3S0GA

Apis mellifera obp 14 double mutant gln44cys, his97cys
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVCLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPCLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Transport protein
molecule keywords OBP14
total genus 48
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0gA00
3FE8A 3S0DA 2PQLA 3S0BA 3R72A 1OOFA 1OOHA 3NGVA 1LS8A 4OZDA 2ERBA 2QEVA 1P28A 3N7HA 2QDIA 3DXLA 1T14A 3DYEA 3R1OA 3CYZA 3S0EA 1C3YA 1DQEA 2WCLA 3CABA 4INWA 3B88A 3BJHA 2QEBA 2H8VA 1TWOA 4F7FA 3V2LA 4JD9A 3B7AA 2WCJA 1ORGA 1OOGA 3FE6A 2FJYA 3BFAA 3CZ0A 3B87A 3D75A 2P71A 3CZ1A 2QEOA 3VB1A 3D73A 3D74A 2JPOA 3NHTA 3RZSA 2WCKA 3R1VA 2P70A 2GTEA 3L4AA 3L47A 1OOIX 3CZ2A 3BFBA 2WC5A 3FE9A 2QEHA 5EL2A 3B6XA 3DY9A 3D76A 3OGNA 3B86A 3S0FA 3PJIA 2KPHA 3CDNA 3Q8IA 3BFHA 1QWVA 3D78A 3S0AA 2WCHA 2WC6A 3K1EA 1XFRA 3R1PA 3L4LA 4FQTA 4PT1A 3DZTA 1TUJA 3QMEA 1GM0A 1C3ZA 3S0GA 2L2CA 1OW4A 3NHIA 5DICA 3D77A 4INXA 2WCMA
chains in the Genus database with same CATH superfamily
3NSIA 3FE8A 3PSRA 4L9MA 1QS7A 2Q91A 1ALVA 4M2QA 2JTTA 2CTNA 5J3XA 1BLQA 3AKBA 1OOHA 1BR4B 1ZMZA 1M45A 2JXLA 1B1GA 2LANA 5KSZA 1XFYO 5AFPA 1LS8A 3PN7B 5FI7A 3CR5X 2BCBA 2D8NA 1NPQA 2QEVA 2M0RA 3O6BA 1RWYA 2M8UA 2JNFA 4PE4A 1QX5B 1LA3A 2M49B 2QDIA 2MA2A 3BUWB 1T14A 3DXLA 5TNCA 1AK8A 1B47A 1KWOC 1R6PA 2FOTA 4GUKA 3S0EA 3A8RA 2Y5IA 3EVUA 1KK7Y 2Y1NA 3TS5C 2LMVA 1YURA 3PN7C 1OOJA 1TNXA 4PCWA 4N1GA 4MEWA 2VRGA 4CFQA 1OMVA 4HRHA 4M2PA 1L2OB 1AP4A 1M39A 2H8VA 2LM5A 4IJ7A 4BY4A 1UP5A 3WHUB 2BE6A 3DF0B 2G2BA 4WQ2A 5HLVA 2LLUA 2LLSA 3FWBA 1A75A 1YTZC 1XK4C 1K95A 2KGRA 2ZRTA 3VRQA 2WCJA 1YUTA 1IG5A 1NCYA 2WOSA 2LVKA 5I94A 1IIOA 1SCMB 2JXCA 1IH0A 1YUUA 1L2OC 4YBHB 1DJIA 5CSJA 1SRAA 2MRDA 2EC6B 1CM1A 2F2PA 4YGEB 3B87A 2SASA 1FF1A 1K9PA 2WORA 2O60A 1N0YA 3EK8A 1UUSA 3EVVA 1K96A 1CFDA 1SK6D 1RK9A 2M7NA 4MN0A 1PSRA 3D73A 3SS4A 2LVJA 4A4CA 1EJ3A 1B7TZ 1DJXA 2KGBC 3RZSA 1DMOA 2E30A 1SYMA 3OB2B 3R1VA 2LLTA 2QACA 1NX0A 4KYNA 1A2XA 2HF5A 1Y1AA 1OZSA 2IS9A 1IJ6A 2E6WA 3PLFB 2PALA 2WCFA 2GGMA 1OOIX 2M1KB 3L47A 1EG3A 4MVFA 1MWNA 1KK7Z 1C7WA 1NYAA 1WRKA 3FE9A 3F45A 1PRWA 2CXJA 1EH2A 1YUSA 3BUOB 2M29A 2JPTA 2PVBA 1J1DA 3B86A 2FCDA 1NX3A 3S0FA 1NX2A 2KFGA 1YRUB 2Y4QA 1K2HA 1DEKA 4MLWA 1RFJA 4DUQA 2MHHA 2OTGC 3Q8IA 1DF0A 1J55A 1KFXL 1TUZA 1OSAA 1IRJA 2R2IA 2WCEA 3BFHA 3O4XA 4GBAA 1BG1A 1DC1A 1QLKA 1ODBA 1KQVA 3GK2A 1H4BA 2WCHA 2F3YA 1DF0B 1CMFA 1K90D 1KFUS 1JBAA 2NCPA 3NXAA 1QVIY 1RJVA 1KQMB 3GK1A 5CPVA 5ER4X 1TCOB 5HYDA 2H61A 5I2OA 1PVBA 3ZWHA 3DZTA 2JZIA 5CSFA 5JOLA 3RLZA 1UHKA 2M97A 1SCMC 3QMEA 3IQQA 1SL9A 4YGDB 3KEVA 4ORAB 1JUOA 1AVSA 2K7OA 2LCPA 2RGIA 3EK7A 4Q04A 5DICA 3D77A 3E3RA 1D1OA 2BECA 4XJKB 1MXEA 1VRKA 4XJKA 1W7IB 1HQVA 2Q4UA 4PE0A 2L2EA 1PALA 1YX8A 3S0BA 1K93D 5AANA 1J7OA 1J7QA 3R72A 2BCAA 4PE1A 2HETA 5D7FA 2QPTA 2L50A 3PFVA 1NCZA 1EG4A 4TNCA 4IL1A 5I2LA 1BJFA 3EVRA 4YGAA 1S5GY 2KI4B 2O5GA 1JSAA 4M2OA 3KO0A 2KI6D 1DQEA 1XFXO 2WCLA 1H8BA 3BXKA 3EKHA 1ZACA 3NSLA 1B8LA 2H2KA 2KFHA 3UO9A 2QEBA 4DRWA 2I94A 2ZKMX 4PALA 2F33A 3ICBA 5B8IB 3TUYC 1B7TY 2JTZA 1B9AA 1CM4A 2KBIA 3TZ1A 3SG3A 2MLEC 3UNWA 1G33A 2AAOA 3CR4X 4MRXA 2KDHA 4GGFA 5DKRA 2V53A 5HKZA 3V2LA 1OQPA 2ZN9A 2JWWA 1WRZA 2K2FA 2SCPA 3WXAA 3TDIA 2FJYA 2KAXA 3BFAA 4GAOA 1KFUL 3CZ0A 2OS8B 3I5GB 4HRGA 2WC8A 3SG6A 4NDCA 4N5XA 3JTDB 1SW8A 1WLMA 2QEOA 3VB1A 4GPLB 3HCMA 5CSIA 1DJHA 1NWDA 5ER5A 1NUBA 1DTLA 3SG4A 4D1EA 4QJ5B 4CPVA 1UURA 4P5OE 1LA0A 1PSBA 1M63B 4C0LA 1BT6A 4NDBA 3L4AA 4MZJA 3KF9A 1QIVA 1RECA 4USLA 3VRNA 1QX7A 2WC5A 2ISDA 3BOWB 4ZCVA 4YRUA 1RROA 1SY9A 3H4SE 1Y1UA 2LV7A 2PMYA 3B6XA 3DY9A 3RM1A 1CLBA 1GQMA 1TCFA 2ZN8A 3VRPA 3OX6A 1XVJA 2Y1MA 4YGBB 1CB1A 3EKJA 2BL0C 2AUCA 2P6BB 3IVTA 4ETOA 3BOWA 5AERA 1JFJA 2K61A 2F8PA 3SIAA 1IQ5A 1S6JA 4MBEA 2L0PA 2OPOA 3OB1B 3S0AA 2WC6A 2OTGB 1IKUA 2NZ0A 1XFRA 3K1EA 2BKIB 4YI8A 2ZNEA 1TN4A 1CMGA 3JVTC 5IBWA 2GV5A 1V1FA 5KTYA 3AAKA 3CWGA 1NSHA 5I8NA 2KFFA 3LL8B 1TIZA 2LNKA 4DIRA 1U5IA 3CGAA 4PT1A 2K60A 4PE7A 3SJSA 1TUJA 4NDDA 2KNEA 4AQIA 3FWCA 5CSNA 2NCOA 5DKNA 5FI6A 3S0GA 3TS5B 1CFPA 1U5IB 4U8DA 4A4BA 1S6CA 1Y1XA 2EHBA 1QV1A 2NLNA 2K0JA 3BYAA 3NHIA 2LHIA 3JVTB 1WDCC 4GGNA 1S3PA 2WCBA 4CIDA 2PQLA 1KWOB 1G4YR 1XFWO 3I5HC 3OHMB 1KK8B 1OOFA 3A4UB 3SS5A 3DVJA 1F4QA 1ALWA 1M46A 2LAPA 1FBVA 5FYXA 3BUNB 3I5IB 3C1VA 4C0KA 1JFKA 4WRIA 2M7LA 1P28A 4P2YB 3N7HA 4OCIA 1OMRA 3OX5A 2L51A 1NIWA 4GNKB 3WHTB 3R1OA 3CYZA 2JU0A 1DJZA 1C3YA 1CFFA 2LMTA 2KYCA 2FJUB 3CZTX 1Y0VH 1TTXA 3O78A 4ORCB 2ZNDA 1R2UA 2CNPA 3AAJA 1YVLA 1OE9B 3DF0A 1NCXA 2PYQA 1XFZO 1SPYA 3TDZA 1Q80A 2K7CA 2H61C 1X02A 1XO5A 3TDUA 1TWOA 2BNXA 4FQOA 5G08A 2MAZA 3FIAA 1XFUO 3D0YB 5I2QA 2BL0B 2JT0A 2L4HA 4JPZB 3SIBA 2AMIA 5HLOA 5JJGA 4JD9A 2I18A 1F8HA 4MSPA 1K8UA 1ZUZA 3OBVA 2KBMA 3SG7A 3NSKA 1OOGA 1A75B 2KHNA 4NQGA 4YGCB 1QXPA 1F4OA 2JT8A 2PASA 1ZFSA 3GK4X 2M3WA 3D75A 4JQ0D 1SMGA 1WRLA 1FI6A 2P71A 3D0YA 3PM8A 1E8AA 2MJWB 1LXFC 2JPOA 2L5XB 3D74A 2KSPA 1XFVO 1A29A 3NHTA 2WCKA 2ZRSA 3GOFA 3DVKA 1MUXA 2JQ6A 1YVHA 2FCEA 2K8MB 2A4JA 1DJGA 1MHOA 1AJ4A 1DT7B 2KI4C 3SG5A 1N65A 2MLFC 3PALA 1BF5A 1SL8A 1DJYA 4PHNA 3I5FC 2KQ6A 4R1EA 3CTNA 1L7ZA 2JULA 5KU1A 1TNQA 1BOCA 1DELA 3HX4A 3BUMB 1PK0D 4MRYA 2M9GA 4DS7A 1A03A 1B8RA 1QTXA 1TNPA 2KQYA 2L4IA 3DVEA 1FW4A 3OGNA 1QVIZ 4I5KA 3LCPC 2EC6C 1WLZA 1JF0A 3PJIA 4I5JA 4MZKA 5HL1A 1WDCB 1JC2A 1G8IA 4F0ZB 1SL7A 3WNXB 1KSMA 2K2AA 1AUIB 1QWVA 2JT3A 1CDPA 2M1UA 1GGWA 3EK4A 3KHEA 1K94A 3DD4A 3O4YA 1KSOA 1YX7A 3NSOA 2LC5A 2LUCA 1OZOA 1IWQA 4WQ3A 5F6TA 1SNLA 1SKTA 2JRFA 1CNPA 1AHRA 2BBMA 4N1FA 1FPWA 3ZNIA 1YR5A 2WNDA 4FQTA 2HPSA 1C7VA 4CLNA 1MF8B 4OVNF 4XYNA 4BY5A 1C3ZA 1CLMA 3AKAA 1UHHA 2MBXA 3DVMA 2KLEA 5GQQC 2PSRA 3OP0A 1MQ1A 1CLLA 1QLSA 1TOPA 1NP8A 1WY9A 1OW4A 2CT9A 3I5HB 1TRFA 2LHLA 1XYDA 4INXA 1RTP1 2LMUA 2LUXA 2HQ8A 4ZCUA 1FI5A 3S0DA 4ORBB 1A4PA 1IQ3A 2YGUA 2L5YA 2B1UA 2JC2A 2CCMA 2L98A 1MR8A 3SS3A 3NGVA 3D10A 4PHMA 1PVAA 1UHNA 1YRTB 1HT9A 4AQJA 1CFCA 1V1GA 2KLDA 1DVIA 2LVVA 3IQOA 4OZDA 1QX2A 4I5NB 1M31A 2ERBA 4MZLA 3LK0A 1B8CA 2KAYA 3FS7A 1K9KA 1J1EA 1W9ZA 3DYEA 2KOTA 4AOMA 4QJ4B 2BKHB 1S26D 1KCYA 3CABA 2TN4A 1JF2A 3VRRA 4C0JA 4INWA 1LKJA 1J7PA 3I5IC 1SBJA 1BODA 4UPGA 2HQWA 1UHJA 2G9BA 2NXQA 1BU3A 3B88A 3BJHA 5HKYA 1F70A 3VROA 1Y6WA 1XA5A 2K7BA 2KYFA 3CLNA 1S6IA 3EG5B 1F54A 2OS8C 3I5GC 3CR2A 1C07A 4GGFC 4F7FA 1MXLC 1IGVA 4FTGA 1LINA 3PM2A 4PHKA 4JWQA 3M0WA 1CKKA 4JKTA 1EL4A 1F71A 3B7AA 1DJWA 3O2PA 1GJYA 1ORGA 3FE6A 1F55A 4HSZA 1CDLA 1NX1A 1DGVA 1SCVA 3IF7A 2LVIA 4HREE 1TNWA 3SG2A 1QJTA 3TUYB 1QV0A 4OR9B 2I2RE 3CZ1A 4I5LB 1KK8C 3BQ3A 1J7RA 4CFRA 1N2DA 2P70A 3PATA 5HKWA 4DCKA 1JWDA 2DOQA 1CDNA 3I5FB 2CBLA 2GTEA 3VGOA 2K7DA 2F3ZA 3JTDC 1IJ5A 1UHIA 3QRXA 2COLB 1GGZA 3CZ2A 5AXIA 1BMOA 3BFBA 3LK1A 2EGDA 3CS1A 5FI2A 2BAPA 2QEHA 5EL2A 1B4CA 1AJ5A 3D76A 1BR1B 2PRUA 2F2OA 1QIWA 2KI6C 1EXRA 2GGZA 4GFTA 2KPHA 3K21A 4OV2A 3CDNA 1S1EA 1LVCD 5D69A 1KFXS 2BCXA 2KAVA 3D78A 1OMDA 1DGUA 5BPJA 1QATA 1UWOA 1Z4HA 1PULA 2LE9B 2I7AA 5DKQA 5K89A 1SSEB 1Z2CB 2JOJA 4ICBA 5AEQA 1W7JB 1S36A 3LLEA 5PALA 3R1PA 1SR6B 3L4LA 5D3OA 1KQMC 2LP2A 1ZOTB 1XK4A 4QJ3B 2LP3A 4OKHA 1GM0A 1S5GZ 2ZFDA 1CTRA 2L2CA 3BUXB 3MSEB 2JNXA 1QASA 4YI9A 2BE4A 1CDMA 1SR6C 2BBNA 4E68A 4PDZA 4PHJA 1K9UA 2WCMA 3KPXA
chains in the Genus database with same CATH topology
3FE8A 3S0DA 2PQLA 3S0BA 3R72A 1OOFA 1OOHA 3NGVA 1LS8A 4OZDA 2ERBA 2QEVA 1P28A 3N7HA 2QDIA 3DXLA 1T14A 3DYEA 3R1OA 3CYZA 3S0EA 1C3YA 1DQEA 2WCLA 3CABA 4INWA 3B88A 3BJHA 2QEBA 2H8VA 1TWOA 4F7FA 3V2LA 4JD9A 3B7AA 2WCJA 1ORGA 1OOGA 3FE6A 2FJYA 3BFAA 3CZ0A 3B87A 3D75A 2P71A 3CZ1A 2QEOA 3VB1A 3D73A 3D74A 2JPOA 3NHTA 3RZSA 2WCKA 3R1VA 2P70A 2GTEA 3L4AA 3L47A 1OOIX 3CZ2A 3BFBA 2WC5A 3FE9A 2QEHA 5EL2A 3B6XA 3DY9A 3D76A 3OGNA 3B86A 3S0FA 3PJIA 2KPHA 3CDNA 3Q8IA 3BFHA 1QWVA 3D78A 3S0AA 2WCHA 2WC6A 3K1EA 1XFRA 3R1PA 3L4LA 4FQTA 4PT1A 3DZTA 1TUJA 3QMEA 1GM0A 1C3ZA 3S0GA 2L2CA 1OW4A 3NHIA 5DICA 3D77A 4INXA 2WCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE8 A;  3S0D A;  2PQL A;  3S0B A;  3R72 A;  1OOF A;  1OOH A;  3NGV A;  1LS8 A;  4OZD A;  2ERB A;  2QEV A;  1P28 A;  3N7H A;  2QDI A;  3DXL A;  1T14 A;  3DYE A;  3R1O A;  3CYZ A;  3S0E A;  1C3Y A;  1DQE A;  2WCL A;  3CAB A;  4INW A;  3B88 A;  3BJH A;  2QEB A;  2H8V A;  1TWO A;  4F7F A;  3V2L A;  4JD9 A;  3B7A A;  2WCJ A;  1ORG A;  1OOG A;  3FE6 A;  2FJY A;  3BFA A;  3CZ0 A;  3B87 A;  3D75 A;  2P71 A;  3CZ1 A;  2QEO A;  3VB1 A;  3D73 A;  3D74 A;  2JPO A;  3NHT A;  3RZS A;  2WCK A;  3R1V A;  2P70 A;  2GTE A;  3L4A A;  3L47 A;  1OOI X;  3CZ2 A;  3BFB A;  2WC5 A;  3FE9 A;  2QEH A;  5EL2 A;  3B6X A;  3DY9 A;  3D76 A;  3OGN A;  3B86 A;  3S0F A;  3PJI A;  2KPH A;  3CDN A;  3Q8I A;  3BFH A;  1QWV A;  3D78 A;  3S0A A;  2WCH A;  2WC6 A;  3K1E A;  1XFR A;  3R1P A;  3L4L A;  4FQT A;  4PT1 A;  3DZT A;  1TUJ A;  3QME A;  1GM0 A;  1C3Z A;  3S0G A;  2L2C A;  1OW4 A;  3NHI A;  5DIC A;  3D77 A;  4INX A;  2WCM A; 
#chains in the Genus database with same CATH topology
 3NSI A;  3FE8 A;  3PSR A;  4L9M A;  1QS7 A;  2Q91 A;  1ALV A;  4M2Q A;  2JTT A;  2CTN A;  5J3X A;  1BLQ A;  3AKB A;  1OOH A;  1BR4 B;  1ZMZ A;  1M45 A;  2JXL A;  1B1G A;  2LAN A;  5KSZ A;  1XFY O;  5AFP A;  1LS8 A;  3PN7 B;  5FI7 A;  3CR5 X;  2BCB A;  2D8N A;  1NPQ A;  2QEV A;  2M0R A;  3O6B A;  1RWY A;  2M8U A;  2JNF A;  4PE4 A;  1QX5 B;  1LA3 A;  2M49 B;  2QDI A;  2MA2 A;  3BUW B;  1T14 A;  3DXL A;  5TNC A;  1AK8 A;  1B47 A;  1KWO C;  1R6P A;  2FOT A;  4GUK A;  3S0E A;  3A8R A;  2Y5I A;  3EVU A;  1KK7 Y;  2Y1N A;  3TS5 C;  2LMV A;  1YUR A;  3PN7 C;  1OOJ A;  1TNX A;  4PCW A;  4N1G A;  4MEW A;  2VRG A;  4CFQ A;  1OMV A;  4HRH A;  4M2P A;  1L2O B;  1AP4 A;  1M39 A;  2H8V A;  2LM5 A;  4IJ7 A;  4BY4 A;  1UP5 A;  3WHU B;  2BE6 A;  3DF0 B;  2G2B A;  4WQ2 A;  5HLV A;  2LLU A;  2LLS A;  3FWB A;  1A75 A;  1YTZ C;  1XK4 C;  1K95 A;  2KGR A;  2ZRT A;  3VRQ A;  2WCJ A;  1YUT A;  1IG5 A;  1NCY A;  2WOS A;  2LVK A;  5I94 A;  1IIO A;  1SCM B;  2JXC A;  1IH0 A;  1YUU A;  1L2O C;  4YBH B;  1DJI A;  5CSJ A;  1SRA A;  2MRD A;  2EC6 B;  1CM1 A;  2F2P A;  4YGE B;  3B87 A;  2SAS A;  1FF1 A;  1K9P A;  2WOR A;  2O60 A;  1N0Y A;  3EK8 A;  1UUS A;  3EVV A;  1K96 A;  1CFD A;  1SK6 D;  1RK9 A;  2M7N A;  4MN0 A;  1PSR A;  3D73 A;  3SS4 A;  2LVJ A;  4A4C A;  1EJ3 A;  1B7T Z;  1DJX A;  2KGB C;  3RZS A;  1DMO A;  2E30 A;  1SYM A;  3OB2 B;  3R1V A;  2LLT A;  2QAC A;  1NX0 A;  4KYN A;  1A2X A;  2HF5 A;  1Y1A A;  1OZS A;  2IS9 A;  1IJ6 A;  2E6W A;  3PLF B;  2PAL A;  2WCF A;  2GGM A;  1OOI X;  2M1K B;  3L47 A;  1EG3 A;  4MVF A;  1MWN A;  1KK7 Z;  1C7W A;  1NYA A;  1WRK A;  3FE9 A;  3F45 A;  1PRW A;  2CXJ A;  1EH2 A;  1YUS A;  3BUO B;  2M29 A;  2JPT A;  2PVB A;  1J1D A;  3B86 A;  2FCD A;  1NX3 A;  3S0F A;  1NX2 A;  2KFG A;  1YRU B;  2Y4Q A;  1K2H A;  1DEK A;  4MLW A;  1RFJ A;  4DUQ A;  2MHH A;  2OTG C;  3Q8I A;  1DF0 A;  1J55 A;  1KFX L;  1TUZ A;  1OSA A;  1IRJ A;  2R2I A;  2WCE A;  3BFH A;  3O4X A;  4GBA A;  1BG1 A;  1DC1 A;  1QLK A;  1ODB A;  1KQV A;  3GK2 A;  1H4B A;  2WCH A;  2F3Y A;  1DF0 B;  1CMF A;  1K90 D;  1KFU S;  1JBA A;  2NCP A;  3NXA A;  1QVI Y;  1RJV A;  1KQM B;  3GK1 A;  5CPV A;  5ER4 X;  1TCO B;  5HYD A;  2H61 A;  5I2O A;  1PVB A;  3ZWH A;  3DZT A;  2JZI A;  5CSF A;  5JOL A;  3RLZ A;  1UHK A;  2M97 A;  1SCM C;  3QME A;  3IQQ A;  1SL9 A;  4YGD B;  3KEV A;  4ORA B;  1JUO A;  1AVS A;  2K7O A;  2LCP A;  2RGI A;  3EK7 A;  4Q04 A;  5DIC A;  3D77 A;  3E3R A;  1D1O A;  2BEC A;  4XJK B;  1MXE A;  1VRK A;  4XJK A;  1W7I B;  1HQV A;  2Q4U A;  4PE0 A;  2L2E A;  1PAL A;  1YX8 A;  3S0B A;  1K93 D;  5AAN A;  1J7O A;  1J7Q A;  3R72 A;  2BCA A;  4PE1 A;  2HET A;  5D7F A;  2QPT A;  2L50 A;  3PFV A;  1NCZ A;  1EG4 A;  4TNC A;  4IL1 A;  5I2L A;  1BJF A;  3EVR A;  4YGA A;  1S5G Y;  2KI4 B;  2O5G A;  1JSA A;  4M2O A;  3KO0 A;  2KI6 D;  1DQE A;  1XFX O;  2WCL A;  1H8B A;  3BXK A;  3EKH A;  1ZAC A;  3NSL A;  1B8L A;  2H2K A;  2KFH A;  3UO9 A;  2QEB A;  4DRW A;  2I94 A;  2ZKM X;  4PAL A;  2F33 A;  3ICB A;  5B8I B;  3TUY C;  1B7T Y;  2JTZ A;  1B9A A;  1CM4 A;  2KBI A;  3TZ1 A;  3SG3 A;  2MLE C;  3UNW A;  1G33 A;  2AAO A;  3CR4 X;  4MRX A;  2KDH A;  4GGF A;  5DKR A;  2V53 A;  5HKZ A;  3V2L A;  1OQP A;  2ZN9 A;  2JWW A;  1WRZ A;  2K2F A;  2SCP A;  3WXA A;  3TDI A;  2FJY A;  2KAX A;  3BFA A;  4GAO A;  1KFU L;  3CZ0 A;  2OS8 B;  3I5G B;  4HRG A;  2WC8 A;  3SG6 A;  4NDC A;  4N5X A;  3JTD B;  1SW8 A;  1WLM A;  2QEO A;  3VB1 A;  4GPL B;  3HCM A;  5CSI A;  1DJH A;  1NWD A;  5ER5 A;  1NUB A;  1DTL A;  3SG4 A;  4D1E A;  4QJ5 B;  4CPV A;  1UUR A;  4P5O E;  1LA0 A;  1PSB A;  1M63 B;  4C0L A;  1BT6 A;  4NDB A;  3L4A A;  4MZJ A;  3KF9 A;  1QIV A;  1REC A;  4USL A;  3VRN A;  1QX7 A;  2WC5 A;  2ISD A;  3BOW B;  4ZCV A;  4YRU A;  1RRO A;  1SY9 A;  3H4S E;  1Y1U A;  2LV7 A;  2PMY A;  3B6X A;  3DY9 A;  3RM1 A;  1CLB A;  1GQM A;  1TCF A;  2ZN8 A;  3VRP A;  3OX6 A;  1XVJ A;  2Y1M A;  4YGB B;  1CB1 A;  3EKJ A;  2BL0 C;  2AUC A;  2P6B B;  3IVT A;  4ETO A;  3BOW A;  5AER A;  1JFJ A;  2K61 A;  2F8P A;  3SIA A;  1IQ5 A;  1S6J A;  4MBE A;  2L0P A;  2OPO A;  3OB1 B;  3S0A A;  2WC6 A;  2OTG B;  1IKU A;  2NZ0 A;  1XFR A;  3K1E A;  2BKI B;  4YI8 A;  2ZNE A;  1TN4 A;  1CMG A;  3JVT C;  5IBW A;  2GV5 A;  1V1F A;  5KTY A;  3AAK A;  3CWG A;  1NSH A;  5I8N A;  2KFF A;  3LL8 B;  1TIZ A;  2LNK A;  4DIR A;  1U5I A;  3CGA A;  4PT1 A;  2K60 A;  4PE7 A;  3SJS A;  1TUJ A;  4NDD A;  2KNE A;  4AQI A;  3FWC A;  5CSN A;  2NCO A;  5DKN A;  5FI6 A;  3S0G A;  3TS5 B;  1CFP A;  1U5I B;  4U8D A;  4A4B A;  1S6C A;  1Y1X A;  2EHB A;  1QV1 A;  2NLN A;  2K0J A;  3BYA A;  3NHI A;  2LHI A;  3JVT B;  1WDC C;  4GGN A;  1S3P A;  2WCB A;  4CID A;  2PQL A;  1KWO B;  1G4Y R;  1XFW O;  3I5H C;  3OHM B;  1KK8 B;  1OOF A;  3A4U B;  3SS5 A;  3DVJ A;  1F4Q A;  1ALW A;  1M46 A;  2LAP A;  1FBV A;  5FYX A;  3BUN B;  3I5I B;  3C1V A;  4C0K A;  1JFK A;  4WRI A;  2M7L A;  1P28 A;  4P2Y B;  3N7H A;  4OCI A;  1OMR A;  3OX5 A;  2L51 A;  1NIW A;  4GNK B;  3WHT B;  3R1O A;  3CYZ A;  2JU0 A;  1DJZ A;  1C3Y A;  1CFF A;  2LMT A;  2KYC A;  2FJU B;  3CZT X;  1Y0V H;  1TTX A;  3O78 A;  4ORC B;  2ZND A;  1R2U A;  2CNP A;  3AAJ A;  1YVL A;  1OE9 B;  3DF0 A;  1NCX A;  2PYQ A;  1XFZ O;  1SPY A;  3TDZ A;  1Q80 A;  2K7C A;  2H61 C;  1X02 A;  1XO5 A;  3TDU A;  1TWO A;  2BNX A;  4FQO A;  5G08 A;  2MAZ A;  3FIA A;  1XFU O;  3D0Y B;  5I2Q A;  2BL0 B;  2JT0 A;  2L4H A;  4JPZ B;  3SIB A;  2AMI A;  5HLO A;  5JJG A;  4JD9 A;  2I18 A;  1F8H A;  4MSP A;  1K8U A;  1ZUZ A;  3OBV A;  2KBM A;  3SG7 A;  3NSK A;  1OOG A;  1A75 B;  2KHN A;  4NQG A;  4YGC B;  1QXP A;  1F4O A;  2JT8 A;  2PAS A;  1ZFS A;  3GK4 X;  2M3W A;  3D75 A;  4JQ0 D;  1SMG A;  1WRL A;  1FI6 A;  2P71 A;  3D0Y A;  3PM8 A;  1E8A A;  2MJW B;  1LXF C;  2JPO A;  2L5X B;  3D74 A;  2KSP A;  1XFV O;  1A29 A;  3NHT A;  2WCK A;  2ZRS A;  3GOF A;  3DVK A;  1MUX A;  2JQ6 A;  1YVH A;  2FCE A;  2K8M B;  2A4J A;  1DJG A;  1MHO A;  1AJ4 A;  1DT7 B;  2KI4 C;  3SG5 A;  1N65 A;  2MLF C;  3PAL A;  1BF5 A;  1SL8 A;  1DJY A;  4PHN A;  3I5F C;  2KQ6 A;  4R1E A;  3CTN A;  1L7Z A;  2JUL A;  5KU1 A;  1TNQ A;  1BOC A;  1DEL A;  3HX4 A;  3BUM B;  1PK0 D;  4MRY A;  2M9G A;  4DS7 A;  1A03 A;  1B8R A;  1QTX A;  1TNP A;  2KQY A;  2L4I A;  3DVE A;  1FW4 A;  3OGN A;  1QVI Z;  4I5K A;  3LCP C;  2EC6 C;  1WLZ A;  1JF0 A;  3PJI A;  4I5J A;  4MZK A;  5HL1 A;  1WDC B;  1JC2 A;  1G8I A;  4F0Z B;  1SL7 A;  3WNX B;  1KSM A;  2K2A A;  1AUI B;  1QWV A;  2JT3 A;  1CDP A;  2M1U A;  1GGW A;  3EK4 A;  3KHE A;  1K94 A;  3DD4 A;  3O4Y A;  1KSO A;  1YX7 A;  3NSO A;  2LC5 A;  2LUC A;  1OZO A;  1IWQ A;  4WQ3 A;  5F6T A;  1SNL A;  1SKT A;  2JRF A;  1CNP A;  1AHR A;  2BBM A;  4N1F A;  1FPW A;  3ZNI A;  1YR5 A;  2WND A;  4FQT A;  2HPS A;  1C7V A;  4CLN A;  1MF8 B;  4OVN F;  4XYN A;  4BY5 A;  1C3Z A;  1CLM A;  3AKA A;  1UHH A;  2MBX A;  3DVM A;  2KLE A;  5GQQ C;  2PSR A;  3OP0 A;  1MQ1 A;  1CLL A;  1QLS A;  1TOP A;  1NP8 A;  1WY9 A;  1OW4 A;  2CT9 A;  3I5H B;  1TRF A;  2LHL A;  1XYD A;  4INX A;  1RTP 1;  2LMU A;  2LUX A;  2HQ8 A;  4ZCU A;  1FI5 A;  3S0D A;  4ORB B;  1A4P A;  1IQ3 A;  2YGU A;  2L5Y A;  2B1U A;  2JC2 A;  2CCM A;  2L98 A;  1MR8 A;  3SS3 A;  3NGV A;  3D10 A;  4PHM A;  1PVA A;  1UHN A;  1YRT B;  1HT9 A;  4AQJ A;  1CFC A;  1V1G A;  2KLD A;  1DVI A;  2LVV A;  3IQO A;  4OZD A;  1QX2 A;  4I5N B;  1M31 A;  2ERB A;  4MZL A;  3LK0 A;  1B8C A;  2KAY A;  3FS7 A;  1K9K A;  1J1E A;  1W9Z A;  3DYE A;  2KOT A;  4AOM A;  4QJ4 B;  2BKH B;  1S26 D;  1KCY A;  3CAB A;  2TN4 A;  1JF2 A;  3VRR A;  4C0J A;  4INW A;  1LKJ A;  1J7P A;  3I5I C;  1SBJ A;  1BOD A;  4UPG A;  2HQW A;  1UHJ A;  2G9B A;  2NXQ A;  1BU3 A;  3B88 A;  3BJH A;  5HKY A;  1F70 A;  3VRO A;  1Y6W A;  1XA5 A;  2K7B A;  2KYF A;  3CLN A;  1S6I A;  3EG5 B;  1F54 A;  2OS8 C;  3I5G C;  3CR2 A;  1C07 A;  4GGF C;  4F7F A;  1MXL C;  1IGV A;  4FTG A;  1LIN A;  3PM2 A;  4PHK A;  4JWQ A;  3M0W A;  1CKK A;  4JKT A;  1EL4 A;  1F71 A;  3B7A A;  1DJW A;  3O2P A;  1GJY A;  1ORG A;  3FE6 A;  1F55 A;  4HSZ A;  1CDL A;  1NX1 A;  1DGV A;  1SCV A;  3IF7 A;  2LVI A;  4HRE E;  1TNW A;  3SG2 A;  1QJT A;  3TUY B;  1QV0 A;  4OR9 B;  2I2R E;  3CZ1 A;  4I5L B;  1KK8 C;  3BQ3 A;  1J7R A;  4CFR A;  1N2D A;  2P70 A;  3PAT A;  5HKW A;  4DCK A;  1JWD A;  2DOQ A;  1CDN A;  3I5F B;  2CBL A;  2GTE A;  3VGO A;  2K7D A;  2F3Z A;  3JTD C;  1IJ5 A;  1UHI A;  3QRX A;  2COL B;  1GGZ A;  3CZ2 A;  5AXI A;  1BMO A;  3BFB A;  3LK1 A;  2EGD A;  3CS1 A;  5FI2 A;  2BAP A;  2QEH A;  5EL2 A;  1B4C A;  1AJ5 A;  3D76 A;  1BR1 B;  2PRU A;  2F2O A;  1QIW A;  2KI6 C;  1EXR A;  2GGZ A;  4GFT A;  2KPH A;  3K21 A;  4OV2 A;  3CDN A;  1S1E A;  1LVC D;  5D69 A;  1KFX S;  2BCX A;  2KAV A;  3D78 A;  1OMD A;  1DGU A;  5BPJ A;  1QAT A;  1UWO A;  1Z4H A;  1PUL A;  2LE9 B;  2I7A A;  5DKQ A;  5K89 A;  1SSE B;  1Z2C B;  2JOJ A;  4ICB A;  5AEQ A;  1W7J B;  1S36 A;  3LLE A;  5PAL A;  3R1P A;  1SR6 B;  3L4L A;  5D3O A;  1KQM C;  2LP2 A;  1ZOT B;  1XK4 A;  4QJ3 B;  2LP3 A;  4OKH A;  1GM0 A;  1S5G Z;  2ZFD A;  1CTR A;  2L2C A;  3BUX B;  3MSE B;  2JNX A;  1QAS A;  4YI9 A;  2BE4 A;  1CDM A;  1SR6 C;  2BBN A;  4E68 A;  4PDZ A;  4PHJ A;  1K9U A;  2WCM A;  3KPX A; 
#chains in the Genus database with same CATH homology
 3FE8 A;  3S0D A;  2PQL A;  3S0B A;  3R72 A;  1OOF A;  1OOH A;  3NGV A;  1LS8 A;  4OZD A;  2ERB A;  2QEV A;  1P28 A;  3N7H A;  2QDI A;  3DXL A;  1T14 A;  3DYE A;  3R1O A;  3CYZ A;  3S0E A;  1C3Y A;  1DQE A;  2WCL A;  3CAB A;  4INW A;  3B88 A;  3BJH A;  2QEB A;  2H8V A;  1TWO A;  4F7F A;  3V2L A;  4JD9 A;  3B7A A;  2WCJ A;  1ORG A;  1OOG A;  3FE6 A;  2FJY A;  3BFA A;  3CZ0 A;  3B87 A;  3D75 A;  2P71 A;  3CZ1 A;  2QEO A;  3VB1 A;  3D73 A;  3D74 A;  2JPO A;  3NHT A;  3RZS A;  2WCK A;  3R1V A;  2P70 A;  2GTE A;  3L4A A;  3L47 A;  1OOI X;  3CZ2 A;  3BFB A;  2WC5 A;  3FE9 A;  2QEH A;  5EL2 A;  3B6X A;  3DY9 A;  3D76 A;  3OGN A;  3B86 A;  3S0F A;  3PJI A;  2KPH A;  3CDN A;  3Q8I A;  3BFH A;  1QWV A;  3D78 A;  3S0A A;  2WCH A;  2WC6 A;  3K1E A;  1XFR A;  3R1P A;  3L4L A;  4FQT A;  4PT1 A;  3DZT A;  1TUJ A;  3QME A;  1GM0 A;  1C3Z A;  3S0G A;  2L2C A;  1OW4 A;  3NHI A;  5DIC A;  3D77 A;  4INX A;  2WCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...