;  4ZCV A;  1AHR A;  2LVK A;  3PN7 B;  1NCY A;  1SNL A;  4MZL A;  2KNE A;  4IL1 A;  2HQ8 A;  3EKJ A;  3MSE B;  3GK2 A;  5J3X A;  1GJY A;  3EVR A;  2LM5 A;  4E68 A;  5AXI A;  1TNW A;  1JSA A;  1AUI B;  3BUN B;  3JTD B;  3AKA A;  3OX6 A;  1SKT A;  5I2O A;  4BY4 A;  4PE0 A;  1YVL A;  1TOP A;  3O6B A;  1NPQ A;  1SCM C;  3NXA A;  1YTZ C;  1K93 D;  2D8N A;  1IRJ A;  4P2Y B;  1CFP A;  1NCZ A;  1CDM A;  3TDU A;  1MXE A;  2ISD A;  5GQQ C;  2I7A A;  2NLN A;  1PK0 D;  1DJH A;  1PRW A;  1YRU B;  2KHN A;  1K90 D;  4YGB B;  4I5L B;  4A4C A;  2BL0 B;  1K95 A;  1WY9 A;  2KGB C;  3PSR A;  1FPW A;  3DVM A;  4CFR A;  1L7Z A;  2FCD A;  2LUX A;  1NX0 A;  1KQM C;  1IGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...