1XFWO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin and 3'5' cyclic amp (camp)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
molecule keywords Calmodulin-sensitive adenylate cyclase
total genus 34
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfwO02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfwO01
4JQ0D 1PSRA 1R2UA 2MHHA 5I2LA 2JRFA 5HKWA 3TUYC 1XA5A 2L0PA 1AVSA 3VROA 2AUCA 1S5GY 4I5JA 2M29A 3WHTB 5KSZA 2F3YA 1DGVA 1KSMA 1SCMB 1HT9A 1LINA 1YUSA 1PRWA 4WRIA 3IQOA 3BUXB 4MRXA 5KTYA 1QLSA 1YURA 3VRNA 1XFYO 2LMTA 2MRDA 2E6WA 1BODA 5JOLA 1XFVO 2M7LA 2F33A 1AHRA 2M9GA 1DTLA 1RJVA 2F3ZA 2MA2A 3CZTX 4PE1A 3NSOA 2JPTA 1YRTB 2LP3A 4HRGA 1MF8B 2E30A 5CSJA 1MR8A 1YVHA 2L4IA 1V1FA 3LCPC 3SG2A 4E68A 3A4UB 5AANA 1LA0A 1K90D 4N5XA 4WQ2A 1S26D 4R1EA 2BKHB 2JT3A 1DJXA 2I7AA 3AKBA 2LE9B 3FWCA 3PN7C 1BR1B 3JTDC 1KSOA 1NP8A 1KQMB 5ER5A 3CLNA 3SG6A 2K7CA 2L50A 2LC5A 3TUYB 2LMUA 2AAOA 1SNLA 1A29A 1QVIY 4MBEA 1KWOC 3SJSA 1CFDA 1S3PA 1J7QA 1SPYA 3CGAA 4MSPA 1A75A 1MWNA 5AERA 3FS7A 1S6IA 1JC2A 1GGWA 1TNXA 1F70A 4USLA 5CSIA 3PLFB 1BJFA 4GPLB 1SR6B 2AMIA 1QTXA 2JXLA 4N1GA 1JBAA 1WLZA 4OV2A 2LVJA 1DMOA 2MJWB 1CDPA 1Y1XA 1SCVA 5CPVA 3DD4A 1QX5B 3C1VA 1IJ6A 2Q91A 1JWDA 4YGDB 2ZN9A 1SR6C 1TCFA 1K8UA 1TRFA 1TN4A 1JSAA 2QPTA 4OCIA 2KYCA 1KK7Z 3VRRA 2QACA 1M31A 2OTGC 5ER4X 4M2PA 1YUUA 1QVIZ 5KU1A 1RTP1 1YUTA 1KQMC 3QRXA 1N65A 1OMDA 1PVAA 2G9BA 2KAVA 3EVRA 2G2BA 2BBMA 5CSFA 1YX8A 2NCPA 1SKTA 2L4HA 2CTNA 3BUMB 4XYNA 3I5FB 1M39A 1Y6WA 3IF7A 5F6TA 1U5IB 2LUCA 1BOCA 1CB1A 2MBXA 1H4BA 1GQMA 1WRKA 3HCMA 1BMOA 2HQ8A 1F4QA 1CLLA 3CWGA 3SG4A 3JVTB 1MUXA 2BL0B 2PSRA 3CS1A 1J1EA 3NSLA 1OSAA 1YTZC 1LVCD 1K9KA 1K93D 2JTZA 2ZFDA 1F71A 1CFPA 4YGAA 3O6BA 2LVKA 4WQ3A 2ZRSA 4OVNF 2LVVA 1PSBA 1QASA 2KI6C 4DRWA 2LAPA 4ICBA 2JT0A 1IQ3A 1YRUB 4P5OE 1UWOA 1QXPA 1NCXA 1A03A 1LXFC 1K9UA 2Y5IA 2FOTA 1HQVA 1BF5A 1KK8B 1S1EA 3DVKA 4D1EA 1XFUO 2LMVA 1CFFA 1QATA 1WDCB 1NCYA 1ZFSA 1DJZA 1SMGA 3WNXB 3ZWHA 5DKRA 3BUNB 1J1DA 4IL1A 2HPSA 2NZ0A 1B8LA 1OZOA 2BCXA 2EGDA 1BG1A 1QV0A 4MEWA 1JFJA 2JC2A 1ODBA 4C0LA 3PALA 4L9MA 2EC6B 1KQVA 1J7PA 4I5NB 3DVJA 3TDIA 3KO0A 1CNPA 3I5FC 1CDLA 5D69A 1ZUZA 2K7BA 2WCBA 2LLSA 3F45A 2WOSA 1ZACA 2JXCA 3GK1A 4AQJA 1F54A 5FYXA 1PALA 4TNCA 1SK6D 1FBVA 1G8IA 3JVTC 3PM8A 1CMGA 1NWDA 2WNDA 1F8HA 2H61A 4GNKB 1CLBA 5CSNA 1KFXL 3I5IC 3TS5B 2GGZA 2LV7A 2OPOA 2M49B 3D10A 5AFPA 1RFJA 1RK9A 1G4YR 1TOPA 1Y1AA 2KQ6A 3BOWB 4DCKA 1KFUS 1DT7B 3PATA 4PHMA 2K2FA 3WXAA 1C07A 1H8BA 1G33A 1R6PA 4YGEB 4JWQA 4GUKA 1BR4B 4F0ZB 2NCOA 2KDHA 3KEVA 1XFXO 2KI6D 3I5HC 1B8CA 1XYDA 2BKIB 3OP0A 4ORBB 1GJYA 1JUOA 2ZN8A 1B1GA 2KNEA 4FTGA 2BECA 2MAZA 1UUSA 1ZOTB 1DJWA 2B1UA 2F2OA 3BYAA 4PHJA 3ZNIA 2I2RE 1EJ3A 4BY4A 1QLKA 1F55A 1SL9A 5DKQA 1AK8A 1TNWA 3VRPA 2EC6C 2KFGA 3PN7B 3IQQA 1K95A 1UHJA 2H61C 1AP4A 1QS7A 2RGIA 5DKNA 2D8NA 4FQOA 1BT6A 2KSPA 1EXRA 1D1OA 2K0JA 5TNCA 1UURA 1SBJA 1S5GZ 3TS5C 1C7WA 4CFRA 1B4CA 3BUWB 1KWOB 4A4BA 2KAXA 1JFKA 2H2KA 5K89A 2CBLA 4HSZA 1UHNA 1SW8A 1W7IB 2WC8A 4C0KA 1B7TY 1B9AA 2COLB 4YGCB 4M2OA 1XK4A 4XJKA 3I5IB 2Y1NA 4Q04A 1J55A 2KFHA 2KGBC 2I18A 2KFFA 3OX6A 1L2OC 3O4YA 2KI4B 1N2DA 5IBWA 1ALWA 2LANA 1NX3A 4UPGA 4QJ3B 1FI6A 2KYFA 1AJ5A 3A8RA 3BUOB 1ALVA 5D7FA 2M8UA 1W7JB 1DJHA 4C0JA 1MQ1A 2LLUA 1NX2A 5JJGA 3OB2B 1TIZA 1IRJA 5HLOA 3H4SE 4CIDA 3KF9A 3VGOA 2M97A 1CTRA 5HKZA 4GGFA 1M46A 1QX7A 1OMVA 1AJ4A 1IH0A 1FF1A 2ZRTA 3ICBA 4PCWA 2JZIA 3CR2A 4CLNA 3OX5A 2CCMA 3E3RA 5GQQC 2BE4A 4PHKA 1N0YA 4MZJA 1PVBA 1IG5A 2F8PA 3DVEA 1K96A 1C7VA 1UP5A 5HLVA 3EVUA 1OOJA 1MXLC 1QX2A 5G08A 1IKUA 4NDDA 3OHMB 2KI4C 3TDZA 1DJYA 4HRHA 4I5LB 2R2IA 4PDZA 2Y4QA 1WRLA 1IJ5A 2KAYA 1ZMZA 1J7OA 3GK4X 1YX7A 4MZKA 2P6BB 3AKAA 2JTTA 2LNKA 2K2AA 2O5GA 4GFTA 1Y0VH 2CXJA 1TNQA 2CT9A 1WRZA 1WLMA 2TN4A 3KHEA 1NUBA 1DGUA 4DS7A 1IWQA 2IS9A 4MZLA 1B8RA 1XFWO 3HX4A 2FJUB 2HETA 3I5GB 1SY9A 2ISDA 3NSKA 3NSIA 2K8MB 2NXQA 1SRAA 1S36A 3BQ3A 1K9PA 4QJ5B 4YGBB 1CFCA 3M0WA 1TTXA 5HYDA 2FCEA 2ZNDA 3BOWA 3EKHA 3JTDB 4PE0A 1DF0A 2PVBA 2M3WA 3EK4A 1Q80A 1KK8C 4NDCA 2Q4UA 4YI8A 2F2PA 2OTGB 1SL8A 2BL0C 4NQGA 5I8NA 5I2OA 1DJGA 3CR5X 5BPJA 2Y1MA 3O2PA 2KBIA 1RROA 2LHIA 3EK8A 1SYMA 2MLFC 1M63B 1XVJA 1YR5A 1IQ5A 5AEQA 3SG5A 1JF0A 1PK0D 3FWBA 4XJKB 2LUXA 2LVIA 2L2EA 1QJTA 4BY5A 2JWWA 2LHLA 3CTNA 4M2QA 4JPZB 4ZCVA 3BXKA 5I2QA 2KOTA 1UHKA 2JT8A 3LL8B 1XK4C 1KFUL 2PASA 2WCEA 3O78A 4U8DA 1XO5A 2M0RA 4DIRA 1CLMA 1CM4A 2LM5A 2K7DA 2DOQA 1KCYA 2BBNA 1UHIA 1KFXS 1SCMC 2BE6A 4GAOA 3RLZA 1FW4A 3LK0A 1MXEA 1QIWA 1QV1A 2HF5A 4DUQA 2JU0A 1A2XA 1EG3A 2JNXA 1L7ZA 2K61A 2PRUA 4NDBA 4MVFA 1YVLA 1JF2A 1NIWA 1RECA 2I94A 1OE9B 2KHNA 3GK2A 1DF0B 3RM1A 2LLTA 4PE7A 1TCOB 4I5KA 4GBAA 2L98A 1CMFA 4OKHA 4ORCB 4PALA 4GGFC 3SG7A 1NX1A 2FCDA 1V1GA 4MLWA 1OMRA 1X02A 2PMYA 1AUIB 1XFZO 1NX0A 4HREE 2OS8C 3EKJA 1FPWA 1LA3A 5J3XA 2GGMA 1NPQA 2CNPA 2EHBA 2KQYA 1NYAA 2K7OA 4ZCUA 1EL4A 3DVMA 4P2YB 1VRKA 4AQIA 2HQWA 3EVVA 1SL7A 3PSRA 2ZKMX 1CDNA 3NXAA 2BCBA 2OS8B 2WORA 4PHNA 1NSHA 3OB1B 1LKJA 1U5IA 3SIAA 1IGVA 1Y1UA 3MSEB 4OR9B 1A4PA 3D0YA 1B47A 5B8IB 2LCPA 1UHHA 4MN0A 4CFQA 3LLEA 1OQPA 4ORAB 3I5HB 4AOMA 3EK7A 4MRYA 3LK1A 1BLQA 1J7RA 1KK7Y 4N1FA 1GGZA 2L51A 1E8AA 3GOFA 1EH2A 2KGRA 3AAJA 4YBHB 1BU3A 3VRQA 3WHUB 2NLNA 1CM1A 2PALA 2KBMA 3I5GC 3DF0B 1L2OB 2JQ6A 2JULA 4A4CA 4ETOA 1PULA 1MHOA 2ZNEA 1S6JA 4YRUA 1A75B 4YI9A 1QIVA 1WY9A 2L5XB 4PE4A 1WDCC 3SG3A 2GV5A 1K94A 2JOJA 2O60A 2V53A 2VRGA 1OZSA 3DF0A 1K2HA 3D0YB 1CDMA 1DVIA 1CKKA 3SIBA 4CPVA 2M7NA 3KPXA 1NCZA 3PFVA 2WCFA 1RWYA 2BCAA 1EG4A 2M1UA 1DJIA 1F4OA 3FIAA 5PALA 3AAKA 3TZ1A 3K21A 1B7TZ 3TDUA 2JNFA 3CR4X 5AXIA 1S6CA 2LP2A 5HKYA 1M45A 2M1KB 2SCPA 2MLEC 2SASA 1TNPA 4QJ4B 1FI5A 4GGNA 2A4JA
chains in the Genus database with same CATH superfamily
4JQ0D 1PSRA 1R2UA 2MHHA 5I2LA 2JRFA 5HKWA 3TUYC 1XA5A 2L0PA 1AVSA 3VROA 1OOHA 1S5GY 2AUCA 2KLEA 4I5JA 2M29A 3WHTB 3R1VA 3DY9A 5KSZA 2QEVA 2F3YA 1DGVA 1KSMA 1SCMB 1HT9A 1LINA 1YUSA 1PRWA 1Z2CB 3IQOA 3BUXB 3D73A 4WRIA 4MRXA 5KTYA 1QLSA 1YURA 3VRNA 1XFYO 2LMTA 2MRDA 3D77A 2E6WA 1BODA 5JOLA 1OOIX 1XFVO 2M7LA 2F33A 1AHRA 2M9GA 1DTLA 1RJVA 2F3ZA 5D3OA 2MA2A 3CZTX 3FE8A 4PE1A 2QEHA 3CDNA 2JPTA 3NSOA 1YRTB 2LP3A 4INWA 4HRGA 1MF8B 2E30A 5CSJA 1MR8A 1YVHA 2L4IA 1V1FA 3LCPC 5EL2A 3SG2A 4E68A 2QEBA 3A4UB 5AANA 1LA0A 1K90D 3D74A 4N5XA 1TWOA 4WQ2A 2P71A 1S26D 4R1EA 2BKHB 2JT3A 1DJXA 2I7AA 3AKBA 2LE9B 3FWCA 3PN7C 1BR1B 3JTDC 1KSOA 1NP8A 2BNXA 1KQMB 5ER5A 3CLNA 3SG6A 2K7CA 2L50A 2LC5A 2JPOA 3TUYB 2LMUA 4IJ7A 3CZ0A 2AAOA 3D75A 1SNLA 1A29A 1QVIY 4MBEA 1DELA 1KWOC 3SJSA 4FQTA 1CFDA 1S3PA 1J7QA 1SPYA 3CGAA 4MSPA 1A75A 3L4LA 2P70A 1MWNA 5AERA 3FS7A 1S6IA 1QWVA 1JC2A 1GGWA 3BFHA 1TNXA 1F70A 4USLA 5CSIA 3S0BA 3PLFB 1BJFA 5FI7A 1DC1A 4GPLB 1SR6B 2AMIA 1QTXA 2JXLA 4N1GA 1JBAA 1WLZA 4OV2A 2LVJA 1DMOA 2MJWB 1CDPA 1Y1XA 1SCVA 3K1EA 3DD4A 3NHIA 1QX5B 3C1VA 1IJ6A 2Q91A 2FJYA 3DYEA 3R72A 4YGDB 2ZN9A 1JWDA 1Z4HA 1SR6C 1TCFA 1K8UA 1TRFA 1TN4A 1JSAA 2QPTA 4OCIA 2KYCA 1KK7Z 3VRRA 2QACA 1M31A 2OTGC 3B87A 5ER4X 4M2PA 1YUUA 1QVIZ 5KU1A 1RTP1 1YUTA 1KQMC 3QRXA 1N65A 1OMDA 1PVAA 2G9BA 2KAVA 3EVRA 2G2BA 2BBMA 5CSFA 1YX8A 2NCPA 1SKTA 2L4HA 2CTNA 3BUMB 3BJHA 4XYNA 3I5FB 1M39A 1Y6WA 3IF7A 5F6TA 1U5IB 2LUCA 1BOCA 1CB1A 2MBXA 1H4BA 1GQMA 1WRKA 3HCMA 1GM0A 1BMOA 3L47A 2HQ8A 1F4QA 1SSEB 1CLLA 1LS8A 3CWGA 3SG4A 3JVTB 1MUXA 2BL0B 2PSRA 3CS1A 1J1EA 1P28A 3NSLA 1OSAA 1YTZC 1LVCD 1K9KA 1K93D 2JTZA 2ZFDA 1F71A 1CFPA 3PM2A 4YGAA 3O6BA 2LVKA 4WQ3A 4PT1A 3S0DA 1C3YA 2ZRSA 4OVNF 3UNWA 2L2CA 2LVVA 1PSBA 1QASA 2KI6C 3S0GA 2LAPA 4DRWA 3L4AA 4ICBA 4U8DA 2JT0A 1IQ3A 1YRUB 4P5OE 1UWOA 1QXPA 1NCXA 1A03A 1LXFC 1K9UA 2Y5IA 2FOTA 1HQVA 1BF5A 3B86A 1KK8B 1S1EA 3DVKA 4D1EA 1T14A 2PQLA 4KYNA 1XFUO 2LMVA 1CFFA 1OOGA 1QATA 1WDCB 3CYZA 1NCYA 1ZFSA 1DJZA 1SMGA 3WNXB 3ZWHA 5DKRA 3BUNB 1J1DA 4IL1A 2HPSA 3CZ2A 2NZ0A 1B8LA 1OZOA 2BCXA 2EGDA 1BG1A 1QV0A 4MEWA 1JFJA 2JC2A 1ODBA 4C0LA 3PALA 4L9MA 2EC6B 3B7AA 1KQVA 1J7PA 4I5NB 3DVJA 3TDIA 3KO0A 4OZDA 3I5FC 1CNPA 1CDLA 5D69A 1ZUZA 2ERBA 2K7BA 2WCBA 2LLSA 3F45A 2WOSA 1ZACA 2JXCA 3GK1A 4AQJA 1F54A 5FYXA 1PALA 3SS4A 4TNCA 1SK6D 1FBVA 1G8IA 3JVTC 3PM8A 1CMGA 1NWDA 2WNDA 1F8HA 2H61A 4GNKB 2PYQA 2WCLA 1CLBA 5CSNA 1KFXL 3DZTA 3I5IC 3TS5B 2GGZA 2LV7A 2OPOA 2M49B 2WCMA 3D10A 5AFPA 1RFJA 1RK9A 1G4YR 1TOPA 1Y1AA 2KQ6A 3BOWB 3NHTA 1KFUS 4DCKA 3PATA 4PHMA 2K2FA 3WXAA 1DT7B 1H8BA 1G33A 1R6PA 4YGEB 4JWQA 4GUKA 1BR4B 3IVTA 4F0ZB 2NCOA 2KDHA 3KEVA 3FE9A 1XFXO 2KI6D 3I5HC 1B8CA 3DXLA 1XYDA 2BKIB 3OP0A 4ORBB 1GJYA 1JUOA 2ZN8A 1B1GA 2KNEA 2KLDA 4FTGA 2BECA 1DEKA 2MAZA 1UUSA 1ZOTB 1DJWA 2B1UA 2F2OA 3BYAA 4PHJA 3ZNIA 2I2RE 1EJ3A 4BY4A 1QLKA 1F55A 1SL9A 5DKQA 2WC5A 1ORGA 1AK8A 1TNWA 3VRPA 2EC6C 2KFGA 3SS3A 3PN7B 3IQQA 2YGUA 1K95A 1UHJA 2H61C 1AP4A 2KPHA 1QS7A 2RGIA 3EG5B 5DKNA 2D8NA 4FQOA 1BT6A 2KSPA 1EXRA 1D1OA 2K0JA 5TNCA 1UURA 1SBJA 1S5GZ 3O4XA 1C7WA 3TS5C 4CFRA 1B4CA 3BUWB 1KWOB 4A4BA 2KAXA 1JFKA 2H2KA 5K89A 2CBLA 4HSZA 1UHNA 1SW8A 1W7IB 2WC8A 4C0KA 1B7TY 1B9AA 2COLB 4YGCB 3B88A 4M2OA 1XK4A 4XJKA 3I5IB 2Y1NA 4Q04A 1J55A 2KFHA 2KGBC 2I18A 2KFFA 3OX6A 1L2OC 2QDIA 3R1OA 3O4YA 2QEOA 2KI4B 1N2DA 5IBWA 3RZSA 1ALWA 2LANA 1NX3A 4UPGA 4QJ3B 1FI6A 2KYFA 2WC6A 1AJ5A 3A8RA 3BUOB 1W9ZA 1ALVA 5D7FA 2M8UA 1W7JB 1DJHA 4C0JA 1MQ1A 2LLUA 1NX2A 5JJGA 3OB2B 1TIZA 1IRJA 5HLOA 3H4SE 4CIDA 1DQEA 3KF9A 3VGOA 2M97A 1CTRA 5HKZA 4GGFA 1M46A 1QX7A 5FI6A 1OMVA 1AJ4A 1IH0A 4JD9A 1FF1A 2ZRTA 3ICBA 4PCWA 2JZIA 3CR2A 4CLNA 3OX5A 2CCMA 3E3RA 5GQQC 2BE4A 4PHKA 1N0YA 4MZJA 1PVBA 1IG5A 2F8PA 3DVEA 1K96A 1C7VA 1UP5A 5HLVA 3NGVA 3EVUA 1OOJA 1MXLC 1QX2A 5G08A 1IKUA 4NDDA 3OHMB 2KI4C 3TDZA 1DJYA 3B6XA 4HRHA 4I5LB 2R2IA 4PDZA 2Y4QA 1WRLA 1IJ5A 2KAYA 1ZMZA 1J7OA 3GK4X 1YX7A 4MZKA 2P6BB 3AKAA 2JTTA 2LNKA 2K2AA 2O5GA 4GFTA 1Y0VH 2CXJA 1TNQA 2CT9A 1WRZA 3CABA 4JKTA 1WLMA 2TN4A 3KHEA 1NUBA 1DGUA 4DS7A 1IWQA 2IS9A 4MZLA 1B8RA 1XFWO 3HX4A 2FJUB 5DICA 2HETA 3I5GB 1SY9A 2ISDA 3NSKA 3NSIA 2K8MB 2NXQA 1SRAA 1S36A 3BQ3A 1K9PA 4QJ5B 4YGBB 1CFCA 3M0WA 1TTXA 5HYDA 2FCEA 2ZNDA 3BOWA 3EKHA 3JTDB 4PE0A 3S0AA 1DF0A 2PVBA 1OOFA 2M3WA 3EK4A 1Q80A 1KK8C 3QMEA 4NDCA 2Q4UA 4YI8A 2F2PA 2OTGB 1SL8A 1XFRA 2BL0C 4NQGA 5I8NA 5I2OA 1DJGA 3CR5X 3PJIA 5BPJA 2Y1MA 3O2PA 2KBIA 1RROA 2LHIA 2WCKA 1SYMA 2MLFC 3EK8A 1M63B 1XVJA 3CZ1A 1YR5A 3FE6A 2BAPA 1C07A 1IQ5A 5AEQA 3OGNA 1JF0A 1PK0D 3FWBA 4XJKB 3SG5A 3VB1A 2LUXA 2LVIA 2L2EA 1QJTA 3UO9A 4BY5A 2JWWA 2LHLA 2WCJA 3CTNA 4M2QA 4JPZB 4ZCVA 3BXKA 5I2QA 2KOTA 5HL1A 1C3ZA 1UHKA 2JT8A 3BFBA 1XK4C 1KFUL 2PASA 2WCEA 3LL8B 3O78A 1XO5A 2M0RA 4DIRA 1CLMA 1CM4A 2LM5A 3V2LA 2K7DA 2DOQA 1KCYA 2BBNA 1UHIA 1OW4A 1KFXS 1SCMC 2BE6A 4GAOA 3RLZA 1FW4A 3LK0A 1MXEA 1QIWA 1QV1A 2HF5A 4DUQA 2JU0A 1A2XA 1EG3A 2H8VA 2JNXA 1L7ZA 2K61A 2PRUA 4NDBA 4MVFA 1YVLA 1JF2A 1NIWA 1RECA 2I94A 2WCHA 1OE9B 2KHNA 3GK2A 1DF0B 3RM1A 2LLTA 3D78A 4PE7A 1TCOB 4I5KA 4GBAA 2L98A 3SS5A 1CMFA 4OKHA 4ORCB 4PALA 4GGFC 3SG7A 1NX1A 2FCDA 1V1GA 4MLWA 1OMRA 1X02A 2PMYA 1AUIB 1XFZO 1NX0A 4HREE 2OS8C 1IIOA 3EKJA 1FPWA 1LA3A 5J3XA 2GGMA 2K60A 1NPQA 2CNPA 2EHBA 3Q8IA 2KQYA 1NYAA 2K7OA 4ZCUA 1EL4A 3DVMA 4P2YB 1VRKA 4AQIA 4F7FA 2HQWA 3EVVA 1SL7A 3PSRA 2ZKMX 1CDNA 3NXAA 2BCBA 2GTEA 2OS8B 2WORA 4PHNA 1NSHA 3OB1B 1LKJA 1U5IA 3S0FA 3SIAA 1IGVA 1Y1UA 3MSEB 4OR9B 1A4PA 3D0YA 3OBVA 1B47A 5B8IB 4INXA 2LCPA 1UHHA 4MN0A 4CFQA 3LLEA 1OQPA 4ORAB 3I5HB 4AOMA 3EK7A 4MRYA 3LK1A 1BLQA 1J7RA 1KK7Y 4N1FA 1GGZA 2L51A 1E8AA 3GOFA 1EH2A 2KGRA 3AAJA 4YBHB 1BU3A 3VRQA 3WHUB 2NLNA 3S0EA 1CM1A 2PALA 2KBMA 3I5GC 3DF0B 1L2OB 2JQ6A 2JULA 3N7HA 4A4CA 4ETOA 1PULA 1MHOA 2ZNEA 1S6JA 4YRUA 1A75B 5I94A 4YI9A 1QIVA 1WY9A 2L5XB 4PE4A 1WDCC 2L5YA 3SG3A 2GV5A 1K94A 2JOJA 2O60A 2V53A 2VRGA 1OZSA 3DF0A 1K2HA 3D0YB 1CDMA 1DVIA 1CKKA 3SIBA 4CPVA 2M7NA 3BFAA 3KPXA 1NCZA 3D76A 3PFVA 2WCFA 1RWYA 2BCAA 1EG4A 2M1UA 1DJIA 1F4OA 3FIAA 5PALA 3AAKA 1TUJA 3TZ1A 3R1PA 3K21A 1B7TZ 1TUZA 5FI2A 3TDUA 2JNFA 3CR4X 5AXIA 5CPVA 1S6CA 2LP2A 5HKYA 1M45A 2M1KB 2SCPA 2MLEC 2SASA 1TNPA 4QJ4B 1FI5A 4GGNA 2A4JA
chains in the Genus database with same CATH topology
4JQ0D 1PSRA 1R2UA 2MHHA 5I2LA 2JRFA 5HKWA 3TUYC 1XA5A 2L0PA 1AVSA 3VROA 2AUCA 1S5GY 4I5JA 2M29A 3WHTB 5KSZA 2F3YA 1DGVA 1KSMA 1SCMB 1HT9A 1LINA 1YUSA 1PRWA 4WRIA 3IQOA 3BUXB 4MRXA 5KTYA 1QLSA 1YURA 3VRNA 1XFYO 2LMTA 2MRDA 2E6WA 1BODA 5JOLA 1XFVO 2M7LA 2F33A 1AHRA 2M9GA 1DTLA 1RJVA 2F3ZA 2MA2A 3CZTX 4PE1A 3NSOA 2JPTA 1YRTB 2LP3A 4HRGA 1MF8B 2E30A 5CSJA 1MR8A 1YVHA 2L4IA 1V1FA 3LCPC 3SG2A 4E68A 3A4UB 5AANA 1LA0A 1K90D 4N5XA 4WQ2A 1S26D 4R1EA 2BKHB 2JT3A 1DJXA 2I7AA 3AKBA 2LE9B 3FWCA 3PN7C 1BR1B 3JTDC 1KSOA 1NP8A 1KQMB 5ER5A 3CLNA 3SG6A 2K7CA 2L50A 2LC5A 3TUYB 2LMUA 2AAOA 1SNLA 1A29A 1QVIY 4MBEA 1KWOC 3SJSA 1CFDA 1S3PA 1J7QA 1SPYA 3CGAA 4MSPA 1A75A 1MWNA 5AERA 3FS7A 1S6IA 1JC2A 1GGWA 1TNXA 1F70A 4USLA 5CSIA 3PLFB 1BJFA 4GPLB 1SR6B 2AMIA 1QTXA 2JXLA 4N1GA 1JBAA 1WLZA 4OV2A 2LVJA 1DMOA 2MJWB 1CDPA 1Y1XA 1SCVA 5CPVA 3DD4A 1QX5B 3C1VA 1IJ6A 2Q91A 1JWDA 4YGDB 2ZN9A 1SR6C 1TCFA 1K8UA 1TRFA 1TN4A 1JSAA 2QPTA 4OCIA 2KYCA 1KK7Z 3VRRA 2QACA 1M31A 2OTGC 5ER4X 4M2PA 1YUUA 1QVIZ 5KU1A 1RTP1 1YUTA 1KQMC 3QRXA 1N65A 1OMDA 1PVAA 2G9BA 2KAVA 3EVRA 2G2BA 2BBMA 5CSFA 1YX8A 2NCPA 1SKTA 2L4HA 2CTNA 3BUMB 4XYNA 3I5FB 1M39A 1Y6WA 3IF7A 5F6TA 1U5IB 2LUCA 1BOCA 1CB1A 2MBXA 1H4BA 1GQMA 1WRKA 3HCMA 1BMOA 2HQ8A 1F4QA 1CLLA 3CWGA 3SG4A 3JVTB 1MUXA 2BL0B 2PSRA 3CS1A 1J1EA 3NSLA 1OSAA 1YTZC 1LVCD 1K9KA 1K93D 2JTZA 2ZFDA 1F71A 1CFPA 4YGAA 3O6BA 2LVKA 4WQ3A 2ZRSA 4OVNF 2LVVA 1PSBA 1QASA 2KI6C 4DRWA 2LAPA 4ICBA 2JT0A 1IQ3A 1YRUB 4P5OE 1UWOA 1QXPA 1NCXA 1A03A 1LXFC 1K9UA 2Y5IA 2FOTA 1HQVA 1BF5A 1KK8B 1S1EA 3DVKA 4D1EA 1XFUO 2LMVA 1CFFA 1QATA 1WDCB 1NCYA 1ZFSA 1DJZA 1SMGA 3WNXB 3ZWHA 5DKRA 3BUNB 1J1DA 4IL1A 2HPSA 2NZ0A 1B8LA 1OZOA 2BCXA 2EGDA 1BG1A 1QV0A 4MEWA 1JFJA 2JC2A 1ODBA 4C0LA 3PALA 4L9MA 2EC6B 1KQVA 1J7PA 4I5NB 3DVJA 3TDIA 3KO0A 1CNPA 3I5FC 1CDLA 5D69A 1ZUZA 2K7BA 2WCBA 2LLSA 3F45A 2WOSA 1ZACA 2JXCA 3GK1A 4AQJA 1F54A 5FYXA 1PALA 4TNCA 1SK6D 1FBVA 1G8IA 3JVTC 3PM8A 1CMGA 1NWDA 2WNDA 1F8HA 2H61A 4GNKB 1CLBA 5CSNA 1KFXL 3I5IC 3TS5B 2GGZA 2LV7A 2OPOA 2M49B 3D10A 5AFPA 1RFJA 1RK9A 1G4YR 1TOPA 1Y1AA 2KQ6A 3BOWB 4DCKA 1KFUS 1DT7B 3PATA 4PHMA 2K2FA 3WXAA 1C07A 1H8BA 1G33A 1R6PA 4YGEB 4JWQA 4GUKA 1BR4B 4F0ZB 2NCOA 2KDHA 3KEVA 1XFXO 2KI6D 3I5HC 1B8CA 1XYDA 2BKIB 3OP0A 4ORBB 1GJYA 1JUOA 2ZN8A 1B1GA 2KNEA 4FTGA 2BECA 2MAZA 1UUSA 1ZOTB 1DJWA 2B1UA 2F2OA 3BYAA 4PHJA 3ZNIA 2I2RE 1EJ3A 4BY4A 1QLKA 1F55A 1SL9A 5DKQA 1AK8A 1TNWA 3VRPA 2EC6C 2KFGA 3PN7B 3IQQA 1K95A 1UHJA 2H61C 1AP4A 1QS7A 2RGIA 5DKNA 2D8NA 4FQOA 1BT6A 2KSPA 1EXRA 1D1OA 2K0JA 5TNCA 1UURA 1SBJA 1S5GZ 3TS5C 1C7WA 4CFRA 1B4CA 3BUWB 1KWOB 4A4BA 2KAXA 1JFKA 2H2KA 5K89A 2CBLA 4HSZA 1UHNA 1SW8A 1W7IB 2WC8A 4C0KA 1B7TY 1B9AA 2COLB 4YGCB 4M2OA 1XK4A 4XJKA 3I5IB 2Y1NA 4Q04A 1J55A 2KFHA 2KGBC 2I18A 2KFFA 3OX6A 1L2OC 3O4YA 2KI4B 1N2DA 5IBWA 1ALWA 2LANA 1NX3A 4UPGA 4QJ3B 1FI6A 2KYFA 1AJ5A 3A8RA 3BUOB 1ALVA 5D7FA 2M8UA 1W7JB 1DJHA 4C0JA 1MQ1A 2LLUA 1NX2A 5JJGA 3OB2B 1TIZA 1IRJA 5HLOA 3H4SE 4CIDA 3KF9A 3VGOA 2M97A 1CTRA 5HKZA 4GGFA 1M46A 1QX7A 1OMVA 1AJ4A 1IH0A 1FF1A 2ZRTA 3ICBA 4PCWA 2JZIA 3CR2A 4CLNA 3OX5A 2CCMA 3E3RA 5GQQC 2BE4A 4PHKA 1N0YA 4MZJA 1PVBA 1IG5A 2F8PA 3DVEA 1K96A 1C7VA 1UP5A 5HLVA 3EVUA 1OOJA 1MXLC 1QX2A 5G08A 1IKUA 4NDDA 3OHMB 2KI4C 3TDZA 1DJYA 4HRHA 4I5LB 2R2IA 4PDZA 2Y4QA 1WRLA 1IJ5A 2KAYA 1ZMZA 1J7OA 3GK4X 1YX7A 4MZKA 2P6BB 3AKAA 2JTTA 2LNKA 2K2AA 2O5GA 4GFTA 1Y0VH 2CXJA 1TNQA 2CT9A 1WRZA 1WLMA 2TN4A 3KHEA 1NUBA 1DGUA 4DS7A 1IWQA 2IS9A 4MZLA 1B8RA 1XFWO 3HX4A 2FJUB 2HETA 3I5GB 1SY9A 2ISDA 3NSKA 3NSIA 2K8MB 2NXQA 1SRAA 1S36A 3BQ3A 1K9PA 4QJ5B 4YGBB 1CFCA 3M0WA 1TTXA 5HYDA 2FCEA 2ZNDA 3BOWA 3EKHA 3JTDB 4PE0A 1DF0A 2PVBA 2M3WA 3EK4A 1Q80A 1KK8C 4NDCA 2Q4UA 4YI8A 2F2PA 2OTGB 1SL8A 2BL0C 4NQGA 5I8NA 5I2OA 1DJGA 3CR5X 5BPJA 2Y1MA 3O2PA 2KBIA 1RROA 2LHIA 3EK8A 1SYMA 2MLFC 1M63B 1XVJA 1YR5A 1IQ5A 5AEQA 3SG5A 1JF0A 1PK0D 3FWBA 4XJKB 2LUXA 2LVIA 2L2EA 1QJTA 4BY5A 2JWWA 2LHLA 3CTNA 4M2QA 4JPZB 4ZCVA 3BXKA 5I2QA 2KOTA 1UHKA 2JT8A 3LL8B 1XK4C 1KFUL 2PASA 2WCEA 3O78A 4U8DA 1XO5A 2M0RA 4DIRA 1CLMA 1CM4A 2LM5A 2K7DA 2DOQA 1KCYA 2BBNA 1UHIA 1KFXS 1SCMC 2BE6A 4GAOA 3RLZA 1FW4A 3LK0A 1MXEA 1QIWA 1QV1A 2HF5A 4DUQA 2JU0A 1A2XA 1EG3A 2JNXA 1L7ZA 2K61A 2PRUA 4NDBA 4MVFA 1YVLA 1JF2A 1NIWA 1RECA 2I94A 1OE9B 2KHNA 3GK2A 1DF0B 3RM1A 2LLTA 4PE7A 1TCOB 4I5KA 4GBAA 2L98A 1CMFA 4OKHA 4ORCB 4PALA 4GGFC 3SG7A 1NX1A 2FCDA 1V1GA 4MLWA 1OMRA 1X02A 2PMYA 1AUIB 1XFZO 1NX0A 4HREE 2OS8C 3EKJA 1FPWA 1LA3A 5J3XA 2GGMA 1NPQA 2CNPA 2EHBA 2KQYA 1NYAA 2K7OA 4ZCUA 1EL4A 3DVMA 4P2YB 1VRKA 4AQIA 2HQWA 3EVVA 1SL7A 3PSRA 2ZKMX 1CDNA 3NXAA 2BCBA 2OS8B 2WORA 4PHNA 1NSHA 3OB1B 1LKJA 1U5IA 3SIAA 1IGVA 1Y1UA 3MSEB 4OR9B 1A4PA 3D0YA 1B47A 5B8IB 2LCPA 1UHHA 4MN0A 4CFQA 3LLEA 1OQPA 4ORAB 3I5HB 4AOMA 3EK7A 4MRYA 3LK1A 1BLQA 1J7RA 1KK7Y 4N1FA 1GGZA 2L51A 1E8AA 3GOFA 1EH2A 2KGRA 3AAJA 4YBHB 1BU3A 3VRQA 3WHUB 2NLNA 1CM1A 2PALA 2KBMA 3I5GC 3DF0B 1L2OB 2JQ6A 2JULA 4A4CA 4ETOA 1PULA 1MHOA 2ZNEA 1S6JA 4YRUA 1A75B 4YI9A 1QIVA 1WY9A 2L5XB 4PE4A 1WDCC 3SG3A 2GV5A 1K94A 2JOJA 2O60A 2V53A 2VRGA 1OZSA 3DF0A 1K2HA 3D0YB 1CDMA 1DVIA 1CKKA 3SIBA 4CPVA 2M7NA 3KPXA 1NCZA 3PFVA 2WCFA 1RWYA 2BCAA 1EG4A 2M1UA 1DJIA 1F4OA 3FIAA 5PALA 3AAKA 3TZ1A 3K21A 1B7TZ 3TDUA 2JNFA 3CR4X 5AXIA 1S6CA 2LP2A 5HKYA 1M45A 2M1KB 2SCPA 2MLEC 2SASA 1TNPA 4QJ4B 1FI5A 4GGNA 2A4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JQ0 D;  1PSR A;  1R2U A;  2MHH A;  5I2L A;  2JRF A;  5HKW A;  3TUY C;  1XA5 A;  2L0P A;  1AVS A;  3VRO A;  2AUC A;  1S5G Y;  4I5J A;  2M29 A;  3WHT B;  5KSZ A;  2F3Y A;  1DGV A;  1KSM A;  1SCM B;  1HT9 A;  1LIN A;  1YUS A;  1PRW A;  4WRI A;  3IQO A;  3BUX B;  4MRX A;  5KTY A;  1QLS A;  1YUR A;  3VRN A;  1XFY O;  2LMT A;  2MRD A;  2E6W A;  1BOD A;  5JOL A;  1XFV O;  2M7L A;  2F33 A;  1AHR A;  2M9G A;  1DTL A;  1RJV A;  2F3Z A;  2MA2 A;  3CZT X;  4PE1 A;  3NSO A;  2JPT A;  1YRT B;  2LP3 A;  4HRG A;  1MF8 B;  2E30 A;  5CSJ A;  1MR8 A;  1YVH A;  2L4I A;  1V1F A;  3LCP C;  3SG2 A;  4E68 A;  3A4U B;  5AAN A;  1LA0 A;  1K90 D;  4N5X A;  4WQ2 A;  1S26 D;  4R1E A;  2BKH B;  2JT3 A;  1DJX A;  2I7A A;  3AKB A;  2LE9 B;  3FWC A;  3PN7 C;  1BR1 B;  3JTD C;  1KSO A;  1NP8 A;  1KQM B;  5ER5 A;  3CLN A;  3SG6 A;  2K7C A;  2L50 A;  2LC5 A;  3TUY B;  2LMU A;  2AAO A;  1SNL A;  1A29 A;  1QVI Y;  4MBE A;  1KWO C;  3SJS A;  1CFD A;  1S3P A;  1J7Q A;  1SPY A;  3CGA A;  4MSP A;  1A75 A;  1MWN A;  5AER A;  3FS7 A;  1S6I A;  1JC2 A;  1GGW A;  1TNX A;  1F70 A;  4USL A;  5CSI A;  3PLF B;  1BJF A;  4GPL B;  1SR6 B;  2AMI A;  1QTX A;  2JXL A;  4N1G A;  1JBA A;  1WLZ A;  4OV2 A;  2LVJ A;  1DMO A;  2MJW B;  1CDP A;  1Y1X A;  1SCV A;  5CPV A;  3DD4 A;  1QX5 B;  3C1V A;  1IJ6 A;  2Q91 A;  1JWD A;  4YGD B;  2ZN9 A;  1SR6 C;  1TCF A;  1K8U A;  1TRF A;  1TN4 A;  1JSA A;  2QPT A;  4OCI A;  2KYC A;  1KK7 Z;  3VRR A;  2QAC A;  1M31 A;  2OTG C;  5ER4 X;  4M2P A;  1YUU A;  1QVI Z;  5KU1 A;  1RTP 1;  1YUT A;  1KQM C;  3QRX A;  1N65 A;  1OMD A;  1PVA A;  2G9B A;  2KAV A;  3EVR A;  2G2B A;  2BBM A;  5CSF A;  1YX8 A;  2NCP A;  1SKT A;  2L4H A;  2CTN A;  3BUM B;  4XYN A;  3I5F B;  1M39 A;  1Y6W A;  3IF7 A;  5F6T A;  1U5I B;  2LUC A;  1BOC A;  1CB1 A;  2MBX A;  1H4B A;  1GQM A;  1WRK A;  3HCM A;  1BMO A;  2HQ8 A;  1F4Q A;  1CLL A;  3CWG A;  3SG4 A;  3JVT B;  1MUX A;  2BL0 B;  2PSR A;  3CS1 A;  1J1E A;  3NSL A;  1OSA A;  1YTZ C;  1LVC D;  1K9K A;  1K93 D;  2JTZ A;  2ZFD A;  1F71 A;  1CFP A;  4YGA A;  3O6B A;  2LVK A;  4WQ3 A;  2ZRS A;  4OVN F;  2LVV A;  1PSB A;  1QAS A;  2KI6 C;  4DRW A;  2LAP A;  4ICB A;  2JT0 A;  1IQ3 A;  1YRU B;  4P5O E;  1UWO A;  1QXP A;  1NCX A;  1A03 A;  1LXF C;  1K9U A;  2Y5I A;  2FOT A;  1HQV A;  1BF5 A;  1KK8 B;  1S1E A;  3DVK A;  4D1E A;  1XFU O;  2LMV A;  1CFF A;  1QAT A;  1WDC B;  1NCY A;  1ZFS A;  1DJZ A;  1SMG A;  3WNX B;  3ZWH A;  5DKR A;  3BUN B;  1J1D A;  4IL1 A;  2HPS A;  2NZ0 A;  1B8L A;  1OZO A;  2BCX A;  2EGD A;  1BG1 A;  1QV0 A;  4MEW A;  1JFJ A;  2JC2 A;  1ODB A;  4C0L A;  3PAL A;  4L9M A;  2EC6 B;  1KQV A;  1J7P A;  4I5N B;  3DVJ A;  3TDI A;  3KO0 A;  1CNP A;  3I5F C;  1CDL A;  5D69 A;  1ZUZ A;  2K7B A;  2WCB A;  2LLS A;  3F45 A;  2WOS A;  1ZAC A;  2JXC A;  3GK1 A;  4AQJ A;  1F54 A;  5FYX A;  1PAL A;  4TNC A;  1SK6 D;  1FBV A;  1G8I A;  3JVT C;  3PM8 A;  1CMG A;  1NWD A;  2WND A;  1F8H A;  2H61 A;  4GNK B;  1CLB A;  5CSN A;  1KFX L;  3I5I C;  3TS5 B;  2GGZ A;  2LV7 A;  2OPO A;  2M49 B;  3D10 A;  5AFP A;  1RFJ A;  1RK9 A;  1G4Y R;  1TOP A;  1Y1A A;  2KQ6 A;  3BOW B;  4DCK A;  1KFU S;  1DT7 B;  3PAT A;  4PHM A;  2K2F A;  3WXA A;  1C07 A;  1H8B A;  1G33 A;  1R6P A;  4YGE B;  4JWQ A;  4GUK A;  1BR4 B;  4F0Z B;  2NCO A;  2KDH A;  3KEV A;  1XFX O;  2KI6 D;  3I5H C;  1B8C A;  1XYD A;  2BKI B;  3OP0 A;  4ORB B;  1GJY A;  1JUO A;  2ZN8 A;  1B1G A;  2KNE A;  4FTG A;  2BEC A;  2MAZ A;  1UUS A;  1ZOT B;  1DJW A;  2B1U A;  2F2O A;  3BYA A;  4PHJ A;  3ZNI A;  2I2R E;  1EJ3 A;  4BY4 A;  1QLK A;  1F55 A;  1SL9 A;  5DKQ A;  1AK8 A;  1TNW A;  3VRP A;  2EC6 C;  2KFG A;  3PN7 B;  3IQQ A;  1K95 A;  1UHJ A;  2H61 C;  1AP4 A;  1QS7 A;  2RGI A;  5DKN A;  2D8N A;  4FQO A;  1BT6 A;  2KSP A;  1EXR A;  1D1O A;  2K0J A;  5TNC A;  1UUR A;  1SBJ A;  1S5G Z;  3TS5 C;  1C7W A;  4CFR A;  1B4C A;  3BUW B;  1KWO B;  4A4B A;  2KAX A;  1JFK A;  2H2K A;  5K89 A;  2CBL A;  4HSZ A;  1UHN A;  1SW8 A;  1W7I B;  2WC8 A;  4C0K A;  1B7T Y;  1B9A A;  2COL B;  4YGC B;  4M2O A;  1XK4 A;  4XJK A;  3I5I B;  2Y1N A;  4Q04 A;  1J55 A;  2KFH A;  2KGB C;  2I18 A;  2KFF A;  3OX6 A;  1L2O C;  3O4Y A;  2KI4 B;  1N2D A;  5IBW A;  1ALW A;  2LAN A;  1NX3 A;  4UPG A;  4QJ3 B;  1FI6 A;  2KYF A;  1AJ5 A;  3A8R A;  3BUO B;  1ALV A;  5D7F A;  2M8U A;  1W7J B;  1DJH A;  4C0J A;  1MQ1 A;  2LLU A;  1NX2 A;  5JJG A;  3OB2 B;  1TIZ A;  1IRJ A;  5HLO A;  3H4S E;  4CID A;  3KF9 A;  3VGO A;  2M97 A;  1CTR A;  5HKZ A;  4GGF A;  1M46 A;  1QX7 A;  1OMV A;  1AJ4 A;  1IH0 A;  1FF1 A;  2ZRT A;  3ICB A;  4PCW A;  2JZI A;  3CR2 A;  4CLN A;  3OX5 A;  2CCM A;  3E3R A;  5GQQ C;  2BE4 A;  4PHK A;  1N0Y A;  4MZJ A;  1PVB A;  1IG5 A;  2F8P A;  3DVE A;  1K96 A;  1C7V A;  1UP5 A;  5HLV A;  3EVU A;  1OOJ A;  1MXL C;  1QX2 A;  5G08 A;  1IKU A;  4NDD A;  3OHM B;  2KI4 C;  3TDZ A;  1DJY A;  4HRH A;  4I5L B;  2R2I A;  4PDZ A;  2Y4Q A;  1WRL A;  1IJ5 A;  2KAY A;  1ZMZ A;  1J7O A;  3GK4 X;  1YX7 A;  4MZK A;  2P6B B;  3AKA A;  2JTT A;  2LNK A;  2K2A A;  2O5G A;  4GFT A;  1Y0V H;  2CXJ A;  1TNQ A;  2CT9 A;  1WRZ A;  1WLM A;  2TN4 A;  3KHE A;  1NUB A;  1DGU A;  4DS7 A;  1IWQ A;  2IS9 A;  4MZL A;  1B8R A;  1XFW O;  3HX4 A;  2FJU B;  2HET A;  3I5G B;  1SY9 A;  2ISD A;  3NSK A;  3NSI A;  2K8M B;  2NXQ A;  1SRA A;  1S36 A;  3BQ3 A;  1K9P A;  4QJ5 B;  4YGB B;  1CFC A;  3M0W A;  1TTX A;  5HYD A;  2FCE A;  2ZND A;  3BOW A;  3EKH A;  3JTD B;  4PE0 A;  1DF0 A;  2PVB A;  2M3W A;  3EK4 A;  1Q80 A;  1KK8 C;  4NDC A;  2Q4U A;  4YI8 A;  2F2P A;  2OTG B;  1SL8 A;  2BL0 C;  4NQG A;  5I8N A;  5I2O A;  1DJG A;  3CR5 X;  5BPJ A;  2Y1M A;  3O2P A;  2KBI A;  1RRO A;  2LHI A;  3EK8 A;  1SYM A;  2MLF C;  1M63 B;  1XVJ A;  1YR5 A;  1IQ5 A;  5AEQ A;  3SG5 A;  1JF0 A;  1PK0 D;  3FWB A;  4XJK B;  2LUX A;  2LVI A;  2L2E A;  1QJT A;  4BY5 A;  2JWW A;  2LHL A;  3CTN A;  4M2Q A;  4JPZ B;  4ZCV A;  3BXK A;  5I2Q A;  2KOT A;  1UHK A;  2JT8 A;  3LL8 B;  1XK4 C;  1KFU L;  2PAS A;  2WCE A;  3O78 A;  4U8D A;  1XO5 A;  2M0R A;  4DIR A;  1CLM A;  1CM4 A;  2LM5 A;  2K7D A;  2DOQ A;  1KCY A;  2BBN A;  1UHI A;  1KFX S;  1SCM C;  2BE6 A;  4GAO A;  3RLZ A;  1FW4 A;  3LK0 A;  1MXE A;  1QIW A;  1QV1 A;  2HF5 A;  4DUQ A;  2JU0 A;  1A2X A;  1EG3 A;  2JNX A;  1L7Z A;  2K61 A;  2PRU A;  4NDB A;  4MVF A;  1YVL A;  1JF2 A;  1NIW A;  1REC A;  2I94 A;  1OE9 B;  2KHN A;  3GK2 A;  1DF0 B;  3RM1 A;  2LLT A;  4PE7 A;  1TCO B;  4I5K A;  4GBA A;  2L98 A;  1CMF A;  4OKH A;  4ORC B;  4PAL A;  4GGF C;  3SG7 A;  1NX1 A;  2FCD A;  1V1G A;  4MLW A;  1OMR A;  1X02 A;  2PMY A;  1AUI B;  1XFZ O;  1NX0 A;  4HRE E;  2OS8 C;  3EKJ A;  1FPW A;  1LA3 A;  5J3X A;  2GGM A;  1NPQ A;  2CNP A;  2EHB A;  2KQY A;  1NYA A;  2K7O A;  4ZCU A;  1EL4 A;  3DVM A;  4P2Y B;  1VRK A;  4AQI A;  2HQW A;  3EVV A;  1SL7 A;  3PSR A;  2ZKM X;  1CDN A;  3NXA A;  2BCB A;  2OS8 B;  2WOR A;  4PHN A;  1NSH A;  3OB1 B;  1LKJ A;  1U5I A;  3SIA A;  1IGV A;  1Y1U A;  3MSE B;  4OR9 B;  1A4P A;  3D0Y A;  1B47 A;  5B8I B;  2LCP A;  1UHH A;  4MN0 A;  4CFQ A;  3LLE A;  1OQP A;  4ORA B;  3I5H B;  4AOM A;  3EK7 A;  4MRY A;  3LK1 A;  1BLQ A;  1J7R A;  1KK7 Y;  4N1F A;  1GGZ A;  2L51 A;  1E8A A;  3GOF A;  1EH2 A;  2KGR A;  3AAJ A;  4YBH B;  1BU3 A;  3VRQ A;  3WHU B;  2NLN A;  1CM1 A;  2PAL A;  2KBM A;  3I5G C;  3DF0 B;  1L2O B;  2JQ6 A;  2JUL A;  4A4C A;  4ETO A;  1PUL A;  1MHO A;  2ZNE A;  1S6J A;  4YRU A;  1A75 B;  4YI9 A;  1QIV A;  1WY9 A;  2L5X B;  4PE4 A;  1WDC C;  3SG3 A;  2GV5 A;  1K94 A;  2JOJ A;  2O60 A;  2V53 A;  2VRG A;  1OZS A;  3DF0 A;  1K2H A;  3D0Y B;  1CDM A;  1DVI A;  1CKK A;  3SIB A;  4CPV A;  2M7N A;  3KPX A;  1NCZ A;  3PFV A;  2WCF A;  1RWY A;  2BCA A;  1EG4 A;  2M1U A;  1DJI A;  1F4O A;  3FIA A;  5PAL A;  3AAK A;  3TZ1 A;  3K21 A;  1B7T Z;  3TDU A;  2JNF A;  3CR4 X;  5AXI A;  1S6C A;  2LP2 A;  5HKY A;  1M45 A;  2M1K B;  2SCP A;  2MLE C;  2SAS A;  1TNP A;  4QJ4 B;  1FI5 A;  4GGN A;  2A4J A; 
#chains in the Genus database with same CATH topology
 4JQ0 D;  1PSR A;  1R2U A;  2MHH A;  5I2L A;  2JRF A;  5HKW A;  3TUY C;  1XA5 A;  2L0P A;  1AVS A;  3VRO A;  1OOH A;  1S5G Y;  2AUC A;  2KLE A;  4I5J A;  2M29 A;  3WHT B;  3R1V A;  3DY9 A;  5KSZ A;  2QEV A;  2F3Y A;  1DGV A;  1KSM A;  1SCM B;  1HT9 A;  1LIN A;  1YUS A;  1PRW A;  1Z2C B;  3IQO A;  3BUX B;  3D73 A;  4WRI A;  4MRX A;  5KTY A;  1QLS A;  1YUR A;  3VRN A;  1XFY O;  2LMT A;  2MRD A;  3D77 A;  2E6W A;  1BOD A;  5JOL A;  1OOI X;  1XFV O;  2M7L A;  2F33 A;  1AHR A;  2M9G A;  1DTL A;  1RJV A;  2F3Z A;  5D3O A;  2MA2 A;  3CZT X;  3FE8 A;  4PE1 A;  2QEH A;  3CDN A;  2JPT A;  3NSO A;  1YRT B;  2LP3 A;  4INW A;  4HRG A;  1MF8 B;  2E30 A;  5CSJ A;  1MR8 A;  1YVH A;  2L4I A;  1V1F A;  3LCP C;  5EL2 A;  3SG2 A;  4E68 A;  2QEB A;  3A4U B;  5AAN A;  1LA0 A;  1K90 D;  3D74 A;  4N5X A;  1TWO A;  4WQ2 A;  2P71 A;  1S26 D;  4R1E A;  2BKH B;  2JT3 A;  1DJX A;  2I7A A;  3AKB A;  2LE9 B;  3FWC A;  3PN7 C;  1BR1 B;  3JTD C;  1KSO A;  1NP8 A;  2BNX A;  1KQM B;  5ER5 A;  3CLN A;  3SG6 A;  2K7C A;  2L50 A;  2LC5 A;  2JPO A;  3TUY B;  2LMU A;  4IJ7 A;  3CZ0 A;  2AAO A;  3D75 A;  1SNL A;  1A29 A;  1QVI Y;  4MBE A;  1DEL A;  1KWO C;  3SJS A;  4FQT A;  1CFD A;  1S3P A;  1J7Q A;  1SPY A;  3CGA A;  4MSP A;  1A75 A;  3L4L A;  2P70 A;  1MWN A;  5AER A;  3FS7 A;  1S6I A;  1QWV A;  1JC2 A;  1GGW A;  3BFH A;  1TNX A;  1F70 A;  4USL A;  5CSI A;  3S0B A;  3PLF B;  1BJF A;  5FI7 A;  1DC1 A;  4GPL B;  1SR6 B;  2AMI A;  1QTX A;  2JXL A;  4N1G A;  1JBA A;  1WLZ A;  4OV2 A;  2LVJ A;  1DMO A;  2MJW B;  1CDP A;  1Y1X A;  1SCV A;  3K1E A;  3DD4 A;  3NHI A;  1QX5 B;  3C1V A;  1IJ6 A;  2Q91 A;  2FJY A;  3DYE A;  3R72 A;  4YGD B;  2ZN9 A;  1JWD A;  1Z4H A;  1SR6 C;  1TCF A;  1K8U A;  1TRF A;  1TN4 A;  1JSA A;  2QPT A;  4OCI A;  2KYC A;  1KK7 Z;  3VRR A;  2QAC A;  1M31 A;  2OTG C;  3B87 A;  5ER4 X;  4M2P A;  1YUU A;  1QVI Z;  5KU1 A;  1RTP 1;  1YUT A;  1KQM C;  3QRX A;  1N65 A;  1OMD A;  1PVA A;  2G9B A;  2KAV A;  3EVR A;  2G2B A;  2BBM A;  5CSF A;  1YX8 A;  2NCP A;  1SKT A;  2L4H A;  2CTN A;  3BUM B;  3BJH A;  4XYN A;  3I5F B;  1M39 A;  1Y6W A;  3IF7 A;  5F6T A;  1U5I B;  2LUC A;  1BOC A;  1CB1 A;  2MBX A;  1H4B A;  1GQM A;  1WRK A;  3HCM A;  1GM0 A;  1BMO A;  3L47 A;  2HQ8 A;  1F4Q A;  1SSE B;  1CLL A;  1LS8 A;  3CWG A;  3SG4 A;  3JVT B;  1MUX A;  2BL0 B;  2PSR A;  3CS1 A;  1J1E A;  1P28 A;  3NSL A;  1OSA A;  1YTZ C;  1LVC D;  1K9K A;  1K93 D;  2JTZ A;  2ZFD A;  1F71 A;  1CFP A;  3PM2 A;  4YGA A;  3O6B A;  2LVK A;  4WQ3 A;  4PT1 A;  3S0D A;  1C3Y A;  2ZRS A;  4OVN F;  3UNW A;  2L2C A;  2LVV A;  1PSB A;  1QAS A;  2KI6 C;  3S0G A;  2LAP A;  4DRW A;  3L4A A;  4ICB A;  4U8D A;  2JT0 A;  1IQ3 A;  1YRU B;  4P5O E;  1UWO A;  1QXP A;  1NCX A;  1A03 A;  1LXF C;  1K9U A;  2Y5I A;  2FOT A;  1HQV A;  1BF5 A;  3B86 A;  1KK8 B;  1S1E A;  3DVK A;  4D1E A;  1T14 A;  2PQL A;  4KYN A;  1XFU O;  2LMV A;  1CFF A;  1OOG A;  1QAT A;  1WDC B;  3CYZ A;  1NCY A;  1ZFS A;  1DJZ A;  1SMG A;  3WNX B;  3ZWH A;  5DKR A;  3BUN B;  1J1D A;  4IL1 A;  2HPS A;  3CZ2 A;  2NZ0 A;  1B8L A;  1OZO A;  2BCX A;  2EGD A;  1BG1 A;  1QV0 A;  4MEW A;  1JFJ A;  2JC2 A;  1ODB A;  4C0L A;  3PAL A;  4L9M A;  2EC6 B;  3B7A A;  1KQV A;  1J7P A;  4I5N B;  3DVJ A;  3TDI A;  3KO0 A;  4OZD A;  3I5F C;  1CNP A;  1CDL A;  5D69 A;  1ZUZ A;  2ERB A;  2K7B A;  2WCB A;  2LLS A;  3F45 A;  2WOS A;  1ZAC A;  2JXC A;  3GK1 A;  4AQJ A;  1F54 A;  5FYX A;  1PAL A;  3SS4 A;  4TNC A;  1SK6 D;  1FBV A;  1G8I A;  3JVT C;  3PM8 A;  1CMG A;  1NWD A;  2WND A;  1F8H A;  2H61 A;  4GNK B;  2PYQ A;  2WCL A;  1CLB A;  5CSN A;  1KFX L;  3DZT A;  3I5I C;  3TS5 B;  2GGZ A;  2LV7 A;  2OPO A;  2M49 B;  2WCM A;  3D10 A;  5AFP A;  1RFJ A;  1RK9 A;  1G4Y R;  1TOP A;  1Y1A A;  2KQ6 A;  3BOW B;  3NHT A;  1KFU S;  4DCK A;  3PAT A;  4PHM A;  2K2F A;  3WXA A;  1DT7 B;  1H8B A;  1G33 A;  1R6P A;  4YGE B;  4JWQ A;  4GUK A;  1BR4 B;  3IVT A;  4F0Z B;  2NCO A;  2KDH A;  3KEV A;  3FE9 A;  1XFX O;  2KI6 D;  3I5H C;  1B8C A;  3DXL A;  1XYD A;  2BKI B;  3OP0 A;  4ORB B;  1GJY A;  1JUO A;  2ZN8 A;  1B1G A;  2KNE A;  2KLD A;  4FTG A;  2BEC A;  1DEK A;  2MAZ A;  1UUS A;  1ZOT B;  1DJW A;  2B1U A;  2F2O A;  3BYA A;  4PHJ A;  3ZNI A;  2I2R E;  1EJ3 A;  4BY4 A;  1QLK A;  1F55 A;  1SL9 A;  5DKQ A;  2WC5 A;  1ORG A;  1AK8 A;  1TNW A;  3VRP A;  2EC6 C;  2KFG A;  3SS3 A;  3PN7 B;  3IQQ A;  2YGU A;  1K95 A;  1UHJ A;  2H61 C;  1AP4 A;  2KPH A;  1QS7 A;  2RGI A;  3EG5 B;  5DKN A;  2D8N A;  4FQO A;  1BT6 A;  2KSP A;  1EXR A;  1D1O A;  2K0J A;  5TNC A;  1UUR A;  1SBJ A;  1S5G Z;  3O4X A;  1C7W A;  3TS5 C;  4CFR A;  1B4C A;  3BUW B;  1KWO B;  4A4B A;  2KAX A;  1JFK A;  2H2K A;  5K89 A;  2CBL A;  4HSZ A;  1UHN A;  1SW8 A;  1W7I B;  2WC8 A;  4C0K A;  1B7T Y;  1B9A A;  2COL B;  4YGC B;  3B88 A;  4M2O A;  1XK4 A;  4XJK A;  3I5I B;  2Y1N A;  4Q04 A;  1J55 A;  2KFH A;  2KGB C;  2I18 A;  2KFF A;  3OX6 A;  1L2O C;  2QDI A;  3R1O A;  3O4Y A;  2QEO A;  2KI4 B;  1N2D A;  5IBW A;  3RZS A;  1ALW A;  2LAN A;  1NX3 A;  4UPG A;  4QJ3 B;  1FI6 A;  2KYF A;  2WC6 A;  1AJ5 A;  3A8R A;  3BUO B;  1W9Z A;  1ALV A;  5D7F A;  2M8U A;  1W7J B;  1DJH A;  4C0J A;  1MQ1 A;  2LLU A;  1NX2 A;  5JJG A;  3OB2 B;  1TIZ A;  1IRJ A;  5HLO A;  3H4S E;  4CID A;  1DQE A;  3KF9 A;  3VGO A;  2M97 A;  1CTR A;  5HKZ A;  4GGF A;  1M46 A;  1QX7 A;  5FI6 A;  1OMV A;  1AJ4 A;  1IH0 A;  4JD9 A;  1FF1 A;  2ZRT A;  3ICB A;  4PCW A;  2JZI A;  3CR2 A;  4CLN A;  3OX5 A;  2CCM A;  3E3R A;  5GQQ C;  2BE4 A;  4PHK A;  1N0Y A;  4MZJ A;  1PVB A;  1IG5 A;  2F8P A;  3DVE A;  1K96 A;  1C7V A;  1UP5 A;  5HLV A;  3NGV A;  3EVU A;  1OOJ A;  1MXL C;  1QX2 A;  5G08 A;  1IKU A;  4NDD A;  3OHM B;  2KI4 C;  3TDZ A;  1DJY A;  3B6X A;  4HRH A;  4I5L B;  2R2I A;  4PDZ A;  2Y4Q A;  1WRL A;  1IJ5 A;  2KAY A;  1ZMZ A;  1J7O A;  3GK4 X;  1YX7 A;  4MZK A;  2P6B B;  3AKA A;  2JTT A;  2LNK A;  2K2A A;  2O5G A;  4GFT A;  1Y0V H;  2CXJ A;  1TNQ A;  2CT9 A;  1WRZ A;  3CAB A;  4JKT A;  1WLM A;  2TN4 A;  3KHE A;  1NUB A;  1DGU A;  4DS7 A;  1IWQ A;  2IS9 A;  4MZL A;  1B8R A;  1XFW O;  3HX4 A;  2FJU B;  5DIC A;  2HET A;  3I5G B;  1SY9 A;  2ISD A;  3NSK A;  3NSI A;  2K8M B;  2NXQ A;  1SRA A;  1S36 A;  3BQ3 A;  1K9P A;  4QJ5 B;  4YGB B;  1CFC A;  3M0W A;  1TTX A;  5HYD A;  2FCE A;  2ZND A;  3BOW A;  3EKH A;  3JTD B;  4PE0 A;  3S0A A;  1DF0 A;  2PVB A;  1OOF A;  2M3W A;  3EK4 A;  1Q80 A;  1KK8 C;  3QME A;  4NDC A;  2Q4U A;  4YI8 A;  2F2P A;  2OTG B;  1SL8 A;  1XFR A;  2BL0 C;  4NQG A;  5I8N A;  5I2O A;  1DJG A;  3CR5 X;  3PJI A;  5BPJ A;  2Y1M A;  3O2P A;  2KBI A;  1RRO A;  2LHI A;  2WCK A;  1SYM A;  2MLF C;  3EK8 A;  1M63 B;  1XVJ A;  3CZ1 A;  1YR5 A;  3FE6 A;  2BAP A;  1C07 A;  1IQ5 A;  5AEQ A;  3OGN A;  1JF0 A;  1PK0 D;  3FWB A;  4XJK B;  3SG5 A;  3VB1 A;  2LUX A;  2LVI A;  2L2E A;  1QJT A;  3UO9 A;  4BY5 A;  2JWW A;  2LHL A;  2WCJ A;  3CTN A;  4M2Q A;  4JPZ B;  4ZCV A;  3BXK A;  5I2Q A;  2KOT A;  5HL1 A;  1C3Z A;  1UHK A;  2JT8 A;  3BFB A;  1XK4 C;  1KFU L;  2PAS A;  2WCE A;  3LL8 B;  3O78 A;  1XO5 A;  2M0R A;  4DIR A;  1CLM A;  1CM4 A;  2LM5 A;  3V2L A;  2K7D A;  2DOQ A;  1KCY A;  2BBN A;  1UHI A;  1OW4 A;  1KFX S;  1SCM C;  2BE6 A;  4GAO A;  3RLZ A;  1FW4 A;  3LK0 A;  1MXE A;  1QIW A;  1QV1 A;  2HF5 A;  4DUQ A;  2JU0 A;  1A2X A;  1EG3 A;  2H8V A;  2JNX A;  1L7Z A;  2K61 A;  2PRU A;  4NDB A;  4MVF A;  1YVL A;  1JF2 A;  1NIW A;  1REC A;  2I94 A;  2WCH A;  1OE9 B;  2KHN A;  3GK2 A;  1DF0 B;  3RM1 A;  2LLT A;  3D78 A;  4PE7 A;  1TCO B;  4I5K A;  4GBA A;  2L98 A;  3SS5 A;  1CMF A;  4OKH A;  4ORC B;  4PAL A;  4GGF C;  3SG7 A;  1NX1 A;  2FCD A;  1V1G A;  4MLW A;  1OMR A;  1X02 A;  2PMY A;  1AUI B;  1XFZ O;  1NX0 A;  4HRE E;  2OS8 C;  1IIO A;  3EKJ A;  1FPW A;  1LA3 A;  5J3X A;  2GGM A;  2K60 A;  1NPQ A;  2CNP A;  2EHB A;  3Q8I A;  2KQY A;  1NYA A;  2K7O A;  4ZCU A;  1EL4 A;  3DVM A;  4P2Y B;  1VRK A;  4AQI A;  4F7F A;  2HQW A;  3EVV A;  1SL7 A;  3PSR A;  2ZKM X;  1CDN A;  3NXA A;  2BCB A;  2GTE A;  2OS8 B;  2WOR A;  4PHN A;  1NSH A;  3OB1 B;  1LKJ A;  1U5I A;  3S0F A;  3SIA A;  1IGV A;  1Y1U A;  3MSE B;  4OR9 B;  1A4P A;  3D0Y A;  3OBV A;  1B47 A;  5B8I B;  4INX A;  2LCP A;  1UHH A;  4MN0 A;  4CFQ A;  3LLE A;  1OQP A;  4ORA B;  3I5H B;  4AOM A;  3EK7 A;  4MRY A;  3LK1 A;  1BLQ A;  1J7R A;  1KK7 Y;  4N1F A;  1GGZ A;  2L51 A;  1E8A A;  3GOF A;  1EH2 A;  2KGR A;  3AAJ A;  4YBH B;  1BU3 A;  3VRQ A;  3WHU B;  2NLN A;  3S0E A;  1CM1 A;  2PAL A;  2KBM A;  3I5G C;  3DF0 B;  1L2O B;  2JQ6 A;  2JUL A;  3N7H A;  4A4C A;  4ETO A;  1PUL A;  1MHO A;  2ZNE A;  1S6J A;  4YRU A;  1A75 B;  5I94 A;  4YI9 A;  1QIV A;  1WY9 A;  2L5X B;  4PE4 A;  1WDC C;  2L5Y A;  3SG3 A;  2GV5 A;  1K94 A;  2JOJ A;  2O60 A;  2V53 A;  2VRG A;  1OZS A;  3DF0 A;  1K2H A;  3D0Y B;  1CDM A;  1DVI A;  1CKK A;  3SIB A;  4CPV A;  2M7N A;  3BFA A;  3KPX A;  1NCZ A;  3D76 A;  3PFV A;  2WCF A;  1RWY A;  2BCA A;  1EG4 A;  2M1U A;  1DJI A;  1F4O A;  3FIA A;  5PAL A;  3AAK A;  1TUJ A;  3TZ1 A;  3R1P A;  3K21 A;  1B7T Z;  1TUZ A;  5FI2 A;  3TDU A;  2JNF A;  3CR4 X;  5AXI A;  5CPV A;  1S6C A;  2LP2 A;  5HKY A;  1M45 A;  2M1K B;  2SCP A;  2MLE C;  2SAS A;  1TNP A;  4QJ4 B;  1FI5 A;  4GGN A;  2A4J A; 
#chains in the Genus database with same CATH homology
 4JQ0 D;  1PSR A;  1R2U A;  2MHH A;  5I2L A;  2JRF A;  5HKW A;  3TUY C;  1XA5 A;  2L0P A;  1AVS A;  3VRO A;  2AUC A;  1S5G Y;  4I5J A;  2M29 A;  3WHT B;  5KSZ A;  2F3Y A;  1DGV A;  1KSM A;  1SCM B;  1HT9 A;  1LIN A;  1YUS A;  1PRW A;  4WRI A;  3IQO A;  3BUX B;  4MRX A;  5KTY A;  1QLS A;  1YUR A;  3VRN A;  1XFY O;  2LMT A;  2MRD A;  2E6W A;  1BOD A;  5JOL A;  1XFV O;  2M7L A;  2F33 A;  1AHR A;  2M9G A;  1DTL A;  1RJV A;  2F3Z A;  2MA2 A;  3CZT X;  4PE1 A;  3NSO A;  2JPT A;  1YRT B;  2LP3 A;  4HRG A;  1MF8 B;  2E30 A;  5CSJ A;  1MR8 A;  1YVH A;  2L4I A;  1V1F A;  3LCP C;  3SG2 A;  4E68 A;  3A4U B;  5AAN A;  1LA0 A;  1K90 D;  4N5X A;  4WQ2 A;  1S26 D;  4R1E A;  2BKH B;  2JT3 A;  1DJX A;  2I7A A;  3AKB A;  2LE9 B;  3FWC A;  3PN7 C;  1BR1 B;  3JTD C;  1KSO A;  1NP8 A;  1KQM B;  5ER5 A;  3CLN A;  3SG6 A;  2K7C A;  2L50 A;  2LC5 A;  3TUY B;  2LMU A;  2AAO A;  1SNL A;  1A29 A;  1QVI Y;  4MBE A;  1KWO C;  3SJS A;  1CFD A;  1S3P A;  1J7Q A;  1SPY A;  3CGA A;  4MSP A;  1A75 A;  1MWN A;  5AER A;  3FS7 A;  1S6I A;  1JC2 A;  1GGW A;  1TNX A;  1F70 A;  4USL A;  5CSI A;  3PLF B;  1BJF A;  4GPL B;  1SR6 B;  2AMI A;  1QTX A;  2JXL A;  4N1G A;  1JBA A;  1WLZ A;  4OV2 A;  2LVJ A;  1DMO A;  2MJW B;  1CDP A;  1Y1X A;  1SCV A;  5CPV A;  3DD4 A;  1QX5 B;  3C1V A;  1IJ6 A;  2Q91 A;  1JWD A;  4YGD B;  2ZN9 A;  1SR6 C;  1TCF A;  1K8U A;  1TRF A;  1TN4 A;  1JSA A;  2QPT A;  4OCI A;  2KYC A;  1KK7 Z;  3VRR A;  2QAC A;  1M31 A;  2OTG C;  5ER4 X;  4M2P A;  1YUU A;  1QVI Z;  5KU1 A;  1RTP 1;  1YUT A;  1KQM C;  3QRX A;  1N65 A;  1OMD A;  1PVA A;  2G9B A;  2KAV A;  3EVR A;  2G2B A;  2BBM A;  5CSF A;  1YX8 A;  2NCP A;  1SKT A;  2L4H A;  2CTN A;  3BUM B;  4XYN A;  3I5F B;  1M39 A;  1Y6W A;  3IF7 A;  5F6T A;  1U5I B;  2LUC A;  1BOC A;  1CB1 A;  2MBX A;  1H4B A;  1GQM A;  1WRK A;  3HCM A;  1BMO A;  2HQ8 A;  1F4Q A;  1CLL A;  3CWG A;  3SG4 A;  3JVT B;  1MUX A;  2BL0 B;  2PSR A;  3CS1 A;  1J1E A;  3NSL A;  1OSA A;  1YTZ C;  1LVC D;  1K9K A;  1K93 D;  2JTZ A;  2ZFD A;  1F71 A;  1CFP A;  4YGA A;  3O6B A;  2LVK A;  4WQ3 A;  2ZRS A;  4OVN F;  2LVV A;  1PSB A;  1QAS A;  2KI6 C;  4DRW A;  2LAP A;  4ICB A;  2JT0 A;  1IQ3 A;  1YRU B;  4P5O E;  1UWO A;  1QXP A;  1NCX A;  1A03 A;  1LXF C;  1K9U A;  2Y5I A;  2FOT A;  1HQV A;  1BF5 A;  1KK8 B;  1S1E A;  3DVK A;  4D1E A;  1XFU O;  2LMV A;  1CFF A;  1QAT A;  1WDC B;  1NCY A;  1ZFS A;  1DJZ A;  1SMG A;  3WNX B;  3ZWH A;  5DKR A;  3BUN B;  1J1D A;  4IL1 A;  2HPS A;  2NZ0 A;  1B8L A;  1OZO A;  2BCX A;  2EGD A;  1BG1 A;  1QV0 A;  4MEW A;  1JFJ A;  2JC2 A;  1ODB A;  4C0L A;  3PAL A;  4L9M A;  2EC6 B;  1KQV A;  1J7P A;  4I5N B;  3DVJ A;  3TDI A;  3KO0 A;  1CNP A;  3I5F C;  1CDL A;  5D69 A;  1ZUZ A;  2K7B A;  2WCB A;  2LLS A;  3F45 A;  2WOS A;  1ZAC A;  2JXC A;  3GK1 A;  4AQJ A;  1F54 A;  5FYX A;  1PAL A;  4TNC A;  1SK6 D;  1FBV A;  1G8I A;  3JVT C;  3PM8 A;  1CMG A;  1NWD A;  2WND A;  1F8H A;  2H61 A;  4GNK B;  1CLB A;  5CSN A;  1KFX L;  3I5I C;  3TS5 B;  2GGZ A;  2LV7 A;  2OPO A;  2M49 B;  3D10 A;  5AFP A;  1RFJ A;  1RK9 A;  1G4Y R;  1TOP A;  1Y1A A;  2KQ6 A;  3BOW B;  4DCK A;  1KFU S;  1DT7 B;  3PAT A;  4PHM A;  2K2F A;  3WXA A;  1C07 A;  1H8B A;  1G33 A;  1R6P A;  4YGE B;  4JWQ A;  4GUK A;  1BR4 B;  4F0Z B;  2NCO A;  2KDH A;  3KEV A;  1XFX O;  2KI6 D;  3I5H C;  1B8C A;  1XYD A;  2BKI B;  3OP0 A;  4ORB B;  1GJY A;  1JUO A;  2ZN8 A;  1B1G A;  2KNE A;  4FTG A;  2BEC A;  2MAZ A;  1UUS A;  1ZOT B;  1DJW A;  2B1U A;  2F2O A;  3BYA A;  4PHJ A;  3ZNI A;  2I2R E;  1EJ3 A;  4BY4 A;  1QLK A;  1F55 A;  1SL9 A;  5DKQ A;  1AK8 A;  1TNW A;  3VRP A;  2EC6 C;  2KFG A;  3PN7 B;  3IQQ A;  1K95 A;  1UHJ A;  2H61 C;  1AP4 A;  1QS7 A;  2RGI A;  5DKN A;  2D8N A;  4FQO A;  1BT6 A;  2KSP A;  1EXR A;  1D1O A;  2K0J A;  5TNC A;  1UUR A;  1SBJ A;  1S5G Z;  3TS5 C;  1C7W A;  4CFR A;  1B4C A;  3BUW B;  1KWO B;  4A4B A;  2KAX A;  1JFK A;  2H2K A;  5K89 A;  2CBL A;  4HSZ A;  1UHN A;  1SW8 A;  1W7I B;  2WC8 A;  4C0K A;  1B7T Y;  1B9A A;  2COL B;  4YGC B;  4M2O A;  1XK4 A;  4XJK A;  3I5I B;  2Y1N A;  4Q04 A;  1J55 A;  2KFH A;  2KGB C;  2I18 A;  2KFF A;  3OX6 A;  1L2O C;  3O4Y A;  2KI4 B;  1N2D A;  5IBW A;  1ALW A;  2LAN A;  1NX3 A;  4UPG A;  4QJ3 B;  1FI6 A;  2KYF A;  1AJ5 A;  3A8R A;  3BUO B;  1ALV A;  5D7F A;  2M8U A;  1W7J B;  1DJH A;  4C0J A;  1MQ1 A;  2LLU A;  1NX2 A;  5JJG A;  3OB2 B;  1TIZ A;  1IRJ A;  5HLO A;  3H4S E;  4CID A;  3KF9 A;  3VGO A;  2M97 A;  1CTR A;  5HKZ A;  4GGF A;  1M46 A;  1QX7 A;  1OMV A;  1AJ4 A;  1IH0 A;  1FF1 A;  2ZRT A;  3ICB A;  4PCW A;  2JZI A;  3CR2 A;  4CLN A;  3OX5 A;  2CCM A;  3E3R A;  5GQQ C;  2BE4 A;  4PHK A;  1N0Y A;  4MZJ A;  1PVB A;  1IG5 A;  2F8P A;  3DVE A;  1K96 A;  1C7V A;  1UP5 A;  5HLV A;  3EVU A;  1OOJ A;  1MXL C;  1QX2 A;  5G08 A;  1IKU A;  4NDD A;  3OHM B;  2KI4 C;  3TDZ A;  1DJY A;  4HRH A;  4I5L B;  2R2I A;  4PDZ A;  2Y4Q A;  1WRL A;  1IJ5 A;  2KAY A;  1ZMZ A;  1J7O A;  3GK4 X;  1YX7 A;  4MZK A;  2P6B B;  3AKA A;  2JTT A;  2LNK A;  2K2A A;  2O5G A;  4GFT A;  1Y0V H;  2CXJ A;  1TNQ A;  2CT9 A;  1WRZ A;  1WLM A;  2TN4 A;  3KHE A;  1NUB A;  1DGU A;  4DS7 A;  1IWQ A;  2IS9 A;  4MZL A;  1B8R A;  1XFW O;  3HX4 A;  2FJU B;  2HET A;  3I5G B;  1SY9 A;  2ISD A;  3NSK A;  3NSI A;  2K8M B;  2NXQ A;  1SRA A;  1S36 A;  3BQ3 A;  1K9P A;  4QJ5 B;  4YGB B;  1CFC A;  3M0W A;  1TTX A;  5HYD A;  2FCE A;  2ZND A;  3BOW A;  3EKH A;  3JTD B;  4PE0 A;  1DF0 A;  2PVB A;  2M3W A;  3EK4 A;  1Q80 A;  1KK8 C;  4NDC A;  2Q4U A;  4YI8 A;  2F2P A;  2OTG B;  1SL8 A;  2BL0 C;  4NQG A;  5I8N A;  5I2O A;  1DJG A;  3CR5 X;  5BPJ A;  2Y1M A;  3O2P A;  2KBI A;  1RRO A;  2LHI A;  3EK8 A;  1SYM A;  2MLF C;  1M63 B;  1XVJ A;  1YR5 A;  1IQ5 A;  5AEQ A;  3SG5 A;  1JF0 A;  1PK0 D;  3FWB A;  4XJK B;  2LUX A;  2LVI A;  2L2E A;  1QJT A;  4BY5 A;  2JWW A;  2LHL A;  3CTN A;  4M2Q A;  4JPZ B;  4ZCV A;  3BXK A;  5I2Q A;  2KOT A;  1UHK A;  2JT8 A;  3LL8 B;  1XK4 C;  1KFU L;  2PAS A;  2WCE A;  3O78 A;  4U8D A;  1XO5 A;  2M0R A;  4DIR A;  1CLM A;  1CM4 A;  2LM5 A;  2K7D A;  2DOQ A;  1KCY A;  2BBN A;  1UHI A;  1KFX S;  1SCM C;  2BE6 A;  4GAO A;  3RLZ A;  1FW4 A;  3LK0 A;  1MXE A;  1QIW A;  1QV1 A;  2HF5 A;  4DUQ A;  2JU0 A;  1A2X A;  1EG3 A;  2JNX A;  1L7Z A;  2K61 A;  2PRU A;  4NDB A;  4MVF A;  1YVL A;  1JF2 A;  1NIW A;  1REC A;  2I94 A;  1OE9 B;  2KHN A;  3GK2 A;  1DF0 B;  3RM1 A;  2LLT A;  4PE7 A;  1TCO B;  4I5K A;  4GBA A;  2L98 A;  1CMF A;  4OKH A;  4ORC B;  4PAL A;  4GGF C;  3SG7 A;  1NX1 A;  2FCD A;  1V1G A;  4MLW A;  1OMR A;  1X02 A;  2PMY A;  1AUI B;  1XFZ O;  1NX0 A;  4HRE E;  2OS8 C;  3EKJ A;  1FPW A;  1LA3 A;  5J3X A;  2GGM A;  1NPQ A;  2CNP A;  2EHB A;  2KQY A;  1NYA A;  2K7O A;  4ZCU A;  1EL4 A;  3DVM A;  4P2Y B;  1VRK A;  4AQI A;  2HQW A;  3EVV A;  1SL7 A;  3PSR A;  2ZKM X;  1CDN A;  3NXA A;  2BCB A;  2OS8 B;  2WOR A;  4PHN A;  1NSH A;  3OB1 B;  1LKJ A;  1U5I A;  3SIA A;  1IGV A;  1Y1U A;  3MSE B;  4OR9 B;  1A4P A;  3D0Y A;  1B47 A;  5B8I B;  2LCP A;  1UHH A;  4MN0 A;  4CFQ A;  3LLE A;  1OQP A;  4ORA B;  3I5H B;  4AOM A;  3EK7 A;  4MRY A;  3LK1 A;  1BLQ A;  1J7R A;  1KK7 Y;  4N1F A;  1GGZ A;  2L51 A;  1E8A A;  3GOF A;  1EH2 A;  2KGR A;  3AAJ A;  4YBH B;  1BU3 A;  3VRQ A;  3WHU B;  2NLN A;  1CM1 A;  2PAL A;  2KBM A;  3I5G C;  3DF0 B;  1L2O B;  2JQ6 A;  2JUL A;  4A4C A;  4ETO A;  1PUL A;  1MHO A;  2ZNE A;  1S6J A;  4YRU A;  1A75 B;  4YI9 A;  1QIV A;  1WY9 A;  2L5X B;  4PE4 A;  1WDC C;  3SG3 A;  2GV5 A;  1K94 A;  2JOJ A;  2O60 A;  2V53 A;  2VRG A;  1OZS A;  3DF0 A;  1K2H A;  3D0Y B;  1CDM A;  1DVI A;  1CKK A;  3SIB A;  4CPV A;  2M7N A;  3KPX A;  1NCZ A;  3PFV A;  2WCF A;  1RWY A;  2BCA A;  1EG4 A;  2M1U A;  1DJI A;  1F4O A;  3FIA A;  5PAL A;  3AAK A;  3TZ1 A;  3K21 A;  1B7T Z;  3TDU A;  2JNF A;  3CR4 X;  5AXI A;  1S6C A;  2LP2 A;  5HKY A;  1M45 A;  2M1K B;  2SCP A;  2MLE C;  2SAS A;  1TNP A;  4QJ4 B;  1FI5 A;  4GGN A;  2A4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...