3DY9A

Crystal structure of aed7 potassium bromide soak
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
302
structure length
298
Chain Sequence
MGPFDPEEMLFIFTRCMEDNLEDGANRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVKQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCQIRQYTVLDDALFKEHTDCVMKGIRYITKDNQLDVEEVKRDFKLVNKDTKALEEVLNDCKSKEPSNAKEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKNQAYSKPAVMEIDGKQCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D7 protein
publication title Multifunctionality and mechanism of ligand binding in a mosquito antiinflammatory protein
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Odorant-binding protein
total genus 119
structure length 298
sequence length 302
ec nomenclature
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dy9A01
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dy9A02
3S0FA 1C3ZA 1LS8A 1P28A 1QWVA 3B86A 3PJIA 2P71A 3BJHA 3R1VA 1TWOA 3CYZA 3L47A 3D73A 3CZ2A 3B6XA 3VB1A 2QEOA 2QEVA 3DY9A 2WCJA 2KPHA 4PT1A 2GTEA 3NHTA 3L4AA 3D75A 3B88A 3R1PA 1OW4A 3S0GA 2WC6A 4OZDA 2L2CA 2H8VA 3FE9A 3BFBA 2P70A 2JPOA 2WCLA 3B87A 3RZSA 3NGVA 3OGNA 2WC5A 1TUJA 1C3YA 3BFHA 3CABA 4F7FA 3CZ1A 2QEBA 4FQTA 2WCMA 3D77A 3S0AA 4INWA 3B7AA 4INXA 2QDIA 3S0EA 3L4LA 2WCHA 1OOGA 1OOFA 3DXLA 3D76A 3S0DA 3CDNA 3CZ0A 3DYEA 1OOHA 2FJYA 3R1OA 3FE6A 3D74A 3QMEA 3R72A 1GM0A 3N7HA 5DICA 4JD9A 2QEHA 3V2LA 1T14A 2PQLA 2ERBA 3FE8A 3D78A 3K1EA 3DZTA 2WCKA 3NHIA 1OOIX 3Q8IA 1ORGA 5EL2A 1DQEA 3BFAA 1XFRA 3S0BA
chains in the Genus database with same CATH superfamily
4A4CA 3VRPA 2L5XB 3OHMB 3BUOB 4PHJA 1WDCC 1BMOA 3TUYC 3OX6A 1QWVA 5FYXA 1IQ3A 1RK9A 1SSEB 2M1KB 3D0YA 3GOFA 1MXEA 2HQWA 3EVRA 3PFVA 1TIZA 1Y6WA 4PHKA 2L50A 1DJHA 4MZKA 3KPXA 3SIAA 2A4JA 2JRFA 2JULA 3I5GB 1XA5A 1FPWA 1YRTB 2LAPA 2JTTA 2I94A 1F8HA 1AJ4A 2Y1NA 4GGFC 3A8RA 1DVIA 1B8LA 1K9PA 1KSOA 1PULA 2D8NA 3NHTA 4PE7A 5CSIA 2PMYA 1CDNA 5KTYA 1DT7B 3VRNA 1OZSA 3NSOA 1MQ1A 1QS7A 1UHJA 5D7FA 2WCBA 1CFDA 4GFTA 1WLZA 1SCMC 2JPOA 2WCLA 2KDHA 3OGNA 5HKZA 2F3ZA 1Y1XA 4MZJA 2OS8B 1XK4C 3BYAA 1BU3A 1WRZA 2MJWB 3SG2A 1NP8A 1YRUB 1TUZA 1K8UA 2M7NA 2BCAA 4OCIA 1CFPA 2ZN9A 1PALA 4F7FA 4OR9B 4DIRA 3FS7A 1NUBA 4PALA 3AAKA 1B7TZ 3F45A 2PYQA 4N5XA 5HLVA 3I5FB 4D1EA 1SKTA 2ZFDA 4CIDA 4HRHA 1PSRA 1QX7A 1UURA 2JNXA 1G8IA 1Y1AA 1ODBA 4JQ0D 4MVFA 4PHNA 5AANA 1YURA 2WC8A 3DF0A 1K90D 1GQMA 3CR5X 1ZOTB 2BCXA 1SR6B 3SG7A 1BF5A 1LKJA 1F55A 1SK6D 3LK0A 1BOCA 3EVVA 4INXA 3DD4A 4QJ3B 1KQMC 2KYCA 4MRYA 2LE9B 3ZNIA 3DXLA 1PK0D 2L4IA 3QRXA 1PSBA 2JOJA 1ALVA 1QJTA 2ZNDA 3CDNA 3CZ0A 1CM4A 3DVJA 3EG5B 1A75A 4ICBA 1MWNA 2MBXA 2M97A 1J7PA 2JPTA 1QX5B 1CDLA 1FW4A 3R72A 5JJGA 4BY5A 4CFRA 5CPVA 4OVNF 3SG5A 2EGDA 3CGAA 3FIAA 4ETOA 1KFXL 4NDBA 1IKUA 1JC2A 3CR2A 3V2LA 3EVUA 3IVTA 2PQLA 3FE8A 3KO0A 2AAOA 3O78A 3NSKA 1NSHA 1KCYA 1U5IA 1OMRA 2WCKA 3NHIA 2BNXA 2GV5A 2NZ0A 2M49B 2CCMA 2O60A 3WHTB 1HT9A 2M0RA 1NX3A 3JTDB 4PE0A 1YR5A 1HQVA 3GK4X 1UP5A 3I5IB 1AJ5A 2IS9A 1EG3A 3BFAA 1UHHA 1XFRA 1KFXS 3VGOA 3KHEA 1V1FA 1NCZA 3CR4X 2ZNEA 4GGFA 1WRKA 1P28A 3PJIA 1ZACA 2P6BB 3R1VA 3UNWA 2JC2A 1S5GY 1W7IB 1RFJA 1SYMA 2I2RE 1FI5A 1H4BA 3L47A 4JPZB 1SL9A 3D73A 2MA2A 3LL8B 3CS1A 3CZ2A 3BOWB 4HREE 3SS5A 1IJ5A 2BL0C 5CSJA 3BUNB 1AUIB 2K2AA 1YTZC 3VB1A 1PVBA 2QEOA 3DY9A 2WCJA 3EKHA 1DJYA 4AQIA 4A4BA 2K7DA 1LXFC 2WORA 5I2LA 2GTEA 2PASA 2GGMA 3PN7B 1J7QA 1IWQA 1MF8B 1XK4A 1SPYA 1Y0VH 3RM1A 1S5GZ 3B88A 4Q04A 1K9KA 2K7BA 3NSIA 3R1PA 1SRAA 1G33A 1DF0B 4C0LA 4WQ3A 2L2CA 3JVTB 1GJYA 1KWOC 5I2OA 4I5JA 1DTLA 1KK7Z 2LMVA 2KYFA 2L2EA 3BFBA 5CSFA 2EHBA 1MXLC 3I5HB 3B87A 5I8NA 3DF0B 2M8UA 3BUXB 2KAXA 3NGVA 1N2DA 1Z2CB 1FBVA 2LMTA 1KK8C 4YGBB 3TS5C 1DC1A 2K61A 1C3YA 4U8DA 2CT9A 1JSAA 4GGNA 4BY4A 4MEWA 1ZUZA 3CABA 2YGUA 2FCDA 1IRJA 4NQGA 2RGIA 4DS7A 1UUSA 1V1GA 1B9AA 3OB1B 2CTNA 2HPSA 5DKQA 4M2PA 2I7AA 1YVHA 3AKBA 4AOMA 1JF2A 2WOSA 1WRLA 2KI4B 4FQTA 5DKNA 3IQQA 1AVSA 1B8RA 3PLFB 4ORAB 3PM8A 2WCEA 2LLUA 2AUCA 2KFGA 3ICBA 1PRWA 1L7ZA 3FWBA 1IJ6A 1EJ3A 1F71A 2QDIA 3S0EA 2JXCA 4DUQA 1OOJA 4OKHA 3WHUB 1C07A 4PE4A 2VRGA 3D76A 4YGCB 2GGZA 2F8PA 5PALA 3DVEA 3RLZA 2FJYA 3R1OA 1R2UA 2HF5A 2LP3A 4YBHB 4E68A 1YX8A 3TUYB 1DGVA 1S6CA 5I94A 3O6BA 1CNPA 1L2OC 1DJIA 1NX2A 1EG4A 2LVJA 4PDZA 1SBJA 1A2XA 1OMVA 1Y1UA 1K93D 2F2OA 2L51A 1M39A 1NCYA 1NYAA 2KOTA 5ER5A 2HETA 1GM0A 3N7HA 1WY9A 1XVJA 1PVAA 1NWDA 2KHNA 5BPJA 1TNQA 1TRFA 5DICA 2M3WA 1JFKA 2H2KA 2QEHA 1DJWA 3KF9A 1LINA 2L98A 2LCPA 2EC6C 2Y5IA 1QV0A 2BE4A 1TNXA 2LP2A 3OP0A 4WQ2A 2F3YA 1NIWA 4I5NB 3EK8A 4PCWA 4XJKA 2SCPA 1LA3A 4GNKB 5B8IB 1M31A 1DJZA 3S0BA 5HKYA 5EL2A 2FOTA 1DQEA 1SCMB 1B4CA 1JBAA 1J1DA 1F54A 2PALA 2NCOA 3MSEB 1BLQA 1C3ZA 2PVBA 3HCMA 4OV2A 1AK8A 2MLFC 1SCVA 2KI6D 1H8BA 4KYNA 4MRXA 2P71A 1BT6A 1TTXA 3BJHA 1EL4A 3PM2A 2HQ8A 1XFVO 3CYZA 1QV1A 5AEQA 4F0ZB 3D0YB 3C1VA 1IGVA 4YGAA 1D1OA 1KFUL 1NX0A 2JT0A 2PRUA 2KGRA 3B6XA 5D3OA 2JQ6A 2TN4A 1QLSA 1TCFA 2KPHA 2KBIA 1TN4A 2ZN8A 3BUWB 3GK1A 4PT1A 2OTGC 4AQJA 1BR4B 4P2YB 2LNKA 3L4AA 1KQVA 1QXPA 4ZCUA 3SG3A 1R6PA 3SJSA 4M2OA 5J3XA 1EH2A 1OW4A 1ZMZA 2B1UA 1BJFA 5TNCA 2LANA 2L4HA 2M1UA 1JFJA 5CSNA 1QVIY 2LUXA 3SG4A 1KQMB 2P70A 2KQYA 3DVMA 3RZSA 1KFUS 2CBLA 3IQOA 2WC5A 3EKJA 4P5OE 1S36A 3TDZA 3CTNA 3UO9A 5F6TA 1AHRA 2JNFA 2JXLA 2JWWA 2BE6A 1S3PA 5AXIA 3AKAA 4CPVA 1S6IA 1CFFA 3PATA 1C7WA 1DGUA 1YVLA 1GGZA 1B47A 2BBNA 2JU0A 3VRQA 1UHKA 1XFUO 1IIOA 4GAOA 5FI7A 3I5GC 4UPGA 1M63B 1OMDA 1UHIA 3OBVA 2Y1MA 2F2PA 5AFPA 1N0YA 2WCMA 1CLMA 1XO5A 4DRWA 1CDPA 1TNWA 2H61C 3FWCA 3WXAA 5HL1A 5K89A 1CLBA 2E30A 1C7VA 5IBWA 3DVKA 2LVVA 2G2BA 4CLNA 1K94A 1DJXA 2MRDA 1RTP1 3M0WA 3OB2B 2KSPA 4L9MA 4TNCA 3S0DA 4QJ4B 2O5GA 2COLB 1UWOA 1OOHA 2BAPA 2OS8C 1F4OA 3FE6A 1Q80A 4HSZA 3ZWHA 4IJ7A 3HX4A 4HRGA 3WNXB 1QIWA 2KQ6A 1A75B 2FJUB 2K7CA 5DKRA 2NCPA 3PSRA 2M7LA 1X02A 2WNDA 2BL0B 1SL7A 3D10A 1RWYA 3I5FC 2KLEA 1DJGA 2M29A 2ZRSA 4JD9A 4JKTA 4MN0A 1TCOB 3NSLA 2LMUA 2ERBA 5FI6A 5KSZA 2LHIA 3K1EA 3TDIA 2KNEA 2ZRTA 3CZTX 3DZTA 1G4YR 4JWQA 1CMFA 1OOIX 1QLKA 1SR6C 1TOPA 1KWOB 1U5IB 3PALA 1XFZO 1WDCB 2M9GA 3BXKA 4N1GA 1CTRA 1MR8A 4I5KA 2K0JA 1W7JB 4YGDB 1K9UA 2K7OA 1KK8B 5HYDA 1VRKA 3S0FA 1DELA 3A4UB 1M46A 1IQ5A 2MAZA 1LS8A 3TS5B 1K96A 4MZLA 1OQPA 1UHNA 4ORCB 4CFQA 1B7TY 1QATA 3B86A 4YI8A 4GBAA 1BR1B 1IH0A 3BOWA 5I2QA 1OE9B 1TWOA 5ER4X 3SS4A 2NLNA 1QIVA 1EXRA 3LCPC 2LUCA 2E6WA 2BBMA 2KBMA 4PE1A 1JUOA 1QX2A 4R1EA 1B1GA 1K95A 2JT8A 4PHMA 2JZIA 2QEVA 1GGWA 4ORBB 1DF0A 1RJVA 5HKWA 1QASA 2JTZA 2LHLA 1OSAA 3D75A 1JWDA 1IG5A 4MLWA 5D69A 3VROA 3S0GA 3H4SE 2WC6A 4OZDA 3EK7A 2KFHA 4N1FA 2H8VA 2KGBC 1CLLA 1M45A 3FE9A 3JTDC 4NDDA 1LVCD 3AAJA 3I5IC 1CDMA 2PSRA 2BKHB 2I18A 1CKKA 3OX5A 2KAVA 4WRIA 1ALWA 2V53A 2BKIB 1RROA 2ZKMX 2LC5A 1TUJA 2FCEA 3GK2A 1YUUA 1L2OB 1XFXO 3LLEA 2KAYA 2QPTA 1ZFSA 3BFHA 3IF7A 2MLEC 1XYDA 2ISDA 2H61A 1SY9A 1E8AA 1JF0A 1RECA 2K60A 2LV7A 1NPQA 3O4YA 2Q91A 4IL1A 1A03A 2L5YA 3BQ3A 1B8CA 3CZ1A 2F33A 2MHHA 1YX7A 2LVIA 2QEBA 5FI2A 1FI6A 1J55A 1WLMA 1YUSA 1YUTA 2BCBA 1S26D 5G08A 2EC6B 1NX1A 3PN7C 3BUMB 1XFWO 1DEKA 1J1EA 3EK4A 4MSPA 2LLSA 3D77A 4USLA 4ZCVA 1CFCA 3TDUA 4DCKA 1FF1A 2KI6C 3S0AA 3JVTC 4FTGA 4INWA 3B7AA 4YI9A 1DMOA 3L4LA 1BG1A 2WCHA 1BODA 1CB1A 1OOGA 1OOFA 3CLNA 3NXAA 2KLDA 2Y4QA 3SS3A 4YRUA 1CMGA 3I5HC 5JOLA 1W9ZA 1LA0A 1J7RA 1A4PA 2AMIA 2WCFA 1QVIZ 3DYEA 4NDCA 3E3RA 5KU1A 3D74A 1MHOA 4M2QA 1SL8A 3QMEA 4YGEB 1SMGA 3VRRA 2G9BA 4C0JA 3SIBA 2LM5A 1S6JA 1SNLA 1CM1A 1TNPA 1N65A 2SASA 3K21A 5HLOA 2CNPA 3SG6A 1F4QA 1NCXA 2K8MB 3CWGA 2BECA 1KSMA 2KFFA 2OPOA 4GUKA 1OZOA 1F70A 4GPLB 4XYNA 4QJ5B 2JT3A 1K2HA 2OTGB 1T14A 2LVKA 1Z4HA 5GQQC 3D78A 3KEVA 2KI4C 4MBEA 3O2PA 1AP4A 1SW8A 3TZ1A 1KK7Y 2LLTA 1J7OA 4FQOA 2Q4UA 3O4XA 3Q8IA 1MUXA 2QACA 4I5LB 1QTXA 1S1EA 4C0KA 1ORGA 2R2IA 1A29A 3LK1A 2DOQA 2L0PA 4XJKB 2K2FA 1XFYO 2NXQA 5AERA 2CXJA
chains in the Genus database with same CATH topology
3S0FA 1C3ZA 1LS8A 1P28A 1QWVA 3B86A 3PJIA 2P71A 3BJHA 3R1VA 1TWOA 3CYZA 3L47A 3D73A 3CZ2A 3B6XA 3VB1A 2QEOA 2QEVA 3DY9A 2WCJA 2KPHA 4PT1A 2GTEA 3NHTA 3L4AA 3D75A 3B88A 3R1PA 1OW4A 3S0GA 2WC6A 4OZDA 2L2CA 2H8VA 3FE9A 3BFBA 2P70A 2JPOA 2WCLA 3B87A 3RZSA 3NGVA 3OGNA 2WC5A 1TUJA 1C3YA 3BFHA 3CABA 4F7FA 3CZ1A 2QEBA 4FQTA 2WCMA 3D77A 3S0AA 4INWA 3B7AA 4INXA 2QDIA 3S0EA 3L4LA 2WCHA 1OOGA 1OOFA 3DXLA 3D76A 3S0DA 3CDNA 3CZ0A 3DYEA 1OOHA 2FJYA 3R1OA 3FE6A 3D74A 3QMEA 3R72A 1GM0A 3N7HA 5DICA 4JD9A 2QEHA 3V2LA 1T14A 2PQLA 2ERBA 3FE8A 3D78A 3K1EA 3DZTA 2WCKA 3NHIA 1OOIX 3Q8IA 1ORGA 5EL2A 1DQEA 3BFAA 1XFRA 3S0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0F A;  1C3Z A;  1LS8 A;  1P28 A;  1QWV A;  3B86 A;  3PJI A;  2P71 A;  3BJH A;  3R1V A;  1TWO A;  3CYZ A;  3L47 A;  3D73 A;  3CZ2 A;  3B6X A;  3VB1 A;  2QEO A;  2QEV A;  3DY9 A;  2WCJ A;  2KPH A;  4PT1 A;  2GTE A;  3NHT A;  3L4A A;  3D75 A;  3B88 A;  3R1P A;  1OW4 A;  3S0G A;  2WC6 A;  4OZD A;  2L2C A;  2H8V A;  3FE9 A;  3BFB A;  2P70 A;  2JPO A;  2WCL A;  3B87 A;  3RZS A;  3NGV A;  3OGN A;  2WC5 A;  1TUJ A;  1C3Y A;  3BFH A;  3CAB A;  4F7F A;  3CZ1 A;  2QEB A;  4FQT A;  2WCM A;  3D77 A;  3S0A A;  4INW A;  3B7A A;  4INX A;  2QDI A;  3S0E A;  3L4L A;  2WCH A;  1OOG A;  1OOF A;  3DXL A;  3D76 A;  3S0D A;  3CDN A;  3CZ0 A;  3DYE A;  1OOH A;  2FJY A;  3R1O A;  3FE6 A;  3D74 A;  3QME A;  3R72 A;  1GM0 A;  3N7H A;  5DIC A;  4JD9 A;  2QEH A;  3V2L A;  1T14 A;  2PQL A;  2ERB A;  3FE8 A;  3D78 A;  3K1E A;  3DZT A;  2WCK A;  3NHI A;  1OOI X;  3Q8I A;  1ORG A;  5EL2 A;  1DQE A;  3BFA A;  1XFR A;  3S0B A; 
#chains in the Genus database with same CATH topology
 4A4C A;  3VRP A;  2L5X B;  3OHM B;  3BUO B;  4PHJ A;  1WDC C;  1BMO A;  3TUY C;  3OX6 A;  1QWV A;  5FYX A;  1IQ3 A;  1RK9 A;  1SSE B;  2M1K B;  3D0Y A;  3GOF A;  1MXE A;  2HQW A;  3EVR A;  3PFV A;  1TIZ A;  1Y6W A;  4PHK A;  2L50 A;  1DJH A;  4MZK A;  3KPX A;  3SIA A;  2A4J A;  2JRF A;  2JUL A;  3I5G B;  1XA5 A;  1FPW A;  1YRT B;  2LAP A;  2JTT A;  2I94 A;  1F8H A;  1AJ4 A;  2Y1N A;  4GGF C;  3A8R A;  1DVI A;  1B8L A;  1K9P A;  1KSO A;  1PUL A;  2D8N A;  3NHT A;  4PE7 A;  5CSI A;  2PMY A;  1CDN A;  5KTY A;  1DT7 B;  3VRN A;  1OZS A;  3NSO A;  1MQ1 A;  1QS7 A;  1UHJ A;  5D7F A;  2WCB A;  1CFD A;  4GFT A;  1WLZ A;  1SCM C;  2JPO A;  2WCL A;  2KDH A;  3OGN A;  5HKZ A;  2F3Z A;  1Y1X A;  4MZJ A;  2OS8 B;  1XK4 C;  3BYA A;  1BU3 A;  1WRZ A;  2MJW B;  3SG2 A;  1NP8 A;  1YRU B;  1TUZ A;  1K8U A;  2M7N A;  2BCA A;  4OCI A;  1CFP A;  2ZN9 A;  1PAL A;  4F7F A;  4OR9 B;  4DIR A;  3FS7 A;  1NUB A;  4PAL A;  3AAK A;  1B7T Z;  3F45 A;  2PYQ A;  4N5X A;  5HLV A;  3I5F B;  4D1E A;  1SKT A;  2ZFD A;  4CID A;  4HRH A;  1PSR A;  1QX7 A;  1UUR A;  2JNX A;  1G8I A;  1Y1A A;  1ODB A;  4JQ0 D;  4MVF A;  4PHN A;  5AAN A;  1YUR A;  2WC8 A;  3DF0 A;  1K90 D;  1GQM A;  3CR5 X;  1ZOT B;  2BCX A;  1SR6 B;  3SG7 A;  1BF5 A;  1LKJ A;  1F55 A;  1SK6 D;  3LK0 A;  1BOC A;  3EVV A;  4INX A;  3DD4 A;  4QJ3 B;  1KQM C;  2KYC A;  4MRY A;  2LE9 B;  3ZNI A;  3DXL A;  1PK0 D;  2L4I A;  3QRX A;  1PSB A;  2JOJ A;  1ALV A;  1QJT A;  2ZND A;  3CDN A;  3CZ0 A;  1CM4 A;  3DVJ A;  3EG5 B;  1A75 A;  4ICB A;  1MWN A;  2MBX A;  2M97 A;  1J7P A;  2JPT A;  1QX5 B;  1CDL A;  1FW4 A;  3R72 A;  5JJG A;  4BY5 A;  4CFR A;  5CPV A;  4OVN F;  3SG5 A;  2EGD A;  3CGA A;  3FIA A;  4ETO A;  1KFX L;  4NDB A;  1IKU A;  1JC2 A;  3CR2 A;  3V2L A;  3EVU A;  3IVT A;  2PQL A;  3FE8 A;  3KO0 A;  2AAO A;  3O78 A;  3NSK A;  1NSH A;  1KCY A;  1U5I A;  1OMR A;  2WCK A;  3NHI A;  2BNX A;  2GV5 A;  2NZ0 A;  2M49 B;  2CCM A;  2O60 A;  3WHT B;  1HT9 A;  2M0R A;  1NX3 A;  3JTD B;  4PE0 A;  1YR5 A;  1HQV A;  3GK4 X;  1UP5 A;  3I5I B;  1AJ5 A;  2IS9 A;  1EG3 A;  3BFA A;  1UHH A;  1XFR A;  1KFX S;  3VGO A;  3KHE A;  1V1F A;  1NCZ A;  3CR4 X;  2ZNE A;  4GGF A;  1WRK A;  1P28 A;  3PJI A;  1ZAC A;  2P6B B;  3R1V A;  3UNW A;  2JC2 A;  1S5G Y;  1W7I B;  1RFJ A;  1SYM A;  2I2R E;  1FI5 A;  1H4B A;  3L47 A;  4JPZ B;  1SL9 A;  3D73 A;  2MA2 A;  3LL8 B;  3CS1 A;  3CZ2 A;  3BOW B;  4HRE E;  3SS5 A;  1IJ5 A;  2BL0 C;  5CSJ A;  3BUN B;  1AUI B;  2K2A A;  1YTZ C;  3VB1 A;  1PVB A;  2QEO A;  3DY9 A;  2WCJ A;  3EKH A;  1DJY A;  4AQI A;  4A4B A;  2K7D A;  1LXF C;  2WOR A;  5I2L A;  2GTE A;  2PAS A;  2GGM A;  3PN7 B;  1J7Q A;  1IWQ A;  1MF8 B;  1XK4 A;  1SPY A;  1Y0V H;  3RM1 A;  1S5G Z;  3B88 A;  4Q04 A;  1K9K A;  2K7B A;  3NSI A;  3R1P A;  1SRA A;  1G33 A;  1DF0 B;  4C0L A;  4WQ3 A;  2L2C A;  3JVT B;  1GJY A;  1KWO C;  5I2O A;  4I5J A;  1DTL A;  1KK7 Z;  2LMV A;  2KYF A;  2L2E A;  3BFB A;  5CSF A;  2EHB A;  1MXL C;  3I5H B;  3B87 A;  5I8N A;  3DF0 B;  2M8U A;  3BUX B;  2KAX A;  3NGV A;  1N2D A;  1Z2C B;  1FBV A;  2LMT A;  1KK8 C;  4YGB B;  3TS5 C;  1DC1 A;  2K61 A;  1C3Y A;  4U8D A;  2CT9 A;  1JSA A;  4GGN A;  4BY4 A;  4MEW A;  1ZUZ A;  3CAB A;  2YGU A;  2FCD A;  1IRJ A;  4NQG A;  2RGI A;  4DS7 A;  1UUS A;  1V1G A;  1B9A A;  3OB1 B;  2CTN A;  2HPS A;  5DKQ A;  4M2P A;  2I7A A;  1YVH A;  3AKB A;  4AOM A;  1JF2 A;  2WOS A;  1WRL A;  2KI4 B;  4FQT A;  5DKN A;  3IQQ A;  1AVS A;  1B8R A;  3PLF B;  4ORA B;  3PM8 A;  2WCE A;  2LLU A;  2AUC A;  2KFG A;  3ICB A;  1PRW A;  1L7Z A;  3FWB A;  1IJ6 A;  1EJ3 A;  1F71 A;  2QDI A;  3S0E A;  2JXC A;  4DUQ A;  1OOJ A;  4OKH A;  3WHU B;  1C07 A;  4PE4 A;  2VRG A;  3D76 A;  4YGC B;  2GGZ A;  2F8P A;  5PAL A;  3DVE A;  3RLZ A;  2FJY A;  3R1O A;  1R2U A;  2HF5 A;  2LP3 A;  4YBH B;  4E68 A;  1YX8 A;  3TUY B;  1DGV A;  1S6C A;  5I94 A;  3O6B A;  1CNP A;  1L2O C;  1DJI A;  1NX2 A;  1EG4 A;  2LVJ A;  4PDZ A;  1SBJ A;  1A2X A;  1OMV A;  1Y1U A;  1K93 D;  2F2O A;  2L51 A;  1M39 A;  1NCY A;  1NYA A;  2KOT A;  5ER5 A;  2HET A;  1GM0 A;  3N7H A;  1WY9 A;  1XVJ A;  1PVA A;  1NWD A;  2KHN A;  5BPJ A;  1TNQ A;  1TRF A;  5DIC A;  2M3W A;  1JFK A;  2H2K A;  2QEH A;  1DJW A;  3KF9 A;  1LIN A;  2L98 A;  2LCP A;  2EC6 C;  2Y5I A;  1QV0 A;  2BE4 A;  1TNX A;  2LP2 A;  3OP0 A;  4WQ2 A;  2F3Y A;  1NIW A;  4I5N B;  3EK8 A;  4PCW A;  4XJK A;  2SCP A;  1LA3 A;  4GNK B;  5B8I B;  1M31 A;  1DJZ A;  3S0B A;  5HKY A;  5EL2 A;  2FOT A;  1DQE A;  1SCM B;  1B4C A;  1JBA A;  1J1D A;  1F54 A;  2PAL A;  2NCO A;  3MSE B;  1BLQ A;  1C3Z A;  2PVB A;  3HCM A;  4OV2 A;  1AK8 A;  2MLF C;  1SCV A;  2KI6 D;  1H8B A;  4KYN A;  4MRX A;  2P71 A;  1BT6 A;  1TTX A;  3BJH A;  1EL4 A;  3PM2 A;  2HQ8 A;  1XFV O;  3CYZ A;  1QV1 A;  5AEQ A;  4F0Z B;  3D0Y B;  3C1V A;  1IGV A;  4YGA A;  1D1O A;  1KFU L;  1NX0 A;  2JT0 A;  2PRU A;  2KGR A;  3B6X A;  5D3O A;  2JQ6 A;  2TN4 A;  1QLS A;  1TCF A;  2KPH A;  2KBI A;  1TN4 A;  2ZN8 A;  3BUW B;  3GK1 A;  4PT1 A;  2OTG C;  4AQJ A;  1BR4 B;  4P2Y B;  2LNK A;  3L4A A;  1KQV A;  1QXP A;  4ZCU A;  3SG3 A;  1R6P A;  3SJS A;  4M2O A;  5J3X A;  1EH2 A;  1OW4 A;  1ZMZ A;  2B1U A;  1BJF A;  5TNC A;  2LAN A;  2L4H A;  2M1U A;  1JFJ A;  5CSN A;  1QVI Y;  2LUX A;  3SG4 A;  1KQM B;  2P70 A;  2KQY A;  3DVM A;  3RZS A;  1KFU S;  2CBL A;  3IQO A;  2WC5 A;  3EKJ A;  4P5O E;  1S36 A;  3TDZ A;  3CTN A;  3UO9 A;  5F6T A;  1AHR A;  2JNF A;  2JXL A;  2JWW A;  2BE6 A;  1S3P A;  5AXI A;  3AKA A;  4CPV A;  1S6I A;  1CFF A;  3PAT A;  1C7W A;  1DGU A;  1YVL A;  1GGZ A;  1B47 A;  2BBN A;  2JU0 A;  3VRQ A;  1UHK A;  1XFU O;  1IIO A;  4GAO A;  5FI7 A;  3I5G C;  4UPG A;  1M63 B;  1OMD A;  1UHI A;  3OBV A;  2Y1M A;  2F2P A;  5AFP A;  1N0Y A;  2WCM A;  1CLM A;  1XO5 A;  4DRW A;  1CDP A;  1TNW A;  2H61 C;  3FWC A;  3WXA A;  5HL1 A;  5K89 A;  1CLB A;  2E30 A;  1C7V A;  5IBW A;  3DVK A;  2LVV A;  2G2B A;  4CLN A;  1K94 A;  1DJX A;  2MRD A;  1RTP 1;  3M0W A;  3OB2 B;  2KSP A;  4L9M A;  4TNC A;  3S0D A;  4QJ4 B;  2O5G A;  2COL B;  1UWO A;  1OOH A;  2BAP A;  2OS8 C;  1F4O A;  3FE6 A;  1Q80 A;  4HSZ A;  3ZWH A;  4IJ7 A;  3HX4 A;  4HRG A;  3WNX B;  1QIW A;  2KQ6 A;  1A75 B;  2FJU B;  2K7C A;  5DKR A;  2NCP A;  3PSR A;  2M7L A;  1X02 A;  2WND A;  2BL0 B;  1SL7 A;  3D10 A;  1RWY A;  3I5F C;  2KLE A;  1DJG A;  2M29 A;  2ZRS A;  4JD9 A;  4JKT A;  4MN0 A;  1TCO B;  3NSL A;  2LMU A;  2ERB A;  5FI6 A;  5KSZ A;  2LHI A;  3K1E A;  3TDI A;  2KNE A;  2ZRT A;  3CZT X;  3DZT A;  1G4Y R;  4JWQ A;  1CMF A;  1OOI X;  1QLK A;  1SR6 C;  1TOP A;  1KWO B;  1U5I B;  3PAL A;  1XFZ O;  1WDC B;  2M9G A;  3BXK A;  4N1G A;  1CTR A;  1MR8 A;  4I5K A;  2K0J A;  1W7J B;  4YGD B;  1K9U A;  2K7O A;  1KK8 B;  5HYD A;  1VRK A;  3S0F A;  1DEL A;  3A4U B;  1M46 A;  1IQ5 A;  2MAZ A;  1LS8 A;  3TS5 B;  1K96 A;  4MZL A;  1OQP A;  1UHN A;  4ORC B;  4CFQ A;  1B7T Y;  1QAT A;  3B86 A;  4YI8 A;  4GBA A;  1BR1 B;  1IH0 A;  3BOW A;  5I2Q A;  1OE9 B;  1TWO A;  5ER4 X;  3SS4 A;  2NLN A;  1QIV A;  1EXR A;  3LCP C;  2LUC A;  2E6W A;  2BBM A;  2KBM A;  4PE1 A;  1JUO A;  1QX2 A;  4R1E A;  1B1G A;  1K95 A;  2JT8 A;  4PHM A;  2JZI A;  2QEV A;  1GGW A;  4ORB B;  1DF0 A;  1RJV A;  5HKW A;  1QAS A;  2JTZ A;  2LHL A;  1OSA A;  3D75 A;  1JWD A;  1IG5 A;  4MLW A;  5D69 A;  3VRO A;  3S0G A;  3H4S E;  2WC6 A;  4OZD A;  3EK7 A;  2KFH A;  4N1F A;  2H8V A;  2KGB C;  1CLL A;  1M45 A;  3FE9 A;  3JTD C;  4NDD A;  1LVC D;  3AAJ A;  3I5I C;  1CDM A;  2PSR A;  2BKH B;  2I18 A;  1CKK A;  3OX5 A;  2KAV A;  4WRI A;  1ALW A;  2V53 A;  2BKI B;  1RRO A;  2ZKM X;  2LC5 A;  1TUJ A;  2FCE A;  3GK2 A;  1YUU A;  1L2O B;  1XFX O;  3LLE A;  2KAY A;  2QPT A;  1ZFS A;  3BFH A;  3IF7 A;  2MLE C;  1XYD A;  2ISD A;  2H61 A;  1SY9 A;  1E8A A;  1JF0 A;  1REC A;  2K60 A;  2LV7 A;  1NPQ A;  3O4Y A;  2Q91 A;  4IL1 A;  1A03 A;  2L5Y A;  3BQ3 A;  1B8C A;  3CZ1 A;  2F33 A;  2MHH A;  1YX7 A;  2LVI A;  2QEB A;  5FI2 A;  1FI6 A;  1J55 A;  1WLM A;  1YUS A;  1YUT A;  2BCB A;  1S26 D;  5G08 A;  2EC6 B;  1NX1 A;  3PN7 C;  3BUM B;  1XFW O;  1DEK A;  1J1E A;  3EK4 A;  4MSP A;  2LLS A;  3D77 A;  4USL A;  4ZCV A;  1CFC A;  3TDU A;  4DCK A;  1FF1 A;  2KI6 C;  3S0A A;  3JVT C;  4FTG A;  4INW A;  3B7A A;  4YI9 A;  1DMO A;  3L4L A;  1BG1 A;  2WCH A;  1BOD A;  1CB1 A;  1OOG A;  1OOF A;  3CLN A;  3NXA A;  2KLD A;  2Y4Q A;  3SS3 A;  4YRU A;  1CMG A;  3I5H C;  5JOL A;  1W9Z A;  1LA0 A;  1J7R A;  1A4P A;  2AMI A;  2WCF A;  1QVI Z;  3DYE A;  4NDC A;  3E3R A;  5KU1 A;  3D74 A;  1MHO A;  4M2Q A;  1SL8 A;  3QME A;  4YGE B;  1SMG A;  3VRR A;  2G9B A;  4C0J A;  3SIB A;  2LM5 A;  1S6J A;  1SNL A;  1CM1 A;  1TNP A;  1N65 A;  2SAS A;  3K21 A;  5HLO A;  2CNP A;  3SG6 A;  1F4Q A;  1NCX A;  2K8M B;  3CWG A;  2BEC A;  1KSM A;  2KFF A;  2OPO A;  4GUK A;  1OZO A;  1F70 A;  4GPL B;  4XYN A;  4QJ5 B;  2JT3 A;  1K2H A;  2OTG B;  1T14 A;  2LVK A;  1Z4H A;  5GQQ C;  3D78 A;  3KEV A;  2KI4 C;  4MBE A;  3O2P A;  1AP4 A;  1SW8 A;  3TZ1 A;  1KK7 Y;  2LLT A;  1J7O A;  4FQO A;  2Q4U A;  3O4X A;  3Q8I A;  1MUX A;  2QAC A;  4I5L B;  1QTX A;  1S1E A;  4C0K A;  1ORG A;  2R2I A;  1A29 A;  3LK1 A;  2DOQ A;  2L0P A;  4XJK B;  2K2F A;  1XFY O;  2NXQ A;  5AER A;  2CXJ A; 
#chains in the Genus database with same CATH homology
 3S0F A;  1C3Z A;  1LS8 A;  1P28 A;  1QWV A;  3B86 A;  3PJI A;  2P71 A;  3BJH A;  3R1V A;  1TWO A;  3CYZ A;  3L47 A;  3D73 A;  3CZ2 A;  3B6X A;  3VB1 A;  2QEO A;  2QEV A;  3DY9 A;  2WCJ A;  2KPH A;  4PT1 A;  2GTE A;  3NHT A;  3L4A A;  3D75 A;  3B88 A;  3R1P A;  1OW4 A;  3S0G A;  2WC6 A;  4OZD A;  2L2C A;  2H8V A;  3FE9 A;  3BFB A;  2P70 A;  2JPO A;  2WCL A;  3B87 A;  3RZS A;  3NGV A;  3OGN A;  2WC5 A;  1TUJ A;  1C3Y A;  3BFH A;  3CAB A;  4F7F A;  3CZ1 A;  2QEB A;  4FQT A;  2WCM A;  3D77 A;  3S0A A;  4INW A;  3B7A A;  4INX A;  2QDI A;  3S0E A;  3L4L A;  2WCH A;  1OOG A;  1OOF A;  3DXL A;  3D76 A;  3S0D A;  3CDN A;  3CZ0 A;  3DYE A;  1OOH A;  2FJY A;  3R1O A;  3FE6 A;  3D74 A;  3QME A;  3R72 A;  1GM0 A;  3N7H A;  5DIC A;  4JD9 A;  2QEH A;  3V2L A;  1T14 A;  2PQL A;  2ERB A;  3FE8 A;  3D78 A;  3K1E A;  3DZT A;  2WCK A;  3NHI A;  1OOI X;  3Q8I A;  1ORG A;  5EL2 A;  1DQE A;  3BFA A;  1XFR A;  3S0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...