3S0GA

Apis mellifera obp 14 double mutant gln44cys, his97cys
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVCLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPCLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 48
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0gA00
3B7AA 3L4LA 4INWA 4PT1A 2P70A 2WCKA 1TUJA 2QEBA 3FE9A 2WC6A 3CZ0A 1QWVA 1P28A 3CDNA 2GTEA 3D75A 3DZTA 1OOFA 3V2LA 5DICA 3R1VA 3FE8A 1OOGA 3R1PA 3FE6A 2QEOA 4FQTA 4JD9A 3S0GA 3BFHA 2WCJA 1C3YA 3N7HA 2FJYA 2PQLA 3D78A 3DXLA 3B6XA 3CYZA 3DYEA 5EL2A 2L2CA 2QDIA 2WCLA 3D76A 3S0EA 3RZSA 1GM0A 3DY9A 2WC5A 3BJHA 3B88A 3OGNA 3S0BA 3CZ1A 2P71A 3R1OA 3BFBA 2WCMA 1OOIX 3PJIA 1LS8A 3B86A 3BFAA 2KPHA 1OOHA 2QEVA 2WCHA 3L4AA 3NHIA 3Q8IA 3R72A 1C3ZA 4INXA 2ERBA 3S0FA 4OZDA 1XFRA 3D73A 3D77A 3QMEA 3B87A 4F7FA 1T14A 3K1EA 3S0AA 1ORGA 3CZ2A 3L47A 2QEHA 3NGVA 2JPOA 1TWOA 1OW4A 3D74A 3NHTA 3S0DA 3VB1A 2H8VA 3CABA 1DQEA
chains in the Genus database with same CATH superfamily
4N5XA 1YX7A 3QRXA 4PT1A 1DELA 4QJ3B 1OMDA 3OP0A 1FW4A 1TCFA 3CR4X 1FPWA 1SPYA 2F33A 1TUJA 1YVLA 3RLZA 1YTZC 4ZCVA 1J7RA 2BE4A 3I5GC 4P5OE 1CKKA 4OVNF 3OB2B 2YGUA 2JZIA 5IBWA 2MJWB 3DVJA 5I94A 1MHOA 2BAPA 2WCEA 1Y6WA 3DZTA 1GGWA 2WCFA 1OOFA 3OX6A 1TNQA 4M2PA 3I5HB 1UHIA 2Y4QA 3NSLA 1CLMA 1CM4A 1F4QA 3TDIA 3GK4X 3LK0A 3PATA 4YI8A 4YGCB 4YRUA 3BUOB 3R1PA 4FQOA 3FE6A 2LHIA 4DIRA 2BBMA 2F2OA 3IVTA 5CSNA 2QEOA 3WHTB 1CLLA 1C7VA 2KFHA 1ZUZA 2ZFDA 4FQTA 2LVIA 2I2RE 1CFPA 1QASA 3O4XA 2COLB 1KFXL 2NXQA 1S5GY 3PSRA 2L5YA 3DVEA 1UHKA 4NDCA 1CB1A 1XK4A 3PLFB 2BNXA 2HF5A 1SSEB 2KFFA 4JKTA 3DXLA 1CFDA 3SIBA 1TNWA 2MAZA 1KK8C 1B8CA 4IJ7A 1BODA 2JT3A 4ORCB 1UP5A 2K60A 2ISDA 4MSPA 3RZSA 1B1GA 1GM0A 3DY9A 1Z4HA 2WC5A 3D10A 1H4BA 1TNXA 3EG5B 1MQ1A 1KQVA 3OGNA 2E6WA 4PHKA 3S0BA 1WRKA 3R1OA 4GUKA 2F2PA 4CLNA 2WCMA 3VRNA 1J1DA 4GAOA 4PE0A 2BCBA 2L4IA 1RECA 1XFWO 2EC6C 3ZNIA 1U5IB 3PJIA 1K93D 4BY5A 2K7DA 1FBVA 5DKQA 1VRKA 2KPHA 1TCOB 3D0YA 3L4AA 3NHIA 4PE1A 2JU0A 1UHJA 1L2OC 4NQGA 1B7TY 4D1EA 1IIOA 4INXA 4PHJA 3S0FA 3EVVA 1QLKA 1DJGA 4OZDA 1XFRA 3D77A 5CSJA 5KTYA 2FJUB 1WLZA 4XYNA 3DF0B 3B87A 1MR8A 1DMOA 1QX7A 3K1EA 3PM8A 1S6CA 3LK1A 4MRXA 2A4JA 1IWQA 2CNPA 3CZ2A 4IL1A 2LCPA 2LVVA 4DRWA 1SR6C 1CNPA 2LNKA 1N2DA 2PSRA 1JF2A 3AAJA 1BU3A 3UNWA 1K8UA 5AFPA 1KQMC 5HL1A 4JWQA 1F71A 2EC6B 2G2BA 1EG4A 3CWGA 5J3XA 4ETOA 2NLNA 3NHTA 1AJ5A 1PRWA 1DJXA 3S0DA 2JOJA 1WDCB 3VB1A 1YR5A 1DGVA 1NCXA 1CTRA 1MF8B 5F6TA 4AOMA 3TUYC 5KU1A 1AVSA 2BECA 1S6IA 4GFTA 2H8VA 2O60A 4I5NB 1QXPA 2KBIA 1M39A 2Y1MA 1PVAA 2P70A 4MEWA 3RM1A 1CDNA 1D1OA 1ODBA 2K61A 4YGEB 4I5LB 1J7OA 2L98A 5I2OA 3FE9A 3CZ0A 2NCOA 1QWVA 1JF0A 1XVJA 2JQ6A 3CDNA 4OCIA 1CMFA 2GTEA 1YUSA 2HQWA 1SCMC 3CS1A 1S5GZ 3V2LA 4AQJA 2LP3A 5AXIA 1SR6B 2D8NA 1RTP1 2BL0C 2L0PA 3OX5A 5I2LA 5DICA 2MA2A 3FE8A 1A03A 3KHEA 1N65A 1SRAA 2M1UA 2F3ZA 1QJTA 3GOFA 1LVCD 2KBMA 1LINA 1NX2A 1SBJA 2ZNDA 4CIDA 4QJ4B 2Y1NA 1U5IA 4I5JA 1XFUO 4USLA 3SG2A 1SY9A 5HLOA 2ZKMX 4JD9A 2M97A 1W9ZA 2WNDA 3JTDC 1KCYA 4YI9A 3BFHA 1V1GA 4DCKA 2WCJA 1K2HA 3CTNA 1C3YA 3SG4A 1QTXA 2I7AA 1FI6A 1B8RA 2H2KA 2FJYA 4OV2A 1TN4A 2LC5A 1AJ4A 3PN7C 1RJVA 1IH0A 4ICBA 2K8MB 2JT8A 3BUXB 3KF9A 1YRTB 4GGNA 3KPXA 3LCPC 1PSBA 3OBVA 2PALA 5JOLA 1LXFC 1K95A 1SCMB 1ZFSA 3DD4A 4ZCUA 3SS4A 3CZ1A 4AQIA 5AANA 1SL9A 3SG3A 3AKBA 1K90D 1OZOA 1IQ3A 1OE9B 1DF0B 1B7TZ 2M1KB 1S36A 4A4BA 3VGOA 1OMRA 2FCEA 3EK4A 2BL0B 1CLBA 3EK7A 2LUXA 1SKTA 1A2XA 4I5KA 1S26D 2PYQA 1BT6A 2KI6C 2M3WA 4JPZB 1FI5A 3LL8B 4OKHA 3C1VA 4MZJA 2F3YA 2QACA 1C07A 1LS8A 2KHNA 2ZNEA 3BQ3A 3BFAA 1QIWA 4L9MA 1OOHA 1NX0A 2WCHA 4MBEA 2M49B 3CLNA 3SG5A 2FOTA 1C3ZA 3I5GB 4HRGA 4HREE 1SYMA 1DJZA 3O6BA 1CM1A 2BCAA 3TZ1A 3GK1A 1YURA 1L7ZA 1YUTA 2JT0A 2NCPA 2BKIB 3QMEA 1JWDA 1MXLC 3SJSA 4F7FA 1DT7B 3S0AA 1G8IA 1RFJA 1QATA 2LE9B 1GGZA 2FCDA 5D3OA 4Q04A 1QS7A 5DKRA 1NUBA 2QEHA 2KI6D 3NGVA 3WHUB 1W7IB 2SASA 3BOWB 4CFQA 2BKHB 3TDZA 3I5FC 4GGFA 2JPOA 2Y5IA 3FIAA 2M9GA 3SIAA 3UO9A 5FI6A 4R1EA 1BR1B 3CGAA 1CMGA 4OR9B 2LVJA 2F8PA 4C0KA 1YUUA 1KK8B 5FYXA 1MXEA 3B7AA 3L4LA 4INWA 2BCXA 1ALWA 2ZRTA 1F8HA 2LP2A 2M0RA 4C0LA 1DC1A 1BG1A 3M0WA 1DVIA 1F70A 4ORBB 5AERA 2JTZA 1RWYA 1SMGA 1XK4C 2WC6A 1F55A 1C7WA 1NWDA 1P28A 4YGAA 2CXJA 1SNLA 4HRHA 1UUSA 2JNXA 1A75B 1G33A 1DF0A 5JJGA 2BE6A 1J1EA 4BY4A 2KNEA 1PSRA 4PDZA 1Y1XA 1YX8A 1OOGA 4DS7A 1EL4A 3I5FB 1W7JB 3OHMB 1NSHA 2LVKA 2KGRA 1L2OB 2MBXA 1XFXO 5HKWA 5CSIA 1RROA 4MN0A 5BPJA 2LLTA 3CZTX 4PE7A 2KGBC 3S0GA 1FF1A 4GPLB 2K0JA 2JXLA 4FTGA 4JQ0D 4MVFA 1KFUS 1CDLA 1SL8A 3CABA 2K7CA 1AK8A 2KSPA 1XFYO 1B4CA 4XJKB 5AEQA 2LAPA 2PQLA 3D78A 1IG5A 4WQ2A 1XFVO 3DYEA 3DVKA 2KI4C 2KLEA 5EL2A 1JUOA 3VROA 2PVBA 1QIVA 1NX3A 1OZSA 1M46A 2QDIA 1S3PA 1IQ5A 2WCLA 3D76A 3S0EA 1WRLA 1G4YR 1A29A 5CPVA 3BJHA 2LLUA 3NSKA 2DOQA 1F4OA 5DKNA 1NPQA 1KQMB 3IF7A 4UPGA 2P71A 2LHLA 2K2FA 2HPSA 1H8BA 3JVTC 3BXKA 3CR2A 3O2PA 2M8UA 3BOWA 2EGDA 1OOIX 3TUYB 2PMYA 4PCWA 2AAOA 1DEKA 2LMVA 1B9AA 3GK2A 1CDMA 1GJYA 3B86A 3KEVA 1DTLA 1YRUB 2MLFC 4YBHB 1J7QA 1QVIZ 1R6PA 2QEVA 1SCVA 3SS3A 1KSMA 1WY9A 3SG6A 1EH2A 1IJ6A 5K89A 3DF0A 2KDHA 4M2OA 4MRYA 1F54A 2JPTA 2ERBA 3O4YA 5ER4X 3D0YB 1TRFA 5D7FA 2LM5A 3D73A 2VRGA 1GQMA 4HSZA 2IS9A 1SK6D 3A8RA 2JTTA 2LUCA 1J55A 1J7PA 3CR5X 1KWOC 2KYFA 3BYAA 1ZACA 4C0JA 2LANA 2CBLA 4PALA 1BLQA 1Y1AA 3AAKA 1A75A 2MHHA 2WOSA 1BF5A 1WLMA 3L47A 2L51A 3JVTB 1K9PA 2LMTA 3PFVA 2SCPA 1AUIB 1OSAA 3EK8A 1KK7Y 4PHNA 1QX5B 3JTDB 1Z2CB 4WRIA 1TWOA 4MLWA 5B8IB 3HCMA 5I2QA 4CFRA 1OW4A 3D74A 1PK0D 2H61C 2LMUA 4NDBA 1IKUA 1JC2A 1KSOA 2K7OA 2KYCA 1JFJA 1TOPA 1LA0A 3A4UB 3BUMB 3ICBA 3PN7B 1Y0VH 4ORAB 1V1FA 3ZWHA 4N1FA 3TS5C 4DUQA 2MLEC 1RK9A 1NIWA 2LLSA 5FI2A 5HKZA 1DJWA 1WRZA 4N1GA 1QX2A 1SL7A 2WCKA 2K2AA 4M2QA 4XJKA 5HLVA 2EHBA 2QEBA 2L2EA 1QVIY 2Q4UA 2KLDA 1KFXS 1DJIA 1ZMZA 1IJ5A 2ZN8A 1KWOB 3EVUA 1UHNA 1XFZO 1NP8A 3EVRA 3D75A 2Q91A 2CTNA 5PALA 1R2UA 3AKAA 1UHHA 5ER5A 5HYDA 1N0YA 5I8NA 4NDDA 2JC2A 4E68A 1TIZA 1UURA 1MWNA 1PULA 2JRFA 3R1VA 3O78A 2OS8C 3IQQA 1EXRA 3HX4A 1B8LA 1YVHA 4PE4A 4YGBB 2CT9A 1S6JA 2GGMA 3F45A 1CFCA 1XA5A 2R2IA 4MZLA 1QV1A 2QPTA 1EJ3A 3EKHA 1BOCA 2HETA 3TS5B 3VRRA 4TNCA 1UWOA 2PASA 2I94A 1TUZA 3N7HA 4F0ZB 1JBAA 2E30A 5TNCA 1WDCC 1X02A 1BR4B 1AHRA 2JULA 2B1UA 2ZN9A 3B6XA 2BBNA 3CYZA 3I5IC 1BMOA 1M45A 2L2CA 2M7NA 3SS5A 1DJYA 3K21A 3H4SE 1AP4A 1EG3A 1ZOTB 3MSEB 1B47A 2JNFA 1JFKA 2L50A 1PALA 3B88A 2KAXA 5CSFA 3FWCA 1NYAA 2RGIA 1OOJA 1TNPA 2WCBA 2JWWA 3BFBA 1K96A 1MUXA 1Y1UA 2KAYA 2M29A 2O5GA 4YGDB 2OS8B 2PRUA 1KFUL 3NSOA 5D69A 2WORA 2JXCA 3PM2A 4CPVA 3BUNB 1JSAA 1K9UA 2V53A 3KO0A 4A4CA 2L5XB 2OTGC 3BUWB 1QLSA 4P2YB 2KOTA 2AMIA 1IGVA 3EKJA 4GGFC 1M31A 2I18A 2CCMA 1A4PA 3FS7A 3Q8IA 5FI7A 2WC8A 4KYNA 3WXAA 5KSZA 2HQ8A 1NCYA 1PVBA 3DVMA 2GV5A 3IQOA 3R72A 1CFFA 2KFGA 4PHMA 1LKJA 1KK7Z 1NX1A 1CDPA 1E8AA 3PALA 1LA3A 1XYDA 3I5IB 1IRJA 3LLEA 2M7LA 2ZRSA 2KQYA 4U8DA 3VRPA 2OPOA 1DJHA 2P6BB 1HT9A 1T14A 2AUCA 3OB1B 1M63B 1ORGA 2K7BA 5GQQC 2KAVA 1K9KA 4WQ3A 2L4HA 2GGZA 1OMVA 2LV7A 2TN4A 3NXAA 3TDUA 5HKYA 3I5HC 1XO5A 3WNXB 3SG7A 3VRQA 1DGUA 2NZ0A 2MRDA 5G08A 1NCZA 2G9BA 1HQVA 1QV0A 4GBAA 1ALVA 1BJFA 3FWBA 1TTXA 3E3RA 2H61A 2OTGB 1Q80A 2KQ6A 4QJ5B 3NSIA 4MZKA 4GNKB 1S1EA 1OQPA 2KI4B 1K94A 1DQEA 1SW8A
chains in the Genus database with same CATH topology
3B7AA 3L4LA 4INWA 4PT1A 2P70A 2WCKA 1TUJA 2QEBA 3FE9A 2WC6A 3CZ0A 1QWVA 1P28A 3CDNA 2GTEA 3D75A 3DZTA 1OOFA 3V2LA 5DICA 3R1VA 3FE8A 1OOGA 3R1PA 3FE6A 2QEOA 4FQTA 4JD9A 3S0GA 3BFHA 2WCJA 1C3YA 3N7HA 2FJYA 2PQLA 3D78A 3DXLA 3B6XA 3CYZA 3DYEA 5EL2A 2L2CA 2QDIA 2WCLA 3D76A 3S0EA 3RZSA 1GM0A 3DY9A 2WC5A 3BJHA 3B88A 3OGNA 3S0BA 3CZ1A 2P71A 3R1OA 3BFBA 2WCMA 1OOIX 3PJIA 1LS8A 3B86A 3BFAA 2KPHA 1OOHA 2QEVA 2WCHA 3L4AA 3NHIA 3Q8IA 3R72A 1C3ZA 4INXA 2ERBA 3S0FA 4OZDA 1XFRA 3D73A 3D77A 3QMEA 3B87A 4F7FA 1T14A 3K1EA 3S0AA 1ORGA 3CZ2A 3L47A 2QEHA 3NGVA 2JPOA 1TWOA 1OW4A 3D74A 3NHTA 3S0DA 3VB1A 2H8VA 3CABA 1DQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7A A;  3L4L A;  4INW A;  4PT1 A;  2P70 A;  2WCK A;  1TUJ A;  2QEB A;  3FE9 A;  2WC6 A;  3CZ0 A;  1QWV A;  1P28 A;  3CDN A;  2GTE A;  3D75 A;  3DZT A;  1OOF A;  3V2L A;  5DIC A;  3R1V A;  3FE8 A;  1OOG A;  3R1P A;  3FE6 A;  2QEO A;  4FQT A;  4JD9 A;  3S0G A;  3BFH A;  2WCJ A;  1C3Y A;  3N7H A;  2FJY A;  2PQL A;  3D78 A;  3DXL A;  3B6X A;  3CYZ A;  3DYE A;  5EL2 A;  2L2C A;  2QDI A;  2WCL A;  3D76 A;  3S0E A;  3RZS A;  1GM0 A;  3DY9 A;  2WC5 A;  3BJH A;  3B88 A;  3OGN A;  3S0B A;  3CZ1 A;  2P71 A;  3R1O A;  3BFB A;  2WCM A;  1OOI X;  3PJI A;  1LS8 A;  3B86 A;  3BFA A;  2KPH A;  1OOH A;  2QEV A;  2WCH A;  3L4A A;  3NHI A;  3Q8I A;  3R72 A;  1C3Z A;  4INX A;  2ERB A;  3S0F A;  4OZD A;  1XFR A;  3D73 A;  3D77 A;  3QME A;  3B87 A;  4F7F A;  1T14 A;  3K1E A;  3S0A A;  1ORG A;  3CZ2 A;  3L47 A;  2QEH A;  3NGV A;  2JPO A;  1TWO A;  1OW4 A;  3D74 A;  3NHT A;  3S0D A;  3VB1 A;  2H8V A;  3CAB A;  1DQE A; 
#chains in the Genus database with same CATH topology
 4N5X A;  1YX7 A;  3QRX A;  4PT1 A;  1DEL A;  4QJ3 B;  1OMD A;  3OP0 A;  1FW4 A;  1TCF A;  3CR4 X;  1FPW A;  1SPY A;  2F33 A;  1TUJ A;  1YVL A;  3RLZ A;  1YTZ C;  4ZCV A;  1J7R A;  2BE4 A;  3I5G C;  4P5O E;  1CKK A;  4OVN F;  3OB2 B;  2YGU A;  2JZI A;  5IBW A;  2MJW B;  3DVJ A;  5I94 A;  1MHO A;  2BAP A;  2WCE A;  1Y6W A;  3DZT A;  1GGW A;  2WCF A;  1OOF A;  3OX6 A;  1TNQ A;  4M2P A;  3I5H B;  1UHI A;  2Y4Q A;  3NSL A;  1CLM A;  1CM4 A;  1F4Q A;  3TDI A;  3GK4 X;  3LK0 A;  3PAT A;  4YI8 A;  4YGC B;  4YRU A;  3BUO B;  3R1P A;  4FQO A;  3FE6 A;  2LHI A;  4DIR A;  2BBM A;  2F2O A;  3IVT A;  5CSN A;  2QEO A;  3WHT B;  1CLL A;  1C7V A;  2KFH A;  1ZUZ A;  2ZFD A;  4FQT A;  2LVI A;  2I2R E;  1CFP A;  1QAS A;  3O4X A;  2COL B;  1KFX L;  2NXQ A;  1S5G Y;  3PSR A;  2L5Y A;  3DVE A;  1UHK A;  4NDC A;  1CB1 A;  1XK4 A;  3PLF B;  2BNX A;  2HF5 A;  1SSE B;  2KFF A;  4JKT A;  3DXL A;  1CFD A;  3SIB A;  1TNW A;  2MAZ A;  1KK8 C;  1B8C A;  4IJ7 A;  1BOD A;  2JT3 A;  4ORC B;  1UP5 A;  2K60 A;  2ISD A;  4MSP A;  3RZS A;  1B1G A;  1GM0 A;  3DY9 A;  1Z4H A;  2WC5 A;  3D10 A;  1H4B A;  1TNX A;  3EG5 B;  1MQ1 A;  1KQV A;  3OGN A;  2E6W A;  4PHK A;  3S0B A;  1WRK A;  3R1O A;  4GUK A;  2F2P A;  4CLN A;  2WCM A;  3VRN A;  1J1D A;  4GAO A;  4PE0 A;  2BCB A;  2L4I A;  1REC A;  1XFW O;  2EC6 C;  3ZNI A;  1U5I B;  3PJI A;  1K93 D;  4BY5 A;  2K7D A;  1FBV A;  5DKQ A;  1VRK A;  2KPH A;  1TCO B;  3D0Y A;  3L4A A;  3NHI A;  4PE1 A;  2JU0 A;  1UHJ A;  1L2O C;  4NQG A;  1B7T Y;  4D1E A;  1IIO A;  4INX A;  4PHJ A;  3S0F A;  3EVV A;  1QLK A;  1DJG A;  4OZD A;  1XFR A;  3D77 A;  5CSJ A;  5KTY A;  2FJU B;  1WLZ A;  4XYN A;  3DF0 B;  3B87 A;  1MR8 A;  1DMO A;  1QX7 A;  3K1E A;  3PM8 A;  1S6C A;  3LK1 A;  4MRX A;  2A4J A;  1IWQ A;  2CNP A;  3CZ2 A;  4IL1 A;  2LCP A;  2LVV A;  4DRW A;  1SR6 C;  1CNP A;  2LNK A;  1N2D A;  2PSR A;  1JF2 A;  3AAJ A;  1BU3 A;  3UNW A;  1K8U A;  5AFP A;  1KQM C;  5HL1 A;  4JWQ A;  1F71 A;  2EC6 B;  2G2B A;  1EG4 A;  3CWG A;  5J3X A;  4ETO A;  2NLN A;  3NHT A;  1AJ5 A;  1PRW A;  1DJX A;  3S0D A;  2JOJ A;  1WDC B;  3VB1 A;  1YR5 A;  1DGV A;  1NCX A;  1CTR A;  1MF8 B;  5F6T A;  4AOM A;  3TUY C;  5KU1 A;  1AVS A;  2BEC A;  1S6I A;  4GFT A;  2H8V A;  2O60 A;  4I5N B;  1QXP A;  2KBI A;  1M39 A;  2Y1M A;  1PVA A;  2P70 A;  4MEW A;  3RM1 A;  1CDN A;  1D1O A;  1ODB A;  2K61 A;  4YGE B;  4I5L B;  1J7O A;  2L98 A;  5I2O A;  3FE9 A;  3CZ0 A;  2NCO A;  1QWV A;  1JF0 A;  1XVJ A;  2JQ6 A;  3CDN A;  4OCI A;  1CMF A;  2GTE A;  1YUS A;  2HQW A;  1SCM C;  3CS1 A;  1S5G Z;  3V2L A;  4AQJ A;  2LP3 A;  5AXI A;  1SR6 B;  2D8N A;  1RTP 1;  2BL0 C;  2L0P A;  3OX5 A;  5I2L A;  5DIC A;  2MA2 A;  3FE8 A;  1A03 A;  3KHE A;  1N65 A;  1SRA A;  2M1U A;  2F3Z A;  1QJT A;  3GOF A;  1LVC D;  2KBM A;  1LIN A;  1NX2 A;  1SBJ A;  2ZND A;  4CID A;  4QJ4 B;  2Y1N A;  1U5I A;  4I5J A;  1XFU O;  4USL A;  3SG2 A;  1SY9 A;  5HLO A;  2ZKM X;  4JD9 A;  2M97 A;  1W9Z A;  2WND A;  3JTD C;  1KCY A;  4YI9 A;  3BFH A;  1V1G A;  4DCK A;  2WCJ A;  1K2H A;  3CTN A;  1C3Y A;  3SG4 A;  1QTX A;  2I7A A;  1FI6 A;  1B8R A;  2H2K A;  2FJY A;  4OV2 A;  1TN4 A;  2LC5 A;  1AJ4 A;  3PN7 C;  1RJV A;  1IH0 A;  4ICB A;  2K8M B;  2JT8 A;  3BUX B;  3KF9 A;  1YRT B;  4GGN A;  3KPX A;  3LCP C;  1PSB A;  3OBV A;  2PAL A;  5JOL A;  1LXF C;  1K95 A;  1SCM B;  1ZFS A;  3DD4 A;  4ZCU A;  3SS4 A;  3CZ1 A;  4AQI A;  5AAN A;  1SL9 A;  3SG3 A;  3AKB A;  1K90 D;  1OZO A;  1IQ3 A;  1OE9 B;  1DF0 B;  1B7T Z;  2M1K B;  1S36 A;  4A4B A;  3VGO A;  1OMR A;  2FCE A;  3EK4 A;  2BL0 B;  1CLB A;  3EK7 A;  2LUX A;  1SKT A;  1A2X A;  4I5K A;  1S26 D;  2PYQ A;  1BT6 A;  2KI6 C;  2M3W A;  4JPZ B;  1FI5 A;  3LL8 B;  4OKH A;  3C1V A;  4MZJ A;  2F3Y A;  2QAC A;  1C07 A;  1LS8 A;  2KHN A;  2ZNE A;  3BQ3 A;  3BFA A;  1QIW A;  4L9M A;  1OOH A;  1NX0 A;  2WCH A;  4MBE A;  2M49 B;  3CLN A;  3SG5 A;  2FOT A;  1C3Z A;  3I5G B;  4HRG A;  4HRE E;  1SYM A;  1DJZ A;  3O6B A;  1CM1 A;  2BCA A;  3TZ1 A;  3GK1 A;  1YUR A;  1L7Z A;  1YUT A;  2JT0 A;  2NCP A;  2BKI B;  3QME A;  1JWD A;  1MXL C;  3SJS A;  4F7F A;  1DT7 B;  3S0A A;  1G8I A;  1RFJ A;  1QAT A;  2LE9 B;  1GGZ A;  2FCD A;  5D3O A;  4Q04 A;  1QS7 A;  5DKR A;  1NUB A;  2QEH A;  2KI6 D;  3NGV A;  3WHU B;  1W7I B;  2SAS A;  3BOW B;  4CFQ A;  2BKH B;  3TDZ A;  3I5F C;  4GGF A;  2JPO A;  2Y5I A;  3FIA A;  2M9G A;  3SIA A;  3UO9 A;  5FI6 A;  4R1E A;  1BR1 B;  3CGA A;  1CMG A;  4OR9 B;  2LVJ A;  2F8P A;  4C0K A;  1YUU A;  1KK8 B;  5FYX A;  1MXE A;  3B7A A;  3L4L A;  4INW A;  2BCX A;  1ALW A;  2ZRT A;  1F8H A;  2LP2 A;  2M0R A;  4C0L A;  1DC1 A;  1BG1 A;  3M0W A;  1DVI A;  1F70 A;  4ORB B;  5AER A;  2JTZ A;  1RWY A;  1SMG A;  1XK4 C;  2WC6 A;  1F55 A;  1C7W A;  1NWD A;  1P28 A;  4YGA A;  2CXJ A;  1SNL A;  4HRH A;  1UUS A;  2JNX A;  1A75 B;  1G33 A;  1DF0 A;  5JJG A;  2BE6 A;  1J1E A;  4BY4 A;  2KNE A;  1PSR A;  4PDZ A;  1Y1X A;  1YX8 A;  1OOG A;  4DS7 A;  1EL4 A;  3I5F B;  1W7J B;  3OHM B;  1NSH A;  2LVK A;  2KGR A;  1L2O B;  2MBX A;  1XFX O;  5HKW A;  5CSI A;  1RRO A;  4MN0 A;  5BPJ A;  2LLT A;  3CZT X;  4PE7 A;  2KGB C;  3S0G A;  1FF1 A;  4GPL B;  2K0J A;  2JXL A;  4FTG A;  4JQ0 D;  4MVF A;  1KFU S;  1CDL A;  1SL8 A;  3CAB A;  2K7C A;  1AK8 A;  2KSP A;  1XFY O;  1B4C A;  4XJK B;  5AEQ A;  2LAP A;  2PQL A;  3D78 A;  1IG5 A;  4WQ2 A;  1XFV O;  3DYE A;  3DVK A;  2KI4 C;  2KLE A;  5EL2 A;  1JUO A;  3VRO A;  2PVB A;  1QIV A;  1NX3 A;  1OZS A;  1M46 A;  2QDI A;  1S3P A;  1IQ5 A;  2WCL A;  3D76 A;  3S0E A;  1WRL A;  1G4Y R;  1A29 A;  5CPV A;  3BJH A;  2LLU A;  3NSK A;  2DOQ A;  1F4O A;  5DKN A;  1NPQ A;  1KQM B;  3IF7 A;  4UPG A;  2P71 A;  2LHL A;  2K2F A;  2HPS A;  1H8B A;  3JVT C;  3BXK A;  3CR2 A;  3O2P A;  2M8U A;  3BOW A;  2EGD A;  1OOI X;  3TUY B;  2PMY A;  4PCW A;  2AAO A;  1DEK A;  2LMV A;  1B9A A;  3GK2 A;  1CDM A;  1GJY A;  3B86 A;  3KEV A;  1DTL A;  1YRU B;  2MLF C;  4YBH B;  1J7Q A;  1QVI Z;  1R6P A;  2QEV A;  1SCV A;  3SS3 A;  1KSM A;  1WY9 A;  3SG6 A;  1EH2 A;  1IJ6 A;  5K89 A;  3DF0 A;  2KDH A;  4M2O A;  4MRY A;  1F54 A;  2JPT A;  2ERB A;  3O4Y A;  5ER4 X;  3D0Y B;  1TRF A;  5D7F A;  2LM5 A;  3D73 A;  2VRG A;  1GQM A;  4HSZ A;  2IS9 A;  1SK6 D;  3A8R A;  2JTT A;  2LUC A;  1J55 A;  1J7P A;  3CR5 X;  1KWO C;  2KYF A;  3BYA A;  1ZAC A;  4C0J A;  2LAN A;  2CBL A;  4PAL A;  1BLQ A;  1Y1A A;  3AAK A;  1A75 A;  2MHH A;  2WOS A;  1BF5 A;  1WLM A;  3L47 A;  2L51 A;  3JVT B;  1K9P A;  2LMT A;  3PFV A;  2SCP A;  1AUI B;  1OSA A;  3EK8 A;  1KK7 Y;  4PHN A;  1QX5 B;  3JTD B;  1Z2C B;  4WRI A;  1TWO A;  4MLW A;  5B8I B;  3HCM A;  5I2Q A;  4CFR A;  1OW4 A;  3D74 A;  1PK0 D;  2H61 C;  2LMU A;  4NDB A;  1IKU A;  1JC2 A;  1KSO A;  2K7O A;  2KYC A;  1JFJ A;  1TOP A;  1LA0 A;  3A4U B;  3BUM B;  3ICB A;  3PN7 B;  1Y0V H;  4ORA B;  1V1F A;  3ZWH A;  4N1F A;  3TS5 C;  4DUQ A;  2MLE C;  1RK9 A;  1NIW A;  2LLS A;  5FI2 A;  5HKZ A;  1DJW A;  1WRZ A;  4N1G A;  1QX2 A;  1SL7 A;  2WCK A;  2K2A A;  4M2Q A;  4XJK A;  5HLV A;  2EHB A;  2QEB A;  2L2E A;  1QVI Y;  2Q4U A;  2KLD A;  1KFX S;  1DJI A;  1ZMZ A;  1IJ5 A;  2ZN8 A;  1KWO B;  3EVU A;  1UHN A;  1XFZ O;  1NP8 A;  3EVR A;  3D75 A;  2Q91 A;  2CTN A;  5PAL A;  1R2U A;  3AKA A;  1UHH A;  5ER5 A;  5HYD A;  1N0Y A;  5I8N A;  4NDD A;  2JC2 A;  4E68 A;  1TIZ A;  1UUR A;  1MWN A;  1PUL A;  2JRF A;  3R1V A;  3O78 A;  2OS8 C;  3IQQ A;  1EXR A;  3HX4 A;  1B8L A;  1YVH A;  4PE4 A;  4YGB B;  2CT9 A;  1S6J A;  2GGM A;  3F45 A;  1CFC A;  1XA5 A;  2R2I A;  4MZL A;  1QV1 A;  2QPT A;  1EJ3 A;  3EKH A;  1BOC A;  2HET A;  3TS5 B;  3VRR A;  4TNC A;  1UWO A;  2PAS A;  2I94 A;  1TUZ A;  3N7H A;  4F0Z B;  1JBA A;  2E30 A;  5TNC A;  1WDC C;  1X02 A;  1BR4 B;  1AHR A;  2JUL A;  2B1U A;  2ZN9 A;  3B6X A;  2BBN A;  3CYZ A;  3I5I C;  1BMO A;  1M45 A;  2L2C A;  2M7N A;  3SS5 A;  1DJY A;  3K21 A;  3H4S E;  1AP4 A;  1EG3 A;  1ZOT B;  3MSE B;  1B47 A;  2JNF A;  1JFK A;  2L50 A;  1PAL A;  3B88 A;  2KAX A;  5CSF A;  3FWC A;  1NYA A;  2RGI A;  1OOJ A;  1TNP A;  2WCB A;  2JWW A;  3BFB A;  1K96 A;  1MUX A;  1Y1U A;  2KAY A;  2M29 A;  2O5G A;  4YGD B;  2OS8 B;  2PRU A;  1KFU L;  3NSO A;  5D69 A;  2WOR A;  2JXC A;  3PM2 A;  4CPV A;  3BUN B;  1JSA A;  1K9U A;  2V53 A;  3KO0 A;  4A4C A;  2L5X B;  2OTG C;  3BUW B;  1QLS A;  4P2Y B;  2KOT A;  2AMI A;  1IGV A;  3EKJ A;  4GGF C;  1M31 A;  2I18 A;  2CCM A;  1A4P A;  3FS7 A;  3Q8I A;  5FI7 A;  2WC8 A;  4KYN A;  3WXA A;  5KSZ A;  2HQ8 A;  1NCY A;  1PVB A;  3DVM A;  2GV5 A;  3IQO A;  3R72 A;  1CFF A;  2KFG A;  4PHM A;  1LKJ A;  1KK7 Z;  1NX1 A;  1CDP A;  1E8A A;  3PAL A;  1LA3 A;  1XYD A;  3I5I B;  1IRJ A;  3LLE A;  2M7L A;  2ZRS A;  2KQY A;  4U8D A;  3VRP A;  2OPO A;  1DJH A;  2P6B B;  1HT9 A;  1T14 A;  2AUC A;  3OB1 B;  1M63 B;  1ORG A;  2K7B A;  5GQQ C;  2KAV A;  1K9K A;  4WQ3 A;  2L4H A;  2GGZ A;  1OMV A;  2LV7 A;  2TN4 A;  3NXA A;  3TDU A;  5HKY A;  3I5H C;  1XO5 A;  3WNX B;  3SG7 A;  3VRQ A;  1DGU A;  2NZ0 A;  2MRD A;  5G08 A;  1NCZ A;  2G9B A;  1HQV A;  1QV0 A;  4GBA A;  1ALV A;  1BJF A;  3FWB A;  1TTX A;  3E3R A;  2H61 A;  2OTG B;  1Q80 A;  2KQ6 A;  4QJ5 B;  3NSI A;  4MZK A;  4GNK B;  1S1E A;  1OQP A;  2KI4 B;  1K94 A;  1DQE A;  1SW8 A; 
#chains in the Genus database with same CATH homology
 3B7A A;  3L4L A;  4INW A;  4PT1 A;  2P70 A;  2WCK A;  1TUJ A;  2QEB A;  3FE9 A;  2WC6 A;  3CZ0 A;  1QWV A;  1P28 A;  3CDN A;  2GTE A;  3D75 A;  3DZT A;  1OOF A;  3V2L A;  5DIC A;  3R1V A;  3FE8 A;  1OOG A;  3R1P A;  3FE6 A;  2QEO A;  4FQT A;  4JD9 A;  3S0G A;  3BFH A;  2WCJ A;  1C3Y A;  3N7H A;  2FJY A;  2PQL A;  3D78 A;  3DXL A;  3B6X A;  3CYZ A;  3DYE A;  5EL2 A;  2L2C A;  2QDI A;  2WCL A;  3D76 A;  3S0E A;  3RZS A;  1GM0 A;  3DY9 A;  2WC5 A;  3BJH A;  3B88 A;  3OGN A;  3S0B A;  3CZ1 A;  2P71 A;  3R1O A;  3BFB A;  2WCM A;  1OOI X;  3PJI A;  1LS8 A;  3B86 A;  3BFA A;  2KPH A;  1OOH A;  2QEV A;  2WCH A;  3L4A A;  3NHI A;  3Q8I A;  3R72 A;  1C3Z A;  4INX A;  2ERB A;  3S0F A;  4OZD A;  1XFR A;  3D73 A;  3D77 A;  3QME A;  3B87 A;  4F7F A;  1T14 A;  3K1E A;  3S0A A;  1ORG A;  3CZ2 A;  3L47 A;  2QEH A;  3NGV A;  2JPO A;  1TWO A;  1OW4 A;  3D74 A;  3NHT A;  3S0D A;  3VB1 A;  2H8V A;  3CAB A;  1DQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...