3S0GA

Apis mellifera obp 14 double mutant gln44cys, his97cys
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
119
structure length
119
Chain Sequence
b'MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVCLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPCLKASKLVQCVSKYKTMKSVDFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBP14
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
total genus 48
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0gA00
3B88A 3BFBA 3NGVA 3RZSA 3D74A 3FE9A 3R1PA 3R1VA 2PQLA 1XFRA 3Q8IA 3B87A 3CDNA 3DZTA 1TWOA 3S0BA 3D76A 1OOHA 3PJIA 2FJYA 1C3ZA 1T14A 3DXLA 2WCJA 4INWA 3FE6A 2L2CA 1OOIX 5DICA 2QEHA 2ERBA 5EL2A 3S0DA 2WCMA 3CZ0A 3R1OA 4FQTA 3S0EA 2GTEA 3BJHA 2WCLA 3L4AA 2P70A 3CZ1A 3B86A 3D77A 2QEBA 2WC6A 3L47A 2WCKA 1LS8A 3B7AA 3NHTA 3S0FA 1GM0A 3QMEA 2KPHA 1OOFA 3B6XA 3BFHA 3D75A 2H8VA 3K1EA 1QWVA 1P28A 3D73A 3V2LA 3DY9A 2WC5A 3BFAA 1DQEA 3FE8A 1ORGA 3N7HA 3CABA 2P71A 2QEOA 3R72A 2QEVA 2QDIA 4OZDA 2JPOA 3CZ2A 4PT1A 4INXA 4JD9A 3D78A 3DYEA 3OGNA 4F7FA 3CYZA 3S0GA 1OOGA 3VB1A 1TUJA 3S0AA 1OW4A 1C3YA 2WCHA 3NHIA 3L4LA
chains in the Genus database with same CATH superfamily
2Y1MA 2EC6B 1A03A 3DVEA 1XFXO 2FCDA 3AKBA 3RZSA 1XVJA 3I5HC 1A2XA 2JT0A 1C07A 1AHRA 4PHJA 2NLNA 3JVTC 1C7VA 4DIRA 1PK0D 2GGMA 5FI7A 1K90D 1A4PA 2JT3A 1Y1XA 1NPQA 2M1UA 3OHMB 1XFRA 2EC6C 2JULA 3VRQA 4HRHA 2KBMA 4ZCUA 5IBWA 1BU3A 2JPTA 1WY9A 2ZRTA 2CT9A 1S6CA 2BL0B 3D76A 3CR5X 3NSKA 3PJIA 3SIBA 2FJYA 2MBXA 3NHIA 2AAOA 1AVSA 1YX8A 1QVIZ 3E3RA 2JU0A 3F45A 1SY9A 3ZWHA 3VGOA 3DXLA 4INWA 4QJ5B 3FE6A 1OOIX 3NSLA 1EG3A 3SIAA 1LKJA 2ERBA 1OMDA 2PYQA 3BUOB 5EL2A 1SYMA 1PALA 1RJVA 2OS8B 4YGCB 1RROA 2Y4QA 4Q04A 2WCMA 3CZ0A 1EJ3A 2BCXA 2HQWA 3EKHA 5PALA 1KSOA 1UHJA 5HL1A 3AAJA 5D7FA 2M0RA 1CDPA 3SG5A 4DCKA 3MSEB 1QLKA 2B1UA 1BMOA 3KHEA 5FYXA 1CKKA 2CXJA 4PCWA 4WQ3A 3EG5B 3GK1A 1UURA 1F55A 1IG5A 3BYAA 2OS8C 5D69A 4OR9B 1TUZA 1NP8A 1SNLA 1OSAA 2WC6A 1QS7A 5DKNA 2WCKA 5AEQA 2L4HA 3BUMB 1XA5A 1XFUO 2KFFA 2KBIA 2M3WA 1BF5A 1FI6A 2WOSA 5CSJA 3CTNA 4MBEA 1OOFA 3KPXA 2LLTA 2GV5A 1KSMA 1FI5A 2LNKA 2LVKA 1IH0A 3HCMA 2M7NA 4CIDA 1XFVO 3D75A 2Q91A 2ZRSA 2H8VA 2EGDA 1QWVA 5HKYA 3TZ1A 1AUIB 2F2PA 1V1GA 2K7DA 1NYAA 1B4CA 4YGAA 2KSPA 5FI6A 1IGVA 2KGBC 1FW4A 2LLSA 2M8UA 2H61A 4YGEB 4C0KA 1BOCA 3DY9A 1PSBA 1G4YR 2KOTA 3BFAA 1M63B 1ORGA 3FE8A 3O4YA 1J7PA 1DF0B 3NSIA 1UUSA 5D3OA 1SL9A 2ZNDA 2K61A 5AANA 3EVUA 4GGFA 1LXFC 1CFPA 1YVHA 1CFDA 2JPOA 1DVIA 4PALA 3VRPA 4ORCB 1QX7A 1AJ4A 2BNXA 3OGNA 2MLEC 3AKAA 5HLOA 5GQQC 4HRGA 3VB1A 1TUJA 1MWNA 1F8HA 1OW4A 1NCZA 1NUBA 2EHBA 1B8LA 2P6BB 3NXAA 5DKQA 1J7OA 2BCAA 1U5IB 1XFYO 2KFHA 4A4BA 3PLFB 2WCHA 1YRTB 2GGZA 1JUOA 1EG4A 3H4SE 5K89A 1H4BA 2CCMA 1DGUA 1X02A 1EH2A 1B8RA 2NCPA 2WCFA 4PHKA 1S5GZ 5HKZA 3KO0A 2I7AA 1RECA 2KAVA 2SCPA 2ISDA 4N1FA 3K21A 1IJ6A 4HREE 2HF5A 2PQLA 2O60A 1TN4A 3BXKA 1NCYA 2WCEA 4D1EA 1YVLA 2NXQA 3B87A 1F54A 1NX3A 4ICBA 1TNXA 1CMFA 1N65A 1WRZA 3FIAA 2JTTA 4P5OE 4CFRA 4OCIA 1ZOTB 1K9PA 1OOHA 1ZUZA 1DJZA 3S0BA 5G08A 2LLUA 1DF0A 4MZLA 1NX1A 5B8IB 2BCBA 1ODBA 1OZSA 1KWOB 2WCJA 1XK4C 3DVMA 1F4OA 2R2IA 3I5FB 2K7OA 2QACA 2JRFA 2QEHA 4C0JA 5AXIA 3D0YB 1DJYA 3SG6A 1QLSA 2LP3A 2F33A 2KQYA 2LVJA 4DUQA 1M39A 2ZN8A 3O4XA 1QXPA 1KCYA 1M46A 4GFTA 3R1OA 1IWQA 1JFKA 3RM1A 1KWOC 1Y6WA 5F6TA 1MQ1A 1U5IA 3L4AA 3I5FC 1KFUL 3CR2A 1K93D 2LP2A 2KNEA 1K94A 1SPYA 1KFXL 5HKWA 1AJ5A 2E30A 1TNWA 3GOFA 3LLEA 3UNWA 3DVKA 2LCPA 1QX5B 4ZCVA 1LS8A 3OX5A 2AMIA 1R6PA 3BUXB 2LV7A 3LK0A 1J55A 1LINA 4NDCA 1NWDA 4PHMA 3NHTA 1WLZA 2G9BA 4JWQA 3QMEA 4MLWA 1FPWA 4L9MA 1M31A 4MN0A 1BT6A 2KQ6A 1SCVA 3SG4A 1QX2A 3BFHA 3TDUA 2SASA 1DEKA 1CMGA 1OZOA 4FTGA 1OE9B 2BKIB 4CLNA 2KGRA 2NCOA 1JWDA 3ICBA 2WORA 1XYDA 1SL8A 3CGAA 2JT8A 2L98A 2K8MB 1KQVA 3V2LA 2M97A 1F71A 1UP5A 2ZN9A 1Y1AA 1Z2CB 3TDZA 1VRKA 2KYFA 2LMVA 3OP0A 2M1KB 3N7HA 4MVFA 3TS5B 1R2UA 3BQ3A 1DJXA 1DT7B 3PFVA 2QEOA 3D0YA 3OBVA 1IJ5A 2L51A 3BUWB 1FBVA 2LE9B 2QEVA 2F3YA 3QRXA 3R72A 1JFJA 1CLMA 2HQ8A 3A8RA 1B7TZ 3CZ2A 4PT1A 4JD9A 3IVTA 2MAZA 4WRIA 3TS5C 3DVJA 1A75B 1YUTA 2Q4UA 2E6WA 5JJGA 3S0GA 1W9ZA 5ER5A 3I5IB 1SMGA 2JNFA 1DJIA 3GK4X 1C3YA 1SRAA 4YRUA 1CFCA 5KSZA 2L5YA 1OOJA 2PRUA 4U8DA 1GGWA 1BR1B 2RGIA 3IF7A 4M2QA 3BUNB 1L2OB 3I5IC 2MJWB 3B88A 1K2HA 3CZTX 2FCEA 2L50A 2JWWA 4CPVA 3D74A 3PALA 2Y1NA 3FE9A 4HSZA 5J3XA 3R1PA 3R1VA 2L2EA 1YRUB 1F70A 4DS7A 1N2DA 2MLFC 4ORBB 4XYNA 3RLZA 1YX7A 3OX6A 1WRKA 3CDNA 1L2OC 1KK7Z 2K60A 2KAXA 2LC5A 2L0PA 1JC2A 2VRGA 1QVIY 1IKUA 1J1DA 1UHNA 1SCMB 1SL7A 1C3ZA 2M7LA 1S26D 1T14A 4XJKB 1AK8A 1BR4B 4DRWA 2I18A 2OTGB 2A4JA 3PN7B 2JXLA 1A29A 2F2OA 1B1GA 2KAYA 1D1OA 5DICA 1RK9A 3LK1A 1OMRA 4I5NB 3S0DA 5AFPA 1A75A 1SCMC 1MXLC 1W7JB 2F3ZA 5CPVA 5TNCA 1PSRA 2DOQA 3EKJA 2LVVA 3O6BA 1Y1UA 4QJ4B 4IL1A 1NX2A 3O78A 4C0LA 1JSAA 2GTEA 1TOPA 2MHHA 2OTGC 1QV1A 3PN7C 2L4IA 4N1GA 4F0ZB 2WC8A 5CSFA 4NDDA 4MRYA 3ZNIA 3SG2A 4OKHA 1Q80A 2LUCA 4BY5A 4YGBB 1PULA 1EXRA 1BODA 4GAOA 2BE6A 4KYNA 4AQIA 5CSIA 3CLNA 2QEBA 4I5LB 4E68A 1DMOA 1TNPA 4QJ3B 1IRJA 5HLVA 4PE0A 2M49B 1DTLA 1F4QA 3TUYB 2M9GA 2D8NA 2H2KA 3CS1A 2PSRA 1XFWO 3UO9A 3D10A 2MRDA 1GQMA 1BLQA 1UHKA 4OVNF 4GGNA 1ZMZA 2CBLA 4N5XA 2BE4A 2PVBA 1TIZA 2FJUB 3FWCA 4NDBA 4XJKA 3TUYC 1CNPA 1B8CA 1K9KA 3LL8B 2WCBA 5I2OA 1PVAA 2WC5A 1IIOA 1DQEA 4PHNA 5JOLA 1BG1A 3CABA 1K95A 1W7IB 2LUXA 1LVCD 2Y5IA 4PE4A 1NCXA 1HT9A 1B9AA 1GJYA 4WQ2A 3BOWB 3EK4A 1XO5A 4FQOA 1S36A 4MSPA 1K9UA 4INXA 1KK7Y 5AERA 1TCFA 1J7QA 5I94A 2LVIA 2KDHA 4F7FA 1CFFA 3PATA 2KYCA 3EVRA 4USLA 1XK4A 3EK7A 1SR6B 1XFZO 1CDNA 4PE1A 3CYZA 3I5GB 5KTYA 1DJHA 1IQ3A 4GNKB 3WXAA 2JZIA 1YTZC 1CM4A 2KLDA 1CDLA 2HPSA 5FI2A 1MUXA 1H8BA 1MR8A 1OMVA 2LM5A 2K2FA 1CLBA 2PASA 3OB1B 1SR6C 1Y0VH 1ZFSA 3DD4A 1PRWA 1QATA 1S5GY 2KLEA 3JTDB 1KK8B 3I5GC 3L4LA 1BJFA 4MZJA 3AAKA 5I2QA 1RFJA 4MRXA 2BBNA 3BFBA 1YUUA 4M2OA 2BBMA 4PDZA 4YI8A 2JNXA 2M29A 3NGVA 4AQJA 2BL0C 1DELA 4AOMA 1FF1A 2I94A 3EK8A 2BAPA 1CB1A 1CDMA 1DJWA 1JF2A 1ZACA 2H61C 3JTDC 2LMUA 3VRRA 1QTXA 1KK8C 3Q8IA 3DZTA 1UWOA 1TWOA 3PM8A 1Z4HA 4IJ7A 3WHUB 4R1EA 2F8PA 1HQVA 2TN4A 3HX4A 4GGFC 3SS3A 4CFQA 1JF0A 2K7BA 5I2LA 1EL4A 2OPOA 2BKHB 1TCOB 1L7ZA 1ALVA 1SW8A 2HETA 1S6IA 2LANA 2LHIA 3BOWA 3LCPC 3PM2A 2JC2A 2L2CA 2YGUA 4YGDB 4I5KA 1SK6D 1TRFA 4OV2A 1KFUS 1IQ5A 2COLB 1SSEB 1KFXS 5ER4X 2PMYA 4A4CA 5KU1A 1WDCB 2CTNA 2FOTA 2JTZA 5I8NA 1YUSA 4FQTA 3S0EA 3BJHA 2CNPA 3WHTB 1WRLA 2KHNA 1K8UA 2WCLA 1SBJA 1DGVA 4GBAA 2LMTA 1C7WA 1QASA 2P70A 4MZKA 1MXEA 1PVBA 4ORAB 5HYDA 1MHOA 2IS9A 1J7RA 3CZ1A 3SG7A 2O5GA 3B86A 1WDCC 2LAPA 2PALA 3D77A 1CM1A 3DF0B 4JKTA 3VRNA 2KI6C 1JBAA 3CWGA 3L47A 4P2YB 1ALWA 1GGZA 2KI4B 3B7AA 3IQQA 4BY4A 5BPJA 3S0FA 5DKRA 4TNCA 1GM0A 1S6JA 2KI6D 1AP4A 1QIWA 2KPHA 1TTXA 1DJGA 1E8AA 1KQMB 3SS4A 2K2AA 2QPTA 3B6XA 2I2RE 1S1EA 2NZ0A 2ZFDA 2JXCA 1OQPA 1RWYA 2KI4C 3K1EA 4MEWA 4NQGA 4YI9A 5CSNA 3TDIA 3NSOA 1UHHA 3M0WA 1WLMA 4JQ0D 1K96A 1KQMC 1CLLA 1YR5A 1P28A 3D73A 1RTP1 1NSHA 4GUKA 4GPLB 1G33A 2BECA 3FWBA 2WNDA 1M45A 1V1FA 1QV0A 3A4UB 4M2PA 2P71A 2AUCA 1B7TY 3IQOA 1QIVA 1DC1A 2QDIA 1TNQA 3FS7A 4OZDA 1S3PA 1MF8B 1UHIA 3KEVA 4JPZB 3VROA 1G8IA 1LA0A 2KFGA 3D78A 2ZNEA 2K7CA 1QJTA 3DYEA 4YBHB 3SG3A 1NIWA 2LHLA 3GK2A 2G2BA 3KF9A 2K0JA 3C1VA 1OOGA 2V53A 1LA3A 1CTRA 3O2PA 4I5JA 3S0AA 1YURA 3DF0A 3I5HB 3WNXB 3SS5A 2JQ6A 2JOJA 1J1EA 3OB2B 3CR4X 1B47A 3JVTB 1N0YA 4UPGA 4PE7A 3EVVA 3PSRA 2MA2A 3SJSA 4ETOA 1NX0A 1SKTA 2L5XB 2ZKMX
chains in the Genus database with same CATH topology
3B88A 3BFBA 3NGVA 3RZSA 3D74A 3FE9A 3R1PA 3R1VA 2PQLA 1XFRA 3Q8IA 3B87A 3CDNA 3DZTA 1TWOA 3S0BA 3D76A 1OOHA 3PJIA 2FJYA 1C3ZA 1T14A 3DXLA 2WCJA 4INWA 3FE6A 2L2CA 1OOIX 5DICA 2QEHA 2ERBA 5EL2A 3S0DA 2WCMA 3CZ0A 3R1OA 4FQTA 3S0EA 2GTEA 3BJHA 2WCLA 3L4AA 2P70A 3CZ1A 3B86A 3D77A 2QEBA 2WC6A 3L47A 2WCKA 1LS8A 3B7AA 3NHTA 3S0FA 1GM0A 3QMEA 2KPHA 1OOFA 3B6XA 3BFHA 3D75A 2H8VA 3K1EA 1QWVA 1P28A 3D73A 3V2LA 3DY9A 2WC5A 3BFAA 1DQEA 3FE8A 1ORGA 3N7HA 3CABA 2P71A 2QEOA 3R72A 2QEVA 2QDIA 4OZDA 2JPOA 3CZ2A 4PT1A 4INXA 4JD9A 3D78A 3DYEA 3OGNA 4F7FA 3CYZA 3S0GA 1OOGA 3VB1A 1TUJA 3S0AA 1OW4A 1C3YA 2WCHA 3NHIA 3L4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B88 A;  3BFB A;  3NGV A;  3RZS A;  3D74 A;  3FE9 A;  3R1P A;  3R1V A;  2PQL A;  1XFR A;  3Q8I A;  3B87 A;  3CDN A;  3DZT A;  1TWO A;  3S0B A;  3D76 A;  1OOH A;  3PJI A;  2FJY A;  1C3Z A;  1T14 A;  3DXL A;  2WCJ A;  4INW A;  3FE6 A;  2L2C A;  1OOI X;  5DIC A;  2QEH A;  2ERB A;  5EL2 A;  3S0D A;  2WCM A;  3CZ0 A;  3R1O A;  4FQT A;  3S0E A;  2GTE A;  3BJH A;  2WCL A;  3L4A A;  2P70 A;  3CZ1 A;  3B86 A;  3D77 A;  2QEB A;  2WC6 A;  3L47 A;  2WCK A;  1LS8 A;  3B7A A;  3NHT A;  3S0F A;  1GM0 A;  3QME A;  2KPH A;  1OOF A;  3B6X A;  3BFH A;  3D75 A;  2H8V A;  3K1E A;  1QWV A;  1P28 A;  3D73 A;  3V2L A;  3DY9 A;  2WC5 A;  3BFA A;  1DQE A;  3FE8 A;  1ORG A;  3N7H A;  3CAB A;  2P71 A;  2QEO A;  3R72 A;  2QEV A;  2QDI A;  4OZD A;  2JPO A;  3CZ2 A;  4PT1 A;  4INX A;  4JD9 A;  3D78 A;  3DYE A;  3OGN A;  4F7F A;  3CYZ A;  3S0G A;  1OOG A;  3VB1 A;  1TUJ A;  3S0A A;  1OW4 A;  1C3Y A;  2WCH A;  3NHI A;  3L4L A; 
#chains in the Genus database with same CATH topology
 2Y1M A;  2EC6 B;  1A03 A;  3DVE A;  1XFX O;  2FCD A;  3AKB A;  3RZS A;  1XVJ A;  3I5H C;  1A2X A;  2JT0 A;  1C07 A;  1AHR A;  4PHJ A;  2NLN A;  3JVT C;  1C7V A;  4DIR A;  1PK0 D;  2GGM A;  5FI7 A;  1K90 D;  1A4P A;  2JT3 A;  1Y1X A;  1NPQ A;  2M1U A;  3OHM B;  1XFR A;  2EC6 C;  2JUL A;  3VRQ A;  4HRH A;  2KBM A;  4ZCU A;  5IBW A;  1BU3 A;  2JPT A;  1WY9 A;  2ZRT A;  2CT9 A;  1S6C A;  2BL0 B;  3D76 A;  3CR5 X;  3NSK A;  3PJI A;  3SIB A;  2FJY A;  2MBX A;  3NHI A;  2AAO A;  1AVS A;  1YX8 A;  1QVI Z;  3E3R A;  2JU0 A;  3F45 A;  1SY9 A;  3ZWH A;  3VGO A;  3DXL A;  4INW A;  4QJ5 B;  3FE6 A;  1OOI X;  3NSL A;  1EG3 A;  3SIA A;  1LKJ A;  2ERB A;  1OMD A;  2PYQ A;  3BUO B;  5EL2 A;  1SYM A;  1PAL A;  1RJV A;  2OS8 B;  4YGC B;  1RRO A;  2Y4Q A;  4Q04 A;  2WCM A;  3CZ0 A;  1EJ3 A;  2BCX A;  2HQW A;  3EKH A;  5PAL A;  1KSO A;  1UHJ A;  5HL1 A;  3AAJ A;  5D7F A;  2M0R A;  1CDP A;  3SG5 A;  4DCK A;  3MSE B;  1QLK A;  2B1U A;  1BMO A;  3KHE A;  5FYX A;  1CKK A;  2CXJ A;  4PCW A;  4WQ3 A;  3EG5 B;  3GK1 A;  1UUR A;  1F55 A;  1IG5 A;  3BYA A;  2OS8 C;  5D69 A;  4OR9 B;  1TUZ A;  1NP8 A;  1SNL A;  1OSA A;  2WC6 A;  1QS7 A;  5DKN A;  2WCK A;  5AEQ A;  2L4H A;  3BUM B;  1XA5 A;  1XFU O;  2KFF A;  2KBI A;  2M3W A;  1BF5 A;  1FI6 A;  2WOS A;  5CSJ A;  3CTN A;  4MBE A;  1OOF A;  3KPX A;  2LLT A;  2GV5 A;  1KSM A;  1FI5 A;  2LNK A;  2LVK A;  1IH0 A;  3HCM A;  2M7N A;  4CID A;  1XFV O;  3D75 A;  2Q91 A;  2ZRS A;  2H8V A;  2EGD A;  1QWV A;  5HKY A;  3TZ1 A;  1AUI B;  2F2P A;  1V1G A;  2K7D A;  1NYA A;  1B4C A;  4YGA A;  2KSP A;  5FI6 A;  1IGV A;  2KGB C;  1FW4 A;  2LLS A;  2M8U A;  2H61 A;  4YGE B;  4C0K A;  1BOC A;  3DY9 A;  1PSB A;  1G4Y R;  2KOT A;  3BFA A;  1M63 B;  1ORG A;  3FE8 A;  3O4Y A;  1J7P A;  1DF0 B;  3NSI A;  1UUS A;  5D3O A;  1SL9 A;  2ZND A;  2K61 A;  5AAN A;  3EVU A;  4GGF A;  1LXF C;  1CFP A;  1YVH A;  1CFD A;  2JPO A;  1DVI A;  4PAL A;  3VRP A;  4ORC B;  1QX7 A;  1AJ4 A;  2BNX A;  3OGN A;  2MLE C;  3AKA A;  5HLO A;  5GQQ C;  4HRG A;  3VB1 A;  1TUJ A;  1MWN A;  1F8H A;  1OW4 A;  1NCZ A;  1NUB A;  2EHB A;  1B8L A;  2P6B B;  3NXA A;  5DKQ A;  1J7O A;  2BCA A;  1U5I B;  1XFY O;  2KFH A;  4A4B A;  3PLF B;  2WCH A;  1YRT B;  2GGZ A;  1JUO A;  1EG4 A;  3H4S E;  5K89 A;  1H4B A;  2CCM A;  1DGU A;  1X02 A;  1EH2 A;  1B8R A;  2NCP A;  2WCF A;  4PHK A;  1S5G Z;  5HKZ A;  3KO0 A;  2I7A A;  1REC A;  2KAV A;  2SCP A;  2ISD A;  4N1F A;  3K21 A;  1IJ6 A;  4HRE E;  2HF5 A;  2PQL A;  2O60 A;  1TN4 A;  3BXK A;  1NCY A;  2WCE A;  4D1E A;  1YVL A;  2NXQ A;  3B87 A;  1F54 A;  1NX3 A;  4ICB A;  1TNX A;  1CMF A;  1N65 A;  1WRZ A;  3FIA A;  2JTT A;  4P5O E;  4CFR A;  4OCI A;  1ZOT B;  1K9P A;  1OOH A;  1ZUZ A;  1DJZ A;  3S0B A;  5G08 A;  2LLU A;  1DF0 A;  4MZL A;  1NX1 A;  5B8I B;  2BCB A;  1ODB A;  1OZS A;  1KWO B;  2WCJ A;  1XK4 C;  3DVM A;  1F4O A;  2R2I A;  3I5F B;  2K7O A;  2QAC A;  2JRF A;  2QEH A;  4C0J A;  5AXI A;  3D0Y B;  1DJY A;  3SG6 A;  1QLS A;  2LP3 A;  2F33 A;  2KQY A;  2LVJ A;  4DUQ A;  1M39 A;  2ZN8 A;  3O4X A;  1QXP A;  1KCY A;  1M46 A;  4GFT A;  3R1O A;  1IWQ A;  1JFK A;  3RM1 A;  1KWO C;  1Y6W A;  5F6T A;  1MQ1 A;  1U5I A;  3L4A A;  3I5F C;  1KFU L;  3CR2 A;  1K93 D;  2LP2 A;  2KNE A;  1K94 A;  1SPY A;  1KFX L;  5HKW A;  1AJ5 A;  2E30 A;  1TNW A;  3GOF A;  3LLE A;  3UNW A;  3DVK A;  2LCP A;  1QX5 B;  4ZCV A;  1LS8 A;  3OX5 A;  2AMI A;  1R6P A;  3BUX B;  2LV7 A;  3LK0 A;  1J55 A;  1LIN A;  4NDC A;  1NWD A;  4PHM A;  3NHT A;  1WLZ A;  2G9B A;  4JWQ A;  3QME A;  4MLW A;  1FPW A;  4L9M A;  1M31 A;  4MN0 A;  1BT6 A;  2KQ6 A;  1SCV A;  3SG4 A;  1QX2 A;  3BFH A;  3TDU A;  2SAS A;  1DEK A;  1CMG A;  1OZO A;  4FTG A;  1OE9 B;  2BKI B;  4CLN A;  2KGR A;  2NCO A;  1JWD A;  3ICB A;  2WOR A;  1XYD A;  1SL8 A;  3CGA A;  2JT8 A;  2L98 A;  2K8M B;  1KQV A;  3V2L A;  2M97 A;  1F71 A;  1UP5 A;  2ZN9 A;  1Y1A A;  1Z2C B;  3TDZ A;  1VRK A;  2KYF A;  2LMV A;  3OP0 A;  2M1K B;  3N7H A;  4MVF A;  3TS5 B;  1R2U A;  3BQ3 A;  1DJX A;  1DT7 B;  3PFV A;  2QEO A;  3D0Y A;  3OBV A;  1IJ5 A;  2L51 A;  3BUW B;  1FBV A;  2LE9 B;  2QEV A;  2F3Y A;  3QRX A;  3R72 A;  1JFJ A;  1CLM A;  2HQ8 A;  3A8R A;  1B7T Z;  3CZ2 A;  4PT1 A;  4JD9 A;  3IVT A;  2MAZ A;  4WRI A;  3TS5 C;  3DVJ A;  1A75 B;  1YUT A;  2Q4U A;  2E6W A;  5JJG A;  3S0G A;  1W9Z A;  5ER5 A;  3I5I B;  1SMG A;  2JNF A;  1DJI A;  3GK4 X;  1C3Y A;  1SRA A;  4YRU A;  1CFC A;  5KSZ A;  2L5Y A;  1OOJ A;  2PRU A;  4U8D A;  1GGW A;  1BR1 B;  2RGI A;  3IF7 A;  4M2Q A;  3BUN B;  1L2O B;  3I5I C;  2MJW B;  3B88 A;  1K2H A;  3CZT X;  2FCE A;  2L50 A;  2JWW A;  4CPV A;  3D74 A;  3PAL A;  2Y1N A;  3FE9 A;  4HSZ A;  5J3X A;  3R1P A;  3R1V A;  2L2E A;  1YRU B;  1F70 A;  4DS7 A;  1N2D A;  2MLF C;  4ORB B;  4XYN A;  3RLZ A;  1YX7 A;  3OX6 A;  1WRK A;  3CDN A;  1L2O C;  1KK7 Z;  2K60 A;  2KAX A;  2LC5 A;  2L0P A;  1JC2 A;  2VRG A;  1QVI Y;  1IKU A;  1J1D A;  1UHN A;  1SCM B;  1SL7 A;  1C3Z A;  2M7L A;  1S26 D;  1T14 A;  4XJK B;  1AK8 A;  1BR4 B;  4DRW A;  2I18 A;  2OTG B;  2A4J A;  3PN7 B;  2JXL A;  1A29 A;  2F2O A;  1B1G A;  2KAY A;  1D1O A;  5DIC A;  1RK9 A;  3LK1 A;  1OMR A;  4I5N B;  3S0D A;  5AFP A;  1A75 A;  1SCM C;  1MXL C;  1W7J B;  2F3Z A;  5CPV A;  5TNC A;  1PSR A;  2DOQ A;  3EKJ A;  2LVV A;  3O6B A;  1Y1U A;  4QJ4 B;  4IL1 A;  1NX2 A;  3O78 A;  4C0L A;  1JSA A;  2GTE A;  1TOP A;  2MHH A;  2OTG C;  1QV1 A;  3PN7 C;  2L4I A;  4N1G A;  4F0Z B;  2WC8 A;  5CSF A;  4NDD A;  4MRY A;  3ZNI A;  3SG2 A;  4OKH A;  1Q80 A;  2LUC A;  4BY5 A;  4YGB B;  1PUL A;  1EXR A;  1BOD A;  4GAO A;  2BE6 A;  4KYN A;  4AQI A;  5CSI A;  3CLN A;  2QEB A;  4I5L B;  4E68 A;  1DMO A;  1TNP A;  4QJ3 B;  1IRJ A;  5HLV A;  4PE0 A;  2M49 B;  1DTL A;  1F4Q A;  3TUY B;  2M9G A;  2D8N A;  2H2K A;  3CS1 A;  2PSR A;  1XFW O;  3UO9 A;  3D10 A;  2MRD A;  1GQM A;  1BLQ A;  1UHK A;  4OVN F;  4GGN A;  1ZMZ A;  2CBL A;  4N5X A;  2BE4 A;  2PVB A;  1TIZ A;  2FJU B;  3FWC A;  4NDB A;  4XJK A;  3TUY C;  1CNP A;  1B8C A;  1K9K A;  3LL8 B;  2WCB A;  5I2O A;  1PVA A;  2WC5 A;  1IIO A;  1DQE A;  4PHN A;  5JOL A;  1BG1 A;  3CAB A;  1K95 A;  1W7I B;  2LUX A;  1LVC D;  2Y5I A;  4PE4 A;  1NCX A;  1HT9 A;  1B9A A;  1GJY A;  4WQ2 A;  3BOW B;  3EK4 A;  1XO5 A;  4FQO A;  1S36 A;  4MSP A;  1K9U A;  4INX A;  1KK7 Y;  5AER A;  1TCF A;  1J7Q A;  5I94 A;  2LVI A;  2KDH A;  4F7F A;  1CFF A;  3PAT A;  2KYC A;  3EVR A;  4USL A;  1XK4 A;  3EK7 A;  1SR6 B;  1XFZ O;  1CDN A;  4PE1 A;  3CYZ A;  3I5G B;  5KTY A;  1DJH A;  1IQ3 A;  4GNK B;  3WXA A;  2JZI A;  1YTZ C;  1CM4 A;  2KLD A;  1CDL A;  2HPS A;  5FI2 A;  1MUX A;  1H8B A;  1MR8 A;  1OMV A;  2LM5 A;  2K2F A;  1CLB A;  2PAS A;  3OB1 B;  1SR6 C;  1Y0V H;  1ZFS A;  3DD4 A;  1PRW A;  1QAT A;  1S5G Y;  2KLE A;  3JTD B;  1KK8 B;  3I5G C;  3L4L A;  1BJF A;  4MZJ A;  3AAK A;  5I2Q A;  1RFJ A;  4MRX A;  2BBN A;  3BFB A;  1YUU A;  4M2O A;  2BBM A;  4PDZ A;  4YI8 A;  2JNX A;  2M29 A;  3NGV A;  4AQJ A;  2BL0 C;  1DEL A;  4AOM A;  1FF1 A;  2I94 A;  3EK8 A;  2BAP A;  1CB1 A;  1CDM A;  1DJW A;  1JF2 A;  1ZAC A;  2H61 C;  3JTD C;  2LMU A;  3VRR A;  1QTX A;  1KK8 C;  3Q8I A;  3DZT A;  1UWO A;  1TWO A;  3PM8 A;  1Z4H A;  4IJ7 A;  3WHU B;  4R1E A;  2F8P A;  1HQV A;  2TN4 A;  3HX4 A;  4GGF C;  3SS3 A;  4CFQ A;  1JF0 A;  2K7B A;  5I2L A;  1EL4 A;  2OPO A;  2BKH B;  1TCO B;  1L7Z A;  1ALV A;  1SW8 A;  2HET A;  1S6I A;  2LAN A;  2LHI A;  3BOW A;  3LCP C;  3PM2 A;  2JC2 A;  2L2C A;  2YGU A;  4YGD B;  4I5K A;  1SK6 D;  1TRF A;  4OV2 A;  1KFU S;  1IQ5 A;  2COL B;  1SSE B;  1KFX S;  5ER4 X;  2PMY A;  4A4C A;  5KU1 A;  1WDC B;  2CTN A;  2FOT A;  2JTZ A;  5I8N A;  1YUS A;  4FQT A;  3S0E A;  3BJH A;  2CNP A;  3WHT B;  1WRL A;  2KHN A;  1K8U A;  2WCL A;  1SBJ A;  1DGV A;  4GBA A;  2LMT A;  1C7W A;  1QAS A;  2P70 A;  4MZK A;  1MXE A;  1PVB A;  4ORA B;  5HYD A;  1MHO A;  2IS9 A;  1J7R A;  3CZ1 A;  3SG7 A;  2O5G A;  3B86 A;  1WDC C;  2LAP A;  2PAL A;  3D77 A;  1CM1 A;  3DF0 B;  4JKT A;  3VRN A;  2KI6 C;  1JBA A;  3CWG A;  3L47 A;  4P2Y B;  1ALW A;  1GGZ A;  2KI4 B;  3B7A A;  3IQQ A;  4BY4 A;  5BPJ A;  3S0F A;  5DKR A;  4TNC A;  1GM0 A;  1S6J A;  2KI6 D;  1AP4 A;  1QIW A;  2KPH A;  1TTX A;  1DJG A;  1E8A A;  1KQM B;  3SS4 A;  2K2A A;  2QPT A;  3B6X A;  2I2R E;  1S1E A;  2NZ0 A;  2ZFD A;  2JXC A;  1OQP A;  1RWY A;  2KI4 C;  3K1E A;  4MEW A;  4NQG A;  4YI9 A;  5CSN A;  3TDI A;  3NSO A;  1UHH A;  3M0W A;  1WLM A;  4JQ0 D;  1K96 A;  1KQM C;  1CLL A;  1YR5 A;  1P28 A;  3D73 A;  1RTP 1;  1NSH A;  4GUK A;  4GPL B;  1G33 A;  2BEC A;  3FWB A;  2WND A;  1M45 A;  1V1F A;  1QV0 A;  3A4U B;  4M2P A;  2P71 A;  2AUC A;  1B7T Y;  3IQO A;  1QIV A;  1DC1 A;  2QDI A;  1TNQ A;  3FS7 A;  4OZD A;  1S3P A;  1MF8 B;  1UHI A;  3KEV A;  4JPZ B;  3VRO A;  1G8I A;  1LA0 A;  2KFG A;  3D78 A;  2ZNE A;  2K7C A;  1QJT A;  3DYE A;  4YBH B;  3SG3 A;  1NIW A;  2LHL A;  3GK2 A;  2G2B A;  3KF9 A;  2K0J A;  3C1V A;  1OOG A;  2V53 A;  1LA3 A;  1CTR A;  3O2P A;  4I5J A;  3S0A A;  1YUR A;  3DF0 A;  3I5H B;  3WNX B;  3SS5 A;  2JQ6 A;  2JOJ A;  1J1E A;  3OB2 B;  3CR4 X;  1B47 A;  3JVT B;  1N0Y A;  4UPG A;  4PE7 A;  3EVV A;  3PSR A;  2MA2 A;  3SJS A;  4ETO A;  1NX0 A;  1SKT A;  2L5X B;  2ZKM X; 
#chains in the Genus database with same CATH homology
 3B88 A;  3BFB A;  3NGV A;  3RZS A;  3D74 A;  3FE9 A;  3R1P A;  3R1V A;  2PQL A;  1XFR A;  3Q8I A;  3B87 A;  3CDN A;  3DZT A;  1TWO A;  3S0B A;  3D76 A;  1OOH A;  3PJI A;  2FJY A;  1C3Z A;  1T14 A;  3DXL A;  2WCJ A;  4INW A;  3FE6 A;  2L2C A;  1OOI X;  5DIC A;  2QEH A;  2ERB A;  5EL2 A;  3S0D A;  2WCM A;  3CZ0 A;  3R1O A;  4FQT A;  3S0E A;  2GTE A;  3BJH A;  2WCL A;  3L4A A;  2P70 A;  3CZ1 A;  3B86 A;  3D77 A;  2QEB A;  2WC6 A;  3L47 A;  2WCK A;  1LS8 A;  3B7A A;  3NHT A;  3S0F A;  1GM0 A;  3QME A;  2KPH A;  1OOF A;  3B6X A;  3BFH A;  3D75 A;  2H8V A;  3K1E A;  1QWV A;  1P28 A;  3D73 A;  3V2L A;  3DY9 A;  2WC5 A;  3BFA A;  1DQE A;  3FE8 A;  1ORG A;  3N7H A;  3CAB A;  2P71 A;  2QEO A;  3R72 A;  2QEV A;  2QDI A;  4OZD A;  2JPO A;  3CZ2 A;  4PT1 A;  4INX A;  4JD9 A;  3D78 A;  3DYE A;  3OGN A;  4F7F A;  3CYZ A;  3S0G A;  1OOG A;  3VB1 A;  1TUJ A;  3S0A A;  1OW4 A;  1C3Y A;  2WCH A;  3NHI A;  3L4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...