1XFWO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin and 3'5' cyclic amp (camp)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
molecule keywords Calmodulin-sensitive adenylate cyclase
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
total genus 34
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfwO02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfwO01
1CLLA 1J1DA 1WRZA 1A75A 3LL8B 1F4QA 1XO5A 1IQ5A 2L51A 2G9BA 1KSOA 4GNKB 4YI9A 3I5HC 4N1FA 2CCMA 2ZN8A 1CFCA 2HF5A 1CFFA 1YR5A 1KQMB 1FI5A 3M0WA 3AKBA 1CM4A 1MXLC 1N2DA 1LA3A 2K7DA 1YUTA 2D8NA 1NCZA 1SCMC 3H4SE 1SCMB 1PVAA 2H2KA 2JNXA 1NPQA 2OS8C 4OV2A 2OS8B 1IKUA 1RWYA 2FCDA 1AP4A 1ZFSA 1PULA 2BECA 3O4YA 1M45A 2KDHA 2HQ8A 4NDDA 1Y6WA 2K2AA 4U8DA 2G2BA 1AK8A 5AEQA 3BUMB 1M46A 1DVIA 1TNQA 1TCOB 4MRYA 4YGCB 1E8AA 5KU1A 1HQVA 4C0JA 1JF0A 2JC2A 3OX5A 1TRFA 3WNXB 1MUXA 1B4CA 2COLB 3TZ1A 2JU0A 1DJWA 4ORBB 1F55A 2BCXA 3VRNA 1ZUZA 4DRWA 2EGDA 4PE1A 1SL7A 1CTRA 3EVUA 5F6TA 2LP3A 1NCYA 1MWNA 3C1VA 1RECA 1AJ4A 3SG4A 2QACA 2JQ6A 2KI6C 1NX3A 1S6JA 2L0PA 2HETA 1V1FA 3HX4A 1K90D 2JTTA 3JTDC 4MZLA 2P6BB 4MSPA 1QV0A 2K7BA 5CSFA 2M7LA 1UHHA 2NCOA 1CNPA 3DF0B 4GPLB 3GK4X 1DJIA 1DJXA 1X02A 2JWWA 4CFQA 1B9AA 1CDLA 1IJ5A 2SASA 3DVKA 1AUIB 3CR5X 5CSIA 2JXCA 1JFKA 4N5XA 3PLFB 5KTYA 3DF0A 1BMOA 1V1GA 1S5GZ 2WCFA 4OKHA 4CFRA 4PDZA 2ZRTA 5AXIA 1NX2A 5DKRA 4C0KA 1ALVA 1SK6D 2Y4QA 2ISDA 2L98A 1PVBA 1FI6A 3EVVA 4PE7A 1S6IA 1YTZC 2LVJA 4QJ3B 2OPOA 3K21A 3CTNA 2FCEA 4QJ4B 1QIWA 1XA5A 2KFGA 3LCPC 3IQOA 2OTGC 5G08A 2OTGB 1B1GA 1J7PA 2PRUA 1JSAA 1BU3A 1DJZA 1MQ1A 1B7TZ 4DIRA 1A03A 1EG3A 4XYNA 1FW4A 5CPVA 1CM1A 1KWOB 3SG3A 3EKJA 3FWBA 2KGBC 3I5GC 2WC8A 3I5IC 1J7OA 1QVIZ 3LK1A 1WDCB 2JXLA 1QXPA 2JTZA 4BY5A 3GK1A 3FIAA 4P5OE 2JOJA 1VRKA 2K2FA 2PMYA 1BLQA 2FJUB 2WCEA 4GFTA 1QATA 3PM8A 2KAXA 3OX6A 4PHKA 2AMIA 1SCVA 2WOSA 2L4IA 3LLEA 1IRJA 4NDBA 1J7QA 5BPJA 1QJTA 1SL9A 3A8RA 3DVEA 1RFJA 4GUKA 1BR1B 4NDCA 3TUYC 3TUYB 5K89A 3SG2A 3BXKA 3VRQA 3BOWB 3RM1A 4OCIA 2K7CA 1OMDA 1Y1AA 2KFFA 3VGOA 2LUXA 2JULA 2LC5A 1Q80A 1KQMC 5D7FA 2MJWB 4WQ2A 5CSNA 1BG1A 1KFUL 3SG7A 1C7WA 1YRTB 1RJVA 2WCBA 1CDPA 2MLFC 1SBJA 2LMVA 2KGRA 1PK0D 1JUOA 1M63B 3WHTB 1K96A 1KFXL 5DKQA 1DTLA 3BOWA 1L7ZA 2F2PA 2KI4B 2LVVA 5I2LA 5HKZA 3IF7A 1YUUA 4PE0A 1C07A 1KQVA 3LK0A 1WRLA 1RROA 4N1GA 1JC2A 3SG5A 1K9KA 2JT0A 2K8MB 1PSBA 1OMRA 3BQ3A 1K9UA 3JVTB 2BBNA 1LKJA 1IQ3A 2K7OA 3DD4A 4MLWA 2BKHB 4TNCA 2M49B 2M3WA 2KOTA 2Y1NA 5I2OA 1BOCA 2KBMA 1QASA 1OZOA 3CR2A 2L2EA 3PATA 2LV7A 2SCPA 1BJFA 1UP5A 1XFZO 2LLSA 1CKKA 1RK9A 2LM5A 2LE9B 3WXAA 4I5NB 2JT8A 2ZN9A 2BE6A 4PCWA 1FBVA 1R2UA 1OQPA 4YGAA 4CPVA 4YRUA 1D1OA 2M8UA 2LP2A 1WY9A 1EL4A 1F4OA 1RTP1 4AQIA 1Y1UA 1A2XA 2JZIA 2L5XB 4ETOA 4L9MA 4JWQA 4YBHB 2MLEC 1OSAA 2H61A 2M0RA 2V53A 3KEVA 1BF5A 3PSRA 2GGZA 2NLNA 4F0ZB 4NQGA 2KQYA 1BT6A 1YX7A 1SYMA 1UURA 2BCBA 1A29A 1BR4B 3NSKA 3ZNIA 1EH2A 1XFUO 3D0YB 4ZCVA 1QTXA 1ZOTB 1CDNA 2PVBA 1CMGA 3O78A 1GQMA 1W7JB 4PALA 4PHNA 4ORAB 1NX1A 2KFHA 3BYAA 2PSRA 1MR8A 3E3RA 3AAJA 4HREE 5HLOA 1MXEA 2L50A 4M2OA 4MZJA 1JBAA 3F45A 1K93D 1B8LA 4USLA 4YI8A 3SIAA 2F2OA 1FPWA 1B8RA 2BCAA 3D0YA 1LINA 2JNFA 4OR9B 3BUOB 4CIDA 1QS7A 4YGDB 1WLZA 5AFPA 1A4PA 3NSIA 1XFVO 1NIWA 4WRIA 5CSJA 1W7IB 2K61A 2MBXA 2EHBA 1H4BA 2M9GA 1KSMA 5ER5A 2CT9A 2ZNDA 1U5IB 3KHEA 3ZWHA 1KK8C 1TNXA 2RGIA 1KK8B 1CLMA 3EVRA 4AOMA 3BUXB 3QRXA 1XFXO 3PALA 2F3YA 1M39A 1QX5B 2Q91A 4AQJA 4D1EA 1ODBA 2KAVA 1S5GY 2KBIA 1F54A 1KWOC 1G33A 1KK7Y 2BL0B 2NXQA 1QIVA 2DOQA 1XK4A 3BUNB 1U5IA 5D69A 2MAZA 3CLNA 1YVLA 1WRKA 1TNPA 4I5LB 1WDCC 2MHHA 2TN4A 3DVJA 3EK8A 1KFUS 2LANA 1SMGA 1SNLA 3MSEB 3TDZA 4ICBA 5PALA 4XJKB 4A4CA 1KFXS 4PHJA 2M1KB 1NSHA 2EC6C 3TS5C 2EC6B 3SG6A 3TS5B 3A4UB 4HRHA 3EK7A 1TNWA 5TNCA 5J3XA 1DT7B 2CBLA 4FTGA 1UHIA 3OB2B 2CTNA 3PN7B 1IJ6A 1UHKA 2R2IA 1DMOA 5HKYA 1R6PA 4UPGA 5JOLA 1L2OC 3RLZA 1IWQA 1L2OB 4XJKA 1S36A 4MRXA 1MF8B 4GBAA 3CZTX 2LCPA 1K8UA 1XYDA 2PALA 5AERA 1YX8A 4R1EA 2O60A 4YGBB 2KI6D 5I2QA 4ZCUA 2NCPA 5FYXA 2F8PA 1OOJA 4MN0A 3NSLA 2KI4C 2I18A 4GGFC 2LHLA 3DVMA 2M1UA 1J7RA 2ZFDA 1TOPA 3WHUB 1F71A 1K95A 3I5HB 3TDUA 3JVTC 1HT9A 2Y5IA 4HSZA 4CLNA 1SW8A 4M2QA 3KF9A 1F70A 4PE4A 1GGWA 2CXJA 1XFYO 3GK2A 3CR4X 1SY9A 3PFVA 2JPTA 4GGFA 4PHMA 1C7VA 2H61C 2GGMA 1G8IA 1S3PA 1JFJA 1H8BA 3HCMA 4BY4A 3FWCA 2L4HA 1TTXA 1M31A 3NSOA 4GGNA 2CNPA 2KYFA 4MZKA 2BE4A 1PALA 5HLVA 5KSZA 1BODA 1SL8A 1NCXA 1J1EA 2LVIA 3TDIA 4JQ0D 1TN4A 1CFPA 1WLMA 3CGAA 1IG5A 2F3ZA 1SKTA 3VRPA 3ICBA 1XFWO 5GQQC 1N65A 2BBMA 1Y0VH 4DS7A 1DF0B 4MVFA 2KYCA 2BKIB 3IQQA 1TIZA 4IL1A 4I5KA 1K94A 3EKHA 1YVHA 2JRFA 2ZRSA 5HKWA 4FQOA 2O5GA 4JPZB 2A4JA 1CFDA 1CDMA 1UHNA 2HQWA 2LUCA 1SPYA 2I2RE 3OP0A 2LNKA 1QLKA 1LA0A 2LAPA 3FS7A 1UHJA 3VROA 2LMUA 1AVSA 1MHOA 4WQ3A 4HRGA 1DF0A 2LHIA 1K9PA 2HPSA 1FF1A 1YRUB 1LXFC 1KCYA 5DKNA 3O6BA 3O2PA 2I94A 2LVKA 3JTDB 1UUSA 2I7AA 4C0LA 1XVJA 1QX2A 3D10A 1XK4C 5HYDA 1TCFA 2WNDA 4DCKA 1JF2A 1NUBA 3EK4A 2K0JA 2QPTA 2NZ0A 3CS1A 1JWDA 2AUCA 5IBWA 1OMVA 2KNEA 4OVNF 2Q4UA 2IS9A 1YUSA 2KAYA 2LLTA 1DGVA 1S26D 2KQ6A 3KPXA 1QV1A 1ZACA 1CLBA 1YURA 2BL0C 2AAOA 4DUQA 5JJGA 1SRAA 4E68A 3AAKA 1KK7Z 3I5FC 3I5FB 1EG4A 1DGUA 1LVCD 2FOTA 2LMTA 1F8HA 1DJGA 1K2HA 4MEWA 1NWDA 2PASA 4Q04A 3SIBA 1OZSA 4M2PA 1S6CA 3KO0A 1AJ5A 1B8CA 1NX0A 1S1EA 1QX7A 2E6WA 2GV5A 2ZNEA 4I5JA 5ER4X 5I8NA 1B47A 2KSPA 1DJHA 3CWGA 1J55A 3OHMB 1GJYA 5B8IB 2F33A 1B7TY 4A4BA 1OE9B 5AANA 1PSRA 1QLSA 3NXAA 1NYAA 2M97A 2M29A 1EJ3A 1AHRA 1NP8A 2MRDA 1DJYA 1GGZA 1Y1XA 2LLUA 2M7NA 2Y1MA 3GOFA 3I5GB 3PN7C 3AKAA 3OB1B 4QJ5B 1N0YA 2MA2A 3VRRA 1QVIY 1CMFA 1IH0A 4YGEB 3I5IB 1ALWA 1PRWA 3SJSA 1A75B 4ORCB 1G4YR 2E30A 1SR6C 1EXRA 2JT3A 1SR6B 1ZMZA 3BUWB 2ZKMX 1CB1A 4GAOA 4MBEA 2KHNA 4P2YB 2B1UA 2VRGA 1IGVA 2WORA 1UWOA
chains in the Genus database with same CATH superfamily
1CLLA 1J1DA 3FE8A 1WRZA 1A75A 3LL8B 1F4QA 1XO5A 1IQ5A 2L51A 2G9BA 1KSOA 3SS3A 4GNKB 4YI9A 3I5HC 4N1FA 2CCMA 2BNXA 2ZN8A 2HF5A 1CFCA 1CFFA 1YR5A 1KQMB 4INWA 2WC5A 1FI5A 3M0WA 3AKBA 1CM4A 1MXLC 1N2DA 1LA3A 2K7DA 1YUTA 2D8NA 1NCZA 1SCMC 3H4SE 1SCMB 1PVAA 2H2KA 3L4AA 3QMEA 2JNXA 1NPQA 2BAPA 2OS8C 4OV2A 2OS8B 1IKUA 1RWYA 2FCDA 1AP4A 1ZFSA 1PULA 2BECA 1OOIX 3Q8IA 3O4YA 1M45A 2KDHA 2HQ8A 2QEBA 2WCMA 4NDDA 1Y6WA 3S0GA 3S0FA 2K2AA 3EG5B 4U8DA 2G2BA 1AK8A 5FI6A 5AEQA 3BUMB 1M46A 1DVIA 1TNQA 1TCOB 4MRYA 4YGCB 1E8AA 5FI7A 5KU1A 1HQVA 4C0JA 1JF0A 2JC2A 3OX5A 3VB1A 1TRFA 3WNXB 1MUXA 1B4CA 2COLB 3TZ1A 2JU0A 1DJWA 4ORBB 1F55A 2BCXA 3UNWA 3VRNA 3S0EA 1ZUZA 4DRWA 2EGDA 4PE1A 1SL7A 1CTRA 3EVUA 5F6TA 2LP3A 1NCYA 3O4XA 2WCLA 1MWNA 3C1VA 3CDNA 1RECA 1AJ4A 3SG4A 2QACA 2JQ6A 2KI6C 1NX3A 3PM2A 1S6JA 2L0PA 2HETA 1V1FA 3HX4A 1K90D 2JTTA 3JTDC 4MZLA 2P6BB 4MSPA 1QV0A 2K7BA 5CSFA 2M7LA 1UHHA 2PQLA 2NCOA 1CNPA 3DF0B 4GPLB 3GK4X 1DJIA 1DJXA 1X02A 2JWWA 3L4LA 4CFQA 1B9AA 1CDLA 1IJ5A 2SASA 5DICA 3DVKA 1AUIB 3CR5X 3N7HA 5CSIA 2JXCA 1JFKA 4N5XA 2QDIA 3PLFB 4JD9A 5KTYA 3CYZA 3FE6A 3DF0A 3DY9A 1BMOA 1V1GA 1S5GZ 2WCFA 4OKHA 4CFRA 4PDZA 2ZRTA 5AXIA 1OOHA 1NX2A 5DKRA 4C0KA 1ALVA 1SK6D 2Y4QA 3B6XA 2L98A 1PVBA 2ISDA 1FI6A 3EVVA 4PE7A 1S6IA 1YTZC 2LVJA 4QJ3B 2OPOA 3R1OA 3K21A 3CTNA 2FCEA 4QJ4B 1QIWA 1XA5A 2KFGA 3LCPC 3IQOA 2OTGC 5G08A 2OTGB 1B1GA 3SS4A 1J7PA 2PRUA 3B7AA 1BU3A 3CZ0A 1JSAA 1DJZA 1MQ1A 1B7TZ 4DIRA 1A03A 1EG3A 1DQEA 2P71A 4XYNA 1LS8A 1FW4A 5CPVA 1CM1A 1KWOB 3SG3A 3EKJA 3FWBA 2KGBC 3I5GC 3PN7C 1OOGA 2WC8A 3I5IC 1J7OA 1QVIZ 3LK1A 1WDCB 2JXLA 1QXPA 2JTZA 4BY5A 3GK1A 3FIAA 4P5OE 2JOJA 1VRKA 2K2FA 2PMYA 1BLQA 2FJUB 2WCEA 4GFTA 1QATA 3PM8A 2KAXA 3OX6A 5I94A 4PHKA 2AMIA 1SCVA 1Z4HA 2WOSA 2L4IA 1ORGA 3LLEA 1IRJA 4NDBA 1J7QA 5BPJA 1QJTA 1SL9A 3A8RA 3BFAA 3DVEA 1RFJA 4GUKA 1BR1B 4NDCA 3TUYC 3TUYB 3B87A 3SG2A 3BXKA 3VRQA 5K89A 3BOWB 3RM1A 4OCIA 2K7CA 1IIOA 1OMDA 1Y1AA 2KFFA 3VGOA 2LUXA 2JULA 2PYQA 2LC5A 1Q80A 1KQMC 5D7FA 2MJWB 4WQ2A 5CSNA 1BG1A 1KFUL 3SG7A 1C7WA 1YRTB 1RJVA 3NHTA 2WCBA 1CDPA 2MLFC 1SBJA 2LMVA 2KGRA 1PK0D 3IVTA 1JUOA 1M63B 3WHTB 1K96A 1KFXL 3CZ1A 5DKQA 1DTLA 3BOWA 1L7ZA 2F2PA 2KI4B 2LVVA 5I2LA 5HKZA 3IF7A 1YUUA 4PE0A 1C07A 1KQVA 3LK0A 1WRLA 1RROA 4N1GA 1JC2A 3SG5A 1K9KA 2L5YA 2JT0A 2K8MB 1PSBA 1OMRA 3BQ3A 1K9UA 3JVTB 2BBNA 1LKJA 1IQ3A 2K7OA 3DD4A 4MLWA 2BKHB 4TNCA 2M49B 2M3WA 2KOTA 2Y1NA 5I2OA 1BOCA 2KBMA 1QASA 3CZ2A 1OZOA 3CR2A 2L2EA 3PATA 2LV7A 2SCPA 1BJFA 1UP5A 1XFZO 2LLSA 2QEOA 1CKKA 1RK9A 2LM5A 2LE9B 5EL2A 3WXAA 4I5NB 2JT8A 2ZN9A 2BE6A 4PCWA 1FBVA 1P28A 1OQPA 1R2UA 4YGAA 4CPVA 4YRUA 2K60A 1D1OA 2M8UA 2LP2A 1WY9A 1EL4A 2GTEA 1F4OA 1RTP1 4AQIA 1Y1UA 1A2XA 2JZIA 2L5XB 4ETOA 4L9MA 4JWQA 3DYEA 4YBHB 3SS5A 2MLEC 1OSAA 3V2LA 1XFRA 2H61A 2M0RA 2V53A 3KEVA 3PSRA 1BF5A 2GGZA 2NLNA 4F0ZB 4NQGA 2KQYA 1BT6A 1YX7A 1SYMA 1UURA 2BCBA 1A29A 1BR4B 3NSKA 3ZNIA 1EH2A 1XFUO 3D0YB 4ZCVA 1QTXA 1ZOTB 3CABA 2PVBA 1CDNA 1CMGA 2WC6A 3NHIA 3O78A 1GQMA 1W7JB 1TWOA 4PALA 4PHNA 4ORAB 1NX1A 2KFHA 3BYAA 1Z2CB 2PSRA 1MR8A 3E3RA 3AAJA 4HREE 5HLOA 5FI2A 1MXEA 2L50A 2WCKA 4M2OA 4MZJA 1JBAA 3F45A 1K93D 1B8LA 4USLA 4YI8A 3SIAA 2F2OA 1FPWA 1B8RA 2BCAA 2JPOA 3D0YA 1LINA 2JNFA 4OR9B 3BUOB 4CIDA 3OBVA 1QS7A 4YGDB 1WLZA 5AFPA 1A4PA 3NSIA 1XFVO 1NIWA 4WRIA 5CSJA 1W7IB 2K61A 2MBXA 2EHBA 4INXA 1H4BA 2M9GA 1DC1A 1KSMA 5ER5A 2CT9A 2ZNDA 1U5IB 3KHEA 3B86A 3ZWHA 1KK8C 1TNXA 2RGIA 1KK8B 1CLMA 3EVRA 4AOMA 3BUXB 3D75A 3QRXA 1XFXO 3PALA 3D73A 2F3YA 1M39A 1QX5B 1QWVA 2Q91A 4AQJA 3OGNA 4D1EA 1ODBA 3NGVA 2KAVA 1S5GY 2KBIA 1F54A 1KWOC 1G33A 1KK7Y 2BL0B 2NXQA 1QIVA 2DOQA 1XK4A 3BUNB 1U5IA 5D69A 2KPHA 2MAZA 1YVLA 3CLNA 1WRKA 1TNPA 4I5LB 1WDCC 2MHHA 2TN4A 3DVJA 3EK8A 1GM0A 1KFUS 2LANA 1SMGA 1SNLA 3MSEB 3TDZA 2ERBA 4ICBA 1SSEB 5PALA 4XJKB 4A4CA 1KFXS 4PHJA 2M1KB 1NSHA 2EC6C 3TS5C 2EC6B 3SG6A 3R1VA 3TS5B 3DZTA 4PT1A 3A4UB 4HRHA 3EK7A 1TNWA 5TNCA 5J3XA 1DT7B 2CBLA 4FTGA 1UHIA 3OB2B 2CTNA 3PN7B 4FQTA 1IJ6A 1UHKA 2R2IA 1DMOA 5HKYA 1R6PA 4UPGA 5JOLA 1L2OC 3RLZA 1IWQA 1L2OB 4XJKA 3R1PA 1S36A 4MRXA 1MF8B 4GBAA 3CZTX 2LCPA 1K8UA 1XYDA 2PALA 5AERA 2P70A 1YX8A 4R1EA 2O60A 4YGBB 2KI6D 5I2QA 4ZCUA 2NCPA 5FYXA 2F8PA 1C3YA 2KLDA 1OOJA 1W9ZA 4MN0A 3NSLA 2KI4C 2WCJA 2I18A 4GGFC 2LHLA 3DVMA 2M1UA 1J7RA 2ZFDA 1TOPA 3D76A 3WHUB 1F71A 1K95A 3K1EA 3I5HB 3TDUA 3JVTC 1HT9A 2Y5IA 4HSZA 4CLNA 1SW8A 4M2QA 3KF9A 1F70A 4PE4A 1GGWA 2CXJA 1XFYO 3GK2A 5HL1A 3S0BA 3CR4X 1SY9A 3PFVA 2JPTA 4GGFA 3BFBA 4PHMA 1C7VA 2H61C 2GGMA 1G8IA 1S3PA 1JFJA 1OOFA 1H8BA 4JKTA 3HCMA 2YGUA 4BY4A 3FWCA 2L4HA 1T14A 1TTXA 1M31A 3NSOA 4GGNA 2CNPA 2KYFA 4MZKA 2BE4A 1PALA 5HLVA 5KSZA 1BODA 1SL8A 1NCXA 1J1EA 2LVIA 3B88A 3TDIA 4JQ0D 1TN4A 1CFPA 1WLMA 3CGAA 3D77A 1IG5A 3PJIA 2F3ZA 1SKTA 3VRPA 3ICBA 1XFWO 5GQQC 1N65A 2BBMA 1Y0VH 4DS7A 1DF0B 4MVFA 2KYCA 2BKIB 3IQQA 1TIZA 4IL1A 4I5KA 1K94A 3EKHA 1YVHA 2JRFA 2ZRSA 4OZDA 5HKWA 4FQOA 2O5GA 4JPZB 2A4JA 1CFDA 1CDMA 1TUJA 1UHNA 2HQWA 5I8NA 2LUCA 1SPYA 2I2RE 3OP0A 2LNKA 1QLKA 1LA0A 3S0AA 2LAPA 3FS7A 1UHJA 3VROA 2LMUA 1AVSA 1MHOA 4WQ3A 4HRGA 1DF0A 2LHIA 3D78A 1K9PA 2HPSA 1FF1A 4KYNA 1YRUB 1LXFC 1KCYA 5DKNA 3O6BA 3O2PA 4F7FA 2I94A 3L47A 2LVKA 1TUZA 1UUSA 2I7AA 3JTDB 4C0LA 1XVJA 4IJ7A 1C3ZA 2FJYA 1QX2A 3D10A 1XK4C 5HYDA 1TCFA 2WNDA 4DCKA 1DEKA 1JF2A 1NUBA 3EK4A 2K0JA 2QPTA 2NZ0A 3CS1A 1JWDA 2AUCA 5IBWA 1OMVA 2KNEA 4OVNF 2Q4UA 2IS9A 2KLEA 1YUSA 2KAYA 3FE9A 2LLTA 1DGVA 1S26D 2KQ6A 3RZSA 3KPXA 3DXLA 1QV1A 1ZACA 1CLBA 1YURA 2BL0C 2AAOA 4DUQA 2QEVA 1SRAA 5JJGA 3AAKA 1KK7Z 3I5FC 4E68A 3I5FB 1EG4A 1DGUA 1LVCD 2FOTA 2LMTA 1F8HA 1DJGA 5D3OA 4MEWA 1NWDA 1K2HA 2PASA 4Q04A 1DELA 3SIBA 1OZSA 4M2PA 1S6CA 3BFHA 1AJ5A 3KO0A 1B8CA 1NX0A 1S1EA 1QX7A 2E6WA 2GV5A 2ZNEA 4I5JA 5ER4X 3UO9A 1B47A 2KSPA 1DJHA 3CWGA 1J55A 3OHMB 1GJYA 5B8IB 2F33A 1B7TY 4A4BA 2H8VA 1OE9B 3R72A 5AANA 1PSRA 1QLSA 2WCHA 1NYAA 2M97A 2M29A 3NXAA 1EJ3A 1AHRA 1NP8A 2MRDA 1DJYA 1GGZA 1OW4A 1Y1XA 2LLUA 2M7NA 2Y1MA 3GOFA 3I5GB 3AKAA 3OB1B 4QJ5B 1N0YA 2MA2A 3VRRA 1QVIY 1CMFA 1IH0A 4YGEB 3D74A 3I5IB 1ALWA 1PRWA 3SJSA 2QEHA 1A75B 2L2CA 1G4YR 2E30A 1SR6C 1EXRA 2JT3A 4ORCB 1SR6B 1ZMZA 3S0DA 3BUWB 2ZKMX 3BJHA 1CB1A 4GAOA 4MBEA 2KHNA 4P2YB 2B1UA 2VRGA 1IGVA 2WORA 1UWOA
chains in the Genus database with same CATH topology
1CLLA 1J1DA 1WRZA 1A75A 3LL8B 1F4QA 1XO5A 1IQ5A 2L51A 2G9BA 1KSOA 4GNKB 4YI9A 3I5HC 4N1FA 2CCMA 2ZN8A 1CFCA 2HF5A 1CFFA 1YR5A 1KQMB 1FI5A 3M0WA 3AKBA 1CM4A 1MXLC 1N2DA 1LA3A 2K7DA 1YUTA 2D8NA 1NCZA 1SCMC 3H4SE 1SCMB 1PVAA 2H2KA 2JNXA 1NPQA 2OS8C 4OV2A 2OS8B 1IKUA 1RWYA 2FCDA 1AP4A 1ZFSA 1PULA 2BECA 3O4YA 1M45A 2KDHA 2HQ8A 4NDDA 1Y6WA 2K2AA 4U8DA 2G2BA 1AK8A 5AEQA 3BUMB 1M46A 1DVIA 1TNQA 1TCOB 4MRYA 4YGCB 1E8AA 5KU1A 1HQVA 4C0JA 1JF0A 2JC2A 3OX5A 1TRFA 3WNXB 1MUXA 1B4CA 2COLB 3TZ1A 2JU0A 1DJWA 4ORBB 1F55A 2BCXA 3VRNA 1ZUZA 4DRWA 2EGDA 4PE1A 1SL7A 1CTRA 3EVUA 5F6TA 2LP3A 1NCYA 1MWNA 3C1VA 1RECA 1AJ4A 3SG4A 2QACA 2JQ6A 2KI6C 1NX3A 1S6JA 2L0PA 2HETA 1V1FA 3HX4A 1K90D 2JTTA 3JTDC 4MZLA 2P6BB 4MSPA 1QV0A 2K7BA 5CSFA 2M7LA 1UHHA 2NCOA 1CNPA 3DF0B 4GPLB 3GK4X 1DJIA 1DJXA 1X02A 2JWWA 4CFQA 1B9AA 1CDLA 1IJ5A 2SASA 3DVKA 1AUIB 3CR5X 5CSIA 2JXCA 1JFKA 4N5XA 3PLFB 5KTYA 3DF0A 1BMOA 1V1GA 1S5GZ 2WCFA 4OKHA 4CFRA 4PDZA 2ZRTA 5AXIA 1NX2A 5DKRA 4C0KA 1ALVA 1SK6D 2Y4QA 2ISDA 2L98A 1PVBA 1FI6A 3EVVA 4PE7A 1S6IA 1YTZC 2LVJA 4QJ3B 2OPOA 3K21A 3CTNA 2FCEA 4QJ4B 1QIWA 1XA5A 2KFGA 3LCPC 3IQOA 2OTGC 5G08A 2OTGB 1B1GA 1J7PA 2PRUA 1JSAA 1BU3A 1DJZA 1MQ1A 1B7TZ 4DIRA 1A03A 1EG3A 4XYNA 1FW4A 5CPVA 1CM1A 1KWOB 3SG3A 3EKJA 3FWBA 2KGBC 3I5GC 2WC8A 3I5IC 1J7OA 1QVIZ 3LK1A 1WDCB 2JXLA 1QXPA 2JTZA 4BY5A 3GK1A 3FIAA 4P5OE 2JOJA 1VRKA 2K2FA 2PMYA 1BLQA 2FJUB 2WCEA 4GFTA 1QATA 3PM8A 2KAXA 3OX6A 4PHKA 2AMIA 1SCVA 2WOSA 2L4IA 3LLEA 1IRJA 4NDBA 1J7QA 5BPJA 1QJTA 1SL9A 3A8RA 3DVEA 1RFJA 4GUKA 1BR1B 4NDCA 3TUYC 3TUYB 5K89A 3SG2A 3BXKA 3VRQA 3BOWB 3RM1A 4OCIA 2K7CA 1OMDA 1Y1AA 2KFFA 3VGOA 2LUXA 2JULA 2LC5A 1Q80A 1KQMC 5D7FA 2MJWB 4WQ2A 5CSNA 1BG1A 1KFUL 3SG7A 1C7WA 1YRTB 1RJVA 2WCBA 1CDPA 2MLFC 1SBJA 2LMVA 2KGRA 1PK0D 1JUOA 1M63B 3WHTB 1K96A 1KFXL 5DKQA 1DTLA 3BOWA 1L7ZA 2F2PA 2KI4B 2LVVA 5I2LA 5HKZA 3IF7A 1YUUA 4PE0A 1C07A 1KQVA 3LK0A 1WRLA 1RROA 4N1GA 1JC2A 3SG5A 1K9KA 2JT0A 2K8MB 1PSBA 1OMRA 3BQ3A 1K9UA 3JVTB 2BBNA 1LKJA 1IQ3A 2K7OA 3DD4A 4MLWA 2BKHB 4TNCA 2M49B 2M3WA 2KOTA 2Y1NA 5I2OA 1BOCA 2KBMA 1QASA 1OZOA 3CR2A 2L2EA 3PATA 2LV7A 2SCPA 1BJFA 1UP5A 1XFZO 2LLSA 1CKKA 1RK9A 2LM5A 2LE9B 3WXAA 4I5NB 2JT8A 2ZN9A 2BE6A 4PCWA 1FBVA 1R2UA 1OQPA 4YGAA 4CPVA 4YRUA 1D1OA 2M8UA 2LP2A 1WY9A 1EL4A 1F4OA 1RTP1 4AQIA 1Y1UA 1A2XA 2JZIA 2L5XB 4ETOA 4L9MA 4JWQA 4YBHB 2MLEC 1OSAA 2H61A 2M0RA 2V53A 3KEVA 1BF5A 3PSRA 2GGZA 2NLNA 4F0ZB 4NQGA 2KQYA 1BT6A 1YX7A 1SYMA 1UURA 2BCBA 1A29A 1BR4B 3NSKA 3ZNIA 1EH2A 1XFUO 3D0YB 4ZCVA 1QTXA 1ZOTB 1CDNA 2PVBA 1CMGA 3O78A 1GQMA 1W7JB 4PALA 4PHNA 4ORAB 1NX1A 2KFHA 3BYAA 2PSRA 1MR8A 3E3RA 3AAJA 4HREE 5HLOA 1MXEA 2L50A 4M2OA 4MZJA 1JBAA 3F45A 1K93D 1B8LA 4USLA 4YI8A 3SIAA 2F2OA 1FPWA 1B8RA 2BCAA 3D0YA 1LINA 2JNFA 4OR9B 3BUOB 4CIDA 1QS7A 4YGDB 1WLZA 5AFPA 1A4PA 3NSIA 1XFVO 1NIWA 4WRIA 5CSJA 1W7IB 2K61A 2MBXA 2EHBA 1H4BA 2M9GA 1KSMA 5ER5A 2CT9A 2ZNDA 1U5IB 3KHEA 3ZWHA 1KK8C 1TNXA 2RGIA 1KK8B 1CLMA 3EVRA 4AOMA 3BUXB 3QRXA 1XFXO 3PALA 2F3YA 1M39A 1QX5B 2Q91A 4AQJA 4D1EA 1ODBA 2KAVA 1S5GY 2KBIA 1F54A 1KWOC 1G33A 1KK7Y 2BL0B 2NXQA 1QIVA 2DOQA 1XK4A 3BUNB 1U5IA 5D69A 2MAZA 3CLNA 1YVLA 1WRKA 1TNPA 4I5LB 1WDCC 2MHHA 2TN4A 3DVJA 3EK8A 1KFUS 2LANA 1SMGA 1SNLA 3MSEB 3TDZA 4ICBA 5PALA 4XJKB 4A4CA 1KFXS 4PHJA 2M1KB 1NSHA 2EC6C 3TS5C 2EC6B 3SG6A 3TS5B 3A4UB 4HRHA 3EK7A 1TNWA 5TNCA 5J3XA 1DT7B 2CBLA 4FTGA 1UHIA 3OB2B 2CTNA 3PN7B 1IJ6A 1UHKA 2R2IA 1DMOA 5HKYA 1R6PA 4UPGA 5JOLA 1L2OC 3RLZA 1IWQA 1L2OB 4XJKA 1S36A 4MRXA 1MF8B 4GBAA 3CZTX 2LCPA 1K8UA 1XYDA 2PALA 5AERA 1YX8A 4R1EA 2O60A 4YGBB 2KI6D 5I2QA 4ZCUA 2NCPA 5FYXA 2F8PA 1OOJA 4MN0A 3NSLA 2KI4C 2I18A 4GGFC 2LHLA 3DVMA 2M1UA 1J7RA 2ZFDA 1TOPA 3WHUB 1F71A 1K95A 3I5HB 3TDUA 3JVTC 1HT9A 2Y5IA 4HSZA 4CLNA 1SW8A 4M2QA 3KF9A 1F70A 4PE4A 1GGWA 2CXJA 1XFYO 3GK2A 3CR4X 1SY9A 3PFVA 2JPTA 4GGFA 4PHMA 1C7VA 2H61C 2GGMA 1G8IA 1S3PA 1JFJA 1H8BA 3HCMA 4BY4A 3FWCA 2L4HA 1TTXA 1M31A 3NSOA 4GGNA 2CNPA 2KYFA 4MZKA 2BE4A 1PALA 5HLVA 5KSZA 1BODA 1SL8A 1NCXA 1J1EA 2LVIA 3TDIA 4JQ0D 1TN4A 1CFPA 1WLMA 3CGAA 1IG5A 2F3ZA 1SKTA 3VRPA 3ICBA 1XFWO 5GQQC 1N65A 2BBMA 1Y0VH 4DS7A 1DF0B 4MVFA 2KYCA 2BKIB 3IQQA 1TIZA 4IL1A 4I5KA 1K94A 3EKHA 1YVHA 2JRFA 2ZRSA 5HKWA 4FQOA 2O5GA 4JPZB 2A4JA 1CFDA 1CDMA 1UHNA 2HQWA 2LUCA 1SPYA 2I2RE 3OP0A 2LNKA 1QLKA 1LA0A 2LAPA 3FS7A 1UHJA 3VROA 2LMUA 1AVSA 1MHOA 4WQ3A 4HRGA 1DF0A 2LHIA 1K9PA 2HPSA 1FF1A 1YRUB 1LXFC 1KCYA 5DKNA 3O6BA 3O2PA 2I94A 2LVKA 3JTDB 1UUSA 2I7AA 4C0LA 1XVJA 1QX2A 3D10A 1XK4C 5HYDA 1TCFA 2WNDA 4DCKA 1JF2A 1NUBA 3EK4A 2K0JA 2QPTA 2NZ0A 3CS1A 1JWDA 2AUCA 5IBWA 1OMVA 2KNEA 4OVNF 2Q4UA 2IS9A 1YUSA 2KAYA 2LLTA 1DGVA 1S26D 2KQ6A 3KPXA 1QV1A 1ZACA 1CLBA 1YURA 2BL0C 2AAOA 4DUQA 5JJGA 1SRAA 4E68A 3AAKA 1KK7Z 3I5FC 3I5FB 1EG4A 1DGUA 1LVCD 2FOTA 2LMTA 1F8HA 1DJGA 1K2HA 4MEWA 1NWDA 2PASA 4Q04A 3SIBA 1OZSA 4M2PA 1S6CA 3KO0A 1AJ5A 1B8CA 1NX0A 1S1EA 1QX7A 2E6WA 2GV5A 2ZNEA 4I5JA 5ER4X 5I8NA 1B47A 2KSPA 1DJHA 3CWGA 1J55A 3OHMB 1GJYA 5B8IB 2F33A 1B7TY 4A4BA 1OE9B 5AANA 1PSRA 1QLSA 3NXAA 1NYAA 2M97A 2M29A 1EJ3A 1AHRA 1NP8A 2MRDA 1DJYA 1GGZA 1Y1XA 2LLUA 2M7NA 2Y1MA 3GOFA 3I5GB 3PN7C 3AKAA 3OB1B 4QJ5B 1N0YA 2MA2A 3VRRA 1QVIY 1CMFA 1IH0A 4YGEB 3I5IB 1ALWA 1PRWA 3SJSA 1A75B 4ORCB 1G4YR 2E30A 1SR6C 1EXRA 2JT3A 1SR6B 1ZMZA 3BUWB 2ZKMX 1CB1A 4GAOA 4MBEA 2KHNA 4P2YB 2B1UA 2VRGA 1IGVA 2WORA 1UWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLL A;  1J1D A;  1WRZ A;  1A75 A;  3LL8 B;  1F4Q A;  1XO5 A;  1IQ5 A;  2L51 A;  2G9B A;  1KSO A;  4GNK B;  4YI9 A;  3I5H C;  4N1F A;  2CCM A;  2ZN8 A;  1CFC A;  2HF5 A;  1CFF A;  1YR5 A;  1KQM B;  1FI5 A;  3M0W A;  3AKB A;  1CM4 A;  1MXL C;  1N2D A;  1LA3 A;  2K7D A;  1YUT A;  2D8N A;  1NCZ A;  1SCM C;  3H4S E;  1SCM B;  1PVA A;  2H2K A;  2JNX A;  1NPQ A;  2OS8 C;  4OV2 A;  2OS8 B;  1IKU A;  1RWY A;  2FCD A;  1AP4 A;  1ZFS A;  1PUL A;  2BEC A;  3O4Y A;  1M45 A;  2KDH A;  2HQ8 A;  4NDD A;  1Y6W A;  2K2A A;  4U8D A;  2G2B A;  1AK8 A;  5AEQ A;  3BUM B;  1M46 A;  1DVI A;  1TNQ A;  1TCO B;  4MRY A;  4YGC B;  1E8A A;  5KU1 A;  1HQV A;  4C0J A;  1JF0 A;  2JC2 A;  3OX5 A;  1TRF A;  3WNX B;  1MUX A;  1B4C A;  2COL B;  3TZ1 A;  2JU0 A;  1DJW A;  4ORB B;  1F55 A;  2BCX A;  3VRN A;  1ZUZ A;  4DRW A;  2EGD A;  4PE1 A;  1SL7 A;  1CTR A;  3EVU A;  5F6T A;  2LP3 A;  1NCY A;  1MWN A;  3C1V A;  1REC A;  1AJ4 A;  3SG4 A;  2QAC A;  2JQ6 A;  2KI6 C;  1NX3 A;  1S6J A;  2L0P A;  2HET A;  1V1F A;  3HX4 A;  1K90 D;  2JTT A;  3JTD C;  4MZL A;  2P6B B;  4MSP A;  1QV0 A;  2K7B A;  5CSF A;  2M7L A;  1UHH A;  2NCO A;  1CNP A;  3DF0 B;  4GPL B;  3GK4 X;  1DJI A;  1DJX A;  1X02 A;  2JWW A;  4CFQ A;  1B9A A;  1CDL A;  1IJ5 A;  2SAS A;  3DVK A;  1AUI B;  3CR5 X;  5CSI A;  2JXC A;  1JFK A;  4N5X A;  3PLF B;  5KTY A;  3DF0 A;  1BMO A;  1V1G A;  1S5G Z;  2WCF A;  4OKH A;  4CFR A;  4PDZ A;  2ZRT A;  5AXI A;  1NX2 A;  5DKR A;  4C0K A;  1ALV A;  1SK6 D;  2Y4Q A;  2ISD A;  2L98 A;  1PVB A;  1FI6 A;  3EVV A;  4PE7 A;  1S6I A;  1YTZ C;  2LVJ A;  4QJ3 B;  2OPO A;  3K21 A;  3CTN A;  2FCE A;  4QJ4 B;  1QIW A;  1XA5 A;  2KFG A;  3LCP C;  3IQO A;  2OTG C;  5G08 A;  2OTG B;  1B1G A;  1J7P A;  2PRU A;  1JSA A;  1BU3 A;  1DJZ A;  1MQ1 A;  1B7T Z;  4DIR A;  1A03 A;  1EG3 A;  4XYN A;  1FW4 A;  5CPV A;  1CM1 A;  1KWO B;  3SG3 A;  3EKJ A;  3FWB A;  2KGB C;  3I5G C;  2WC8 A;  3I5I C;  1J7O A;  1QVI Z;  3LK1 A;  1WDC B;  2JXL A;  1QXP A;  2JTZ A;  4BY5 A;  3GK1 A;  3FIA A;  4P5O E;  2JOJ A;  1VRK A;  2K2F A;  2PMY A;  1BLQ A;  2FJU B;  2WCE A;  4GFT A;  1QAT A;  3PM8 A;  2KAX A;  3OX6 A;  4PHK A;  2AMI A;  1SCV A;  2WOS A;  2L4I A;  3LLE A;  1IRJ A;  4NDB A;  1J7Q A;  5BPJ A;  1QJT A;  1SL9 A;  3A8R A;  3DVE A;  1RFJ A;  4GUK A;  1BR1 B;  4NDC A;  3TUY C;  3TUY B;  5K89 A;  3SG2 A;  3BXK A;  3VRQ A;  3BOW B;  3RM1 A;  4OCI A;  2K7C A;  1OMD A;  1Y1A A;  2KFF A;  3VGO A;  2LUX A;  2JUL A;  2LC5 A;  1Q80 A;  1KQM C;  5D7F A;  2MJW B;  4WQ2 A;  5CSN A;  1BG1 A;  1KFU L;  3SG7 A;  1C7W A;  1YRT B;  1RJV A;  2WCB A;  1CDP A;  2MLF C;  1SBJ A;  2LMV A;  2KGR A;  1PK0 D;  1JUO A;  1M63 B;  3WHT B;  1K96 A;  1KFX L;  5DKQ A;  1DTL A;  3BOW A;  1L7Z A;  2F2P A;  2KI4 B;  2LVV A;  5I2L A;  5HKZ A;  3IF7 A;  1YUU A;  4PE0 A;  1C07 A;  1KQV A;  3LK0 A;  1WRL A;  1RRO A;  4N1G A;  1JC2 A;  3SG5 A;  1K9K A;  2JT0 A;  2K8M B;  1PSB A;  1OMR A;  3BQ3 A;  1K9U A;  3JVT B;  2BBN A;  1LKJ A;  1IQ3 A;  2K7O A;  3DD4 A;  4MLW A;  2BKH B;  4TNC A;  2M49 B;  2M3W A;  2KOT A;  2Y1N A;  5I2O A;  1BOC A;  2KBM A;  1QAS A;  1OZO A;  3CR2 A;  2L2E A;  3PAT A;  2LV7 A;  2SCP A;  1BJF A;  1UP5 A;  1XFZ O;  2LLS A;  1CKK A;  1RK9 A;  2LM5 A;  2LE9 B;  3WXA A;  4I5N B;  2JT8 A;  2ZN9 A;  2BE6 A;  4PCW A;  1FBV A;  1R2U A;  1OQP A;  4YGA A;  4CPV A;  4YRU A;  1D1O A;  2M8U A;  2LP2 A;  1WY9 A;  1EL4 A;  1F4O A;  1RTP 1;  4AQI A;  1Y1U A;  1A2X A;  2JZI A;  2L5X B;  4ETO A;  4L9M A;  4JWQ A;  4YBH B;  2MLE C;  1OSA A;  2H61 A;  2M0R A;  2V53 A;  3KEV A;  1BF5 A;  3PSR A;  2GGZ A;  2NLN A;  4F0Z B;  4NQG A;  2KQY A;  1BT6 A;  1YX7 A;  1SYM A;  1UUR A;  2BCB A;  1A29 A;  1BR4 B;  3NSK A;  3ZNI A;  1EH2 A;  1XFU O;  3D0Y B;  4ZCV A;  1QTX A;  1ZOT B;  1CDN A;  2PVB A;  1CMG A;  3O78 A;  1GQM A;  1W7J B;  4PAL A;  4PHN A;  4ORA B;  1NX1 A;  2KFH A;  3BYA A;  2PSR A;  1MR8 A;  3E3R A;  3AAJ A;  4HRE E;  5HLO A;  1MXE A;  2L50 A;  4M2O A;  4MZJ A;  1JBA A;  3F45 A;  1K93 D;  1B8L A;  4USL A;  4YI8 A;  3SIA A;  2F2O A;  1FPW A;  1B8R A;  2BCA A;  3D0Y A;  1LIN A;  2JNF A;  4OR9 B;  3BUO B;  4CID A;  1QS7 A;  4YGD B;  1WLZ A;  5AFP A;  1A4P A;  3NSI A;  1XFV O;  1NIW A;  4WRI A;  5CSJ A;  1W7I B;  2K61 A;  2MBX A;  2EHB A;  1H4B A;  2M9G A;  1KSM A;  5ER5 A;  2CT9 A;  2ZND A;  1U5I B;  3KHE A;  3ZWH A;  1KK8 C;  1TNX A;  2RGI A;  1KK8 B;  1CLM A;  3EVR A;  4AOM A;  3BUX B;  3QRX A;  1XFX O;  3PAL A;  2F3Y A;  1M39 A;  1QX5 B;  2Q91 A;  4AQJ A;  4D1E A;  1ODB A;  2KAV A;  1S5G Y;  2KBI A;  1F54 A;  1KWO C;  1G33 A;  1KK7 Y;  2BL0 B;  2NXQ A;  1QIV A;  2DOQ A;  1XK4 A;  3BUN B;  1U5I A;  5D69 A;  2MAZ A;  3CLN A;  1YVL A;  1WRK A;  1TNP A;  4I5L B;  1WDC C;  2MHH A;  2TN4 A;  3DVJ A;  3EK8 A;  1KFU S;  2LAN A;  1SMG A;  1SNL A;  3MSE B;  3TDZ A;  4ICB A;  5PAL A;  4XJK B;  4A4C A;  1KFX S;  4PHJ A;  2M1K B;  1NSH A;  2EC6 C;  3TS5 C;  2EC6 B;  3SG6 A;  3TS5 B;  3A4U B;  4HRH A;  3EK7 A;  1TNW A;  5TNC A;  5J3X A;  1DT7 B;  2CBL A;  4FTG A;  1UHI A;  3OB2 B;  2CTN A;  3PN7 B;  1IJ6 A;  1UHK A;  2R2I A;  1DMO A;  5HKY A;  1R6P A;  4UPG A;  5JOL A;  1L2O C;  3RLZ A;  1IWQ A;  1L2O B;  4XJK A;  1S36 A;  4MRX A;  1MF8 B;  4GBA A;  3CZT X;  2LCP A;  1K8U A;  1XYD A;  2PAL A;  5AER A;  1YX8 A;  4R1E A;  2O60 A;  4YGB B;  2KI6 D;  5I2Q A;  4ZCU A;  2NCP A;  5FYX A;  2F8P A;  1OOJ A;  4MN0 A;  3NSL A;  2KI4 C;  2I18 A;  4GGF C;  2LHL A;  3DVM A;  2M1U A;  1J7R A;  2ZFD A;  1TOP A;  3WHU B;  1F71 A;  1K95 A;  3I5H B;  3TDU A;  3JVT C;  1HT9 A;  2Y5I A;  4HSZ A;  4CLN A;  1SW8 A;  4M2Q A;  3KF9 A;  1F70 A;  4PE4 A;  1GGW A;  2CXJ A;  1XFY O;  3GK2 A;  3CR4 X;  1SY9 A;  3PFV A;  2JPT A;  4GGF A;  4PHM A;  1C7V A;  2H61 C;  2GGM A;  1G8I A;  1S3P A;  1JFJ A;  1H8B A;  3HCM A;  4BY4 A;  3FWC A;  2L4H A;  1TTX A;  1M31 A;  3NSO A;  4GGN A;  2CNP A;  2KYF A;  4MZK A;  2BE4 A;  1PAL A;  5HLV A;  5KSZ A;  1BOD A;  1SL8 A;  1NCX A;  1J1E A;  2LVI A;  3TDI A;  4JQ0 D;  1TN4 A;  1CFP A;  1WLM A;  3CGA A;  1IG5 A;  2F3Z A;  1SKT A;  3VRP A;  3ICB A;  1XFW O;  5GQQ C;  1N65 A;  2BBM A;  1Y0V H;  4DS7 A;  1DF0 B;  4MVF A;  2KYC A;  2BKI B;  3IQQ A;  1TIZ A;  4IL1 A;  4I5K A;  1K94 A;  3EKH A;  1YVH A;  2JRF A;  2ZRS A;  5HKW A;  4FQO A;  2O5G A;  4JPZ B;  2A4J A;  1CFD A;  1CDM A;  1UHN A;  2HQW A;  2LUC A;  1SPY A;  2I2R E;  3OP0 A;  2LNK A;  1QLK A;  1LA0 A;  2LAP A;  3FS7 A;  1UHJ A;  3VRO A;  2LMU A;  1AVS A;  1MHO A;  4WQ3 A;  4HRG A;  1DF0 A;  2LHI A;  1K9P A;  2HPS A;  1FF1 A;  1YRU B;  1LXF C;  1KCY A;  5DKN A;  3O6B A;  3O2P A;  2I94 A;  2LVK A;  3JTD B;  1UUS A;  2I7A A;  4C0L A;  1XVJ A;  1QX2 A;  3D10 A;  1XK4 C;  5HYD A;  1TCF A;  2WND A;  4DCK A;  1JF2 A;  1NUB A;  3EK4 A;  2K0J A;  2QPT A;  2NZ0 A;  3CS1 A;  1JWD A;  2AUC A;  5IBW A;  1OMV A;  2KNE A;  4OVN F;  2Q4U A;  2IS9 A;  1YUS A;  2KAY A;  2LLT A;  1DGV A;  1S26 D;  2KQ6 A;  3KPX A;  1QV1 A;  1ZAC A;  1CLB A;  1YUR A;  2BL0 C;  2AAO A;  4DUQ A;  5JJG A;  1SRA A;  4E68 A;  3AAK A;  1KK7 Z;  3I5F C;  3I5F B;  1EG4 A;  1DGU A;  1LVC D;  2FOT A;  2LMT A;  1F8H A;  1DJG A;  1K2H A;  4MEW A;  1NWD A;  2PAS A;  4Q04 A;  3SIB A;  1OZS A;  4M2P A;  1S6C A;  3KO0 A;  1AJ5 A;  1B8C A;  1NX0 A;  1S1E A;  1QX7 A;  2E6W A;  2GV5 A;  2ZNE A;  4I5J A;  5ER4 X;  5I8N A;  1B47 A;  2KSP A;  1DJH A;  3CWG A;  1J55 A;  3OHM B;  1GJY A;  5B8I B;  2F33 A;  1B7T Y;  4A4B A;  1OE9 B;  5AAN A;  1PSR A;  1QLS A;  3NXA A;  1NYA A;  2M97 A;  2M29 A;  1EJ3 A;  1AHR A;  1NP8 A;  2MRD A;  1DJY A;  1GGZ A;  1Y1X A;  2LLU A;  2M7N A;  2Y1M A;  3GOF A;  3I5G B;  3PN7 C;  3AKA A;  3OB1 B;  4QJ5 B;  1N0Y A;  2MA2 A;  3VRR A;  1QVI Y;  1CMF A;  1IH0 A;  4YGE B;  3I5I B;  1ALW A;  1PRW A;  3SJS A;  1A75 B;  4ORC B;  1G4Y R;  2E30 A;  1SR6 C;  1EXR A;  2JT3 A;  1SR6 B;  1ZMZ A;  3BUW B;  2ZKM X;  1CB1 A;  4GAO A;  4MBE A;  2KHN A;  4P2Y B;  2B1U A;  2VRG A;  1IGV A;  2WOR A;  1UWO A; 
#chains in the Genus database with same CATH topology
 1CLL A;  1J1D A;  3FE8 A;  1WRZ A;  1A75 A;  3LL8 B;  1F4Q A;  1XO5 A;  1IQ5 A;  2L51 A;  2G9B A;  1KSO A;  3SS3 A;  4GNK B;  4YI9 A;  3I5H C;  4N1F A;  2CCM A;  2BNX A;  2ZN8 A;  2HF5 A;  1CFC A;  1CFF A;  1YR5 A;  1KQM B;  4INW A;  2WC5 A;  1FI5 A;  3M0W A;  3AKB A;  1CM4 A;  1MXL C;  1N2D A;  1LA3 A;  2K7D A;  1YUT A;  2D8N A;  1NCZ A;  1SCM C;  3H4S E;  1SCM B;  1PVA A;  2H2K A;  3L4A A;  3QME A;  2JNX A;  1NPQ A;  2BAP A;  2OS8 C;  4OV2 A;  2OS8 B;  1IKU A;  1RWY A;  2FCD A;  1AP4 A;  1ZFS A;  1PUL A;  2BEC A;  1OOI X;  3Q8I A;  3O4Y A;  1M45 A;  2KDH A;  2HQ8 A;  2QEB A;  2WCM A;  4NDD A;  1Y6W A;  3S0G A;  3S0F A;  2K2A A;  3EG5 B;  4U8D A;  2G2B A;  1AK8 A;  5FI6 A;  5AEQ A;  3BUM B;  1M46 A;  1DVI A;  1TNQ A;  1TCO B;  4MRY A;  4YGC B;  1E8A A;  5FI7 A;  5KU1 A;  1HQV A;  4C0J A;  1JF0 A;  2JC2 A;  3OX5 A;  3VB1 A;  1TRF A;  3WNX B;  1MUX A;  1B4C A;  2COL B;  3TZ1 A;  2JU0 A;  1DJW A;  4ORB B;  1F55 A;  2BCX A;  3UNW A;  3VRN A;  3S0E A;  1ZUZ A;  4DRW A;  2EGD A;  4PE1 A;  1SL7 A;  1CTR A;  3EVU A;  5F6T A;  2LP3 A;  1NCY A;  3O4X A;  2WCL A;  1MWN A;  3C1V A;  3CDN A;  1REC A;  1AJ4 A;  3SG4 A;  2QAC A;  2JQ6 A;  2KI6 C;  1NX3 A;  3PM2 A;  1S6J A;  2L0P A;  2HET A;  1V1F A;  3HX4 A;  1K90 D;  2JTT A;  3JTD C;  4MZL A;  2P6B B;  4MSP A;  1QV0 A;  2K7B A;  5CSF A;  2M7L A;  1UHH A;  2PQL A;  2NCO A;  1CNP A;  3DF0 B;  4GPL B;  3GK4 X;  1DJI A;  1DJX A;  1X02 A;  2JWW A;  3L4L A;  4CFQ A;  1B9A A;  1CDL A;  1IJ5 A;  2SAS A;  5DIC A;  3DVK A;  1AUI B;  3CR5 X;  3N7H A;  5CSI A;  2JXC A;  1JFK A;  4N5X A;  2QDI A;  3PLF B;  4JD9 A;  5KTY A;  3CYZ A;  3FE6 A;  3DF0 A;  3DY9 A;  1BMO A;  1V1G A;  1S5G Z;  2WCF A;  4OKH A;  4CFR A;  4PDZ A;  2ZRT A;  5AXI A;  1OOH A;  1NX2 A;  5DKR A;  4C0K A;  1ALV A;  1SK6 D;  2Y4Q A;  3B6X A;  2L98 A;  1PVB A;  2ISD A;  1FI6 A;  3EVV A;  4PE7 A;  1S6I A;  1YTZ C;  2LVJ A;  4QJ3 B;  2OPO A;  3R1O A;  3K21 A;  3CTN A;  2FCE A;  4QJ4 B;  1QIW A;  1XA5 A;  2KFG A;  3LCP C;  3IQO A;  2OTG C;  5G08 A;  2OTG B;  1B1G A;  3SS4 A;  1J7P A;  2PRU A;  3B7A A;  1BU3 A;  3CZ0 A;  1JSA A;  1DJZ A;  1MQ1 A;  1B7T Z;  4DIR A;  1A03 A;  1EG3 A;  1DQE A;  2P71 A;  4XYN A;  1LS8 A;  1FW4 A;  5CPV A;  1CM1 A;  1KWO B;  3SG3 A;  3EKJ A;  3FWB A;  2KGB C;  3I5G C;  3PN7 C;  1OOG A;  2WC8 A;  3I5I C;  1J7O A;  1QVI Z;  3LK1 A;  1WDC B;  2JXL A;  1QXP A;  2JTZ A;  4BY5 A;  3GK1 A;  3FIA A;  4P5O E;  2JOJ A;  1VRK A;  2K2F A;  2PMY A;  1BLQ A;  2FJU B;  2WCE A;  4GFT A;  1QAT A;  3PM8 A;  2KAX A;  3OX6 A;  5I94 A;  4PHK A;  2AMI A;  1SCV A;  1Z4H A;  2WOS A;  2L4I A;  1ORG A;  3LLE A;  1IRJ A;  4NDB A;  1J7Q A;  5BPJ A;  1QJT A;  1SL9 A;  3A8R A;  3BFA A;  3DVE A;  1RFJ A;  4GUK A;  1BR1 B;  4NDC A;  3TUY C;  3TUY B;  3B87 A;  3SG2 A;  3BXK A;  3VRQ A;  5K89 A;  3BOW B;  3RM1 A;  4OCI A;  2K7C A;  1IIO A;  1OMD A;  1Y1A A;  2KFF A;  3VGO A;  2LUX A;  2JUL A;  2PYQ A;  2LC5 A;  1Q80 A;  1KQM C;  5D7F A;  2MJW B;  4WQ2 A;  5CSN A;  1BG1 A;  1KFU L;  3SG7 A;  1C7W A;  1YRT B;  1RJV A;  3NHT A;  2WCB A;  1CDP A;  2MLF C;  1SBJ A;  2LMV A;  2KGR A;  1PK0 D;  3IVT A;  1JUO A;  1M63 B;  3WHT B;  1K96 A;  1KFX L;  3CZ1 A;  5DKQ A;  1DTL A;  3BOW A;  1L7Z A;  2F2P A;  2KI4 B;  2LVV A;  5I2L A;  5HKZ A;  3IF7 A;  1YUU A;  4PE0 A;  1C07 A;  1KQV A;  3LK0 A;  1WRL A;  1RRO A;  4N1G A;  1JC2 A;  3SG5 A;  1K9K A;  2L5Y A;  2JT0 A;  2K8M B;  1PSB A;  1OMR A;  3BQ3 A;  1K9U A;  3JVT B;  2BBN A;  1LKJ A;  1IQ3 A;  2K7O A;  3DD4 A;  4MLW A;  2BKH B;  4TNC A;  2M49 B;  2M3W A;  2KOT A;  2Y1N A;  5I2O A;  1BOC A;  2KBM A;  1QAS A;  3CZ2 A;  1OZO A;  3CR2 A;  2L2E A;  3PAT A;  2LV7 A;  2SCP A;  1BJF A;  1UP5 A;  1XFZ O;  2LLS A;  2QEO A;  1CKK A;  1RK9 A;  2LM5 A;  2LE9 B;  5EL2 A;  3WXA A;  4I5N B;  2JT8 A;  2ZN9 A;  2BE6 A;  4PCW A;  1FBV A;  1P28 A;  1OQP A;  1R2U A;  4YGA A;  4CPV A;  4YRU A;  2K60 A;  1D1O A;  2M8U A;  2LP2 A;  1WY9 A;  1EL4 A;  2GTE A;  1F4O A;  1RTP 1;  4AQI A;  1Y1U A;  1A2X A;  2JZI A;  2L5X B;  4ETO A;  4L9M A;  4JWQ A;  3DYE A;  4YBH B;  3SS5 A;  2MLE C;  1OSA A;  3V2L A;  1XFR A;  2H61 A;  2M0R A;  2V53 A;  3KEV A;  3PSR A;  1BF5 A;  2GGZ A;  2NLN A;  4F0Z B;  4NQG A;  2KQY A;  1BT6 A;  1YX7 A;  1SYM A;  1UUR A;  2BCB A;  1A29 A;  1BR4 B;  3NSK A;  3ZNI A;  1EH2 A;  1XFU O;  3D0Y B;  4ZCV A;  1QTX A;  1ZOT B;  3CAB A;  2PVB A;  1CDN A;  1CMG A;  2WC6 A;  3NHI A;  3O78 A;  1GQM A;  1W7J B;  1TWO A;  4PAL A;  4PHN A;  4ORA B;  1NX1 A;  2KFH A;  3BYA A;  1Z2C B;  2PSR A;  1MR8 A;  3E3R A;  3AAJ A;  4HRE E;  5HLO A;  5FI2 A;  1MXE A;  2L50 A;  2WCK A;  4M2O A;  4MZJ A;  1JBA A;  3F45 A;  1K93 D;  1B8L A;  4USL A;  4YI8 A;  3SIA A;  2F2O A;  1FPW A;  1B8R A;  2BCA A;  2JPO A;  3D0Y A;  1LIN A;  2JNF A;  4OR9 B;  3BUO B;  4CID A;  3OBV A;  1QS7 A;  4YGD B;  1WLZ A;  5AFP A;  1A4P A;  3NSI A;  1XFV O;  1NIW A;  4WRI A;  5CSJ A;  1W7I B;  2K61 A;  2MBX A;  2EHB A;  4INX A;  1H4B A;  2M9G A;  1DC1 A;  1KSM A;  5ER5 A;  2CT9 A;  2ZND A;  1U5I B;  3KHE A;  3B86 A;  3ZWH A;  1KK8 C;  1TNX A;  2RGI A;  1KK8 B;  1CLM A;  3EVR A;  4AOM A;  3BUX B;  3D75 A;  3QRX A;  1XFX O;  3PAL A;  3D73 A;  2F3Y A;  1M39 A;  1QX5 B;  1QWV A;  2Q91 A;  4AQJ A;  3OGN A;  4D1E A;  1ODB A;  3NGV A;  2KAV A;  1S5G Y;  2KBI A;  1F54 A;  1KWO C;  1G33 A;  1KK7 Y;  2BL0 B;  2NXQ A;  1QIV A;  2DOQ A;  1XK4 A;  3BUN B;  1U5I A;  5D69 A;  2KPH A;  2MAZ A;  1YVL A;  3CLN A;  1WRK A;  1TNP A;  4I5L B;  1WDC C;  2MHH A;  2TN4 A;  3DVJ A;  3EK8 A;  1GM0 A;  1KFU S;  2LAN A;  1SMG A;  1SNL A;  3MSE B;  3TDZ A;  2ERB A;  4ICB A;  1SSE B;  5PAL A;  4XJK B;  4A4C A;  1KFX S;  4PHJ A;  2M1K B;  1NSH A;  2EC6 C;  3TS5 C;  2EC6 B;  3SG6 A;  3R1V A;  3TS5 B;  3DZT A;  4PT1 A;  3A4U B;  4HRH A;  3EK7 A;  1TNW A;  5TNC A;  5J3X A;  1DT7 B;  2CBL A;  4FTG A;  1UHI A;  3OB2 B;  2CTN A;  3PN7 B;  4FQT A;  1IJ6 A;  1UHK A;  2R2I A;  1DMO A;  5HKY A;  1R6P A;  4UPG A;  5JOL A;  1L2O C;  3RLZ A;  1IWQ A;  1L2O B;  4XJK A;  3R1P A;  1S36 A;  4MRX A;  1MF8 B;  4GBA A;  3CZT X;  2LCP A;  1K8U A;  1XYD A;  2PAL A;  5AER A;  2P70 A;  1YX8 A;  4R1E A;  2O60 A;  4YGB B;  2KI6 D;  5I2Q A;  4ZCU A;  2NCP A;  5FYX A;  2F8P A;  1C3Y A;  2KLD A;  1OOJ A;  1W9Z A;  4MN0 A;  3NSL A;  2KI4 C;  2WCJ A;  2I18 A;  4GGF C;  2LHL A;  3DVM A;  2M1U A;  1J7R A;  2ZFD A;  1TOP A;  3D76 A;  3WHU B;  1F71 A;  1K95 A;  3K1E A;  3I5H B;  3TDU A;  3JVT C;  1HT9 A;  2Y5I A;  4HSZ A;  4CLN A;  1SW8 A;  4M2Q A;  3KF9 A;  1F70 A;  4PE4 A;  1GGW A;  2CXJ A;  1XFY O;  3GK2 A;  5HL1 A;  3S0B A;  3CR4 X;  1SY9 A;  3PFV A;  2JPT A;  4GGF A;  3BFB A;  4PHM A;  1C7V A;  2H61 C;  2GGM A;  1G8I A;  1S3P A;  1JFJ A;  1OOF A;  1H8B A;  4JKT A;  3HCM A;  2YGU A;  4BY4 A;  3FWC A;  2L4H A;  1T14 A;  1TTX A;  1M31 A;  3NSO A;  4GGN A;  2CNP A;  2KYF A;  4MZK A;  2BE4 A;  1PAL A;  5HLV A;  5KSZ A;  1BOD A;  1SL8 A;  1NCX A;  1J1E A;  2LVI A;  3B88 A;  3TDI A;  4JQ0 D;  1TN4 A;  1CFP A;  1WLM A;  3CGA A;  3D77 A;  1IG5 A;  3PJI A;  2F3Z A;  1SKT A;  3VRP A;  3ICB A;  1XFW O;  5GQQ C;  1N65 A;  2BBM A;  1Y0V H;  4DS7 A;  1DF0 B;  4MVF A;  2KYC A;  2BKI B;  3IQQ A;  1TIZ A;  4IL1 A;  4I5K A;  1K94 A;  3EKH A;  1YVH A;  2JRF A;  2ZRS A;  4OZD A;  5HKW A;  4FQO A;  2O5G A;  4JPZ B;  2A4J A;  1CFD A;  1CDM A;  1TUJ A;  1UHN A;  2HQW A;  5I8N A;  2LUC A;  1SPY A;  2I2R E;  3OP0 A;  2LNK A;  1QLK A;  1LA0 A;  3S0A A;  2LAP A;  3FS7 A;  1UHJ A;  3VRO A;  2LMU A;  1AVS A;  1MHO A;  4WQ3 A;  4HRG A;  1DF0 A;  2LHI A;  3D78 A;  1K9P A;  2HPS A;  1FF1 A;  4KYN A;  1YRU B;  1LXF C;  1KCY A;  5DKN A;  3O6B A;  3O2P A;  4F7F A;  2I94 A;  3L47 A;  2LVK A;  1TUZ A;  1UUS A;  2I7A A;  3JTD B;  4C0L A;  1XVJ A;  4IJ7 A;  1C3Z A;  2FJY A;  1QX2 A;  3D10 A;  1XK4 C;  5HYD A;  1TCF A;  2WND A;  4DCK A;  1DEK A;  1JF2 A;  1NUB A;  3EK4 A;  2K0J A;  2QPT A;  2NZ0 A;  3CS1 A;  1JWD A;  2AUC A;  5IBW A;  1OMV A;  2KNE A;  4OVN F;  2Q4U A;  2IS9 A;  2KLE A;  1YUS A;  2KAY A;  3FE9 A;  2LLT A;  1DGV A;  1S26 D;  2KQ6 A;  3RZS A;  3KPX A;  3DXL A;  1QV1 A;  1ZAC A;  1CLB A;  1YUR A;  2BL0 C;  2AAO A;  4DUQ A;  2QEV A;  1SRA A;  5JJG A;  3AAK A;  1KK7 Z;  3I5F C;  4E68 A;  3I5F B;  1EG4 A;  1DGU A;  1LVC D;  2FOT A;  2LMT A;  1F8H A;  1DJG A;  5D3O A;  4MEW A;  1NWD A;  1K2H A;  2PAS A;  4Q04 A;  1DEL A;  3SIB A;  1OZS A;  4M2P A;  1S6C A;  3BFH A;  1AJ5 A;  3KO0 A;  1B8C A;  1NX0 A;  1S1E A;  1QX7 A;  2E6W A;  2GV5 A;  2ZNE A;  4I5J A;  5ER4 X;  3UO9 A;  1B47 A;  2KSP A;  1DJH A;  3CWG A;  1J55 A;  3OHM B;  1GJY A;  5B8I B;  2F33 A;  1B7T Y;  4A4B A;  2H8V A;  1OE9 B;  3R72 A;  5AAN A;  1PSR A;  1QLS A;  2WCH A;  1NYA A;  2M97 A;  2M29 A;  3NXA A;  1EJ3 A;  1AHR A;  1NP8 A;  2MRD A;  1DJY A;  1GGZ A;  1OW4 A;  1Y1X A;  2LLU A;  2M7N A;  2Y1M A;  3GOF A;  3I5G B;  3AKA A;  3OB1 B;  4QJ5 B;  1N0Y A;  2MA2 A;  3VRR A;  1QVI Y;  1CMF A;  1IH0 A;  4YGE B;  3D74 A;  3I5I B;  1ALW A;  1PRW A;  3SJS A;  2QEH A;  1A75 B;  2L2C A;  1G4Y R;  2E30 A;  1SR6 C;  1EXR A;  2JT3 A;  4ORC B;  1SR6 B;  1ZMZ A;  3S0D A;  3BUW B;  2ZKM X;  3BJH A;  1CB1 A;  4GAO A;  4MBE A;  2KHN A;  4P2Y B;  2B1U A;  2VRG A;  1IGV A;  2WOR A;  1UWO A; 
#chains in the Genus database with same CATH homology
 1CLL A;  1J1D A;  1WRZ A;  1A75 A;  3LL8 B;  1F4Q A;  1XO5 A;  1IQ5 A;  2L51 A;  2G9B A;  1KSO A;  4GNK B;  4YI9 A;  3I5H C;  4N1F A;  2CCM A;  2ZN8 A;  1CFC A;  2HF5 A;  1CFF A;  1YR5 A;  1KQM B;  1FI5 A;  3M0W A;  3AKB A;  1CM4 A;  1MXL C;  1N2D A;  1LA3 A;  2K7D A;  1YUT A;  2D8N A;  1NCZ A;  1SCM C;  3H4S E;  1SCM B;  1PVA A;  2H2K A;  2JNX A;  1NPQ A;  2OS8 C;  4OV2 A;  2OS8 B;  1IKU A;  1RWY A;  2FCD A;  1AP4 A;  1ZFS A;  1PUL A;  2BEC A;  3O4Y A;  1M45 A;  2KDH A;  2HQ8 A;  4NDD A;  1Y6W A;  2K2A A;  4U8D A;  2G2B A;  1AK8 A;  5AEQ A;  3BUM B;  1M46 A;  1DVI A;  1TNQ A;  1TCO B;  4MRY A;  4YGC B;  1E8A A;  5KU1 A;  1HQV A;  4C0J A;  1JF0 A;  2JC2 A;  3OX5 A;  1TRF A;  3WNX B;  1MUX A;  1B4C A;  2COL B;  3TZ1 A;  2JU0 A;  1DJW A;  4ORB B;  1F55 A;  2BCX A;  3VRN A;  1ZUZ A;  4DRW A;  2EGD A;  4PE1 A;  1SL7 A;  1CTR A;  3EVU A;  5F6T A;  2LP3 A;  1NCY A;  1MWN A;  3C1V A;  1REC A;  1AJ4 A;  3SG4 A;  2QAC A;  2JQ6 A;  2KI6 C;  1NX3 A;  1S6J A;  2L0P A;  2HET A;  1V1F A;  3HX4 A;  1K90 D;  2JTT A;  3JTD C;  4MZL A;  2P6B B;  4MSP A;  1QV0 A;  2K7B A;  5CSF A;  2M7L A;  1UHH A;  2NCO A;  1CNP A;  3DF0 B;  4GPL B;  3GK4 X;  1DJI A;  1DJX A;  1X02 A;  2JWW A;  4CFQ A;  1B9A A;  1CDL A;  1IJ5 A;  2SAS A;  3DVK A;  1AUI B;  3CR5 X;  5CSI A;  2JXC A;  1JFK A;  4N5X A;  3PLF B;  5KTY A;  3DF0 A;  1BMO A;  1V1G A;  1S5G Z;  2WCF A;  4OKH A;  4CFR A;  4PDZ A;  2ZRT A;  5AXI A;  1NX2 A;  5DKR A;  4C0K A;  1ALV A;  1SK6 D;  2Y4Q A;  2ISD A;  2L98 A;  1PVB A;  1FI6 A;  3EVV A;  4PE7 A;  1S6I A;  1YTZ C;  2LVJ A;  4QJ3 B;  2OPO A;  3K21 A;  3CTN A;  2FCE A;  4QJ4 B;  1QIW A;  1XA5 A;  2KFG A;  3LCP C;  3IQO A;  2OTG C;  5G08 A;  2OTG B;  1B1G A;  1J7P A;  2PRU A;  1JSA A;  1BU3 A;  1DJZ A;  1MQ1 A;  1B7T Z;  4DIR A;  1A03 A;  1EG3 A;  4XYN A;  1FW4 A;  5CPV A;  1CM1 A;  1KWO B;  3SG3 A;  3EKJ A;  3FWB A;  2KGB C;  3I5G C;  2WC8 A;  3I5I C;  1J7O A;  1QVI Z;  3LK1 A;  1WDC B;  2JXL A;  1QXP A;  2JTZ A;  4BY5 A;  3GK1 A;  3FIA A;  4P5O E;  2JOJ A;  1VRK A;  2K2F A;  2PMY A;  1BLQ A;  2FJU B;  2WCE A;  4GFT A;  1QAT A;  3PM8 A;  2KAX A;  3OX6 A;  4PHK A;  2AMI A;  1SCV A;  2WOS A;  2L4I A;  3LLE A;  1IRJ A;  4NDB A;  1J7Q A;  5BPJ A;  1QJT A;  1SL9 A;  3A8R A;  3DVE A;  1RFJ A;  4GUK A;  1BR1 B;  4NDC A;  3TUY C;  3TUY B;  5K89 A;  3SG2 A;  3BXK A;  3VRQ A;  3BOW B;  3RM1 A;  4OCI A;  2K7C A;  1OMD A;  1Y1A A;  2KFF A;  3VGO A;  2LUX A;  2JUL A;  2LC5 A;  1Q80 A;  1KQM C;  5D7F A;  2MJW B;  4WQ2 A;  5CSN A;  1BG1 A;  1KFU L;  3SG7 A;  1C7W A;  1YRT B;  1RJV A;  2WCB A;  1CDP A;  2MLF C;  1SBJ A;  2LMV A;  2KGR A;  1PK0 D;  1JUO A;  1M63 B;  3WHT B;  1K96 A;  1KFX L;  5DKQ A;  1DTL A;  3BOW A;  1L7Z A;  2F2P A;  2KI4 B;  2LVV A;  5I2L A;  5HKZ A;  3IF7 A;  1YUU A;  4PE0 A;  1C07 A;  1KQV A;  3LK0 A;  1WRL A;  1RRO A;  4N1G A;  1JC2 A;  3SG5 A;  1K9K A;  2JT0 A;  2K8M B;  1PSB A;  1OMR A;  3BQ3 A;  1K9U A;  3JVT B;  2BBN A;  1LKJ A;  1IQ3 A;  2K7O A;  3DD4 A;  4MLW A;  2BKH B;  4TNC A;  2M49 B;  2M3W A;  2KOT A;  2Y1N A;  5I2O A;  1BOC A;  2KBM A;  1QAS A;  1OZO A;  3CR2 A;  2L2E A;  3PAT A;  2LV7 A;  2SCP A;  1BJF A;  1UP5 A;  1XFZ O;  2LLS A;  1CKK A;  1RK9 A;  2LM5 A;  2LE9 B;  3WXA A;  4I5N B;  2JT8 A;  2ZN9 A;  2BE6 A;  4PCW A;  1FBV A;  1R2U A;  1OQP A;  4YGA A;  4CPV A;  4YRU A;  1D1O A;  2M8U A;  2LP2 A;  1WY9 A;  1EL4 A;  1F4O A;  1RTP 1;  4AQI A;  1Y1U A;  1A2X A;  2JZI A;  2L5X B;  4ETO A;  4L9M A;  4JWQ A;  4YBH B;  2MLE C;  1OSA A;  2H61 A;  2M0R A;  2V53 A;  3KEV A;  1BF5 A;  3PSR A;  2GGZ A;  2NLN A;  4F0Z B;  4NQG A;  2KQY A;  1BT6 A;  1YX7 A;  1SYM A;  1UUR A;  2BCB A;  1A29 A;  1BR4 B;  3NSK A;  3ZNI A;  1EH2 A;  1XFU O;  3D0Y B;  4ZCV A;  1QTX A;  1ZOT B;  1CDN A;  2PVB A;  1CMG A;  3O78 A;  1GQM A;  1W7J B;  4PAL A;  4PHN A;  4ORA B;  1NX1 A;  2KFH A;  3BYA A;  2PSR A;  1MR8 A;  3E3R A;  3AAJ A;  4HRE E;  5HLO A;  1MXE A;  2L50 A;  4M2O A;  4MZJ A;  1JBA A;  3F45 A;  1K93 D;  1B8L A;  4USL A;  4YI8 A;  3SIA A;  2F2O A;  1FPW A;  1B8R A;  2BCA A;  3D0Y A;  1LIN A;  2JNF A;  4OR9 B;  3BUO B;  4CID A;  1QS7 A;  4YGD B;  1WLZ A;  5AFP A;  1A4P A;  3NSI A;  1XFV O;  1NIW A;  4WRI A;  5CSJ A;  1W7I B;  2K61 A;  2MBX A;  2EHB A;  1H4B A;  2M9G A;  1KSM A;  5ER5 A;  2CT9 A;  2ZND A;  1U5I B;  3KHE A;  3ZWH A;  1KK8 C;  1TNX A;  2RGI A;  1KK8 B;  1CLM A;  3EVR A;  4AOM A;  3BUX B;  3QRX A;  1XFX O;  3PAL A;  2F3Y A;  1M39 A;  1QX5 B;  2Q91 A;  4AQJ A;  4D1E A;  1ODB A;  2KAV A;  1S5G Y;  2KBI A;  1F54 A;  1KWO C;  1G33 A;  1KK7 Y;  2BL0 B;  2NXQ A;  1QIV A;  2DOQ A;  1XK4 A;  3BUN B;  1U5I A;  5D69 A;  2MAZ A;  3CLN A;  1YVL A;  1WRK A;  1TNP A;  4I5L B;  1WDC C;  2MHH A;  2TN4 A;  3DVJ A;  3EK8 A;  1KFU S;  2LAN A;  1SMG A;  1SNL A;  3MSE B;  3TDZ A;  4ICB A;  5PAL A;  4XJK B;  4A4C A;  1KFX S;  4PHJ A;  2M1K B;  1NSH A;  2EC6 C;  3TS5 C;  2EC6 B;  3SG6 A;  3TS5 B;  3A4U B;  4HRH A;  3EK7 A;  1TNW A;  5TNC A;  5J3X A;  1DT7 B;  2CBL A;  4FTG A;  1UHI A;  3OB2 B;  2CTN A;  3PN7 B;  1IJ6 A;  1UHK A;  2R2I A;  1DMO A;  5HKY A;  1R6P A;  4UPG A;  5JOL A;  1L2O C;  3RLZ A;  1IWQ A;  1L2O B;  4XJK A;  1S36 A;  4MRX A;  1MF8 B;  4GBA A;  3CZT X;  2LCP A;  1K8U A;  1XYD A;  2PAL A;  5AER A;  1YX8 A;  4R1E A;  2O60 A;  4YGB B;  2KI6 D;  5I2Q A;  4ZCU A;  2NCP A;  5FYX A;  2F8P A;  1OOJ A;  4MN0 A;  3NSL A;  2KI4 C;  2I18 A;  4GGF C;  2LHL A;  3DVM A;  2M1U A;  1J7R A;  2ZFD A;  1TOP A;  3WHU B;  1F71 A;  1K95 A;  3I5H B;  3TDU A;  3JVT C;  1HT9 A;  2Y5I A;  4HSZ A;  4CLN A;  1SW8 A;  4M2Q A;  3KF9 A;  1F70 A;  4PE4 A;  1GGW A;  2CXJ A;  1XFY O;  3GK2 A;  3CR4 X;  1SY9 A;  3PFV A;  2JPT A;  4GGF A;  4PHM A;  1C7V A;  2H61 C;  2GGM A;  1G8I A;  1S3P A;  1JFJ A;  1H8B A;  3HCM A;  4BY4 A;  3FWC A;  2L4H A;  1TTX A;  1M31 A;  3NSO A;  4GGN A;  2CNP A;  2KYF A;  4MZK A;  2BE4 A;  1PAL A;  5HLV A;  5KSZ A;  1BOD A;  1SL8 A;  1NCX A;  1J1E A;  2LVI A;  3TDI A;  4JQ0 D;  1TN4 A;  1CFP A;  1WLM A;  3CGA A;  1IG5 A;  2F3Z A;  1SKT A;  3VRP A;  3ICB A;  1XFW O;  5GQQ C;  1N65 A;  2BBM A;  1Y0V H;  4DS7 A;  1DF0 B;  4MVF A;  2KYC A;  2BKI B;  3IQQ A;  1TIZ A;  4IL1 A;  4I5K A;  1K94 A;  3EKH A;  1YVH A;  2JRF A;  2ZRS A;  5HKW A;  4FQO A;  2O5G A;  4JPZ B;  2A4J A;  1CFD A;  1CDM A;  1UHN A;  2HQW A;  2LUC A;  1SPY A;  2I2R E;  3OP0 A;  2LNK A;  1QLK A;  1LA0 A;  2LAP A;  3FS7 A;  1UHJ A;  3VRO A;  2LMU A;  1AVS A;  1MHO A;  4WQ3 A;  4HRG A;  1DF0 A;  2LHI A;  1K9P A;  2HPS A;  1FF1 A;  1YRU B;  1LXF C;  1KCY A;  5DKN A;  3O6B A;  3O2P A;  2I94 A;  2LVK A;  3JTD B;  1UUS A;  2I7A A;  4C0L A;  1XVJ A;  1QX2 A;  3D10 A;  1XK4 C;  5HYD A;  1TCF A;  2WND A;  4DCK A;  1JF2 A;  1NUB A;  3EK4 A;  2K0J A;  2QPT A;  2NZ0 A;  3CS1 A;  1JWD A;  2AUC A;  5IBW A;  1OMV A;  2KNE A;  4OVN F;  2Q4U A;  2IS9 A;  1YUS A;  2KAY A;  2LLT A;  1DGV A;  1S26 D;  2KQ6 A;  3KPX A;  1QV1 A;  1ZAC A;  1CLB A;  1YUR A;  2BL0 C;  2AAO A;  4DUQ A;  5JJG A;  1SRA A;  4E68 A;  3AAK A;  1KK7 Z;  3I5F C;  3I5F B;  1EG4 A;  1DGU A;  1LVC D;  2FOT A;  2LMT A;  1F8H A;  1DJG A;  1K2H A;  4MEW A;  1NWD A;  2PAS A;  4Q04 A;  3SIB A;  1OZS A;  4M2P A;  1S6C A;  3KO0 A;  1AJ5 A;  1B8C A;  1NX0 A;  1S1E A;  1QX7 A;  2E6W A;  2GV5 A;  2ZNE A;  4I5J A;  5ER4 X;  5I8N A;  1B47 A;  2KSP A;  1DJH A;  3CWG A;  1J55 A;  3OHM B;  1GJY A;  5B8I B;  2F33 A;  1B7T Y;  4A4B A;  1OE9 B;  5AAN A;  1PSR A;  1QLS A;  3NXA A;  1NYA A;  2M97 A;  2M29 A;  1EJ3 A;  1AHR A;  1NP8 A;  2MRD A;  1DJY A;  1GGZ A;  1Y1X A;  2LLU A;  2M7N A;  2Y1M A;  3GOF A;  3I5G B;  3PN7 C;  3AKA A;  3OB1 B;  4QJ5 B;  1N0Y A;  2MA2 A;  3VRR A;  1QVI Y;  1CMF A;  1IH0 A;  4YGE B;  3I5I B;  1ALW A;  1PRW A;  3SJS A;  1A75 B;  4ORC B;  1G4Y R;  2E30 A;  1SR6 C;  1EXR A;  2JT3 A;  1SR6 B;  1ZMZ A;  3BUW B;  2ZKM X;  1CB1 A;  4GAO A;  4MBE A;  2KHN A;  4P2Y B;  2B1U A;  2VRG A;  1IGV A;  2WOR A;  1UWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...