3DY9A

Crystal structure of aed7 potassium bromide soak
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
302
structure length
298
Chain Sequence
MGPFDPEEMLFIFTRCMEDNLEDGANRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVKQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCQIRQYTVLDDALFKEHTDCVMKGIRYITKDNQLDVEEVKRDFKLVNKDTKALEEVLNDCKSKEPSNAKEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKNQAYSKPAVMEIDGKQCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Odorant-binding protein
molecule keywords D7 protein
publication title Multifunctionality and mechanism of ligand binding in a mosquito antiinflammatory protein
pubmed doi rcsb
source organism Aedes aegypti
total genus 119
structure length 298
sequence length 302
ec nomenclature
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dy9A01
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3dy9A02
2WCJA 2QEOA 2QDIA 3D75A 3CABA 1ORGA 2JPOA 3L47A 3DY9A 1TUJA 4PT1A 3CZ1A 2ERBA 3PJIA 3D73A 1XFRA 2WCHA 3DYEA 3K1EA 4OZDA 3R1OA 2WCLA 3S0EA 3V2LA 3B7AA 3B6XA 4INXA 1OOHA 3CDNA 3VB1A 3B88A 2GTEA 3S0DA 3D74A 3D76A 3FE6A 2L2CA 3S0GA 1DQEA 3QMEA 5EL2A 2WCMA 3FE9A 3CZ0A 2WC5A 2FJYA 2WC6A 2KPHA 2H8VA 3R72A 3BJHA 3S0BA 3DZTA 1C3YA 3OGNA 3NHIA 3S0AA 3RZSA 1TWOA 3L4AA 3CYZA 3B86A 4F7FA 3NGVA 3D78A 1C3ZA 3N7HA 2QEHA 3BFHA 2P71A 2QEBA 1OOIX 1P28A 3FE8A 3NHTA 3Q8IA 2PQLA 3D77A 2QEVA 3BFAA 3S0FA 3R1PA 2WCKA 4FQTA 3CZ2A 5DICA 3BFBA 4JD9A 3L4LA 1T14A 3R1VA 1OOGA 3DXLA 1QWVA 3B87A 1OW4A 1OOFA 1GM0A 1LS8A 4INWA 2P70A
chains in the Genus database with same CATH superfamily
2LUCA 2LUXA 2WCJA 2WNDA 3NXAA 1S1EA 1PK0D 3O4YA 2ZNDA 1G33A 3C1VA 2PVBA 1MUXA 1YX8A 3CABA 3IQOA 1G4YR 4PHMA 4WRIA 3BOWA 4I5NB 4OR9B 4GBAA 3KO0A 2M97A 4YGBB 4PE1A 3L47A 1NCXA 3IF7A 1FI5A 1KQMB 2KOTA 1TUJA 1UHJA 5D3OA 1K94A 2LHLA 4MSPA 1KQVA 3VROA 2L5YA 1JC2A 1NWDA 3EKHA 1ZOTB 3D0YA 2HQ8A 1QLSA 5DKRA 4MVFA 2KFGA 3M0WA 5I2QA 2HPSA 1IQ3A 3JTDC 1QLKA 1FI6A 1CM4A 3CTNA 1DJWA 5HYDA 3CS1A 4MEWA 2ZRTA 1CMFA 4GAOA 2WCLA 1SBJA 1Y1UA 1F54A 2OS8B 1E8AA 3B7AA 1DT7B 1CDMA 1A03A 3B6XA 2M1UA 2PALA 2HQWA 3CDNA 1F70A 1BODA 3TUYC 1S36A 2KFFA 1L2OB 3SG4A 2NXQA 1A29A 5D7FA 2KI6C 1MHOA 3CWGA 3D74A 3D76A 3K21A 4MRXA 2MBXA 4CLNA 1TNPA 1B9AA 1SR6B 2LCPA 4CFRA 1M39A 1SW8A 3AKBA 1CFCA 1TUZA 2M1KB 2P70A 1KK7Z 2I18A 1B8RA 1CMGA 1C07A 1IJ6A 1QTXA 4GPLB 2LMTA 5AEQA 1N2DA 2K60A 2LVKA 5G08A 1MWNA 1DJZA 1K93D 3SG3A 1QX2A 5HKYA 1BF5A 2R2IA 2L51A 4MZJA 1CDLA 1YRTB 4GGNA 1RJVA 3S0BA 3O4XA 2L4HA 3WNXB 3OGNA 1M46A 3PN7B 5PALA 1R2UA 3PFVA 1IH0A 1KFXS 3RZSA 1KFUL 2BKIB 1EL4A 2BCAA 3RLZA 2KQYA 1TWOA 1K90D 1YRUB 2KI6D 3L4AA 1S6JA 1RROA 3BYAA 4GFTA 5I8NA 3D78A 2KLDA 4YI9A 1BOCA 2KNEA 3AAJA 1QASA 1ODBA 1B47A 3BFHA 5D69A 5TNCA 1AP4A 1J1EA 2WC8A 2QEBA 4JPZB 2KLEA 1XFUO 3SG6A 1WDCC 3KF9A 3PM8A 1DTLA 1P28A 2JTZA 3NHTA 5FYXA 3Q8IA 3NSIA 1MF8B 3BOWB 1OQPA 1SL9A 2QEVA 1K95A 1UWOA 2WCKA 2FCDA 4FQTA 2K7DA 1CKKA 4ICBA 3BFBA 5AXIA 3JVTC 1XFXO 2Y1MA 3L4LA 1EG3A 2M29A 4KYNA 1WY9A 2ZFDA 3BQ3A 4MRYA 1G8IA 3CGAA 4DIRA 2LAPA 1QWVA 3B87A 2BKHB 3OB1B 3D0YB 3GOFA 1GM0A 1OMDA 2F3ZA 2I2RE 1UHHA 2M7LA 1LS8A 1PALA 3GK2A 3TS5C 1H4BA 1V1FA 4I5JA 4WQ3A 2KFHA 1CFDA 1AHRA 1BU3A 4U8DA 2F2PA 2L50A 4P5OE 2QEOA 1JFJA 2COLB 2QDIA 3JTDB 4M2PA 3OX6A 2CTNA 1TRFA 3NSOA 4F0ZB 3LL8B 1TNXA 4C0KA 1ZACA 3SS4A 1Y1XA 2ZN9A 1K9KA 4PT1A 1OE9B 2GV5A 4XJKA 3TUYB 3O2PA 2OTGC 2YGUA 2LP3A 2PMYA 1N0YA 1J7QA 1XFWO 1Y6WA 1RECA 3FWCA 3GK4X 3A8RA 1SNLA 3O6BA 1XFRA 4DUQA 1TCOB 2LLUA 1UHIA 1TNQA 2WOSA 2JTTA 4AQIA 2A4JA 2PRUA 1B7TY 1B4CA 2ZRSA 1IRJA 2O5GA 1XK4C 2F3YA 2K7OA 3R1OA 5ER5A 4AOMA 1WRLA 1LA0A 1NP8A 1XK4A 4QJ3B 2VRGA 3MSEB 3V2LA 2FJUB 1XYDA 1MXEA 3HCMA 1TOPA 4CFQA 1YVHA 5JJGA 1AVSA 1OOHA 3VB1A 1F55A 1LA3A 1XFYO 4PCWA 1S6IA 2GTEA 2G9BA 4MZLA 4ZCUA 1C7VA 2LLSA 1LVCD 3CR2A 4JWQA 3FE6A 2SASA 2I7AA 2JOJA 1JFKA 3CLNA 1WRKA 2EC6C 2GGMA 2KBMA 1DMOA 2BBMA 1M45A 4FTGA 3QMEA 2QACA 2EGDA 3I5HC 2M7NA 4I5KA 3SIBA 2HF5A 1SK6D 1DELA 2FJYA 1XA5A 2K7CA 5IBWA 2G2BA 1YR5A 1PSRA 3I5IC 1YURA 3VGOA 1BLQA 4PE4A 3I5FC 1LKJA 1WDCB 5F6TA 2KDHA 2F8PA 1IWQA 4QJ5B 1KCYA 1KWOC 1W9ZA 2MLFC 2H2KA 1AJ5A 3TDUA 2IS9A 2M49B 3NSLA 3SS5A 3WHTB 1DJHA 4R1EA 2BE6A 2ZNEA 4M2OA 4ZCVA 4DS7A 4ETOA 3AAKA 3FIAA 2LLTA 3CYZA 1KFUS 3JVTB 3KEVA 1S5GZ 4DRWA 2DOQA 2M3WA 1CNPA 1YTZC 3BUOB 3VRQA 3NGVA 1S6CA 1D1OA 1QXPA 1S3PA 2JT0A 4L9MA 1C3ZA 3E3RA 2OPOA 1J7RA 2KI4C 3PALA 1QJTA 3TS5B 1DGUA 1CTRA 1X02A 2JPTA 4FQOA 2Y4QA 1Z2CB 3SG5A 2O60A 3FE8A 5FI2A 3EVUA 1DVIA 2K0JA 1VRKA 2PQLA 3FS7A 3FWBA 2L4IA 1KK7Y 2F2OA 4M2QA 2LC5A 3S0FA 2Q91A 2E30A 2JU0A 5DKNA 2CT9A 4OKHA 4MLWA 4A4CA 4BY4A 4MBEA 1ALWA 4XJKB 1EG4A 4YBHB 1T14A 4PE0A 2MRDA 3UO9A 5HL1A 3WXAA 3OX5A 3D10A 1CLLA 1ZMZA 2JXCA 2OTGB 5AERA 5DKQA 4PHKA 1SY9A 4OV2A 3IVTA 2ZN8A 4OCIA 3NSKA 1QIWA 4Q04A 2MJWB 1GQMA 2KAVA 2JQ6A 2JWWA 1W7JB 2F33A 2JNFA 1MR8A 3PATA 3OP0A 3CR4X 3D75A 2JZIA 2LP2A 2K7BA 1MQ1A 2BCXA 4P2YB 4BY5A 1IQ5A 2LM5A 1TIZA 3DVJA 4NQGA 3DY9A 2LV7A 4ORCB 3ZWHA 2JT3A 2LVJA 2H61C 4GUKA 4DCKA 2P6BB 1IJ5A 1QVIZ 2H61A 5GQQC 1L7ZA 3CZ1A 1KK8C 3DD4A 3SS3A 5FI7A 1JBAA 1Z4HA 1NSHA 2ERBA 3PJIA 4JKTA 2EC6B 1A4PA 4CPVA 4OVNF 1FW4A 1CM1A 1SSEB 3I5HB 1CLBA 1C7WA 1FBVA 1LXFC 4YGCB 2WCHA 3DYEA 4C0JA 3EK7A 1NX2A 3EG5B 1QATA 4ORAB 4OZDA 4XYNA 1V1GA 4HSZA 4N1FA 4AQJA 2BL0C 1DGVA 3S0EA 2BECA 1XO5A 2LE9B 3I5IB 2SCPA 3I5FB 4ORBB 1K2HA 2KQ6A 1BT6A 1K96A 1GJYA 1KWOB 2M0RA 5HLOA 1OSAA 1CFFA 3EVRA 3B88A 1DF0A 1NCYA 5BPJA 1OMVA 1NX1A 2KGRA 1JWDA 2WORA 3TZ1A 1EXRA 2KYFA 2MAZA 1ALVA 2L2CA 1YUUA 1DQEA 3I5GC 3LK1A 2BAPA 2LVIA 2Y1NA 4I5LB 1QV1A 3DVMA 1J1DA 1A2XA 2NCPA 3ZNIA 3FE9A 2WC5A 3OHMB 2KI4B 4MZKA 2WC6A 3A4UB 1XFVO 2KPHA 2H8VA 1F8HA 1B8LA 2LNKA 4N5XA 2KSPA 1SL7A 3DZTA 1RTP1 5I2OA 1OZOA 3S0AA 3NHIA 2KGBC 2NLNA 2PSRA 3EKJA 3ICBA 1SCMC 2M8UA 4NDCA 1M63B 1JF2A 2K61A 1OZSA 2CXJA 1UUSA 3OB2B 4GNKB 3BUMB 5KSZA 3WHUB 2CCMA 1SYMA 3PM2A 1WRZA 4UPGA 1GGWA 1YVLA 1K9PA 1JF0A 1NIWA 1UURA 2FOTA 2LVVA 2QEHA 1BMOA 2BNXA 1OOIX 1NX0A 1F4OA 1QS7A 1ZFSA 1DJXA 1A75A 1M31A 2I94A 3EVVA 3KPXA 2L5XB 1SKTA 1YX7A 5CSNA 3OBVA 2PASA 1IG5A 3D77A 1EJ3A 3BFAA 4PHNA 1J7OA 1F4QA 2KBIA 3EK8A 5HKZA 3CZ2A 5DICA 2E6WA 3EK4A 2MHHA 3F45A 1KSMA 1U5IA 1TCFA 1OOGA 3KHEA 4YI8A 1BG1A 3DXLA 1KK8B 1Y0VH 1OW4A 1UHNA 1IIOA 2GGZA 1K9UA 3SG7A 2L98A 1HQVA 5CPVA 4HRGA 5HLVA 4INWA 4PHJA 2CBLA 2KAYA 3PSRA 1RWYA 4YRUA 3SG2A 1S5GY 5AFPA 2BL0B 1ORGA 2JPOA 2M9GA 1NCZA 1QX5B 2WCFA 4WQ2A 5FI6A 1PRWA 3BUXB 1PVBA 1DF0B 3BUWB 3QRXA 4YGDB 4QJ4B 4C0LA 2JC2A 3O78A 5J3XA 2RGIA 4MN0A 1UHKA 3DF0A 3H4SE 1IKUA 4CIDA 1HT9A 1OMRA 1KSOA 1S26D 3I5GB 1CLMA 1TTXA 3D73A 1J7PA 1QX7A 2QPTA 1CDPA 1AK8A 1QV0A 3PLFB 1Q80A 2L2EA 3K1EA 3SJSA 1WLZA 4A4BA 1BR4B 2JULA 2NZ0A 2WCEA 5KU1A 1DEKA 1DJGA 3UNWA 2BBNA 1KQMC 4PDZA 3VRRA 1B1GA 1NX3A 4INXA 1OOJA 4USLA 1TNWA 1DJIA 1J55A 1PSBA 2LHIA 1SCMB 2ISDA 5CSIA 2AUCA 2JNXA 3CR5X 3IQQA 1RFJA 4YGAA 3S0DA 1Y1AA 4GGFC 3VRPA 1AUIB 5I94A 4GGFA 3BUNB 3S0GA 3RM1A 2JRFA 2ZKMX 4D1EA 3TDIA 5EL2A 4HRHA 1FF1A 2KAXA 1AJ4A 2WCMA 3TDZA 1WLMA 5CSJA 2TN4A 3CZ0A 1W7IB 2V53A 4TNCA 4YGEB 4IL1A 2LMVA 1A75B 1SL8A 1QVIY 2OS8C 5JOLA 4HREE 3GK1A 2JT8A 3R72A 3BJHA 1NPQA 1KFXL 1B8CA 4NDDA 3BXKA 1C3YA 1MXLC 1JSAA 5KTYA 4N1GA 2NCOA 3HX4A 2FCEA 1RK9A 1L2OC 2MA2A 2Y5IA 5CSFA 4NDBA 2JXLA 1SPYA 5ER4X 2Q4UA 1SR6C 2L0PA 1YUSA 1F71A 1U5IB 1IGVA 3B86A 4F7FA 2EHBA 5HKWA 1CB1A 3VRNA 2BE4A 5AANA 1BJFA 1R6PA 1UP5A 3DVKA 3N7HA 1NYAA 2BCBA 2LMUA 1N65A 1PULA 1LINA 2P71A 2K2AA 2B1UA 3DVEA 2KHNA 1H8BA 5I2LA 3LCPC 4E68A 1PVAA 1GGZA 2AAOA 3PN7C 2D8NA 1BR1B 3SIAA 4JQ0D 1DJYA 3R1PA 1TN4A 1K8UA 3LLEA 5K89A 4IJ7A 2LANA 1YUTA 1FPWA 2PYQA 3LK0A 2AMIA 1B7TZ 4JD9A 1NUBA 2CNPA 3AKAA 1XVJA 2K2FA 2MLEC 4PALA 3R1VA 3DF0B 1CDNA 1SMGA 1ZUZA 1DC1A 1OOFA 2K8MB 1JUOA 2KYCA 3CZTX 1SRAA 2HETA 5B8IB 1SCVA 2WCBA 4PE7A 1CFPA 1XFZO 1EH2A 1QIVA
chains in the Genus database with same CATH topology
2WCJA 2QEOA 2QDIA 3D75A 3CABA 1ORGA 2JPOA 3L47A 3DY9A 1TUJA 4PT1A 3CZ1A 2ERBA 3PJIA 3D73A 1XFRA 2WCHA 3DYEA 3K1EA 4OZDA 3R1OA 2WCLA 3S0EA 3V2LA 3B7AA 3B6XA 4INXA 1OOHA 3CDNA 3VB1A 3B88A 2GTEA 3S0DA 3D74A 3D76A 3FE6A 2L2CA 3S0GA 1DQEA 3QMEA 5EL2A 2WCMA 3FE9A 3CZ0A 2WC5A 2FJYA 2WC6A 2KPHA 2H8VA 3R72A 3BJHA 3S0BA 3DZTA 1C3YA 3OGNA 3NHIA 3S0AA 3RZSA 1TWOA 3L4AA 3CYZA 3B86A 4F7FA 3NGVA 3D78A 1C3ZA 3N7HA 2QEHA 3BFHA 2P71A 2QEBA 1OOIX 1P28A 3FE8A 3NHTA 3Q8IA 2PQLA 3D77A 2QEVA 3BFAA 3S0FA 3R1PA 2WCKA 4FQTA 3CZ2A 5DICA 3BFBA 4JD9A 3L4LA 1T14A 3R1VA 1OOGA 3DXLA 1QWVA 3B87A 1OW4A 1OOFA 1GM0A 1LS8A 4INWA 2P70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCJ A;  2QEO A;  2QDI A;  3D75 A;  3CAB A;  1ORG A;  2JPO A;  3L47 A;  3DY9 A;  1TUJ A;  4PT1 A;  3CZ1 A;  2ERB A;  3PJI A;  3D73 A;  1XFR A;  2WCH A;  3DYE A;  3K1E A;  4OZD A;  3R1O A;  2WCL A;  3S0E A;  3V2L A;  3B7A A;  3B6X A;  4INX A;  1OOH A;  3CDN A;  3VB1 A;  3B88 A;  2GTE A;  3S0D A;  3D74 A;  3D76 A;  3FE6 A;  2L2C A;  3S0G A;  1DQE A;  3QME A;  5EL2 A;  2WCM A;  3FE9 A;  3CZ0 A;  2WC5 A;  2FJY A;  2WC6 A;  2KPH A;  2H8V A;  3R72 A;  3BJH A;  3S0B A;  3DZT A;  1C3Y A;  3OGN A;  3NHI A;  3S0A A;  3RZS A;  1TWO A;  3L4A A;  3CYZ A;  3B86 A;  4F7F A;  3NGV A;  3D78 A;  1C3Z A;  3N7H A;  2QEH A;  3BFH A;  2P71 A;  2QEB A;  1OOI X;  1P28 A;  3FE8 A;  3NHT A;  3Q8I A;  2PQL A;  3D77 A;  2QEV A;  3BFA A;  3S0F A;  3R1P A;  2WCK A;  4FQT A;  3CZ2 A;  5DIC A;  3BFB A;  4JD9 A;  3L4L A;  1T14 A;  3R1V A;  1OOG A;  3DXL A;  1QWV A;  3B87 A;  1OW4 A;  1OOF A;  1GM0 A;  1LS8 A;  4INW A;  2P70 A; 
#chains in the Genus database with same CATH topology
 2LUC A;  2LUX A;  2WCJ A;  2WND A;  3NXA A;  1S1E A;  1PK0 D;  3O4Y A;  2ZND A;  1G33 A;  3C1V A;  2PVB A;  1MUX A;  1YX8 A;  3CAB A;  3IQO A;  1G4Y R;  4PHM A;  4WRI A;  3BOW A;  4I5N B;  4OR9 B;  4GBA A;  3KO0 A;  2M97 A;  4YGB B;  4PE1 A;  3L47 A;  1NCX A;  3IF7 A;  1FI5 A;  1KQM B;  2KOT A;  1TUJ A;  1UHJ A;  5D3O A;  1K94 A;  2LHL A;  4MSP A;  1KQV A;  3VRO A;  2L5Y A;  1JC2 A;  1NWD A;  3EKH A;  1ZOT B;  3D0Y A;  2HQ8 A;  1QLS A;  5DKR A;  4MVF A;  2KFG A;  3M0W A;  5I2Q A;  2HPS A;  1IQ3 A;  3JTD C;  1QLK A;  1FI6 A;  1CM4 A;  3CTN A;  1DJW A;  5HYD A;  3CS1 A;  4MEW A;  2ZRT A;  1CMF A;  4GAO A;  2WCL A;  1SBJ A;  1Y1U A;  1F54 A;  2OS8 B;  1E8A A;  3B7A A;  1DT7 B;  1CDM A;  1A03 A;  3B6X A;  2M1U A;  2PAL A;  2HQW A;  3CDN A;  1F70 A;  1BOD A;  3TUY C;  1S36 A;  2KFF A;  1L2O B;  3SG4 A;  2NXQ A;  1A29 A;  5D7F A;  2KI6 C;  1MHO A;  3CWG A;  3D74 A;  3D76 A;  3K21 A;  4MRX A;  2MBX A;  4CLN A;  1TNP A;  1B9A A;  1SR6 B;  2LCP A;  4CFR A;  1M39 A;  1SW8 A;  3AKB A;  1CFC A;  1TUZ A;  2M1K B;  2P70 A;  1KK7 Z;  2I18 A;  1B8R A;  1CMG A;  1C07 A;  1IJ6 A;  1QTX A;  4GPL B;  2LMT A;  5AEQ A;  1N2D A;  2K60 A;  2LVK A;  5G08 A;  1MWN A;  1DJZ A;  1K93 D;  3SG3 A;  1QX2 A;  5HKY A;  1BF5 A;  2R2I A;  2L51 A;  4MZJ A;  1CDL A;  1YRT B;  4GGN A;  1RJV A;  3S0B A;  3O4X A;  2L4H A;  3WNX B;  3OGN A;  1M46 A;  3PN7 B;  5PAL A;  1R2U A;  3PFV A;  1IH0 A;  1KFX S;  3RZS A;  1KFU L;  2BKI B;  1EL4 A;  2BCA A;  3RLZ A;  2KQY A;  1TWO A;  1K90 D;  1YRU B;  2KI6 D;  3L4A A;  1S6J A;  1RRO A;  3BYA A;  4GFT A;  5I8N A;  3D78 A;  2KLD A;  4YI9 A;  1BOC A;  2KNE A;  3AAJ A;  1QAS A;  1ODB A;  1B47 A;  3BFH A;  5D69 A;  5TNC A;  1AP4 A;  1J1E A;  2WC8 A;  2QEB A;  4JPZ B;  2KLE A;  1XFU O;  3SG6 A;  1WDC C;  3KF9 A;  3PM8 A;  1DTL A;  1P28 A;  2JTZ A;  3NHT A;  5FYX A;  3Q8I A;  3NSI A;  1MF8 B;  3BOW B;  1OQP A;  1SL9 A;  2QEV A;  1K95 A;  1UWO A;  2WCK A;  2FCD A;  4FQT A;  2K7D A;  1CKK A;  4ICB A;  3BFB A;  5AXI A;  3JVT C;  1XFX O;  2Y1M A;  3L4L A;  1EG3 A;  2M29 A;  4KYN A;  1WY9 A;  2ZFD A;  3BQ3 A;  4MRY A;  1G8I A;  3CGA A;  4DIR A;  2LAP A;  1QWV A;  3B87 A;  2BKH B;  3OB1 B;  3D0Y B;  3GOF A;  1GM0 A;  1OMD A;  2F3Z A;  2I2R E;  1UHH A;  2M7L A;  1LS8 A;  1PAL A;  3GK2 A;  3TS5 C;  1H4B A;  1V1F A;  4I5J A;  4WQ3 A;  2KFH A;  1CFD A;  1AHR A;  1BU3 A;  4U8D A;  2F2P A;  2L50 A;  4P5O E;  2QEO A;  1JFJ A;  2COL B;  2QDI A;  3JTD B;  4M2P A;  3OX6 A;  2CTN A;  1TRF A;  3NSO A;  4F0Z B;  3LL8 B;  1TNX A;  4C0K A;  1ZAC A;  3SS4 A;  1Y1X A;  2ZN9 A;  1K9K A;  4PT1 A;  1OE9 B;  2GV5 A;  4XJK A;  3TUY B;  3O2P A;  2OTG C;  2YGU A;  2LP3 A;  2PMY A;  1N0Y A;  1J7Q A;  1XFW O;  1Y6W A;  1REC A;  3FWC A;  3GK4 X;  3A8R A;  1SNL A;  3O6B A;  1XFR A;  4DUQ A;  1TCO B;  2LLU A;  1UHI A;  1TNQ A;  2WOS A;  2JTT A;  4AQI A;  2A4J A;  2PRU A;  1B7T Y;  1B4C A;  2ZRS A;  1IRJ A;  2O5G A;  1XK4 C;  2F3Y A;  2K7O A;  3R1O A;  5ER5 A;  4AOM A;  1WRL A;  1LA0 A;  1NP8 A;  1XK4 A;  4QJ3 B;  2VRG A;  3MSE B;  3V2L A;  2FJU B;  1XYD A;  1MXE A;  3HCM A;  1TOP A;  4CFQ A;  1YVH A;  5JJG A;  1AVS A;  1OOH A;  3VB1 A;  1F55 A;  1LA3 A;  1XFY O;  4PCW A;  1S6I A;  2GTE A;  2G9B A;  4MZL A;  4ZCU A;  1C7V A;  2LLS A;  1LVC D;  3CR2 A;  4JWQ A;  3FE6 A;  2SAS A;  2I7A A;  2JOJ A;  1JFK A;  3CLN A;  1WRK A;  2EC6 C;  2GGM A;  2KBM A;  1DMO A;  2BBM A;  1M45 A;  4FTG A;  3QME A;  2QAC A;  2EGD A;  3I5H C;  2M7N A;  4I5K A;  3SIB A;  2HF5 A;  1SK6 D;  1DEL A;  2FJY A;  1XA5 A;  2K7C A;  5IBW A;  2G2B A;  1YR5 A;  1PSR A;  3I5I C;  1YUR A;  3VGO A;  1BLQ A;  4PE4 A;  3I5F C;  1LKJ A;  1WDC B;  5F6T A;  2KDH A;  2F8P A;  1IWQ A;  4QJ5 B;  1KCY A;  1KWO C;  1W9Z A;  2MLF C;  2H2K A;  1AJ5 A;  3TDU A;  2IS9 A;  2M49 B;  3NSL A;  3SS5 A;  3WHT B;  1DJH A;  4R1E A;  2BE6 A;  2ZNE A;  4M2O A;  4ZCV A;  4DS7 A;  4ETO A;  3AAK A;  3FIA A;  2LLT A;  3CYZ A;  1KFU S;  3JVT B;  3KEV A;  1S5G Z;  4DRW A;  2DOQ A;  2M3W A;  1CNP A;  1YTZ C;  3BUO B;  3VRQ A;  3NGV A;  1S6C A;  1D1O A;  1QXP A;  1S3P A;  2JT0 A;  4L9M A;  1C3Z A;  3E3R A;  2OPO A;  1J7R A;  2KI4 C;  3PAL A;  1QJT A;  3TS5 B;  1DGU A;  1CTR A;  1X02 A;  2JPT A;  4FQO A;  2Y4Q A;  1Z2C B;  3SG5 A;  2O60 A;  3FE8 A;  5FI2 A;  3EVU A;  1DVI A;  2K0J A;  1VRK A;  2PQL A;  3FS7 A;  3FWB A;  2L4I A;  1KK7 Y;  2F2O A;  4M2Q A;  2LC5 A;  3S0F A;  2Q91 A;  2E30 A;  2JU0 A;  5DKN A;  2CT9 A;  4OKH A;  4MLW A;  4A4C A;  4BY4 A;  4MBE A;  1ALW A;  4XJK B;  1EG4 A;  4YBH B;  1T14 A;  4PE0 A;  2MRD A;  3UO9 A;  5HL1 A;  3WXA A;  3OX5 A;  3D10 A;  1CLL A;  1ZMZ A;  2JXC A;  2OTG B;  5AER A;  5DKQ A;  4PHK A;  1SY9 A;  4OV2 A;  3IVT A;  2ZN8 A;  4OCI A;  3NSK A;  1QIW A;  4Q04 A;  2MJW B;  1GQM A;  2KAV A;  2JQ6 A;  2JWW A;  1W7J B;  2F33 A;  2JNF A;  1MR8 A;  3PAT A;  3OP0 A;  3CR4 X;  3D75 A;  2JZI A;  2LP2 A;  2K7B A;  1MQ1 A;  2BCX A;  4P2Y B;  4BY5 A;  1IQ5 A;  2LM5 A;  1TIZ A;  3DVJ A;  4NQG A;  3DY9 A;  2LV7 A;  4ORC B;  3ZWH A;  2JT3 A;  2LVJ A;  2H61 C;  4GUK A;  4DCK A;  2P6B B;  1IJ5 A;  1QVI Z;  2H61 A;  5GQQ C;  1L7Z A;  3CZ1 A;  1KK8 C;  3DD4 A;  3SS3 A;  5FI7 A;  1JBA A;  1Z4H A;  1NSH A;  2ERB A;  3PJI A;  4JKT A;  2EC6 B;  1A4P A;  4CPV A;  4OVN F;  1FW4 A;  1CM1 A;  1SSE B;  3I5H B;  1CLB A;  1C7W A;  1FBV A;  1LXF C;  4YGC B;  2WCH A;  3DYE A;  4C0J A;  3EK7 A;  1NX2 A;  3EG5 B;  1QAT A;  4ORA B;  4OZD A;  4XYN A;  1V1G A;  4HSZ A;  4N1F A;  4AQJ A;  2BL0 C;  1DGV A;  3S0E A;  2BEC A;  1XO5 A;  2LE9 B;  3I5I B;  2SCP A;  3I5F B;  4ORB B;  1K2H A;  2KQ6 A;  1BT6 A;  1K96 A;  1GJY A;  1KWO B;  2M0R A;  5HLO A;  1OSA A;  1CFF A;  3EVR A;  3B88 A;  1DF0 A;  1NCY A;  5BPJ A;  1OMV A;  1NX1 A;  2KGR A;  1JWD A;  2WOR A;  3TZ1 A;  1EXR A;  2KYF A;  2MAZ A;  1ALV A;  2L2C A;  1YUU A;  1DQE A;  3I5G C;  3LK1 A;  2BAP A;  2LVI A;  2Y1N A;  4I5L B;  1QV1 A;  3DVM A;  1J1D A;  1A2X A;  2NCP A;  3ZNI A;  3FE9 A;  2WC5 A;  3OHM B;  2KI4 B;  4MZK A;  2WC6 A;  3A4U B;  1XFV O;  2KPH A;  2H8V A;  1F8H A;  1B8L A;  2LNK A;  4N5X A;  2KSP A;  1SL7 A;  3DZT A;  1RTP 1;  5I2O A;  1OZO A;  3S0A A;  3NHI A;  2KGB C;  2NLN A;  2PSR A;  3EKJ A;  3ICB A;  1SCM C;  2M8U A;  4NDC A;  1M63 B;  1JF2 A;  2K61 A;  1OZS A;  2CXJ A;  1UUS A;  3OB2 B;  4GNK B;  3BUM B;  5KSZ A;  3WHU B;  2CCM A;  1SYM A;  3PM2 A;  1WRZ A;  4UPG A;  1GGW A;  1YVL A;  1K9P A;  1JF0 A;  1NIW A;  1UUR A;  2FOT A;  2LVV A;  2QEH A;  1BMO A;  2BNX A;  1OOI X;  1NX0 A;  1F4O A;  1QS7 A;  1ZFS A;  1DJX A;  1A75 A;  1M31 A;  2I94 A;  3EVV A;  3KPX A;  2L5X B;  1SKT A;  1YX7 A;  5CSN A;  3OBV A;  2PAS A;  1IG5 A;  3D77 A;  1EJ3 A;  3BFA A;  4PHN A;  1J7O A;  1F4Q A;  2KBI A;  3EK8 A;  5HKZ A;  3CZ2 A;  5DIC A;  2E6W A;  3EK4 A;  2MHH A;  3F45 A;  1KSM A;  1U5I A;  1TCF A;  1OOG A;  3KHE A;  4YI8 A;  1BG1 A;  3DXL A;  1KK8 B;  1Y0V H;  1OW4 A;  1UHN A;  1IIO A;  2GGZ A;  1K9U A;  3SG7 A;  2L98 A;  1HQV A;  5CPV A;  4HRG A;  5HLV A;  4INW A;  4PHJ A;  2CBL A;  2KAY A;  3PSR A;  1RWY A;  4YRU A;  3SG2 A;  1S5G Y;  5AFP A;  2BL0 B;  1ORG A;  2JPO A;  2M9G A;  1NCZ A;  1QX5 B;  2WCF A;  4WQ2 A;  5FI6 A;  1PRW A;  3BUX B;  1PVB A;  1DF0 B;  3BUW B;  3QRX A;  4YGD B;  4QJ4 B;  4C0L A;  2JC2 A;  3O78 A;  5J3X A;  2RGI A;  4MN0 A;  1UHK A;  3DF0 A;  3H4S E;  1IKU A;  4CID A;  1HT9 A;  1OMR A;  1KSO A;  1S26 D;  3I5G B;  1CLM A;  1TTX A;  3D73 A;  1J7P A;  1QX7 A;  2QPT A;  1CDP A;  1AK8 A;  1QV0 A;  3PLF B;  1Q80 A;  2L2E A;  3K1E A;  3SJS A;  1WLZ A;  4A4B A;  1BR4 B;  2JUL A;  2NZ0 A;  2WCE A;  5KU1 A;  1DEK A;  1DJG A;  3UNW A;  2BBN A;  1KQM C;  4PDZ A;  3VRR A;  1B1G A;  1NX3 A;  4INX A;  1OOJ A;  4USL A;  1TNW A;  1DJI A;  1J55 A;  1PSB A;  2LHI A;  1SCM B;  2ISD A;  5CSI A;  2AUC A;  2JNX A;  3CR5 X;  3IQQ A;  1RFJ A;  4YGA A;  3S0D A;  1Y1A A;  4GGF C;  3VRP A;  1AUI B;  5I94 A;  4GGF A;  3BUN B;  3S0G A;  3RM1 A;  2JRF A;  2ZKM X;  4D1E A;  3TDI A;  5EL2 A;  4HRH A;  1FF1 A;  2KAX A;  1AJ4 A;  2WCM A;  3TDZ A;  1WLM A;  5CSJ A;  2TN4 A;  3CZ0 A;  1W7I B;  2V53 A;  4TNC A;  4YGE B;  4IL1 A;  2LMV A;  1A75 B;  1SL8 A;  1QVI Y;  2OS8 C;  5JOL A;  4HRE E;  3GK1 A;  2JT8 A;  3R72 A;  3BJH A;  1NPQ A;  1KFX L;  1B8C A;  4NDD A;  3BXK A;  1C3Y A;  1MXL C;  1JSA A;  5KTY A;  4N1G A;  2NCO A;  3HX4 A;  2FCE A;  1RK9 A;  1L2O C;  2MA2 A;  2Y5I A;  5CSF A;  4NDB A;  2JXL A;  1SPY A;  5ER4 X;  2Q4U A;  1SR6 C;  2L0P A;  1YUS A;  1F71 A;  1U5I B;  1IGV A;  3B86 A;  4F7F A;  2EHB A;  5HKW A;  1CB1 A;  3VRN A;  2BE4 A;  5AAN A;  1BJF A;  1R6P A;  1UP5 A;  3DVK A;  3N7H A;  1NYA A;  2BCB A;  2LMU A;  1N65 A;  1PUL A;  1LIN A;  2P71 A;  2K2A A;  2B1U A;  3DVE A;  2KHN A;  1H8B A;  5I2L A;  3LCP C;  4E68 A;  1PVA A;  1GGZ A;  2AAO A;  3PN7 C;  2D8N A;  1BR1 B;  3SIA A;  4JQ0 D;  1DJY A;  3R1P A;  1TN4 A;  1K8U A;  3LLE A;  5K89 A;  4IJ7 A;  2LAN A;  1YUT A;  1FPW A;  2PYQ A;  3LK0 A;  2AMI A;  1B7T Z;  4JD9 A;  1NUB A;  2CNP A;  3AKA A;  1XVJ A;  2K2F A;  2MLE C;  4PAL A;  3R1V A;  3DF0 B;  1CDN A;  1SMG A;  1ZUZ A;  1DC1 A;  1OOF A;  2K8M B;  1JUO A;  2KYC A;  3CZT X;  1SRA A;  2HET A;  5B8I B;  1SCV A;  2WCB A;  4PE7 A;  1CFP A;  1XFZ O;  1EH2 A;  1QIV A; 
#chains in the Genus database with same CATH homology
 2WCJ A;  2QEO A;  2QDI A;  3D75 A;  3CAB A;  1ORG A;  2JPO A;  3L47 A;  3DY9 A;  1TUJ A;  4PT1 A;  3CZ1 A;  2ERB A;  3PJI A;  3D73 A;  1XFR A;  2WCH A;  3DYE A;  3K1E A;  4OZD A;  3R1O A;  2WCL A;  3S0E A;  3V2L A;  3B7A A;  3B6X A;  4INX A;  1OOH A;  3CDN A;  3VB1 A;  3B88 A;  2GTE A;  3S0D A;  3D74 A;  3D76 A;  3FE6 A;  2L2C A;  3S0G A;  1DQE A;  3QME A;  5EL2 A;  2WCM A;  3FE9 A;  3CZ0 A;  2WC5 A;  2FJY A;  2WC6 A;  2KPH A;  2H8V A;  3R72 A;  3BJH A;  3S0B A;  3DZT A;  1C3Y A;  3OGN A;  3NHI A;  3S0A A;  3RZS A;  1TWO A;  3L4A A;  3CYZ A;  3B86 A;  4F7F A;  3NGV A;  3D78 A;  1C3Z A;  3N7H A;  2QEH A;  3BFH A;  2P71 A;  2QEB A;  1OOI X;  1P28 A;  3FE8 A;  3NHT A;  3Q8I A;  2PQL A;  3D77 A;  2QEV A;  3BFA A;  3S0F A;  3R1P A;  2WCK A;  4FQT A;  3CZ2 A;  5DIC A;  3BFB A;  4JD9 A;  3L4L A;  1T14 A;  3R1V A;  1OOG A;  3DXL A;  1QWV A;  3B87 A;  1OW4 A;  1OOF A;  1GM0 A;  1LS8 A;  4INW A;  2P70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...