4HRHA

Crystal structure of p11-annexin a2(n-terminal) fusion protein in complex with smarca3 peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
107
Chain Sequence
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQGDSTVHEILSKLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A10, Annexin A2
publication title SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 33
structure length 107
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4hrhA00
2BL0B 2LLSA 1DGVA 1SMGA 1UP5A 1BG1A 5CSIA 1IG5A 2WNDA 2PRUA 3BUOB 1S6JA 5TNCA 3FWCA 5I8NA 4QJ4B 1WDCB 1XK4C 2LMTA 2DOQA 2F2PA 2NCOA 4USLA 2JU0A 2Y1MA 4GFTA 2WORA 4PE1A 1A75B 4TNCA 1MWNA 2G9BA 3PM8A 1Q80A 1ALVA 3OP0A 5D69A 1IKUA 1K94A 4YI8A 5HKYA 4U8DA 4MN0A 1KQMC 4CFQA 1GGZA 3CTNA 2ZFDA 3PFVA 2L51A 1XFYO 1K96A 1CTRA 3SG6A 3IF7A 1M31A 2Q4UA 2SCPA 5AERA 1S26D 2KYCA 4HRGA 3HX4A 1K93D 1EL4A 3KEVA 4I5NB 1ODBA 4ZCVA 1N2DA 1S6CA 2G2BA 2GV5A 1A03A 2K8MB 1PSBA 2K0JA 1FPWA 2LCPA 2ZKMX 3PSRA 4JPZB 1NIWA 1J55A 4GPLB 2JQ6A 1W7JB 4HRHA 2JNFA 3DD4A 3NSKA 3PATA 2H61C 3IQOA 5PALA 3SIBA 2BBNA 1HT9A 1B7TY 2D8NA 1UWOA 1SL9A 1C07A 1BR4B 1WY9A 1AK8A 1LKJA 2LC5A 3WNXB 1S6IA 1CLBA 1Y1UA 2BE6A 1CNPA 1SL7A 3CGAA 1GJYA 4DIRA 3LK1A 2K7CA 2LP2A 2PVBA 4I5KA 1J1DA 2H2KA 4PHNA 1B8CA 2M0RA 2OPOA 1PVBA 2KQ6A 1BT6A 1CMFA 4I5LB 2CT9A 4MZLA 1LXFC 2JC2A 4QJ3B 1MF8B 2ISDA 1YVLA 2KDHA 2KBMA 1CLMA 4MVFA 1QTXA 1DJXA 2KI4B 1YTZC 1F70A 1D1OA 3EK8A 3EVRA 2M97A 3FWBA 2JT3A 1A2XA 3BOWB 1QASA 1KFXS 2KI6C 1TNXA 1SR6C 1BOCA 4NDDA 1ALWA 1RROA 1DF0A 3I5IC 3NSOA 4YGAA 2KYFA 2K7DA 2O5GA 1F4OA 1NX3A 1TTXA 3EKHA 1DTLA 4N1GA 1K90D 1IJ5A 1NWDA 1ZACA 4IL1A 1QIVA 4WRIA 1NPQA 1IWQA 2JT8A 3CLNA 1F8HA 1CLLA 2OS8C 2AAOA 3EVVA 1CKKA 2BKIB 4FQOA 5KSZA 2WCFA 1SPYA 1M46A 2Y5IA 1K2HA 1RWYA 1SCMB 5HLVA 1UHKA 2FOTA 3TDIA 4M2PA 3ICBA 2LMVA 3SIAA 3BUXB 2BECA 2LHLA 1BR1B 2F33A 1N65A 1LA0A 1V1GA 4XJKB 4DCKA 2Y4QA 4PCWA 3GK4X 4N1FA 4ZCUA 3PN7B 1DGUA 3LCPC 1WRLA 4FTGA 1E8AA 1B8LA 2KNEA 2P6BB 4A4BA 1EG3A 2L4HA 3KPXA 5HKWA 4PE7A 4CFRA 2LUXA 1EXRA 1RK9A 2K61A 3JVTC 4P5OE 1F4QA 5K89A 3I5HB 4PALA 1SYMA 3SG7A 2WCBA 3VGOA 5I2LA 1IH0A 4GGFA 1QLKA 4AQIA 1YRUB 3FIAA 2L50A 3TUYB 2M1UA 3JTDB 3KHEA 3OX5A 1A4PA 1OMDA 1FBVA 1BMOA 1JFJA 1FI5A 3CS1A 4OCIA 2KAXA 1AP4A 3I5GC 2L98A 3VRPA 3EK4A 1IRJA 2NCPA 2AMIA 1JF2A 3GK2A 2F3ZA 2FCDA 1DJZA 3AAKA 2PASA 1K9UA 2JRFA 4E68A 2QPTA 1Y1AA 4YBHB 2OTGB 2PMYA 2I2RE 1M45A 2CNPA 2F3YA 5GQQC 3D0YB 3TS5B 1BODA 3BUWB 1TCOB 2ZNEA 2MJWB 2JZIA 4GGNA 4HSZA 3O4YA 1CB1A 2LNKA 2LVVA 4AQJA 3ZNIA 1PRWA 1A75A 1G33A 3HCMA 4P2YB 3LLEA 2LAPA 2MHHA 2M49B 4DS7A 4OKHA 2LUCA 3BYAA 1B4CA 1YRTB 4CIDA 1PALA 2LANA 1UHNA 2BE4A 3WHTB 1DT7B 1BF5A 2KQYA 1IQ3A 2F2OA 2EC6B 4N5XA 1DMOA 1CM1A 1UHIA 2LE9B 3CZTX 1CFPA 2JWWA 3LL8B 2SASA 1A29A 1KK8B 1SNLA 3MSEB 2MBXA 5G08A 5CPVA 3VROA 2M9GA 4JWQA 1MR8A 4UPGA 3TZ1A 4YGEB 2Y1NA 2AUCA 3A8RA 4OR9B 5AEQA 4PHJA 1OOJA 1PVAA 3D10A 1JUOA 1DVIA 1YUSA 1KWOC 2A4JA 4YI9A 2PSRA 5HKZA 1OSAA 1AHRA 1SCMC 1TRFA 4GGFC 1R6PA 3BXKA 5DKNA 1IJ6A 3A4UB 1BU3A 1NX0A 3OB1B 4YGDB 4NDCA 4XYNA 1QXPA 3I5FC 1RJVA 2KOTA 2I18A 3RLZA 1JC2A 1L2OC 1KQMB 3CR5X 4YGBB 1CDPA 1TOPA 3C1VA 4MZJA 1KSOA 1V1FA 2L4IA 3ZWHA 2K2AA 1CM4A 4BY5A 5ER4X 4I5JA 2QACA 1XFZO 2JNXA 1YUUA 1HQVA 3EVUA 1H4BA 2M7LA 1J7QA 4MZKA 1TNPA 1YX7A 3I5HC 3EKJA 2BL0C 3AAJA 4NQGA 4HREE 5I2OA 1KQVA 2VRGA 5FYXA 4OV2A 1TNWA 5B8IB 2TN4A 2WC8A 1WDCC 1F71A 1JF0A 3KO0A 4D1EA 1B1GA 3RM1A 2LMUA 5F6TA 2JXLA 3F45A 2PALA 3PALA 1KFXL 2LVIA 3BUNB 2NZ0A 1PSRA 4MLWA 2HETA 3CR2A 4C0JA 3BOWA 2KGBC 2JTZA 3NSLA 4A4CA 1UURA 3DF0B 1CDLA 1XFXO 2BCXA 1U5IB 2ZRTA 2KSPA 3SJSA 4QJ5B 1KK7Z 1F55A 4R1EA 2M7NA 3SG4A 3TS5C 1K9PA 1B8RA 2ZRSA 2K7BA 1KFUL 3OX6A 4GNKB 1DJHA 1XVJA 1XYDA 2L5XB 3E3RA 4WQ3A 1CFFA 1SW8A 1JFKA 3O78A 3WHUB 1AVSA 5BPJA 4PE4A 3WXAA 1RFJA 1BLQA 1H8BA 2BKHB 2KHNA 4MRYA 1KCYA 4PHKA 1MHOA 1TNQA 1AJ5A 1QIWA 2EC6C 2EGDA 1ZOTB 2RGIA 2L2EA 1DJWA 1UUSA 1NYAA 3DVKA 4MSPA 1N0YA 2V53A 3SG2A 2KAVA 4XJKA 1J1EA 4AOMA 1MQ1A 3IQQA 5CSFA 5AFPA 1LVCD 1QS7A 2B1UA 1SL8A 3BQ3A 1SR6B 1NP8A 2LLUA 2BBMA 3OB2B 1MXEA 1OZSA 1X02A 1LA3A 2KFHA 1MXLC 2ZN8A 1Y6WA 3I5IB 4ORBB 4CLNA 2WCEA 1CMGA 4OVNF 1AJ4A 2NLNA 1JBAA 1KSMA 2GGMA 1CFDA 3O6BA 1G4YR 1YURA 2KBIA 5JJGA 1GGWA 2OS8B 2MA2A 4GAOA 1DJGA 1RTP1 2HQ8A 2KGRA 2FCEA 1WLZA 5JOLA 1OE9B 5CSJA 4ORAB 1NUBA 1SBJA 1XFVO 2KI4C 2LM5A 1Y1XA 2MLEC 1S36A 2LLTA 3NXAA 4C0KA 5IBWA 3CWGA 1K8UA 1YR5A 2E30A 3FS7A 1ZFSA 1QVIZ 4C0LA 1WRKA 1FW4A 3DVEA 2I7AA 2JULA 1IQ5A 1B47A 1UHJA 5KU1A 2M29A 2M3WA 3GK1A 2O60A 2F8PA 3D0YA 3JVTB 1PK0D 1DJYA 2JPTA 2IS9A 1S3PA 1XFUO 4PHMA 4YGCB 1KK7Y 3H4SE 5D7FA 1SY9A 1EJ3A 1OZOA 3PLFB 1WRZA 2KI6D 3O2PA 2CTNA 3LK0A 4M2QA 1QLSA 1SCVA 2BCAA 3TDZA 5KTYA 4MRXA 4PE0A 1W7IB 2KAYA 2LV7A 2KFGA 1B9AA 3AKBA 3I5GB 4ETOA 3SG5A 3KF9A 2GGZA 2COLB 2M1KB 1BJFA 1L7ZA 2M8UA 4M2OA 1TN4A 1NSHA 3AKAA 1AUIB 2CBLA 1S1EA 2I94A 1QX7A 4YRUA 2NXQA 1C7WA 2JTTA 1QJTA 1NX1A 1TIZA 3PN7C 3SG3A 4NDBA 4L9MA 1DF0B 1QV1A 3VRNA 2K2FA 2KFFA 2ZNDA 1K95A 1CDNA 1IGVA 4PDZA 3VRQA 2CCMA 4F0ZB 1JWDA 1S5GY 5I2QA 1SK6D 1XK4A 1CFCA 1MUXA 1J7PA 1C7VA 2EHBA 1JSAA 1XO5A 1YVHA 3DVJA 2CXJA 3M0WA 3GOFA 3TUYC 3JTDC 1EH2A 1QX2A 4WQ2A 2JOJA 1J7OA 1NX2A 1LINA 4CPVA 3QRXA 1XFWO 1XA5A 4BY4A 1ZUZA 2LVKA 1QV0A 1FI6A 4ORCB 1G8IA 1YUTA 1NCZA 2HPSA 5DKQA 3DVMA 1UHHA 2JT0A 1CDMA 2HQWA 2L0PA 2OTGC 1K9KA 2LVJA 2WOSA 5ER5A 1TCFA 2MLFC 1EG4A 1M63B 1QVIY 5HLOA 1SRAA 1QX5B 4MEWA 1WLMA 2MAZA 4DRWA 1GQMA 4GBAA 1KWOB 1VRKA 1KFUS 5CSNA 3BUMB 4GUKA 2JXCA 1OMVA 3CR4X 1QATA 2Q91A 1NCYA 2LHIA 1OQPA 1F54A 1B7TZ 1ZMZA 2E6WA 3NSIA 4DUQA 4MBEA 1M39A 1R2UA 2H61A 2R2IA 1PULA 1J7RA 1SKTA 3I5FB 5AANA 2K7OA 2BCBA 5J3XA 1L2OB 3OHMB 2LP3A 2FJUB 5AXIA 5DKRA 4Q04A 1OMRA 2MRDA 1DJIA 1KK8C 3DF0A 3K21A 1FF1A 1Y0VH 1U5IA 1RECA 3TDUA 2ZN9A 3EK7A 1YX8A 1NCXA 4ICBA 3VRRA 4JQ0D 2HF5A 1S5GZ 5HYDA
chains in the Genus database with same CATH superfamily
2BL0B 4INXA 2LLSA 1DGVA 1SMGA 1TUZA 1UP5A 1BG1A 5CSIA 1IG5A 2WNDA 2PRUA 3BUOB 1S6JA 5TNCA 3FWCA 5I8NA 4QJ4B 1WDCB 1XK4C 2LMTA 2DOQA 2F2PA 2NCOA 4USLA 2JU0A 2Y1MA 4GFTA 2WORA 2ERBA 4PE1A 1A75B 4TNCA 3K1EA 1MWNA 2G9BA 3PM8A 1Q80A 1ALVA 3OP0A 5D69A 1IKUA 1K94A 4YI8A 5HKYA 4U8DA 4MN0A 1KQMC 4CFQA 1GGZA 3CTNA 3CZ1A 2ZFDA 3PFVA 2L51A 1XFYO 1K96A 1CTRA 3SG6A 3IF7A 5FI7A 1M31A 3S0EA 5DICA 1Z2CB 2Q4UA 2SCPA 5AERA 1S26D 3CABA 2KYCA 4HRGA 3HX4A 3DZTA 1K93D 1EL4A 3KEVA 4I5NB 1ODBA 4ZCVA 1N2DA 1S6CA 2G2BA 2GV5A 1A03A 2K8MB 3NGVA 1PSBA 2K0JA 1FPWA 2LCPA 2ZKMX 3PSRA 1DELA 4JPZB 1NIWA 1J55A 4GPLB 2JQ6A 1W7JB 4HRHA 2JNFA 3B7AA 3DD4A 3NSKA 3PATA 2KLEA 2H61C 2QEOA 3IQOA 5PALA 3SIBA 2BBNA 1HT9A 1B7TY 2D8NA 1UWOA 1SL9A 1C07A 1BR4B 1WY9A 1AK8A 3OGNA 4KYNA 1LKJA 2LC5A 3S0DA 3WNXB 1S6IA 1CLBA 1Y1UA 2BE6A 1CNPA 1SL7A 3CGAA 1GJYA 4DIRA 3LK1A 2K7CA 3FE8A 2LP2A 2PVBA 4I5KA 1J1DA 3S0AA 2H2KA 4PHNA 1B8CA 2M0RA 2OPOA 1PVBA 2KQ6A 1BT6A 3DYEA 1CMFA 4I5LB 2CT9A 4MZLA 1XFRA 1LXFC 2JC2A 4QJ3B 1MF8B 2ISDA 1YVLA 2KDHA 2KBMA 1CLMA 4MVFA 1QTXA 1DJXA 2KI4B 2FJYA 4IJ7A 3D77A 1YTZC 1F70A 2WCKA 1D1OA 3EK8A 2QEVA 3EVRA 2M97A 3FWBA 2JT3A 1A2XA 3BOWB 4OZDA 1QASA 1KFXS 2KI6C 1TNXA 1SR6C 1BOCA 3B6XA 4NDDA 1ALWA 1RROA 1DF0A 3I5IC 3NSOA 4JD9A 4YGAA 2KYFA 2K7DA 3SS5A 2O5GA 1F4OA 1NX3A 1TTXA 3EKHA 4F7FA 1DTLA 4N1GA 1K90D 1IJ5A 1NWDA 1ZACA 4IL1A 1QIVA 4WRIA 1NPQA 1IWQA 2JT8A 3CLNA 1F8HA 1CLLA 2OS8C 2AAOA 3EVVA 1CKKA 2BKIB 4FQOA 5KSZA 2WCFA 1SPYA 3FE6A 1M46A 2Y5IA 1K2HA 1C3YA 1RWYA 1SCMB 5HLVA 1UHKA 2FOTA 3TDIA 4M2PA 3ICBA 2LMVA 3SIAA 3FE9A 3BUXB 2BECA 2LHLA 1BR1B 2F33A 1N65A 1LA0A 1V1GA 3R1PA 4XJKB 3UNWA 2Y4QA 4PCWA 4DCKA 1P28A 3GK4X 4N1FA 3V2LA 1W9ZA 4ZCUA 3BFHA 3PN7B 3R72A 1DGUA 3LCPC 1WRLA 3NHIA 4FTGA 1E8AA 1B8LA 2KNEA 2P6BB 4A4BA 1EG3A 2L4HA 3KPXA 5HKWA 4PE7A 4CFRA 2LUXA 1EXRA 1RK9A 2K61A 3JVTC 3S0BA 4P5OE 1F4QA 5K89A 3I5HB 4PALA 1SYMA 3SG7A 2WCBA 3VGOA 5I2LA 1IH0A 4GGFA 1QLKA 4AQIA 1YRUB 3FIAA 2L50A 3TUYB 2M1UA 3JTDB 3KHEA 3OX5A 1DEKA 1A4PA 1OMDA 1FBVA 1BMOA 1JFJA 1FI5A 3CS1A 4OCIA 2KAXA 1AP4A 2PQLA 2L98A 3I5GC 3VRPA 3NHTA 3EK4A 1IRJA 2NCPA 2AMIA 1JF2A 3GK2A 2F3ZA 2FCDA 1DJZA 3AAKA 2PASA 1K9UA 2JRFA 4E68A 2QPTA 1Y1AA 2KPHA 4YBHB 4JKTA 2OTGB 2PMYA 2I2RE 1M45A 2CNPA 2F3YA 5GQQC 3D0YB 2WCJA 3TS5B 2JPOA 1BODA 3BUWB 1TCOB 2ZNEA 2MJWB 2JZIA 4GGNA 4HSZA 3O4YA 1CB1A 2LNKA 5D3OA 2LVVA 4AQJA 3ZNIA 1PRWA 1A75A 1G33A 2GTEA 3HCMA 3LLEA 4P2YB 2LAPA 2MHHA 2M49B 4DS7A 4OKHA 2LUCA 3BYAA 1B4CA 1YRTB 4CIDA 1PALA 2LANA 1UHNA 2BE4A 3WHTB 1DT7B 1BF5A 2KQYA 1IQ3A 2F2OA 2EC6B 4N5XA 1DMOA 1CM1A 1UHIA 2LE9B 3CZTX 1CFPA 2JWWA 3LL8B 2SASA 1A29A 1KK8B 2BNXA 1SNLA 3MSEB 2MBXA 5G08A 5CPVA 3VROA 2M9GA 4JWQA 1MR8A 3L47A 4UPGA 2L2CA 3TZ1A 4YGEB 2Y1NA 2AUCA 3CZ2A 3A8RA 3Q8IA 4OR9B 5AEQA 4PHJA 1OOJA 1PVAA 2QDIA 3D10A 1JUOA 1DVIA 1YUSA 1KWOC 2A4JA 4YI9A 2PSRA 5HKZA 1OSAA 1AHRA 1SCMC 1TRFA 4GGFC 1R6PA 3BXKA 5DKNA 1IJ6A 3A4UB 3D74A 1BU3A 1NX0A 3OB1B 3B88A 4YGDB 4NDCA 4XYNA 1QXPA 3I5FC 2H8VA 1DC1A 2KLDA 1RJVA 2KOTA 2I18A 3RLZA 1JC2A 1L2OC 1KQMB 3CR5X 4YGBB 1CDPA 2BAPA 1TOPA 3C1VA 4MZJA 1KSOA 1V1FA 2L4IA 3ZWHA 2K2AA 1CM4A 4BY5A 5ER4X 4I5JA 3CDNA 2QACA 1XFZO 2JNXA 1YUUA 2WCMA 1HQVA 3EVUA 1H4BA 3R1VA 2M7LA 3SS3A 4MZKA 1TNPA 1J7QA 1YX7A 2P71A 3I5HC 3EKJA 2BL0C 3AAJA 4NQGA 5FI2A 4HREE 5I2OA 1KQVA 1LS8A 2VRGA 5FYXA 4OV2A 1TNWA 5B8IB 2TN4A 4PT1A 2WC8A 1WDCC 1F71A 1JF0A 3BJHA 3KO0A 4D1EA 1B1GA 3RM1A 2LMUA 5F6TA 2JXLA 3F45A 2PALA 3PALA 1KFXL 2LVIA 3BUNB 2NZ0A 1PSRA 4MLWA 1SSEB 2HETA 3CR2A 4C0JA 3BOWA 2KGBC 2JTZA 3NSLA 1TWOA 4A4CA 1UURA 3DF0B 1CDLA 1OOGA 1XFXO 2BCXA 1U5IB 2ZRTA 2KSPA 3BFBA 3SJSA 1KK7Z 4QJ5B 1F55A 4R1EA 2M7NA 3SG4A 3TS5C 1K9PA 1CFFA 1B8RA 2ZRSA 2K7BA 1KFUL 3OX6A 4GNKB 1DJHA 1XVJA 1XYDA 2L5XB 3E3RA 4WQ3A 3D73A 1SW8A 1JFKA 3O78A 3OBVA 1AVSA 3WHUB 5BPJA 4PE4A 1C3ZA 3WXAA 1RFJA 1DQEA 1BLQA 1H8BA 3O4XA 2BKHB 2KHNA 4MRYA 1KCYA 4PHKA 1MHOA 1TNQA 1AJ5A 1QIWA 2EC6C 2EGDA 1ZOTB 2RGIA 3RZSA 2L2EA 1DJWA 1UUSA 1NYAA 3DVKA 4MSPA 1N0YA 2V53A 3SG2A 2KAVA 3CZ0A 1J1EA 4XJKA 1MQ1A 2QEHA 3IQQA 5CSFA 3UO9A 4AOMA 1LVCD 5AFPA 1QS7A 2B1UA 1SL8A 3BQ3A 1SR6B 1NP8A 2LLUA 2BBMA 3OB2B 1MXEA 1OZSA 1X02A 1LA3A 3BFAA 2WC6A 2KFHA 1MXLC 1OOFA 1Y6WA 2ZN8A 2L5YA 3I5IB 3L4AA 4ORBB 4CLNA 2WCEA 1CMGA 4OVNF 3CYZA 1AJ4A 2NLNA 1JBAA 1KSMA 2GGMA 1CFDA 3O6BA 1G4YR 1YURA 2KBIA 5JJGA 2P70A 3DY9A 1GGWA 3IVTA 2OS8B 5FI6A 2MA2A 4GAOA 1DJGA 1RTP1 2HQ8A 2KGRA 1Z4HA 1WLZA 2FCEA 5JOLA 1OE9B 5CSJA 4ORAB 1NUBA 1SBJA 1XFVO 2KI4C 2LM5A 1Y1XA 2MLEC 1S36A 2LLTA 3NXAA 4C0KA 5IBWA 3CWGA 1K8UA 1YR5A 3DXLA 2E30A 3FS7A 1ZFSA 1QVIZ 4C0LA 1WRKA 1FW4A 3DVEA 2I7AA 2WCHA 2WC5A 2JULA 1IQ5A 1B47A 1UHJA 5KU1A 3D78A 2M29A 2M3WA 3GK1A 2O60A 2F8PA 3D0YA 1OOIX 3JVTB 1PK0D 1DJYA 3SS4A 2JPTA 2IS9A 5HL1A 1S3PA 1XFUO 4PHMA 4YGCB 1KK7Y 3H4SE 5D7FA 1SY9A 1EJ3A 1OZOA 3PLFB 1WRZA 2KI6D 2WCLA 2CTNA 3LK0A 3O2PA 3VB1A 4M2QA 1QLSA 1SCVA 2BCAA 3TDZA 5KTYA 5I94A 4MRXA 3N7HA 4PE0A 1W7IB 2KAYA 2LV7A 2KFGA 1B9AA 3AKBA 3I5GB 4ETOA 3SG5A 3KF9A 1OOHA 2GGZA 3B87A 2COLB 2M1KB 1BJFA 1L7ZA 2M8UA 4M2OA 1TN4A 1NSHA 3AKAA 1AUIB 2CBLA 1S1EA 3S0FA 2I94A 1QX7A 4YRUA 2NXQA 1C7WA 2JTTA 1QJTA 1NX1A 1TIZA 3PN7C 3SG3A 1GM0A 4NDBA 4L9MA 1DF0B 1QV1A 3VRNA 2K2FA 2KFFA 2ZNDA 1K95A 1CDNA 1IGVA 4PDZA 3VRQA 2CCMA 4F0ZB 1JWDA 1S5GY 5I2QA 1SK6D 1XK4A 2PYQA 1MUXA 1CFCA 1J7PA 1C7VA 3EG5B 2EHBA 1JSAA 1XO5A 1YVHA 3R1OA 3D75A 4INWA 1IIOA 3DVJA 5EL2A 3QMEA 2CXJA 3M0WA 3GOFA 3TUYC 3JTDC 1EH2A 3L4LA 1QX2A 1QWVA 4WQ2A 2JOJA 1J7OA 1NX2A 1LINA 4CPVA 3QRXA 1XFWO 1XA5A 4BY4A 1ZUZA 2LVKA 1QV0A 1FI6A 1ORGA 4ORCB 4FQTA 1G8IA 1YUTA 1NCZA 2HPSA 5DKQA 3DVMA 1UHHA 2JT0A 1CDMA 2HQWA 2L0PA 2OTGC 1K9KA 2K60A 2LVJA 2YGUA 2WOSA 5ER5A 1TCFA 2MLFC 1EG4A 1M63B 3D76A 1QVIY 3PM2A 5HLOA 1SRAA 1QX5B 4MEWA 1WLMA 2MAZA 4DRWA 1GQMA 4GBAA 1T14A 1KWOB 1VRKA 1KFUS 5CSNA 3BUMB 2QEBA 4GUKA 2JXCA 1OMVA 3CR4X 3PJIA 1QATA 2Q91A 1NCYA 2LHIA 1OQPA 1F54A 1B7TZ 1TUJA 1ZMZA 2E6WA 3NSIA 4DUQA 4MBEA 1M39A 1R2UA 2H61A 2R2IA 1PULA 3S0GA 1J7RA 1SKTA 3I5FB 5AANA 2K7OA 2BCBA 5J3XA 1L2OB 3OHMB 2LP3A 2FJUB 5AXIA 5DKRA 4Q04A 1OMRA 1OW4A 2MRDA 1DJIA 1KK8C 3DF0A 3K21A 1FF1A 1Y0VH 1U5IA 1RECA 3TDUA 2ZN9A 3EK7A 1YX8A 1NCXA 3B86A 4ICBA 3VRRA 4JQ0D 2HF5A 1S5GZ 5HYDA
chains in the Genus database with same CATH topology
2BL0B 2LLSA 1DGVA 1SMGA 1UP5A 1BG1A 5CSIA 1IG5A 2WNDA 2PRUA 3BUOB 1S6JA 5TNCA 3FWCA 5I8NA 4QJ4B 1WDCB 1XK4C 2LMTA 2DOQA 2F2PA 2NCOA 4USLA 2JU0A 2Y1MA 4GFTA 2WORA 4PE1A 1A75B 4TNCA 1MWNA 2G9BA 3PM8A 1Q80A 1ALVA 3OP0A 5D69A 1IKUA 1K94A 4YI8A 5HKYA 4U8DA 4MN0A 1KQMC 4CFQA 1GGZA 3CTNA 2ZFDA 3PFVA 2L51A 1XFYO 1K96A 1CTRA 3SG6A 3IF7A 1M31A 2Q4UA 2SCPA 5AERA 1S26D 2KYCA 4HRGA 3HX4A 1K93D 1EL4A 3KEVA 4I5NB 1ODBA 4ZCVA 1N2DA 1S6CA 2G2BA 2GV5A 1A03A 2K8MB 1PSBA 2K0JA 1FPWA 2LCPA 2ZKMX 3PSRA 4JPZB 1NIWA 1J55A 4GPLB 2JQ6A 1W7JB 4HRHA 2JNFA 3DD4A 3NSKA 3PATA 2H61C 3IQOA 5PALA 3SIBA 2BBNA 1HT9A 1B7TY 2D8NA 1UWOA 1SL9A 1C07A 1BR4B 1WY9A 1AK8A 1LKJA 2LC5A 3WNXB 1S6IA 1CLBA 1Y1UA 2BE6A 1CNPA 1SL7A 3CGAA 1GJYA 4DIRA 3LK1A 2K7CA 2LP2A 2PVBA 4I5KA 1J1DA 2H2KA 4PHNA 1B8CA 2M0RA 2OPOA 1PVBA 2KQ6A 1BT6A 1CMFA 4I5LB 2CT9A 4MZLA 1LXFC 2JC2A 4QJ3B 1MF8B 2ISDA 1YVLA 2KDHA 2KBMA 1CLMA 4MVFA 1QTXA 1DJXA 2KI4B 1YTZC 1F70A 1D1OA 3EK8A 3EVRA 2M97A 3FWBA 2JT3A 1A2XA 3BOWB 1QASA 1KFXS 2KI6C 1TNXA 1SR6C 1BOCA 4NDDA 1ALWA 1RROA 1DF0A 3I5IC 3NSOA 4YGAA 2KYFA 2K7DA 2O5GA 1F4OA 1NX3A 1TTXA 3EKHA 1DTLA 4N1GA 1K90D 1IJ5A 1NWDA 1ZACA 4IL1A 1QIVA 4WRIA 1NPQA 1IWQA 2JT8A 3CLNA 1F8HA 1CLLA 2OS8C 2AAOA 3EVVA 1CKKA 2BKIB 4FQOA 5KSZA 2WCFA 1SPYA 1M46A 2Y5IA 1K2HA 1RWYA 1SCMB 5HLVA 1UHKA 2FOTA 3TDIA 4M2PA 3ICBA 2LMVA 3SIAA 3BUXB 2BECA 2LHLA 1BR1B 2F33A 1N65A 1LA0A 1V1GA 4XJKB 4DCKA 2Y4QA 4PCWA 3GK4X 4N1FA 4ZCUA 3PN7B 1DGUA 3LCPC 1WRLA 4FTGA 1E8AA 1B8LA 2KNEA 2P6BB 4A4BA 1EG3A 2L4HA 3KPXA 5HKWA 4PE7A 4CFRA 2LUXA 1EXRA 1RK9A 2K61A 3JVTC 4P5OE 1F4QA 5K89A 3I5HB 4PALA 1SYMA 3SG7A 2WCBA 3VGOA 5I2LA 1IH0A 4GGFA 1QLKA 4AQIA 1YRUB 3FIAA 2L50A 3TUYB 2M1UA 3JTDB 3KHEA 3OX5A 1A4PA 1OMDA 1FBVA 1BMOA 1JFJA 1FI5A 3CS1A 4OCIA 2KAXA 1AP4A 3I5GC 2L98A 3VRPA 3EK4A 1IRJA 2NCPA 2AMIA 1JF2A 3GK2A 2F3ZA 2FCDA 1DJZA 3AAKA 2PASA 1K9UA 2JRFA 4E68A 2QPTA 1Y1AA 4YBHB 2OTGB 2PMYA 2I2RE 1M45A 2CNPA 2F3YA 5GQQC 3D0YB 3TS5B 1BODA 3BUWB 1TCOB 2ZNEA 2MJWB 2JZIA 4GGNA 4HSZA 3O4YA 1CB1A 2LNKA 2LVVA 4AQJA 3ZNIA 1PRWA 1A75A 1G33A 3HCMA 4P2YB 3LLEA 2LAPA 2MHHA 2M49B 4DS7A 4OKHA 2LUCA 3BYAA 1B4CA 1YRTB 4CIDA 1PALA 2LANA 1UHNA 2BE4A 3WHTB 1DT7B 1BF5A 2KQYA 1IQ3A 2F2OA 2EC6B 4N5XA 1DMOA 1CM1A 1UHIA 2LE9B 3CZTX 1CFPA 2JWWA 3LL8B 2SASA 1A29A 1KK8B 1SNLA 3MSEB 2MBXA 5G08A 5CPVA 3VROA 2M9GA 4JWQA 1MR8A 4UPGA 3TZ1A 4YGEB 2Y1NA 2AUCA 3A8RA 4OR9B 5AEQA 4PHJA 1OOJA 1PVAA 3D10A 1JUOA 1DVIA 1YUSA 1KWOC 2A4JA 4YI9A 2PSRA 5HKZA 1OSAA 1AHRA 1SCMC 1TRFA 4GGFC 1R6PA 3BXKA 5DKNA 1IJ6A 3A4UB 1BU3A 1NX0A 3OB1B 4YGDB 4NDCA 4XYNA 1QXPA 3I5FC 1RJVA 2KOTA 2I18A 3RLZA 1JC2A 1L2OC 1KQMB 3CR5X 4YGBB 1CDPA 1TOPA 3C1VA 4MZJA 1KSOA 1V1FA 2L4IA 3ZWHA 2K2AA 1CM4A 4BY5A 5ER4X 4I5JA 2QACA 1XFZO 2JNXA 1YUUA 1HQVA 3EVUA 1H4BA 2M7LA 1J7QA 4MZKA 1TNPA 1YX7A 3I5HC 3EKJA 2BL0C 3AAJA 4NQGA 4HREE 5I2OA 1KQVA 2VRGA 5FYXA 4OV2A 1TNWA 5B8IB 2TN4A 2WC8A 1WDCC 1F71A 1JF0A 3KO0A 4D1EA 1B1GA 3RM1A 2LMUA 5F6TA 2JXLA 3F45A 2PALA 3PALA 1KFXL 2LVIA 3BUNB 2NZ0A 1PSRA 4MLWA 2HETA 3CR2A 4C0JA 3BOWA 2KGBC 2JTZA 3NSLA 4A4CA 1UURA 3DF0B 1CDLA 1XFXO 2BCXA 1U5IB 2ZRTA 2KSPA 3SJSA 4QJ5B 1KK7Z 1F55A 4R1EA 2M7NA 3SG4A 3TS5C 1K9PA 1B8RA 2ZRSA 2K7BA 1KFUL 3OX6A 4GNKB 1DJHA 1XVJA 1XYDA 2L5XB 3E3RA 4WQ3A 1CFFA 1SW8A 1JFKA 3O78A 3WHUB 1AVSA 5BPJA 4PE4A 3WXAA 1RFJA 1BLQA 1H8BA 2BKHB 2KHNA 4MRYA 1KCYA 4PHKA 1MHOA 1TNQA 1AJ5A 1QIWA 2EC6C 2EGDA 1ZOTB 2RGIA 2L2EA 1DJWA 1UUSA 1NYAA 3DVKA 4MSPA 1N0YA 2V53A 3SG2A 2KAVA 4XJKA 1J1EA 4AOMA 1MQ1A 3IQQA 5CSFA 5AFPA 1LVCD 1QS7A 2B1UA 1SL8A 3BQ3A 1SR6B 1NP8A 2LLUA 2BBMA 3OB2B 1MXEA 1OZSA 1X02A 1LA3A 2KFHA 1MXLC 2ZN8A 1Y6WA 3I5IB 4ORBB 4CLNA 2WCEA 1CMGA 4OVNF 1AJ4A 2NLNA 1JBAA 1KSMA 2GGMA 1CFDA 3O6BA 1G4YR 1YURA 2KBIA 5JJGA 1GGWA 2OS8B 2MA2A 4GAOA 1DJGA 1RTP1 2HQ8A 2KGRA 2FCEA 1WLZA 5JOLA 1OE9B 5CSJA 4ORAB 1NUBA 1SBJA 1XFVO 2KI4C 2LM5A 1Y1XA 2MLEC 1S36A 2LLTA 3NXAA 4C0KA 5IBWA 3CWGA 1K8UA 1YR5A 2E30A 3FS7A 1ZFSA 1QVIZ 4C0LA 1WRKA 1FW4A 3DVEA 2I7AA 2JULA 1IQ5A 1B47A 1UHJA 5KU1A 2M29A 2M3WA 3GK1A 2O60A 2F8PA 3D0YA 3JVTB 1PK0D 1DJYA 2JPTA 2IS9A 1S3PA 1XFUO 4PHMA 4YGCB 1KK7Y 3H4SE 5D7FA 1SY9A 1EJ3A 1OZOA 3PLFB 1WRZA 2KI6D 3O2PA 2CTNA 3LK0A 4M2QA 1QLSA 1SCVA 2BCAA 3TDZA 5KTYA 4MRXA 4PE0A 1W7IB 2KAYA 2LV7A 2KFGA 1B9AA 3AKBA 3I5GB 4ETOA 3SG5A 3KF9A 2GGZA 2COLB 2M1KB 1BJFA 1L7ZA 2M8UA 4M2OA 1TN4A 1NSHA 3AKAA 1AUIB 2CBLA 1S1EA 2I94A 1QX7A 4YRUA 2NXQA 1C7WA 2JTTA 1QJTA 1NX1A 1TIZA 3PN7C 3SG3A 4NDBA 4L9MA 1DF0B 1QV1A 3VRNA 2K2FA 2KFFA 2ZNDA 1K95A 1CDNA 1IGVA 4PDZA 3VRQA 2CCMA 4F0ZB 1JWDA 1S5GY 5I2QA 1SK6D 1XK4A 1CFCA 1MUXA 1J7PA 1C7VA 2EHBA 1JSAA 1XO5A 1YVHA 3DVJA 2CXJA 3M0WA 3GOFA 3TUYC 3JTDC 1EH2A 1QX2A 4WQ2A 2JOJA 1J7OA 1NX2A 1LINA 4CPVA 3QRXA 1XFWO 1XA5A 4BY4A 1ZUZA 2LVKA 1QV0A 1FI6A 4ORCB 1G8IA 1YUTA 1NCZA 2HPSA 5DKQA 3DVMA 1UHHA 2JT0A 1CDMA 2HQWA 2L0PA 2OTGC 1K9KA 2LVJA 2WOSA 5ER5A 1TCFA 2MLFC 1EG4A 1M63B 1QVIY 5HLOA 1SRAA 1QX5B 4MEWA 1WLMA 2MAZA 4DRWA 1GQMA 4GBAA 1KWOB 1VRKA 1KFUS 5CSNA 3BUMB 4GUKA 2JXCA 1OMVA 3CR4X 1QATA 2Q91A 1NCYA 2LHIA 1OQPA 1F54A 1B7TZ 1ZMZA 2E6WA 3NSIA 4DUQA 4MBEA 1M39A 1R2UA 2H61A 2R2IA 1PULA 1J7RA 1SKTA 3I5FB 5AANA 2K7OA 2BCBA 5J3XA 1L2OB 3OHMB 2LP3A 2FJUB 5AXIA 5DKRA 4Q04A 1OMRA 2MRDA 1DJIA 1KK8C 3DF0A 3K21A 1FF1A 1Y0VH 1U5IA 1RECA 3TDUA 2ZN9A 3EK7A 1YX8A 1NCXA 4ICBA 3VRRA 4JQ0D 2HF5A 1S5GZ 5HYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL0 B;  2LLS A;  1DGV A;  1SMG A;  1UP5 A;  1BG1 A;  5CSI A;  1IG5 A;  2WND A;  2PRU A;  3BUO B;  1S6J A;  5TNC A;  3FWC A;  5I8N A;  4QJ4 B;  1WDC B;  1XK4 C;  2LMT A;  2DOQ A;  2F2P A;  2NCO A;  4USL A;  2JU0 A;  2Y1M A;  4GFT A;  2WOR A;  4PE1 A;  1A75 B;  4TNC A;  1MWN A;  2G9B A;  3PM8 A;  1Q80 A;  1ALV A;  3OP0 A;  5D69 A;  1IKU A;  1K94 A;  4YI8 A;  5HKY A;  4U8D A;  4MN0 A;  1KQM C;  4CFQ A;  1GGZ A;  3CTN A;  2ZFD A;  3PFV A;  2L51 A;  1XFY O;  1K96 A;  1CTR A;  3SG6 A;  3IF7 A;  1M31 A;  2Q4U A;  2SCP A;  5AER A;  1S26 D;  2KYC A;  4HRG A;  3HX4 A;  1K93 D;  1EL4 A;  3KEV A;  4I5N B;  1ODB A;  4ZCV A;  1N2D A;  1S6C A;  2G2B A;  2GV5 A;  1A03 A;  2K8M B;  1PSB A;  2K0J A;  1FPW A;  2LCP A;  2ZKM X;  3PSR A;  4JPZ B;  1NIW A;  1J55 A;  4GPL B;  2JQ6 A;  1W7J B;  4HRH A;  2JNF A;  3DD4 A;  3NSK A;  3PAT A;  2H61 C;  3IQO A;  5PAL A;  3SIB A;  2BBN A;  1HT9 A;  1B7T Y;  2D8N A;  1UWO A;  1SL9 A;  1C07 A;  1BR4 B;  1WY9 A;  1AK8 A;  1LKJ A;  2LC5 A;  3WNX B;  1S6I A;  1CLB A;  1Y1U A;  2BE6 A;  1CNP A;  1SL7 A;  3CGA A;  1GJY A;  4DIR A;  3LK1 A;  2K7C A;  2LP2 A;  2PVB A;  4I5K A;  1J1D A;  2H2K A;  4PHN A;  1B8C A;  2M0R A;  2OPO A;  1PVB A;  2KQ6 A;  1BT6 A;  1CMF A;  4I5L B;  2CT9 A;  4MZL A;  1LXF C;  2JC2 A;  4QJ3 B;  1MF8 B;  2ISD A;  1YVL A;  2KDH A;  2KBM A;  1CLM A;  4MVF A;  1QTX A;  1DJX A;  2KI4 B;  1YTZ C;  1F70 A;  1D1O A;  3EK8 A;  3EVR A;  2M97 A;  3FWB A;  2JT3 A;  1A2X A;  3BOW B;  1QAS A;  1KFX S;  2KI6 C;  1TNX A;  1SR6 C;  1BOC A;  4NDD A;  1ALW A;  1RRO A;  1DF0 A;  3I5I C;  3NSO A;  4YGA A;  2KYF A;  2K7D A;  2O5G A;  1F4O A;  1NX3 A;  1TTX A;  3EKH A;  1DTL A;  4N1G A;  1K90 D;  1IJ5 A;  1NWD A;  1ZAC A;  4IL1 A;  1QIV A;  4WRI A;  1NPQ A;  1IWQ A;  2JT8 A;  3CLN A;  1F8H A;  1CLL A;  2OS8 C;  2AAO A;  3EVV A;  1CKK A;  2BKI B;  4FQO A;  5KSZ A;  2WCF A;  1SPY A;  1M46 A;  2Y5I A;  1K2H A;  1RWY A;  1SCM B;  5HLV A;  1UHK A;  2FOT A;  3TDI A;  4M2P A;  3ICB A;  2LMV A;  3SIA A;  3BUX B;  2BEC A;  2LHL A;  1BR1 B;  2F33 A;  1N65 A;  1LA0 A;  1V1G A;  4XJK B;  4DCK A;  2Y4Q A;  4PCW A;  3GK4 X;  4N1F A;  4ZCU A;  3PN7 B;  1DGU A;  3LCP C;  1WRL A;  4FTG A;  1E8A A;  1B8L A;  2KNE A;  2P6B B;  4A4B A;  1EG3 A;  2L4H A;  3KPX A;  5HKW A;  4PE7 A;  4CFR A;  2LUX A;  1EXR A;  1RK9 A;  2K61 A;  3JVT C;  4P5O E;  1F4Q A;  5K89 A;  3I5H B;  4PAL A;  1SYM A;  3SG7 A;  2WCB A;  3VGO A;  5I2L A;  1IH0 A;  4GGF A;  1QLK A;  4AQI A;  1YRU B;  3FIA A;  2L50 A;  3TUY B;  2M1U A;  3JTD B;  3KHE A;  3OX5 A;  1A4P A;  1OMD A;  1FBV A;  1BMO A;  1JFJ A;  1FI5 A;  3CS1 A;  4OCI A;  2KAX A;  1AP4 A;  3I5G C;  2L98 A;  3VRP A;  3EK4 A;  1IRJ A;  2NCP A;  2AMI A;  1JF2 A;  3GK2 A;  2F3Z A;  2FCD A;  1DJZ A;  3AAK A;  2PAS A;  1K9U A;  2JRF A;  4E68 A;  2QPT A;  1Y1A A;  4YBH B;  2OTG B;  2PMY A;  2I2R E;  1M45 A;  2CNP A;  2F3Y A;  5GQQ C;  3D0Y B;  3TS5 B;  1BOD A;  3BUW B;  1TCO B;  2ZNE A;  2MJW B;  2JZI A;  4GGN A;  4HSZ A;  3O4Y A;  1CB1 A;  2LNK A;  2LVV A;  4AQJ A;  3ZNI A;  1PRW A;  1A75 A;  1G33 A;  3HCM A;  4P2Y B;  3LLE A;  2LAP A;  2MHH A;  2M49 B;  4DS7 A;  4OKH A;  2LUC A;  3BYA A;  1B4C A;  1YRT B;  4CID A;  1PAL A;  2LAN A;  1UHN A;  2BE4 A;  3WHT B;  1DT7 B;  1BF5 A;  2KQY A;  1IQ3 A;  2F2O A;  2EC6 B;  4N5X A;  1DMO A;  1CM1 A;  1UHI A;  2LE9 B;  3CZT X;  1CFP A;  2JWW A;  3LL8 B;  2SAS A;  1A29 A;  1KK8 B;  1SNL A;  3MSE B;  2MBX A;  5G08 A;  5CPV A;  3VRO A;  2M9G A;  4JWQ A;  1MR8 A;  4UPG A;  3TZ1 A;  4YGE B;  2Y1N A;  2AUC A;  3A8R A;  4OR9 B;  5AEQ A;  4PHJ A;  1OOJ A;  1PVA A;  3D10 A;  1JUO A;  1DVI A;  1YUS A;  1KWO C;  2A4J A;  4YI9 A;  2PSR A;  5HKZ A;  1OSA A;  1AHR A;  1SCM C;  1TRF A;  4GGF C;  1R6P A;  3BXK A;  5DKN A;  1IJ6 A;  3A4U B;  1BU3 A;  1NX0 A;  3OB1 B;  4YGD B;  4NDC A;  4XYN A;  1QXP A;  3I5F C;  1RJV A;  2KOT A;  2I18 A;  3RLZ A;  1JC2 A;  1L2O C;  1KQM B;  3CR5 X;  4YGB B;  1CDP A;  1TOP A;  3C1V A;  4MZJ A;  1KSO A;  1V1F A;  2L4I A;  3ZWH A;  2K2A A;  1CM4 A;  4BY5 A;  5ER4 X;  4I5J A;  2QAC A;  1XFZ O;  2JNX A;  1YUU A;  1HQV A;  3EVU A;  1H4B A;  2M7L A;  1J7Q A;  4MZK A;  1TNP A;  1YX7 A;  3I5H C;  3EKJ A;  2BL0 C;  3AAJ A;  4NQG A;  4HRE E;  5I2O A;  1KQV A;  2VRG A;  5FYX A;  4OV2 A;  1TNW A;  5B8I B;  2TN4 A;  2WC8 A;  1WDC C;  1F71 A;  1JF0 A;  3KO0 A;  4D1E A;  1B1G A;  3RM1 A;  2LMU A;  5F6T A;  2JXL A;  3F45 A;  2PAL A;  3PAL A;  1KFX L;  2LVI A;  3BUN B;  2NZ0 A;  1PSR A;  4MLW A;  2HET A;  3CR2 A;  4C0J A;  3BOW A;  2KGB C;  2JTZ A;  3NSL A;  4A4C A;  1UUR A;  3DF0 B;  1CDL A;  1XFX O;  2BCX A;  1U5I B;  2ZRT A;  2KSP A;  3SJS A;  4QJ5 B;  1KK7 Z;  1F55 A;  4R1E A;  2M7N A;  3SG4 A;  3TS5 C;  1K9P A;  1B8R A;  2ZRS A;  2K7B A;  1KFU L;  3OX6 A;  4GNK B;  1DJH A;  1XVJ A;  1XYD A;  2L5X B;  3E3R A;  4WQ3 A;  1CFF A;  1SW8 A;  1JFK A;  3O78 A;  3WHU B;  1AVS A;  5BPJ A;  4PE4 A;  3WXA A;  1RFJ A;  1BLQ A;  1H8B A;  2BKH B;  2KHN A;  4MRY A;  1KCY A;  4PHK A;  1MHO A;  1TNQ A;  1AJ5 A;  1QIW A;  2EC6 C;  2EGD A;  1ZOT B;  2RGI A;  2L2E A;  1DJW A;  1UUS A;  1NYA A;  3DVK A;  4MSP A;  1N0Y A;  2V53 A;  3SG2 A;  2KAV A;  4XJK A;  1J1E A;  4AOM A;  1MQ1 A;  3IQQ A;  5CSF A;  5AFP A;  1LVC D;  1QS7 A;  2B1U A;  1SL8 A;  3BQ3 A;  1SR6 B;  1NP8 A;  2LLU A;  2BBM A;  3OB2 B;  1MXE A;  1OZS A;  1X02 A;  1LA3 A;  2KFH A;  1MXL C;  2ZN8 A;  1Y6W A;  3I5I B;  4ORB B;  4CLN A;  2WCE A;  1CMG A;  4OVN F;  1AJ4 A;  2NLN A;  1JBA A;  1KSM A;  2GGM A;  1CFD A;  3O6B A;  1G4Y R;  1YUR A;  2KBI A;  5JJG A;  1GGW A;  2OS8 B;  2MA2 A;  4GAO A;  1DJG A;  1RTP 1;  2HQ8 A;  2KGR A;  2FCE A;  1WLZ A;  5JOL A;  1OE9 B;  5CSJ A;  4ORA B;  1NUB A;  1SBJ A;  1XFV O;  2KI4 C;  2LM5 A;  1Y1X A;  2MLE C;  1S36 A;  2LLT A;  3NXA A;  4C0K A;  5IBW A;  3CWG A;  1K8U A;  1YR5 A;  2E30 A;  3FS7 A;  1ZFS A;  1QVI Z;  4C0L A;  1WRK A;  1FW4 A;  3DVE A;  2I7A A;  2JUL A;  1IQ5 A;  1B47 A;  1UHJ A;  5KU1 A;  2M29 A;  2M3W A;  3GK1 A;  2O60 A;  2F8P A;  3D0Y A;  3JVT B;  1PK0 D;  1DJY A;  2JPT A;  2IS9 A;  1S3P A;  1XFU O;  4PHM A;  4YGC B;  1KK7 Y;  3H4S E;  5D7F A;  1SY9 A;  1EJ3 A;  1OZO A;  3PLF B;  1WRZ A;  2KI6 D;  3O2P A;  2CTN A;  3LK0 A;  4M2Q A;  1QLS A;  1SCV A;  2BCA A;  3TDZ A;  5KTY A;  4MRX A;  4PE0 A;  1W7I B;  2KAY A;  2LV7 A;  2KFG A;  1B9A A;  3AKB A;  3I5G B;  4ETO A;  3SG5 A;  3KF9 A;  2GGZ A;  2COL B;  2M1K B;  1BJF A;  1L7Z A;  2M8U A;  4M2O A;  1TN4 A;  1NSH A;  3AKA A;  1AUI B;  2CBL A;  1S1E A;  2I94 A;  1QX7 A;  4YRU A;  2NXQ A;  1C7W A;  2JTT A;  1QJT A;  1NX1 A;  1TIZ A;  3PN7 C;  3SG3 A;  4NDB A;  4L9M A;  1DF0 B;  1QV1 A;  3VRN A;  2K2F A;  2KFF A;  2ZND A;  1K95 A;  1CDN A;  1IGV A;  4PDZ A;  3VRQ A;  2CCM A;  4F0Z B;  1JWD A;  1S5G Y;  5I2Q A;  1SK6 D;  1XK4 A;  1CFC A;  1MUX A;  1J7P A;  1C7V A;  2EHB A;  1JSA A;  1XO5 A;  1YVH A;  3DVJ A;  2CXJ A;  3M0W A;  3GOF A;  3TUY C;  3JTD C;  1EH2 A;  1QX2 A;  4WQ2 A;  2JOJ A;  1J7O A;  1NX2 A;  1LIN A;  4CPV A;  3QRX A;  1XFW O;  1XA5 A;  4BY4 A;  1ZUZ A;  2LVK A;  1QV0 A;  1FI6 A;  4ORC B;  1G8I A;  1YUT A;  1NCZ A;  2HPS A;  5DKQ A;  3DVM A;  1UHH A;  2JT0 A;  1CDM A;  2HQW A;  2L0P A;  2OTG C;  1K9K A;  2LVJ A;  2WOS A;  5ER5 A;  1TCF A;  2MLF C;  1EG4 A;  1M63 B;  1QVI Y;  5HLO A;  1SRA A;  1QX5 B;  4MEW A;  1WLM A;  2MAZ A;  4DRW A;  1GQM A;  4GBA A;  1KWO B;  1VRK A;  1KFU S;  5CSN A;  3BUM B;  4GUK A;  2JXC A;  1OMV A;  3CR4 X;  1QAT A;  2Q91 A;  1NCY A;  2LHI A;  1OQP A;  1F54 A;  1B7T Z;  1ZMZ A;  2E6W A;  3NSI A;  4DUQ A;  4MBE A;  1M39 A;  1R2U A;  2H61 A;  2R2I A;  1PUL A;  1J7R A;  1SKT A;  3I5F B;  5AAN A;  2K7O A;  2BCB A;  5J3X A;  1L2O B;  3OHM B;  2LP3 A;  2FJU B;  5AXI A;  5DKR A;  4Q04 A;  1OMR A;  2MRD A;  1DJI A;  1KK8 C;  3DF0 A;  3K21 A;  1FF1 A;  1Y0V H;  1U5I A;  1REC A;  3TDU A;  2ZN9 A;  3EK7 A;  1YX8 A;  1NCX A;  4ICB A;  3VRR A;  4JQ0 D;  2HF5 A;  1S5G Z;  5HYD A; 
#chains in the Genus database with same CATH topology
 2BL0 B;  4INX A;  2LLS A;  1DGV A;  1SMG A;  1TUZ A;  1UP5 A;  1BG1 A;  5CSI A;  1IG5 A;  2WND A;  2PRU A;  3BUO B;  1S6J A;  5TNC A;  3FWC A;  5I8N A;  4QJ4 B;  1WDC B;  1XK4 C;  2LMT A;  2DOQ A;  2F2P A;  2NCO A;  4USL A;  2JU0 A;  2Y1M A;  4GFT A;  2WOR A;  2ERB A;  4PE1 A;  1A75 B;  4TNC A;  3K1E A;  1MWN A;  2G9B A;  3PM8 A;  1Q80 A;  1ALV A;  3OP0 A;  5D69 A;  1IKU A;  1K94 A;  4YI8 A;  5HKY A;  4U8D A;  4MN0 A;  1KQM C;  4CFQ A;  1GGZ A;  3CTN A;  3CZ1 A;  2ZFD A;  3PFV A;  2L51 A;  1XFY O;  1K96 A;  1CTR A;  3SG6 A;  3IF7 A;  5FI7 A;  1M31 A;  3S0E A;  5DIC A;  1Z2C B;  2Q4U A;  2SCP A;  5AER A;  1S26 D;  3CAB A;  2KYC A;  4HRG A;  3HX4 A;  3DZT A;  1K93 D;  1EL4 A;  3KEV A;  4I5N B;  1ODB A;  4ZCV A;  1N2D A;  1S6C A;  2G2B A;  2GV5 A;  1A03 A;  2K8M B;  3NGV A;  1PSB A;  2K0J A;  1FPW A;  2LCP A;  2ZKM X;  3PSR A;  1DEL A;  4JPZ B;  1NIW A;  1J55 A;  4GPL B;  2JQ6 A;  1W7J B;  4HRH A;  2JNF A;  3B7A A;  3DD4 A;  3NSK A;  3PAT A;  2KLE A;  2H61 C;  2QEO A;  3IQO A;  5PAL A;  3SIB A;  2BBN A;  1HT9 A;  1B7T Y;  2D8N A;  1UWO A;  1SL9 A;  1C07 A;  1BR4 B;  1WY9 A;  1AK8 A;  3OGN A;  4KYN A;  1LKJ A;  2LC5 A;  3S0D A;  3WNX B;  1S6I A;  1CLB A;  1Y1U A;  2BE6 A;  1CNP A;  1SL7 A;  3CGA A;  1GJY A;  4DIR A;  3LK1 A;  2K7C A;  3FE8 A;  2LP2 A;  2PVB A;  4I5K A;  1J1D A;  3S0A A;  2H2K A;  4PHN A;  1B8C A;  2M0R A;  2OPO A;  1PVB A;  2KQ6 A;  1BT6 A;  3DYE A;  1CMF A;  4I5L B;  2CT9 A;  4MZL A;  1XFR A;  1LXF C;  2JC2 A;  4QJ3 B;  1MF8 B;  2ISD A;  1YVL A;  2KDH A;  2KBM A;  1CLM A;  4MVF A;  1QTX A;  1DJX A;  2KI4 B;  2FJY A;  4IJ7 A;  3D77 A;  1YTZ C;  1F70 A;  2WCK A;  1D1O A;  3EK8 A;  2QEV A;  3EVR A;  2M97 A;  3FWB A;  2JT3 A;  1A2X A;  3BOW B;  4OZD A;  1QAS A;  1KFX S;  2KI6 C;  1TNX A;  1SR6 C;  1BOC A;  3B6X A;  4NDD A;  1ALW A;  1RRO A;  1DF0 A;  3I5I C;  3NSO A;  4JD9 A;  4YGA A;  2KYF A;  2K7D A;  3SS5 A;  2O5G A;  1F4O A;  1NX3 A;  1TTX A;  3EKH A;  4F7F A;  1DTL A;  4N1G A;  1K90 D;  1IJ5 A;  1NWD A;  1ZAC A;  4IL1 A;  1QIV A;  4WRI A;  1NPQ A;  1IWQ A;  2JT8 A;  3CLN A;  1F8H A;  1CLL A;  2OS8 C;  2AAO A;  3EVV A;  1CKK A;  2BKI B;  4FQO A;  5KSZ A;  2WCF A;  1SPY A;  3FE6 A;  1M46 A;  2Y5I A;  1K2H A;  1C3Y A;  1RWY A;  1SCM B;  5HLV A;  1UHK A;  2FOT A;  3TDI A;  4M2P A;  3ICB A;  2LMV A;  3SIA A;  3FE9 A;  3BUX B;  2BEC A;  2LHL A;  1BR1 B;  2F33 A;  1N65 A;  1LA0 A;  1V1G A;  3R1P A;  4XJK B;  3UNW A;  2Y4Q A;  4PCW A;  4DCK A;  1P28 A;  3GK4 X;  4N1F A;  3V2L A;  1W9Z A;  4ZCU A;  3BFH A;  3PN7 B;  3R72 A;  1DGU A;  3LCP C;  1WRL A;  3NHI A;  4FTG A;  1E8A A;  1B8L A;  2KNE A;  2P6B B;  4A4B A;  1EG3 A;  2L4H A;  3KPX A;  5HKW A;  4PE7 A;  4CFR A;  2LUX A;  1EXR A;  1RK9 A;  2K61 A;  3JVT C;  3S0B A;  4P5O E;  1F4Q A;  5K89 A;  3I5H B;  4PAL A;  1SYM A;  3SG7 A;  2WCB A;  3VGO A;  5I2L A;  1IH0 A;  4GGF A;  1QLK A;  4AQI A;  1YRU B;  3FIA A;  2L50 A;  3TUY B;  2M1U A;  3JTD B;  3KHE A;  3OX5 A;  1DEK A;  1A4P A;  1OMD A;  1FBV A;  1BMO A;  1JFJ A;  1FI5 A;  3CS1 A;  4OCI A;  2KAX A;  1AP4 A;  2PQL A;  2L98 A;  3I5G C;  3VRP A;  3NHT A;  3EK4 A;  1IRJ A;  2NCP A;  2AMI A;  1JF2 A;  3GK2 A;  2F3Z A;  2FCD A;  1DJZ A;  3AAK A;  2PAS A;  1K9U A;  2JRF A;  4E68 A;  2QPT A;  1Y1A A;  2KPH A;  4YBH B;  4JKT A;  2OTG B;  2PMY A;  2I2R E;  1M45 A;  2CNP A;  2F3Y A;  5GQQ C;  3D0Y B;  2WCJ A;  3TS5 B;  2JPO A;  1BOD A;  3BUW B;  1TCO B;  2ZNE A;  2MJW B;  2JZI A;  4GGN A;  4HSZ A;  3O4Y A;  1CB1 A;  2LNK A;  5D3O A;  2LVV A;  4AQJ A;  3ZNI A;  1PRW A;  1A75 A;  1G33 A;  2GTE A;  3HCM A;  3LLE A;  4P2Y B;  2LAP A;  2MHH A;  2M49 B;  4DS7 A;  4OKH A;  2LUC A;  3BYA A;  1B4C A;  1YRT B;  4CID A;  1PAL A;  2LAN A;  1UHN A;  2BE4 A;  3WHT B;  1DT7 B;  1BF5 A;  2KQY A;  1IQ3 A;  2F2O A;  2EC6 B;  4N5X A;  1DMO A;  1CM1 A;  1UHI A;  2LE9 B;  3CZT X;  1CFP A;  2JWW A;  3LL8 B;  2SAS A;  1A29 A;  1KK8 B;  2BNX A;  1SNL A;  3MSE B;  2MBX A;  5G08 A;  5CPV A;  3VRO A;  2M9G A;  4JWQ A;  1MR8 A;  3L47 A;  4UPG A;  2L2C A;  3TZ1 A;  4YGE B;  2Y1N A;  2AUC A;  3CZ2 A;  3A8R A;  3Q8I A;  4OR9 B;  5AEQ A;  4PHJ A;  1OOJ A;  1PVA A;  2QDI A;  3D10 A;  1JUO A;  1DVI A;  1YUS A;  1KWO C;  2A4J A;  4YI9 A;  2PSR A;  5HKZ A;  1OSA A;  1AHR A;  1SCM C;  1TRF A;  4GGF C;  1R6P A;  3BXK A;  5DKN A;  1IJ6 A;  3A4U B;  3D74 A;  1BU3 A;  1NX0 A;  3OB1 B;  3B88 A;  4YGD B;  4NDC A;  4XYN A;  1QXP A;  3I5F C;  2H8V A;  1DC1 A;  2KLD A;  1RJV A;  2KOT A;  2I18 A;  3RLZ A;  1JC2 A;  1L2O C;  1KQM B;  3CR5 X;  4YGB B;  1CDP A;  2BAP A;  1TOP A;  3C1V A;  4MZJ A;  1KSO A;  1V1F A;  2L4I A;  3ZWH A;  2K2A A;  1CM4 A;  4BY5 A;  5ER4 X;  4I5J A;  3CDN A;  2QAC A;  1XFZ O;  2JNX A;  1YUU A;  2WCM A;  1HQV A;  3EVU A;  1H4B A;  3R1V A;  2M7L A;  3SS3 A;  4MZK A;  1TNP A;  1J7Q A;  1YX7 A;  2P71 A;  3I5H C;  3EKJ A;  2BL0 C;  3AAJ A;  4NQG A;  5FI2 A;  4HRE E;  5I2O A;  1KQV A;  1LS8 A;  2VRG A;  5FYX A;  4OV2 A;  1TNW A;  5B8I B;  2TN4 A;  4PT1 A;  2WC8 A;  1WDC C;  1F71 A;  1JF0 A;  3BJH A;  3KO0 A;  4D1E A;  1B1G A;  3RM1 A;  2LMU A;  5F6T A;  2JXL A;  3F45 A;  2PAL A;  3PAL A;  1KFX L;  2LVI A;  3BUN B;  2NZ0 A;  1PSR A;  4MLW A;  1SSE B;  2HET A;  3CR2 A;  4C0J A;  3BOW A;  2KGB C;  2JTZ A;  3NSL A;  1TWO A;  4A4C A;  1UUR A;  3DF0 B;  1CDL A;  1OOG A;  1XFX O;  2BCX A;  1U5I B;  2ZRT A;  2KSP A;  3BFB A;  3SJS A;  1KK7 Z;  4QJ5 B;  1F55 A;  4R1E A;  2M7N A;  3SG4 A;  3TS5 C;  1K9P A;  1CFF A;  1B8R A;  2ZRS A;  2K7B A;  1KFU L;  3OX6 A;  4GNK B;  1DJH A;  1XVJ A;  1XYD A;  2L5X B;  3E3R A;  4WQ3 A;  3D73 A;  1SW8 A;  1JFK A;  3O78 A;  3OBV A;  1AVS A;  3WHU B;  5BPJ A;  4PE4 A;  1C3Z A;  3WXA A;  1RFJ A;  1DQE A;  1BLQ A;  1H8B A;  3O4X A;  2BKH B;  2KHN A;  4MRY A;  1KCY A;  4PHK A;  1MHO A;  1TNQ A;  1AJ5 A;  1QIW A;  2EC6 C;  2EGD A;  1ZOT B;  2RGI A;  3RZS A;  2L2E A;  1DJW A;  1UUS A;  1NYA A;  3DVK A;  4MSP A;  1N0Y A;  2V53 A;  3SG2 A;  2KAV A;  3CZ0 A;  1J1E A;  4XJK A;  1MQ1 A;  2QEH A;  3IQQ A;  5CSF A;  3UO9 A;  4AOM A;  1LVC D;  5AFP A;  1QS7 A;  2B1U A;  1SL8 A;  3BQ3 A;  1SR6 B;  1NP8 A;  2LLU A;  2BBM A;  3OB2 B;  1MXE A;  1OZS A;  1X02 A;  1LA3 A;  3BFA A;  2WC6 A;  2KFH A;  1MXL C;  1OOF A;  1Y6W A;  2ZN8 A;  2L5Y A;  3I5I B;  3L4A A;  4ORB B;  4CLN A;  2WCE A;  1CMG A;  4OVN F;  3CYZ A;  1AJ4 A;  2NLN A;  1JBA A;  1KSM A;  2GGM A;  1CFD A;  3O6B A;  1G4Y R;  1YUR A;  2KBI A;  5JJG A;  2P70 A;  3DY9 A;  1GGW A;  3IVT A;  2OS8 B;  5FI6 A;  2MA2 A;  4GAO A;  1DJG A;  1RTP 1;  2HQ8 A;  2KGR A;  1Z4H A;  1WLZ A;  2FCE A;  5JOL A;  1OE9 B;  5CSJ A;  4ORA B;  1NUB A;  1SBJ A;  1XFV O;  2KI4 C;  2LM5 A;  1Y1X A;  2MLE C;  1S36 A;  2LLT A;  3NXA A;  4C0K A;  5IBW A;  3CWG A;  1K8U A;  1YR5 A;  3DXL A;  2E30 A;  3FS7 A;  1ZFS A;  1QVI Z;  4C0L A;  1WRK A;  1FW4 A;  3DVE A;  2I7A A;  2WCH A;  2WC5 A;  2JUL A;  1IQ5 A;  1B47 A;  1UHJ A;  5KU1 A;  3D78 A;  2M29 A;  2M3W A;  3GK1 A;  2O60 A;  2F8P A;  3D0Y A;  1OOI X;  3JVT B;  1PK0 D;  1DJY A;  3SS4 A;  2JPT A;  2IS9 A;  5HL1 A;  1S3P A;  1XFU O;  4PHM A;  4YGC B;  1KK7 Y;  3H4S E;  5D7F A;  1SY9 A;  1EJ3 A;  1OZO A;  3PLF B;  1WRZ A;  2KI6 D;  2WCL A;  2CTN A;  3LK0 A;  3O2P A;  3VB1 A;  4M2Q A;  1QLS A;  1SCV A;  2BCA A;  3TDZ A;  5KTY A;  5I94 A;  4MRX A;  3N7H A;  4PE0 A;  1W7I B;  2KAY A;  2LV7 A;  2KFG A;  1B9A A;  3AKB A;  3I5G B;  4ETO A;  3SG5 A;  3KF9 A;  1OOH A;  2GGZ A;  3B87 A;  2COL B;  2M1K B;  1BJF A;  1L7Z A;  2M8U A;  4M2O A;  1TN4 A;  1NSH A;  3AKA A;  1AUI B;  2CBL A;  1S1E A;  3S0F A;  2I94 A;  1QX7 A;  4YRU A;  2NXQ A;  1C7W A;  2JTT A;  1QJT A;  1NX1 A;  1TIZ A;  3PN7 C;  3SG3 A;  1GM0 A;  4NDB A;  4L9M A;  1DF0 B;  1QV1 A;  3VRN A;  2K2F A;  2KFF A;  2ZND A;  1K95 A;  1CDN A;  1IGV A;  4PDZ A;  3VRQ A;  2CCM A;  4F0Z B;  1JWD A;  1S5G Y;  5I2Q A;  1SK6 D;  1XK4 A;  2PYQ A;  1MUX A;  1CFC A;  1J7P A;  1C7V A;  3EG5 B;  2EHB A;  1JSA A;  1XO5 A;  1YVH A;  3R1O A;  3D75 A;  4INW A;  1IIO A;  3DVJ A;  5EL2 A;  3QME A;  2CXJ A;  3M0W A;  3GOF A;  3TUY C;  3JTD C;  1EH2 A;  3L4L A;  1QX2 A;  1QWV A;  4WQ2 A;  2JOJ A;  1J7O A;  1NX2 A;  1LIN A;  4CPV A;  3QRX A;  1XFW O;  1XA5 A;  4BY4 A;  1ZUZ A;  2LVK A;  1QV0 A;  1FI6 A;  1ORG A;  4ORC B;  4FQT A;  1G8I A;  1YUT A;  1NCZ A;  2HPS A;  5DKQ A;  3DVM A;  1UHH A;  2JT0 A;  1CDM A;  2HQW A;  2L0P A;  2OTG C;  1K9K A;  2K60 A;  2LVJ A;  2YGU A;  2WOS A;  5ER5 A;  1TCF A;  2MLF C;  1EG4 A;  1M63 B;  3D76 A;  1QVI Y;  3PM2 A;  5HLO A;  1SRA A;  1QX5 B;  4MEW A;  1WLM A;  2MAZ A;  4DRW A;  1GQM A;  4GBA A;  1T14 A;  1KWO B;  1VRK A;  1KFU S;  5CSN A;  3BUM B;  2QEB A;  4GUK A;  2JXC A;  1OMV A;  3CR4 X;  3PJI A;  1QAT A;  2Q91 A;  1NCY A;  2LHI A;  1OQP A;  1F54 A;  1B7T Z;  1TUJ A;  1ZMZ A;  2E6W A;  3NSI A;  4DUQ A;  4MBE A;  1M39 A;  1R2U A;  2H61 A;  2R2I A;  1PUL A;  3S0G A;  1J7R A;  1SKT A;  3I5F B;  5AAN A;  2K7O A;  2BCB A;  5J3X A;  1L2O B;  3OHM B;  2LP3 A;  2FJU B;  5AXI A;  5DKR A;  4Q04 A;  1OMR A;  1OW4 A;  2MRD A;  1DJI A;  1KK8 C;  3DF0 A;  3K21 A;  1FF1 A;  1Y0V H;  1U5I A;  1REC A;  3TDU A;  2ZN9 A;  3EK7 A;  1YX8 A;  1NCX A;  3B86 A;  4ICB A;  3VRR A;  4JQ0 D;  2HF5 A;  1S5G Z;  5HYD A; 
#chains in the Genus database with same CATH homology
 2BL0 B;  2LLS A;  1DGV A;  1SMG A;  1UP5 A;  1BG1 A;  5CSI A;  1IG5 A;  2WND A;  2PRU A;  3BUO B;  1S6J A;  5TNC A;  3FWC A;  5I8N A;  4QJ4 B;  1WDC B;  1XK4 C;  2LMT A;  2DOQ A;  2F2P A;  2NCO A;  4USL A;  2JU0 A;  2Y1M A;  4GFT A;  2WOR A;  4PE1 A;  1A75 B;  4TNC A;  1MWN A;  2G9B A;  3PM8 A;  1Q80 A;  1ALV A;  3OP0 A;  5D69 A;  1IKU A;  1K94 A;  4YI8 A;  5HKY A;  4U8D A;  4MN0 A;  1KQM C;  4CFQ A;  1GGZ A;  3CTN A;  2ZFD A;  3PFV A;  2L51 A;  1XFY O;  1K96 A;  1CTR A;  3SG6 A;  3IF7 A;  1M31 A;  2Q4U A;  2SCP A;  5AER A;  1S26 D;  2KYC A;  4HRG A;  3HX4 A;  1K93 D;  1EL4 A;  3KEV A;  4I5N B;  1ODB A;  4ZCV A;  1N2D A;  1S6C A;  2G2B A;  2GV5 A;  1A03 A;  2K8M B;  1PSB A;  2K0J A;  1FPW A;  2LCP A;  2ZKM X;  3PSR A;  4JPZ B;  1NIW A;  1J55 A;  4GPL B;  2JQ6 A;  1W7J B;  4HRH A;  2JNF A;  3DD4 A;  3NSK A;  3PAT A;  2H61 C;  3IQO A;  5PAL A;  3SIB A;  2BBN A;  1HT9 A;  1B7T Y;  2D8N A;  1UWO A;  1SL9 A;  1C07 A;  1BR4 B;  1WY9 A;  1AK8 A;  1LKJ A;  2LC5 A;  3WNX B;  1S6I A;  1CLB A;  1Y1U A;  2BE6 A;  1CNP A;  1SL7 A;  3CGA A;  1GJY A;  4DIR A;  3LK1 A;  2K7C A;  2LP2 A;  2PVB A;  4I5K A;  1J1D A;  2H2K A;  4PHN A;  1B8C A;  2M0R A;  2OPO A;  1PVB A;  2KQ6 A;  1BT6 A;  1CMF A;  4I5L B;  2CT9 A;  4MZL A;  1LXF C;  2JC2 A;  4QJ3 B;  1MF8 B;  2ISD A;  1YVL A;  2KDH A;  2KBM A;  1CLM A;  4MVF A;  1QTX A;  1DJX A;  2KI4 B;  1YTZ C;  1F70 A;  1D1O A;  3EK8 A;  3EVR A;  2M97 A;  3FWB A;  2JT3 A;  1A2X A;  3BOW B;  1QAS A;  1KFX S;  2KI6 C;  1TNX A;  1SR6 C;  1BOC A;  4NDD A;  1ALW A;  1RRO A;  1DF0 A;  3I5I C;  3NSO A;  4YGA A;  2KYF A;  2K7D A;  2O5G A;  1F4O A;  1NX3 A;  1TTX A;  3EKH A;  1DTL A;  4N1G A;  1K90 D;  1IJ5 A;  1NWD A;  1ZAC A;  4IL1 A;  1QIV A;  4WRI A;  1NPQ A;  1IWQ A;  2JT8 A;  3CLN A;  1F8H A;  1CLL A;  2OS8 C;  2AAO A;  3EVV A;  1CKK A;  2BKI B;  4FQO A;  5KSZ A;  2WCF A;  1SPY A;  1M46 A;  2Y5I A;  1K2H A;  1RWY A;  1SCM B;  5HLV A;  1UHK A;  2FOT A;  3TDI A;  4M2P A;  3ICB A;  2LMV A;  3SIA A;  3BUX B;  2BEC A;  2LHL A;  1BR1 B;  2F33 A;  1N65 A;  1LA0 A;  1V1G A;  4XJK B;  4DCK A;  2Y4Q A;  4PCW A;  3GK4 X;  4N1F A;  4ZCU A;  3PN7 B;  1DGU A;  3LCP C;  1WRL A;  4FTG A;  1E8A A;  1B8L A;  2KNE A;  2P6B B;  4A4B A;  1EG3 A;  2L4H A;  3KPX A;  5HKW A;  4PE7 A;  4CFR A;  2LUX A;  1EXR A;  1RK9 A;  2K61 A;  3JVT C;  4P5O E;  1F4Q A;  5K89 A;  3I5H B;  4PAL A;  1SYM A;  3SG7 A;  2WCB A;  3VGO A;  5I2L A;  1IH0 A;  4GGF A;  1QLK A;  4AQI A;  1YRU B;  3FIA A;  2L50 A;  3TUY B;  2M1U A;  3JTD B;  3KHE A;  3OX5 A;  1A4P A;  1OMD A;  1FBV A;  1BMO A;  1JFJ A;  1FI5 A;  3CS1 A;  4OCI A;  2KAX A;  1AP4 A;  3I5G C;  2L98 A;  3VRP A;  3EK4 A;  1IRJ A;  2NCP A;  2AMI A;  1JF2 A;  3GK2 A;  2F3Z A;  2FCD A;  1DJZ A;  3AAK A;  2PAS A;  1K9U A;  2JRF A;  4E68 A;  2QPT A;  1Y1A A;  4YBH B;  2OTG B;  2PMY A;  2I2R E;  1M45 A;  2CNP A;  2F3Y A;  5GQQ C;  3D0Y B;  3TS5 B;  1BOD A;  3BUW B;  1TCO B;  2ZNE A;  2MJW B;  2JZI A;  4GGN A;  4HSZ A;  3O4Y A;  1CB1 A;  2LNK A;  2LVV A;  4AQJ A;  3ZNI A;  1PRW A;  1A75 A;  1G33 A;  3HCM A;  4P2Y B;  3LLE A;  2LAP A;  2MHH A;  2M49 B;  4DS7 A;  4OKH A;  2LUC A;  3BYA A;  1B4C A;  1YRT B;  4CID A;  1PAL A;  2LAN A;  1UHN A;  2BE4 A;  3WHT B;  1DT7 B;  1BF5 A;  2KQY A;  1IQ3 A;  2F2O A;  2EC6 B;  4N5X A;  1DMO A;  1CM1 A;  1UHI A;  2LE9 B;  3CZT X;  1CFP A;  2JWW A;  3LL8 B;  2SAS A;  1A29 A;  1KK8 B;  1SNL A;  3MSE B;  2MBX A;  5G08 A;  5CPV A;  3VRO A;  2M9G A;  4JWQ A;  1MR8 A;  4UPG A;  3TZ1 A;  4YGE B;  2Y1N A;  2AUC A;  3A8R A;  4OR9 B;  5AEQ A;  4PHJ A;  1OOJ A;  1PVA A;  3D10 A;  1JUO A;  1DVI A;  1YUS A;  1KWO C;  2A4J A;  4YI9 A;  2PSR A;  5HKZ A;  1OSA A;  1AHR A;  1SCM C;  1TRF A;  4GGF C;  1R6P A;  3BXK A;  5DKN A;  1IJ6 A;  3A4U B;  1BU3 A;  1NX0 A;  3OB1 B;  4YGD B;  4NDC A;  4XYN A;  1QXP A;  3I5F C;  1RJV A;  2KOT A;  2I18 A;  3RLZ A;  1JC2 A;  1L2O C;  1KQM B;  3CR5 X;  4YGB B;  1CDP A;  1TOP A;  3C1V A;  4MZJ A;  1KSO A;  1V1F A;  2L4I A;  3ZWH A;  2K2A A;  1CM4 A;  4BY5 A;  5ER4 X;  4I5J A;  2QAC A;  1XFZ O;  2JNX A;  1YUU A;  1HQV A;  3EVU A;  1H4B A;  2M7L A;  1J7Q A;  4MZK A;  1TNP A;  1YX7 A;  3I5H C;  3EKJ A;  2BL0 C;  3AAJ A;  4NQG A;  4HRE E;  5I2O A;  1KQV A;  2VRG A;  5FYX A;  4OV2 A;  1TNW A;  5B8I B;  2TN4 A;  2WC8 A;  1WDC C;  1F71 A;  1JF0 A;  3KO0 A;  4D1E A;  1B1G A;  3RM1 A;  2LMU A;  5F6T A;  2JXL A;  3F45 A;  2PAL A;  3PAL A;  1KFX L;  2LVI A;  3BUN B;  2NZ0 A;  1PSR A;  4MLW A;  2HET A;  3CR2 A;  4C0J A;  3BOW A;  2KGB C;  2JTZ A;  3NSL A;  4A4C A;  1UUR A;  3DF0 B;  1CDL A;  1XFX O;  2BCX A;  1U5I B;  2ZRT A;  2KSP A;  3SJS A;  4QJ5 B;  1KK7 Z;  1F55 A;  4R1E A;  2M7N A;  3SG4 A;  3TS5 C;  1K9P A;  1B8R A;  2ZRS A;  2K7B A;  1KFU L;  3OX6 A;  4GNK B;  1DJH A;  1XVJ A;  1XYD A;  2L5X B;  3E3R A;  4WQ3 A;  1CFF A;  1SW8 A;  1JFK A;  3O78 A;  3WHU B;  1AVS A;  5BPJ A;  4PE4 A;  3WXA A;  1RFJ A;  1BLQ A;  1H8B A;  2BKH B;  2KHN A;  4MRY A;  1KCY A;  4PHK A;  1MHO A;  1TNQ A;  1AJ5 A;  1QIW A;  2EC6 C;  2EGD A;  1ZOT B;  2RGI A;  2L2E A;  1DJW A;  1UUS A;  1NYA A;  3DVK A;  4MSP A;  1N0Y A;  2V53 A;  3SG2 A;  2KAV A;  4XJK A;  1J1E A;  4AOM A;  1MQ1 A;  3IQQ A;  5CSF A;  5AFP A;  1LVC D;  1QS7 A;  2B1U A;  1SL8 A;  3BQ3 A;  1SR6 B;  1NP8 A;  2LLU A;  2BBM A;  3OB2 B;  1MXE A;  1OZS A;  1X02 A;  1LA3 A;  2KFH A;  1MXL C;  2ZN8 A;  1Y6W A;  3I5I B;  4ORB B;  4CLN A;  2WCE A;  1CMG A;  4OVN F;  1AJ4 A;  2NLN A;  1JBA A;  1KSM A;  2GGM A;  1CFD A;  3O6B A;  1G4Y R;  1YUR A;  2KBI A;  5JJG A;  1GGW A;  2OS8 B;  2MA2 A;  4GAO A;  1DJG A;  1RTP 1;  2HQ8 A;  2KGR A;  2FCE A;  1WLZ A;  5JOL A;  1OE9 B;  5CSJ A;  4ORA B;  1NUB A;  1SBJ A;  1XFV O;  2KI4 C;  2LM5 A;  1Y1X A;  2MLE C;  1S36 A;  2LLT A;  3NXA A;  4C0K A;  5IBW A;  3CWG A;  1K8U A;  1YR5 A;  2E30 A;  3FS7 A;  1ZFS A;  1QVI Z;  4C0L A;  1WRK A;  1FW4 A;  3DVE A;  2I7A A;  2JUL A;  1IQ5 A;  1B47 A;  1UHJ A;  5KU1 A;  2M29 A;  2M3W A;  3GK1 A;  2O60 A;  2F8P A;  3D0Y A;  3JVT B;  1PK0 D;  1DJY A;  2JPT A;  2IS9 A;  1S3P A;  1XFU O;  4PHM A;  4YGC B;  1KK7 Y;  3H4S E;  5D7F A;  1SY9 A;  1EJ3 A;  1OZO A;  3PLF B;  1WRZ A;  2KI6 D;  3O2P A;  2CTN A;  3LK0 A;  4M2Q A;  1QLS A;  1SCV A;  2BCA A;  3TDZ A;  5KTY A;  4MRX A;  4PE0 A;  1W7I B;  2KAY A;  2LV7 A;  2KFG A;  1B9A A;  3AKB A;  3I5G B;  4ETO A;  3SG5 A;  3KF9 A;  2GGZ A;  2COL B;  2M1K B;  1BJF A;  1L7Z A;  2M8U A;  4M2O A;  1TN4 A;  1NSH A;  3AKA A;  1AUI B;  2CBL A;  1S1E A;  2I94 A;  1QX7 A;  4YRU A;  2NXQ A;  1C7W A;  2JTT A;  1QJT A;  1NX1 A;  1TIZ A;  3PN7 C;  3SG3 A;  4NDB A;  4L9M A;  1DF0 B;  1QV1 A;  3VRN A;  2K2F A;  2KFF A;  2ZND A;  1K95 A;  1CDN A;  1IGV A;  4PDZ A;  3VRQ A;  2CCM A;  4F0Z B;  1JWD A;  1S5G Y;  5I2Q A;  1SK6 D;  1XK4 A;  1CFC A;  1MUX A;  1J7P A;  1C7V A;  2EHB A;  1JSA A;  1XO5 A;  1YVH A;  3DVJ A;  2CXJ A;  3M0W A;  3GOF A;  3TUY C;  3JTD C;  1EH2 A;  1QX2 A;  4WQ2 A;  2JOJ A;  1J7O A;  1NX2 A;  1LIN A;  4CPV A;  3QRX A;  1XFW O;  1XA5 A;  4BY4 A;  1ZUZ A;  2LVK A;  1QV0 A;  1FI6 A;  4ORC B;  1G8I A;  1YUT A;  1NCZ A;  2HPS A;  5DKQ A;  3DVM A;  1UHH A;  2JT0 A;  1CDM A;  2HQW A;  2L0P A;  2OTG C;  1K9K A;  2LVJ A;  2WOS A;  5ER5 A;  1TCF A;  2MLF C;  1EG4 A;  1M63 B;  1QVI Y;  5HLO A;  1SRA A;  1QX5 B;  4MEW A;  1WLM A;  2MAZ A;  4DRW A;  1GQM A;  4GBA A;  1KWO B;  1VRK A;  1KFU S;  5CSN A;  3BUM B;  4GUK A;  2JXC A;  1OMV A;  3CR4 X;  1QAT A;  2Q91 A;  1NCY A;  2LHI A;  1OQP A;  1F54 A;  1B7T Z;  1ZMZ A;  2E6W A;  3NSI A;  4DUQ A;  4MBE A;  1M39 A;  1R2U A;  2H61 A;  2R2I A;  1PUL A;  1J7R A;  1SKT A;  3I5F B;  5AAN A;  2K7O A;  2BCB A;  5J3X A;  1L2O B;  3OHM B;  2LP3 A;  2FJU B;  5AXI A;  5DKR A;  4Q04 A;  1OMR A;  2MRD A;  1DJI A;  1KK8 C;  3DF0 A;  3K21 A;  1FF1 A;  1Y0V H;  1U5I A;  1REC A;  3TDU A;  2ZN9 A;  3EK7 A;  1YX8 A;  1NCX A;  4ICB A;  3VRR A;  4JQ0 D;  2HF5 A;  1S5G Z;  5HYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...