1XFWO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin and 3'5' cyclic amp (camp)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-sensitive adenylate cyclase
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
total genus 34
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfwO02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfwO01
4PHKA 1IKUA 1RK9A 1CMGA 1QLSA 2M7NA 2Y5IA 3AAJA 1RROA 2LVVA 3O78A 4BY4A 4N5XA 3WHTB 1ALVA 4M2OA 1WDCB 1B8CA 2NXQA 4E68A 1LVCD 1YUTA 1PSBA 3BUOB 1YURA 2KSPA 1F71A 2IS9A 1N65A 3SG4A 1K95A 3D0YB 2KQYA 1BF5A 1RJVA 2BL0C 2KI4C 1SCMB 1J1EA 1ZOTB 2KAXA 5HKZA 1DJIA 1M31A 3GOFA 3I5FB 4WQ3A 2LLSA 2M29A 2MLEC 1EL4A 3JTDB 4PE4A 4N1GA 1JF0A 2EGDA 2K7OA 1CB1A 1KQMB 3RM1A 2VRGA 2LMVA 1DGVA 3TUYB 2PVBA 1Y1XA 3EKHA 4MRYA 2KBMA 4U8DA 3EKJA 1Y1AA 3FWCA 1KWOB 3VGOA 1IJ5A 1V1GA 1AP4A 5HYDA 1NX1A 1QX5B 1SRAA 2I18A 1FF1A 1DGUA 5D69A 1KQVA 1W7IB 3BQ3A 3SG7A 4I5JA 1FPWA 1J1DA 2CXJA 1TCOB 2G2BA 4YBHB 4YRUA 4CLNA 4ORBB 1K9PA 3EVVA 2MLFC 4PE7A 4XJKA 3SG3A 2LMTA 3KEVA 2JU0A 1OMVA 4NDDA 3D10A 1KSOA 1A75B 1PULA 2F2OA 1JF2A 3CWGA 2HETA 2PASA 2ZRTA 1BT6A 1AJ5A 4HSZA 1G4YR 5AANA 1YUSA 2KI6C 4DRWA 1QIWA 2ZRSA 2KFFA 1D1OA 1TNPA 1V1FA 2LP3A 3A4UB 3KHEA 4GAOA 2Q4UA 1UWOA 1RWYA 2PSRA 4HREE 4CFQA 2H2KA 2MA2A 3DVMA 1TN4A 2ZNDA 1KK8B 2JNXA 1J7PA 1SR6C 2BKIB 5CPVA 1R2UA 5CSIA 4N1FA 3BUMB 1G33A 3BOWB 2K2AA 4YGBB 1NP8A 2WCBA 3K21A 4HRGA 2BBNA 5ER4X 1A2XA 1TOPA 3PSRA 1IGVA 1M39A 2BBMA 1AHRA 1M46A 1S1EA 4C0JA 1BJFA 1BU3A 1YVHA 1TIZA 1J55A 2JT0A 2BE4A 5AERA 1WY9A 4YGEB 1Q80A 4NDBA 4YI8A 2I94A 2LVKA 3OX6A 2FJUB 4MN0A 1YVLA 2Y1MA 1PK0D 3LL8B 4MVFA 2E6WA 2L4HA 1CLLA 1NIWA 2LCPA 1IWQA 1SBJA 2F2PA 4MSPA 3A8RA 2L4IA 4YGAA 5AFPA 1F4QA 1S26D 4ETOA 1B7TZ 3TS5B 1K90D 1CDMA 1J7RA 1QV0A 2KYFA 3GK1A 3CR5X 1EXRA 1C07A 1RTP1 4DS7A 3JVTB 1BMOA 1LKJA 1MXEA 2WC8A 3PN7C 2M3WA 3NSOA 1Y1UA 1YRUB 2M1KB 3TDUA 4NQGA 2JNFA 1XO5A 2JTTA 1S5GZ 3AKAA 4M2PA 2WNDA 2B1UA 4OVNF 3LLEA 4GNKB 2PALA 1KFXS 4GGNA 2K2FA 3AAKA 3I5GB 2CCMA 2PRUA 4JQ0D 3DVEA 4YGCB 3M0WA 1CNPA 1NPQA 1CLBA 1WLMA 4OV2A 2I2RE 2GGMA 2PMYA 2R2IA 4QJ3B 4PHNA 3KPXA 1TCFA 1TTXA 3CLNA 3BYAA 3DF0B 3ZNIA 2JQ6A 1UP5A 1DVIA 1K9UA 2L98A 1ZUZA 2LMUA 4JPZB 1S6CA 2MJWB 2KGBC 2FCEA 3SG2A 4MBEA 1B7TY 4MZKA 2F8PA 1X02A 2AMIA 2BL0B 2M0RA 2KI4B 2ZKMX 2L51A 1OE9B 2WCEA 3BUWB 3DVJA 3EVUA 1SL8A 3IQQA 4CIDA 1GGWA 1XFUO 4AQIA 1MR8A 2EC6C 5KTYA 1DJWA 1A03A 4ORCB 1Y6WA 1EG3A 4F0ZB 1QX2A 1XFXO 1BG1A 1S5GY 1DJZA 2LAPA 5J3XA 3EK7A 2JT8A 5G08A 1JSAA 2BCBA 3NSKA 1UHKA 1MQ1A 1QASA 2LE9B 2LUXA 5JJGA 1DF0B 1OOJA 2K0JA 1JUOA 1CFPA 2KHNA 1CDNA 3OHMB 3SG5A 3WXAA 1LA3A 1NYAA 3MSEB 4CPVA 2WOSA 2JULA 1W7JB 1L2OC 3HCMA 3FS7A 3OP0A 5AEQA 1QX7A 2KYCA 1S6IA 1U5IA 3GK2A 3O6BA 1DMOA 2M97A 1OMRA 3OX5A 1XVJA 2CBLA 3VROA 1CKKA 4GUKA 1XYDA 2LM5A 1FI6A 1R6PA 2LLTA 2KAVA 1AUIB 1C7WA 1KFUS 1WRKA 2QPTA 1UHIA 4ORAB 5B8IB 1J7QA 2BCAA 4WRIA 1K94A 1XK4C 1CTRA 5FYXA 1M63B 3D0YA 1TNXA 2KNEA 2Y1NA 1NWDA 2BE6A 1EG4A 2TN4A 1IJ6A 1E8AA 1UUSA 1SNLA 2E30A 1PALA 2OTGC 2P6BB 4GBAA 4Q04A 1SKTA 2JWWA 3I5IC 2RGIA 5DKQA 1K93D 1TNWA 1PRWA 5DKRA 1K9KA 3OB1B 4P5OE 5PALA 2SCPA 2MAZA 1YTZC 1CM4A 1DJXA 1LXFC 1XFWO 2KGRA 2ZNEA 3LCPC 5HKYA 2FOTA 4PALA 1HT9A 1UHHA 1DJHA 4YI9A 1PSRA 1XFZO 2KDHA 1TRFA 2L2EA 3SG6A 4C0KA 1NX2A 5ER5A 5KU1A 4DIRA 1YR5A 1KSMA 2JZIA 2KQ6A 2BECA 3AKBA 1B1GA 4USLA 1Y0VH 1LINA 2MRDA 5I2OA 1JWDA 1F55A 2F3ZA 1GJYA 2GV5A 4OCIA 2K7CA 1XK4A 1S36A 3QRXA 1VRKA 1RFJA 2LNKA 2WORA 1IRJA 4MEWA 3PN7B 4ICBA 2JPTA 1OQPA 4CFRA 1B8RA 1OSAA 1OZOA 1DTLA 2MHHA 1QLKA 4C0LA 1FI5A 1GGZA 1ZACA 5I8NA 1F4OA 3TDIA 1HQVA 2F3YA 3CZTX 2LVJA 2LLUA 4BY5A 4GGFC 1JBAA 1DJYA 3CR2A 3ZWHA 4IL1A 4MZJA 2HQ8A 2Q91A 2LC5A 1K2HA 2LHLA 4OR9B 1IG5A 5DKNA 1BLQA 1NSHA 1WRZA 1L7ZA 2BCXA 2QACA 2Y4QA 3BOWA 1OZSA 2JT3A 3KO0A 4FQOA 3FWBA 4MRXA 5HKWA 2LV7A 2ZN8A 1A29A 1YX7A 2OS8C 1SL9A 2LVIA 2CNPA 4XJKB 3I5HC 1A4PA 1QVIY 1ZFSA 3SIAA 1H4BA 1MHOA 3F45A 3PFVA 4TNCA 1B4CA 1UHJA 1CLMA 1MWNA 1WRLA 3CGAA 2F33A 3NSLA 1CFDA 3VRNA 2G9BA 1CMFA 1NCXA 2CT9A 3LK0A 1F8HA 2K61A 3BUNB 4A4BA 2KBIA 2EC6B 1WDCC 1N2DA 2JXLA 3KF9A 1XFYO 3BUXB 3C1VA 2M49B 4NDCA 4GGFA 2H61C 3IF7A 1JFJA 1KK7Y 5CSNA 3WHUB 1OMDA 3H4SE 1SCMC 1F70A 1FW4A 3I5FC 5CSFA 3DVKA 1NX0A 1QXPA 1XFVO 5BPJA 2BKHB 1IQ3A 2L5XB 2WCFA 1BODA 3JTDC 2K8MB 4OKHA 1QIVA 3BXKA 2LHIA 1KFXL 1KQMC 4QJ4B 1C7VA 1F54A 1SK6D 1JC2A 3VRQA 1AVSA 3TUYC 5IBWA 1G8IA 4M2QA 2NCOA 1KWOC 1ODBA 1L2OB 1MXLC 1UURA 1K8UA 1RECA 1SW8A 2M1UA 1B47A 4UPGA 3CS1A 5GQQC 4QJ5B 3ICBA 2GGZA 5F6TA 3CR4X 3DD4A 1NX3A 2OPOA 3SIBA 2KFGA 1CFCA 3SJSA 4I5LB 3DF0A 5AXIA 4ZCUA 2L50A 1AJ4A 1SYMA 1QTXA 1SMGA 3CTNA 4GFTA 3RLZA 2H61A 1SR6B 2FCDA 1QATA 2KAYA 4PDZA 2KOTA 3GK4X 1YX8A 5I2LA 1H8BA 5TNCA 1PVBA 2HQWA 3EK4A 1EH2A 1CDLA 4PE1A 2COLB 2OTGB 1TNQA 1WLZA 3NSIA 3I5IB 3OB2B 5KSZA 2JXCA 2JTZA 2EHBA 2LUCA 1BR4B 1IQ5A 5D7FA 2DOQA 2V53A 3TDZA 1S6JA 3VRRA 1AK8A 1KK8C 1SL7A 4GPLB 4PHJA 4HRHA 2L0PA 1QJTA 4PCWA 2SASA 1QVIZ 4PHMA 2I7AA 3PATA 1QS7A 1UHNA 5HLOA 1DF0A 3EVRA 1CFFA 3O2PA 1B8LA 1NUBA 3LK1A 3PALA 1BR1B 1A75A 1ALWA 2D8NA 2CTNA 3FIAA 1KCYA 1S3PA 1MF8B 1B9AA 4MZLA 2O5GA 2KFHA 1ZMZA 4XYNA 3PM8A 4AOMA 3VRPA 1SCVA 2KI6D 3O4YA 4AQJA 3HX4A 2ISDA 2LP2A 3IQOA 1DJGA 5HLVA 1KK7Z 2AAOA 1SY9A 1KFUL 3E3RA 4PE0A 3TS5C 1XA5A 4WQ2A 5K89A 2JOJA 1K96A 2MBXA 4L9MA 4DCKA 3EK8A 3JVTC 2K7BA 1LA0A 2JRFA 2A4JA 1GQMA 1QV1A 5JOLA 2NZ0A 3PLFB 1J7OA 5I2QA 1YUUA 2M9GA 1NCYA 1M45A 4P2YB 2K7DA 1CM1A 1YRTB 4ZCVA 2OS8B 1MUXA 4JWQA 2AUCA 4MLWA 1BOCA 4DUQA 1NCZA 4I5NB 1IH0A 4R1EA 2O60A 3I5HB 5CSJA 2M7LA 2M8UA 1FBVA 2NLNA 2NCPA 3I5GC 4I5KA 3WNXB 1N0YA 1EJ3A 1PVAA 1U5IB 2ZFDA 4FTGA 4A4CA 4D1EA 2JC2A 1DT7B 3TZ1A 1CDPA 3NXAA 4YGDB 2HPSA 2ZN9A 2LANA 2HF5A 1SPYA 1JFKA
chains in the Genus database with same CATH superfamily
4PHKA 1IKUA 1RK9A 1CMGA 1QLSA 2M7NA 2Y5IA 3AAJA 1RROA 2LVVA 2BNXA 3O78A 4BY4A 4N5XA 3WHTB 1ALVA 4M2OA 1WDCB 1B8CA 2NXQA 4E68A 1LVCD 1YUTA 1PSBA 3BUOB 1YURA 2KSPA 2L2CA 1F71A 2IS9A 1N65A 3SG4A 1K95A 3D0YB 2KQYA 1BF5A 2L5YA 1RJVA 2BL0C 2KI4C 1SCMB 1J1EA 1ZOTB 2KAXA 5HKZA 1DJIA 1M31A 3GOFA 3I5FB 4WQ3A 1DEKA 2LLSA 2M29A 2QEVA 2MLEC 1EL4A 3JTDB 4PE4A 4N1GA 1JF0A 2EGDA 2K7OA 1CB1A 1KQMB 3RM1A 2VRGA 2LMVA 1DGVA 3TUYB 2PVBA 1Y1XA 3EKHA 4MRYA 2KBMA 4U8DA 1GM0A 3EKJA 1Y1AA 3FWCA 1KWOB 3VGOA 1IJ5A 1V1GA 1AP4A 5HYDA 2QEHA 1NX1A 1QX5B 1SRAA 2I18A 1DELA 1FF1A 1DGUA 5D69A 1KQVA 3EG5B 1W7IB 3BQ3A 3SG7A 4I5JA 1FPWA 1J1DA 2CXJA 1TCOB 2G2BA 4YBHB 4YRUA 4CLNA 4ORBB 3BFHA 1K9PA 3EVVA 2MLFC 4PE7A 4XJKA 3SG3A 2LMTA 3KEVA 2JU0A 3DYEA 1OMVA 4NDDA 3D10A 2WCHA 3L47A 1KSOA 1A75B 1PULA 2F2OA 1JF2A 3CWGA 2HETA 2PASA 2ZRTA 1BT6A 1AJ5A 4HSZA 1G4YR 5AANA 3L4LA 1YUSA 2KI6C 4DRWA 1QIWA 2ZRSA 2KFFA 1D1OA 1TNPA 1V1FA 2LP3A 3A4UB 3KHEA 3DZTA 4GAOA 2Q4UA 1UWOA 1RWYA 2PSRA 2GTEA 4HREE 4CFQA 2H2KA 2MA2A 3DVMA 3S0DA 1TN4A 2ZNDA 1KK8B 2JNXA 5HL1A 1SR6C 2BKIB 1J7PA 5CPVA 3R1VA 5I94A 1R2UA 5CSIA 3OGNA 3PJIA 1QWVA 4N1FA 2P70A 3BUMB 1G33A 3BOWB 2K2AA 4YGBB 1TUJA 1NP8A 2WCBA 3K21A 4HRGA 2BBNA 5ER4X 1A2XA 1TOPA 3PSRA 1IGVA 1M39A 2BBMA 1AHRA 1M46A 1S1EA 4C0JA 1BJFA 1BU3A 1YVHA 1TIZA 1J55A 2JT0A 2BE4A 5AERA 1WY9A 4YGEB 3SS5A 1Q80A 4NDBA 4YI8A 2I94A 2LVKA 3OX6A 4IJ7A 3QMEA 5D3OA 2FJUB 4MN0A 1YVLA 2Y1MA 1PK0D 3LL8B 4MVFA 2E6WA 2L4HA 1CLLA 1NIWA 2LCPA 1IWQA 1SBJA 2F2PA 2FJYA 3A8RA 4MSPA 2L4IA 4YGAA 5AFPA 1F4QA 1S26D 4ETOA 1B7TZ 2H8VA 3TS5B 1K90D 1CDMA 1J7RA 1QV0A 2KYFA 3GK1A 3CR5X 1EXRA 1C07A 1RTP1 5EL2A 3JVTB 1BMOA 4DS7A 1LKJA 1MXEA 2WC8A 3PN7C 2M3WA 3NSOA 1Y1UA 1YRUB 2M1KB 3TDUA 4NQGA 2JNFA 1XO5A 2JTTA 1S5GZ 3AKAA 4M2PA 3RZSA 2WNDA 3CZ1A 2B1UA 4OVNF 3LLEA 4GNKB 2PALA 1KFXS 4GGNA 2K2FA 3AAKA 3I5GB 2CCMA 2PRUA 2KLDA 4JQ0D 3DVEA 3CDNA 4YGCB 3M0WA 1CNPA 1LS8A 1NPQA 1CLBA 1WLMA 4OV2A 2I2RE 2GGMA 3BFAA 2PMYA 2R2IA 4QJ3B 3S0FA 2WCKA 4PHNA 3KPXA 1TCFA 1TTXA 3CLNA 3BYAA 2P71A 3DF0B 3ZNIA 2JQ6A 1UP5A 1DVIA 1K9UA 2L98A 1ZUZA 3DXLA 2LMUA 4JPZB 1S6CA 2MJWB 2KGBC 2FCEA 3SG2A 4MBEA 3FE8A 1B7TY 1OOFA 4MZKA 2F8PA 1X02A 2AMIA 2BL0B 2M0RA 2KI4B 2PQLA 2WCJA 2ZKMX 2L51A 1OE9B 2WCEA 3BUWB 3DVJA 3EVUA 1SL8A 1ORGA 3IQQA 4CIDA 1GGWA 1XFUO 2QEOA 3K1EA 4AQIA 3CABA 1MR8A 2EC6C 1Z2CB 1DJWA 5KTYA 3O4XA 1Y6WA 4ORCB 1A03A 3L4AA 1EG3A 4F0ZB 1QX2A 1XFXO 2ERBA 1BG1A 1S5GY 1DJZA 2LAPA 5J3XA 3EK7A 2JT8A 5G08A 1JSAA 2BCBA 3NSKA 1UHKA 1MQ1A 1QASA 2LE9B 2LUXA 4FQTA 5JJGA 1DF0B 1OOJA 2K0JA 2QEBA 1JUOA 3D76A 1CFPA 2KHNA 1CDNA 3OHMB 3SG5A 3WXAA 1LA3A 1NYAA 3MSEB 4CPVA 2WOSA 2JULA 1W7JB 1L2OC 3HCMA 3FS7A 3OP0A 5AEQA 1QX7A 2KYCA 1S6IA 1U5IA 5DICA 4F7FA 3GK2A 3O6BA 1DMOA 2M97A 1OMRA 3OX5A 1XVJA 2CBLA 3VROA 1CKKA 4GUKA 1XYDA 2BAPA 2LM5A 1FI6A 3CZ0A 1R6PA 1OOGA 2LLTA 3IVTA 2KAVA 3N7HA 1AUIB 1C7WA 1KFUS 1WRKA 2QPTA 1UHIA 4ORAB 5B8IB 1J7QA 2BCAA 3B7AA 4WRIA 1K94A 1XK4C 1CTRA 5FYXA 1M63B 3VB1A 3D0YA 1TNXA 2KNEA 2Y1NA 1NWDA 2K60A 3UNWA 2BE6A 1EG4A 2TN4A 1IJ6A 1E8AA 1UUSA 1SNLA 2E30A 1PALA 2OTGC 2P6BB 4GBAA 4Q04A 1SKTA 2JWWA 3I5IC 2RGIA 1XFRA 5DKQA 1K93D 1TNWA 1PRWA 5DKRA 3BJHA 1K9KA 3OB1B 4P5OE 5PALA 1W9ZA 2SCPA 2MAZA 1YTZC 1CM4A 1DJXA 1LXFC 1XFWO 2KGRA 2ZNEA 3LCPC 5HKYA 2FOTA 4PALA 1HT9A 1UHHA 1DJHA 4YI9A 1PSRA 1XFZO 2KDHA 1TRFA 2L2EA 3SG6A 4C0KA 1NX2A 5ER5A 5KU1A 4DIRA 1YR5A 1KSMA 2JZIA 2KQ6A 2BECA 3AKBA 3S0GA 1B1GA 4USLA 1Y0VH 1LINA 2MRDA 5I2OA 1JWDA 1F55A 2F3ZA 1GJYA 2GV5A 4OCIA 2K7CA 1XK4A 1S36A 3QRXA 3SS4A 1VRKA 1RFJA 2LNKA 2WORA 1IRJA 4MEWA 3NGVA 1TUZA 3PN7B 4ICBA 2JPTA 1OQPA 4CFRA 1B8RA 1OSAA 1OZOA 1DTLA 2MHHA 2PYQA 1QLKA 4C0LA 1FI5A 1GGZA 1OOHA 3B6XA 1ZACA 1C3ZA 2WC5A 5I8NA 1F4OA 3TDIA 1HQVA 2F3YA 3CZTX 2LVJA 2LLUA 4JKTA 4BY5A 4GGFC 1JBAA 1DJYA 3CR2A 3ZWHA 4IL1A 4MZJA 2HQ8A 2Q91A 2LC5A 1K2HA 2LHLA 4OR9B 1IG5A 4INWA 5DKNA 1NSHA 1WRZA 1BLQA 1L7ZA 2BCXA 2QACA 2Y4QA 3BOWA 1OZSA 2JT3A 3KO0A 4FQOA 3FWBA 4MRXA 5HKWA 2LV7A 2ZN8A 1A29A 1YX7A 1DQEA 2OS8C 1SL9A 2LVIA 2CNPA 4XJKB 3I5HC 1A4PA 1QVIY 1ZFSA 3SIAA 1H4BA 1MHOA 3F45A 3PFVA 4TNCA 1B4CA 1UHJA 1CLMA 1MWNA 3D74A 1WRLA 3CGAA 2F33A 3NSLA 1CFDA 3VRNA 2G9BA 1CMFA 1NCXA 2CT9A 3LK0A 1F8HA 2K61A 3BUNB 4A4BA 2KBIA 2EC6B 1WDCC 1N2DA 2JXLA 3KF9A 3PM2A 1IIOA 1XFYO 3BUXB 3CYZA 3C1VA 2M49B 1OW4A 4JD9A 4NDCA 4GGFA 3R72A 3UO9A 2H61C 3IF7A 1JFJA 1KK7Y 5CSNA 3WHUB 1OMDA 3H4SE 1SCMC 1F70A 1FW4A 3I5FC 5CSFA 3DVKA 4INXA 1NX0A 1QXPA 1XFVO 3Q8IA 5BPJA 2BKHB 1IQ3A 2L5XB 2WCFA 1BODA 3JTDC 2K8MB 4OKHA 1QIVA 3BXKA 2LHIA 1KFXL 1KQMC 3S0BA 4QJ4B 1C7VA 1SK6D 1F54A 1JC2A 3VRQA 3S0EA 1AVSA 3TUYC 5IBWA 1G8IA 4M2QA 2NCOA 1KWOC 1ODBA 3SS3A 1L2OB 1MXLC 1UURA 1K8UA 3D73A 1RECA 1SW8A 2M1UA 1B47A 4UPGA 3CS1A 5GQQC 4QJ5B 1OOIX 3ICBA 2GGZA 2WCMA 3B87A 5F6TA 3CR4X 3DD4A 1NX3A 2OPOA 2KLEA 3SIBA 2KFGA 1CFCA 3SJSA 4I5LB 3FE9A 3DF0A 5AXIA 4ZCUA 2L50A 1AJ4A 1SYMA 1QTXA 1SMGA 3CTNA 4GFTA 3RLZA 2H61A 1SR6B 2FCDA 1QATA 2KAYA 2YGUA 3NHTA 4PDZA 2KOTA 3GK4X 1YX8A 5I2LA 1H8BA 5TNCA 1PVBA 2HQWA 3EK4A 4PT1A 1CDLA 4PE1A 1EH2A 2COLB 2OTGB 1TNQA 3DY9A 1WLZA 3NSIA 3I5IB 3OB2B 5KSZA 2JXCA 3S0AA 2JTZA 2EHBA 2QDIA 1T14A 1TWOA 2LUCA 1BR4B 1IQ5A 1SSEB 5D7FA 2DOQA 2V53A 3TDZA 1S6JA 3VRRA 1AK8A 1KK8C 1SL7A 3B88A 4GPLB 4PHJA 4HRHA 2L0PA 3B86A 3NHIA 1QJTA 3BFBA 4PCWA 2SASA 1QVIZ 4PHMA 2I7AA 3PATA 1DC1A 1QS7A 1UHNA 5HLOA 1DF0A 3EVRA 1CFFA 3FE6A 3D77A 3O2PA 1B8LA 1NUBA 3LK1A 3PALA 1BR1B 1A75A 1ALWA 2D8NA 2CTNA 3FIAA 1KCYA 1S3PA 1MF8B 1B9AA 2JPOA 4MZLA 2O5GA 2KFHA 1ZMZA 3D78A 3PM8A 4XYNA 4AOMA 3OBVA 3VRPA 1SCVA 2KI6D 3O4YA 3R1PA 4AQJA 3HX4A 2ISDA 4KYNA 2LP2A 3IQOA 1DJGA 2KPHA 1KK7Z 5HLVA 2AAOA 1SY9A 1KFUL 1Z4HA 3E3RA 4PE0A 3TS5C 1XA5A 4WQ2A 5K89A 2JOJA 4OZDA 1K96A 2MBXA 5FI6A 4L9MA 4DCKA 1C3YA 3EK8A 1P28A 3JVTC 2K7BA 1LA0A 2JRFA 2A4JA 1GQMA 3CZ2A 1QV1A 5JOLA 2NZ0A 3PLFB 2WCLA 5FI2A 3V2LA 1J7OA 5I2QA 1YUUA 2M9GA 1NCYA 1M45A 4P2YB 2K7DA 1CM1A 1YRTB 4ZCVA 2OS8B 3D75A 3R1OA 1MUXA 4JWQA 2AUCA 4MLWA 1BOCA 5FI7A 1NCZA 4I5NB 4DUQA 4R1EA 1IH0A 2O60A 3I5HB 5CSJA 2M7LA 2M8UA 1FBVA 2NLNA 2NCPA 3I5GC 4I5KA 3WNXB 2WC6A 1N0YA 1EJ3A 1PVAA 1U5IB 2ZFDA 4FTGA 4A4CA 4D1EA 2JC2A 1DT7B 3TZ1A 1CDPA 3NXAA 4YGDB 2HPSA 2ZN9A 2LANA 2HF5A 1SPYA 1JFKA
chains in the Genus database with same CATH topology
4PHKA 1IKUA 1RK9A 1CMGA 1QLSA 2M7NA 2Y5IA 3AAJA 1RROA 2LVVA 3O78A 4BY4A 4N5XA 3WHTB 1ALVA 4M2OA 1WDCB 1B8CA 2NXQA 4E68A 1LVCD 1YUTA 1PSBA 3BUOB 1YURA 2KSPA 1F71A 2IS9A 1N65A 3SG4A 1K95A 3D0YB 2KQYA 1BF5A 1RJVA 2BL0C 2KI4C 1SCMB 1J1EA 1ZOTB 2KAXA 5HKZA 1DJIA 1M31A 3GOFA 3I5FB 4WQ3A 2LLSA 2M29A 2MLEC 1EL4A 3JTDB 4PE4A 4N1GA 1JF0A 2EGDA 2K7OA 1CB1A 1KQMB 3RM1A 2VRGA 2LMVA 1DGVA 3TUYB 2PVBA 1Y1XA 3EKHA 4MRYA 2KBMA 4U8DA 3EKJA 1Y1AA 3FWCA 1KWOB 3VGOA 1IJ5A 1V1GA 1AP4A 5HYDA 1NX1A 1QX5B 1SRAA 2I18A 1FF1A 1DGUA 5D69A 1KQVA 1W7IB 3BQ3A 3SG7A 4I5JA 1FPWA 1J1DA 2CXJA 1TCOB 2G2BA 4YBHB 4YRUA 4CLNA 4ORBB 1K9PA 3EVVA 2MLFC 4PE7A 4XJKA 3SG3A 2LMTA 3KEVA 2JU0A 1OMVA 4NDDA 3D10A 1KSOA 1A75B 1PULA 2F2OA 1JF2A 3CWGA 2HETA 2PASA 2ZRTA 1BT6A 1AJ5A 4HSZA 1G4YR 5AANA 1YUSA 2KI6C 4DRWA 1QIWA 2ZRSA 2KFFA 1D1OA 1TNPA 1V1FA 2LP3A 3A4UB 3KHEA 4GAOA 2Q4UA 1UWOA 1RWYA 2PSRA 4HREE 4CFQA 2H2KA 2MA2A 3DVMA 1TN4A 2ZNDA 1KK8B 2JNXA 1J7PA 1SR6C 2BKIB 5CPVA 1R2UA 5CSIA 4N1FA 3BUMB 1G33A 3BOWB 2K2AA 4YGBB 1NP8A 2WCBA 3K21A 4HRGA 2BBNA 5ER4X 1A2XA 1TOPA 3PSRA 1IGVA 1M39A 2BBMA 1AHRA 1M46A 1S1EA 4C0JA 1BJFA 1BU3A 1YVHA 1TIZA 1J55A 2JT0A 2BE4A 5AERA 1WY9A 4YGEB 1Q80A 4NDBA 4YI8A 2I94A 2LVKA 3OX6A 2FJUB 4MN0A 1YVLA 2Y1MA 1PK0D 3LL8B 4MVFA 2E6WA 2L4HA 1CLLA 1NIWA 2LCPA 1IWQA 1SBJA 2F2PA 4MSPA 3A8RA 2L4IA 4YGAA 5AFPA 1F4QA 1S26D 4ETOA 1B7TZ 3TS5B 1K90D 1CDMA 1J7RA 1QV0A 2KYFA 3GK1A 3CR5X 1EXRA 1C07A 1RTP1 4DS7A 3JVTB 1BMOA 1LKJA 1MXEA 2WC8A 3PN7C 2M3WA 3NSOA 1Y1UA 1YRUB 2M1KB 3TDUA 4NQGA 2JNFA 1XO5A 2JTTA 1S5GZ 3AKAA 4M2PA 2WNDA 2B1UA 4OVNF 3LLEA 4GNKB 2PALA 1KFXS 4GGNA 2K2FA 3AAKA 3I5GB 2CCMA 2PRUA 4JQ0D 3DVEA 4YGCB 3M0WA 1CNPA 1NPQA 1CLBA 1WLMA 4OV2A 2I2RE 2GGMA 2PMYA 2R2IA 4QJ3B 4PHNA 3KPXA 1TCFA 1TTXA 3CLNA 3BYAA 3DF0B 3ZNIA 2JQ6A 1UP5A 1DVIA 1K9UA 2L98A 1ZUZA 2LMUA 4JPZB 1S6CA 2MJWB 2KGBC 2FCEA 3SG2A 4MBEA 1B7TY 4MZKA 2F8PA 1X02A 2AMIA 2BL0B 2M0RA 2KI4B 2ZKMX 2L51A 1OE9B 2WCEA 3BUWB 3DVJA 3EVUA 1SL8A 3IQQA 4CIDA 1GGWA 1XFUO 4AQIA 1MR8A 2EC6C 5KTYA 1DJWA 1A03A 4ORCB 1Y6WA 1EG3A 4F0ZB 1QX2A 1XFXO 1BG1A 1S5GY 1DJZA 2LAPA 5J3XA 3EK7A 2JT8A 5G08A 1JSAA 2BCBA 3NSKA 1UHKA 1MQ1A 1QASA 2LE9B 2LUXA 5JJGA 1DF0B 1OOJA 2K0JA 1JUOA 1CFPA 2KHNA 1CDNA 3OHMB 3SG5A 3WXAA 1LA3A 1NYAA 3MSEB 4CPVA 2WOSA 2JULA 1W7JB 1L2OC 3HCMA 3FS7A 3OP0A 5AEQA 1QX7A 2KYCA 1S6IA 1U5IA 3GK2A 3O6BA 1DMOA 2M97A 1OMRA 3OX5A 1XVJA 2CBLA 3VROA 1CKKA 4GUKA 1XYDA 2LM5A 1FI6A 1R6PA 2LLTA 2KAVA 1AUIB 1C7WA 1KFUS 1WRKA 2QPTA 1UHIA 4ORAB 5B8IB 1J7QA 2BCAA 4WRIA 1K94A 1XK4C 1CTRA 5FYXA 1M63B 3D0YA 1TNXA 2KNEA 2Y1NA 1NWDA 2BE6A 1EG4A 2TN4A 1IJ6A 1E8AA 1UUSA 1SNLA 2E30A 1PALA 2OTGC 2P6BB 4GBAA 4Q04A 1SKTA 2JWWA 3I5IC 2RGIA 5DKQA 1K93D 1TNWA 1PRWA 5DKRA 1K9KA 3OB1B 4P5OE 5PALA 2SCPA 2MAZA 1YTZC 1CM4A 1DJXA 1LXFC 1XFWO 2KGRA 2ZNEA 3LCPC 5HKYA 2FOTA 4PALA 1HT9A 1UHHA 1DJHA 4YI9A 1PSRA 1XFZO 2KDHA 1TRFA 2L2EA 3SG6A 4C0KA 1NX2A 5ER5A 5KU1A 4DIRA 1YR5A 1KSMA 2JZIA 2KQ6A 2BECA 3AKBA 1B1GA 4USLA 1Y0VH 1LINA 2MRDA 5I2OA 1JWDA 1F55A 2F3ZA 1GJYA 2GV5A 4OCIA 2K7CA 1XK4A 1S36A 3QRXA 1VRKA 1RFJA 2LNKA 2WORA 1IRJA 4MEWA 3PN7B 4ICBA 2JPTA 1OQPA 4CFRA 1B8RA 1OSAA 1OZOA 1DTLA 2MHHA 1QLKA 4C0LA 1FI5A 1GGZA 1ZACA 5I8NA 1F4OA 3TDIA 1HQVA 2F3YA 3CZTX 2LVJA 2LLUA 4BY5A 4GGFC 1JBAA 1DJYA 3CR2A 3ZWHA 4IL1A 4MZJA 2HQ8A 2Q91A 2LC5A 1K2HA 2LHLA 4OR9B 1IG5A 5DKNA 1BLQA 1NSHA 1WRZA 1L7ZA 2BCXA 2QACA 2Y4QA 3BOWA 1OZSA 2JT3A 3KO0A 4FQOA 3FWBA 4MRXA 5HKWA 2LV7A 2ZN8A 1A29A 1YX7A 2OS8C 1SL9A 2LVIA 2CNPA 4XJKB 3I5HC 1A4PA 1QVIY 1ZFSA 3SIAA 1H4BA 1MHOA 3F45A 3PFVA 4TNCA 1B4CA 1UHJA 1CLMA 1MWNA 1WRLA 3CGAA 2F33A 3NSLA 1CFDA 3VRNA 2G9BA 1CMFA 1NCXA 2CT9A 3LK0A 1F8HA 2K61A 3BUNB 4A4BA 2KBIA 2EC6B 1WDCC 1N2DA 2JXLA 3KF9A 1XFYO 3BUXB 3C1VA 2M49B 4NDCA 4GGFA 2H61C 3IF7A 1JFJA 1KK7Y 5CSNA 3WHUB 1OMDA 3H4SE 1SCMC 1F70A 1FW4A 3I5FC 5CSFA 3DVKA 1NX0A 1QXPA 1XFVO 5BPJA 2BKHB 1IQ3A 2L5XB 2WCFA 1BODA 3JTDC 2K8MB 4OKHA 1QIVA 3BXKA 2LHIA 1KFXL 1KQMC 4QJ4B 1C7VA 1F54A 1SK6D 1JC2A 3VRQA 1AVSA 3TUYC 5IBWA 1G8IA 4M2QA 2NCOA 1KWOC 1ODBA 1L2OB 1MXLC 1UURA 1K8UA 1RECA 1SW8A 2M1UA 1B47A 4UPGA 3CS1A 5GQQC 4QJ5B 3ICBA 2GGZA 5F6TA 3CR4X 3DD4A 1NX3A 2OPOA 3SIBA 2KFGA 1CFCA 3SJSA 4I5LB 3DF0A 5AXIA 4ZCUA 2L50A 1AJ4A 1SYMA 1QTXA 1SMGA 3CTNA 4GFTA 3RLZA 2H61A 1SR6B 2FCDA 1QATA 2KAYA 4PDZA 2KOTA 3GK4X 1YX8A 5I2LA 1H8BA 5TNCA 1PVBA 2HQWA 3EK4A 1EH2A 1CDLA 4PE1A 2COLB 2OTGB 1TNQA 1WLZA 3NSIA 3I5IB 3OB2B 5KSZA 2JXCA 2JTZA 2EHBA 2LUCA 1BR4B 1IQ5A 5D7FA 2DOQA 2V53A 3TDZA 1S6JA 3VRRA 1AK8A 1KK8C 1SL7A 4GPLB 4PHJA 4HRHA 2L0PA 1QJTA 4PCWA 2SASA 1QVIZ 4PHMA 2I7AA 3PATA 1QS7A 1UHNA 5HLOA 1DF0A 3EVRA 1CFFA 3O2PA 1B8LA 1NUBA 3LK1A 3PALA 1BR1B 1A75A 1ALWA 2D8NA 2CTNA 3FIAA 1KCYA 1S3PA 1MF8B 1B9AA 4MZLA 2O5GA 2KFHA 1ZMZA 4XYNA 3PM8A 4AOMA 3VRPA 1SCVA 2KI6D 3O4YA 4AQJA 3HX4A 2ISDA 2LP2A 3IQOA 1DJGA 5HLVA 1KK7Z 2AAOA 1SY9A 1KFUL 3E3RA 4PE0A 3TS5C 1XA5A 4WQ2A 5K89A 2JOJA 1K96A 2MBXA 4L9MA 4DCKA 3EK8A 3JVTC 2K7BA 1LA0A 2JRFA 2A4JA 1GQMA 1QV1A 5JOLA 2NZ0A 3PLFB 1J7OA 5I2QA 1YUUA 2M9GA 1NCYA 1M45A 4P2YB 2K7DA 1CM1A 1YRTB 4ZCVA 2OS8B 1MUXA 4JWQA 2AUCA 4MLWA 1BOCA 4DUQA 1NCZA 4I5NB 1IH0A 4R1EA 2O60A 3I5HB 5CSJA 2M7LA 2M8UA 1FBVA 2NLNA 2NCPA 3I5GC 4I5KA 3WNXB 1N0YA 1EJ3A 1PVAA 1U5IB 2ZFDA 4FTGA 4A4CA 4D1EA 2JC2A 1DT7B 3TZ1A 1CDPA 3NXAA 4YGDB 2HPSA 2ZN9A 2LANA 2HF5A 1SPYA 1JFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHK A;  1IKU A;  1RK9 A;  1CMG A;  1QLS A;  2M7N A;  2Y5I A;  3AAJ A;  1RRO A;  2LVV A;  3O78 A;  4BY4 A;  4N5X A;  3WHT B;  1ALV A;  4M2O A;  1WDC B;  1B8C A;  2NXQ A;  4E68 A;  1LVC D;  1YUT A;  1PSB A;  3BUO B;  1YUR A;  2KSP A;  1F71 A;  2IS9 A;  1N65 A;  3SG4 A;  1K95 A;  3D0Y B;  2KQY A;  1BF5 A;  1RJV A;  2BL0 C;  2KI4 C;  1SCM B;  1J1E A;  1ZOT B;  2KAX A;  5HKZ A;  1DJI A;  1M31 A;  3GOF A;  3I5F B;  4WQ3 A;  2LLS A;  2M29 A;  2MLE C;  1EL4 A;  3JTD B;  4PE4 A;  4N1G A;  1JF0 A;  2EGD A;  2K7O A;  1CB1 A;  1KQM B;  3RM1 A;  2VRG A;  2LMV A;  1DGV A;  3TUY B;  2PVB A;  1Y1X A;  3EKH A;  4MRY A;  2KBM A;  4U8D A;  3EKJ A;  1Y1A A;  3FWC A;  1KWO B;  3VGO A;  1IJ5 A;  1V1G A;  1AP4 A;  5HYD A;  1NX1 A;  1QX5 B;  1SRA A;  2I18 A;  1FF1 A;  1DGU A;  5D69 A;  1KQV A;  1W7I B;  3BQ3 A;  3SG7 A;  4I5J A;  1FPW A;  1J1D A;  2CXJ A;  1TCO B;  2G2B A;  4YBH B;  4YRU A;  4CLN A;  4ORB B;  1K9P A;  3EVV A;  2MLF C;  4PE7 A;  4XJK A;  3SG3 A;  2LMT A;  3KEV A;  2JU0 A;  1OMV A;  4NDD A;  3D10 A;  1KSO A;  1A75 B;  1PUL A;  2F2O A;  1JF2 A;  3CWG A;  2HET A;  2PAS A;  2ZRT A;  1BT6 A;  1AJ5 A;  4HSZ A;  1G4Y R;  5AAN A;  1YUS A;  2KI6 C;  4DRW A;  1QIW A;  2ZRS A;  2KFF A;  1D1O A;  1TNP A;  1V1F A;  2LP3 A;  3A4U B;  3KHE A;  4GAO A;  2Q4U A;  1UWO A;  1RWY A;  2PSR A;  4HRE E;  4CFQ A;  2H2K A;  2MA2 A;  3DVM A;  1TN4 A;  2ZND A;  1KK8 B;  2JNX A;  1J7P A;  1SR6 C;  2BKI B;  5CPV A;  1R2U A;  5CSI A;  4N1F A;  3BUM B;  1G33 A;  3BOW B;  2K2A A;  4YGB B;  1NP8 A;  2WCB A;  3K21 A;  4HRG A;  2BBN A;  5ER4 X;  1A2X A;  1TOP A;  3PSR A;  1IGV A;  1M39 A;  2BBM A;  1AHR A;  1M46 A;  1S1E A;  4C0J A;  1BJF A;  1BU3 A;  1YVH A;  1TIZ A;  1J55 A;  2JT0 A;  2BE4 A;  5AER A;  1WY9 A;  4YGE B;  1Q80 A;  4NDB A;  4YI8 A;  2I94 A;  2LVK A;  3OX6 A;  2FJU B;  4MN0 A;  1YVL A;  2Y1M A;  1PK0 D;  3LL8 B;  4MVF A;  2E6W A;  2L4H A;  1CLL A;  1NIW A;  2LCP A;  1IWQ A;  1SBJ A;  2F2P A;  4MSP A;  3A8R A;  2L4I A;  4YGA A;  5AFP A;  1F4Q A;  1S26 D;  4ETO A;  1B7T Z;  3TS5 B;  1K90 D;  1CDM A;  1J7R A;  1QV0 A;  2KYF A;  3GK1 A;  3CR5 X;  1EXR A;  1C07 A;  1RTP 1;  4DS7 A;  3JVT B;  1BMO A;  1LKJ A;  1MXE A;  2WC8 A;  3PN7 C;  2M3W A;  3NSO A;  1Y1U A;  1YRU B;  2M1K B;  3TDU A;  4NQG A;  2JNF A;  1XO5 A;  2JTT A;  1S5G Z;  3AKA A;  4M2P A;  2WND A;  2B1U A;  4OVN F;  3LLE A;  4GNK B;  2PAL A;  1KFX S;  4GGN A;  2K2F A;  3AAK A;  3I5G B;  2CCM A;  2PRU A;  4JQ0 D;  3DVE A;  4YGC B;  3M0W A;  1CNP A;  1NPQ A;  1CLB A;  1WLM A;  4OV2 A;  2I2R E;  2GGM A;  2PMY A;  2R2I A;  4QJ3 B;  4PHN A;  3KPX A;  1TCF A;  1TTX A;  3CLN A;  3BYA A;  3DF0 B;  3ZNI A;  2JQ6 A;  1UP5 A;  1DVI A;  1K9U A;  2L98 A;  1ZUZ A;  2LMU A;  4JPZ B;  1S6C A;  2MJW B;  2KGB C;  2FCE A;  3SG2 A;  4MBE A;  1B7T Y;  4MZK A;  2F8P A;  1X02 A;  2AMI A;  2BL0 B;  2M0R A;  2KI4 B;  2ZKM X;  2L51 A;  1OE9 B;  2WCE A;  3BUW B;  3DVJ A;  3EVU A;  1SL8 A;  3IQQ A;  4CID A;  1GGW A;  1XFU O;  4AQI A;  1MR8 A;  2EC6 C;  5KTY A;  1DJW A;  1A03 A;  4ORC B;  1Y6W A;  1EG3 A;  4F0Z B;  1QX2 A;  1XFX O;  1BG1 A;  1S5G Y;  1DJZ A;  2LAP A;  5J3X A;  3EK7 A;  2JT8 A;  5G08 A;  1JSA A;  2BCB A;  3NSK A;  1UHK A;  1MQ1 A;  1QAS A;  2LE9 B;  2LUX A;  5JJG A;  1DF0 B;  1OOJ A;  2K0J A;  1JUO A;  1CFP A;  2KHN A;  1CDN A;  3OHM B;  3SG5 A;  3WXA A;  1LA3 A;  1NYA A;  3MSE B;  4CPV A;  2WOS A;  2JUL A;  1W7J B;  1L2O C;  3HCM A;  3FS7 A;  3OP0 A;  5AEQ A;  1QX7 A;  2KYC A;  1S6I A;  1U5I A;  3GK2 A;  3O6B A;  1DMO A;  2M97 A;  1OMR A;  3OX5 A;  1XVJ A;  2CBL A;  3VRO A;  1CKK A;  4GUK A;  1XYD A;  2LM5 A;  1FI6 A;  1R6P A;  2LLT A;  2KAV A;  1AUI B;  1C7W A;  1KFU S;  1WRK A;  2QPT A;  1UHI A;  4ORA B;  5B8I B;  1J7Q A;  2BCA A;  4WRI A;  1K94 A;  1XK4 C;  1CTR A;  5FYX A;  1M63 B;  3D0Y A;  1TNX A;  2KNE A;  2Y1N A;  1NWD A;  2BE6 A;  1EG4 A;  2TN4 A;  1IJ6 A;  1E8A A;  1UUS A;  1SNL A;  2E30 A;  1PAL A;  2OTG C;  2P6B B;  4GBA A;  4Q04 A;  1SKT A;  2JWW A;  3I5I C;  2RGI A;  5DKQ A;  1K93 D;  1TNW A;  1PRW A;  5DKR A;  1K9K A;  3OB1 B;  4P5O E;  5PAL A;  2SCP A;  2MAZ A;  1YTZ C;  1CM4 A;  1DJX A;  1LXF C;  1XFW O;  2KGR A;  2ZNE A;  3LCP C;  5HKY A;  2FOT A;  4PAL A;  1HT9 A;  1UHH A;  1DJH A;  4YI9 A;  1PSR A;  1XFZ O;  2KDH A;  1TRF A;  2L2E A;  3SG6 A;  4C0K A;  1NX2 A;  5ER5 A;  5KU1 A;  4DIR A;  1YR5 A;  1KSM A;  2JZI A;  2KQ6 A;  2BEC A;  3AKB A;  1B1G A;  4USL A;  1Y0V H;  1LIN A;  2MRD A;  5I2O A;  1JWD A;  1F55 A;  2F3Z A;  1GJY A;  2GV5 A;  4OCI A;  2K7C A;  1XK4 A;  1S36 A;  3QRX A;  1VRK A;  1RFJ A;  2LNK A;  2WOR A;  1IRJ A;  4MEW A;  3PN7 B;  4ICB A;  2JPT A;  1OQP A;  4CFR A;  1B8R A;  1OSA A;  1OZO A;  1DTL A;  2MHH A;  1QLK A;  4C0L A;  1FI5 A;  1GGZ A;  1ZAC A;  5I8N A;  1F4O A;  3TDI A;  1HQV A;  2F3Y A;  3CZT X;  2LVJ A;  2LLU A;  4BY5 A;  4GGF C;  1JBA A;  1DJY A;  3CR2 A;  3ZWH A;  4IL1 A;  4MZJ A;  2HQ8 A;  2Q91 A;  2LC5 A;  1K2H A;  2LHL A;  4OR9 B;  1IG5 A;  5DKN A;  1BLQ A;  1NSH A;  1WRZ A;  1L7Z A;  2BCX A;  2QAC A;  2Y4Q A;  3BOW A;  1OZS A;  2JT3 A;  3KO0 A;  4FQO A;  3FWB A;  4MRX A;  5HKW A;  2LV7 A;  2ZN8 A;  1A29 A;  1YX7 A;  2OS8 C;  1SL9 A;  2LVI A;  2CNP A;  4XJK B;  3I5H C;  1A4P A;  1QVI Y;  1ZFS A;  3SIA A;  1H4B A;  1MHO A;  3F45 A;  3PFV A;  4TNC A;  1B4C A;  1UHJ A;  1CLM A;  1MWN A;  1WRL A;  3CGA A;  2F33 A;  3NSL A;  1CFD A;  3VRN A;  2G9B A;  1CMF A;  1NCX A;  2CT9 A;  3LK0 A;  1F8H A;  2K61 A;  3BUN B;  4A4B A;  2KBI A;  2EC6 B;  1WDC C;  1N2D A;  2JXL A;  3KF9 A;  1XFY O;  3BUX B;  3C1V A;  2M49 B;  4NDC A;  4GGF A;  2H61 C;  3IF7 A;  1JFJ A;  1KK7 Y;  5CSN A;  3WHU B;  1OMD A;  3H4S E;  1SCM C;  1F70 A;  1FW4 A;  3I5F C;  5CSF A;  3DVK A;  1NX0 A;  1QXP A;  1XFV O;  5BPJ A;  2BKH B;  1IQ3 A;  2L5X B;  2WCF A;  1BOD A;  3JTD C;  2K8M B;  4OKH A;  1QIV A;  3BXK A;  2LHI A;  1KFX L;  1KQM C;  4QJ4 B;  1C7V A;  1F54 A;  1SK6 D;  1JC2 A;  3VRQ A;  1AVS A;  3TUY C;  5IBW A;  1G8I A;  4M2Q A;  2NCO A;  1KWO C;  1ODB A;  1L2O B;  1MXL C;  1UUR A;  1K8U A;  1REC A;  1SW8 A;  2M1U A;  1B47 A;  4UPG A;  3CS1 A;  5GQQ C;  4QJ5 B;  3ICB A;  2GGZ A;  5F6T A;  3CR4 X;  3DD4 A;  1NX3 A;  2OPO A;  3SIB A;  2KFG A;  1CFC A;  3SJS A;  4I5L B;  3DF0 A;  5AXI A;  4ZCU A;  2L50 A;  1AJ4 A;  1SYM A;  1QTX A;  1SMG A;  3CTN A;  4GFT A;  3RLZ A;  2H61 A;  1SR6 B;  2FCD A;  1QAT A;  2KAY A;  4PDZ A;  2KOT A;  3GK4 X;  1YX8 A;  5I2L A;  1H8B A;  5TNC A;  1PVB A;  2HQW A;  3EK4 A;  1EH2 A;  1CDL A;  4PE1 A;  2COL B;  2OTG B;  1TNQ A;  1WLZ A;  3NSI A;  3I5I B;  3OB2 B;  5KSZ A;  2JXC A;  2JTZ A;  2EHB A;  2LUC A;  1BR4 B;  1IQ5 A;  5D7F A;  2DOQ A;  2V53 A;  3TDZ A;  1S6J A;  3VRR A;  1AK8 A;  1KK8 C;  1SL7 A;  4GPL B;  4PHJ A;  4HRH A;  2L0P A;  1QJT A;  4PCW A;  2SAS A;  1QVI Z;  4PHM A;  2I7A A;  3PAT A;  1QS7 A;  1UHN A;  5HLO A;  1DF0 A;  3EVR A;  1CFF A;  3O2P A;  1B8L A;  1NUB A;  3LK1 A;  3PAL A;  1BR1 B;  1A75 A;  1ALW A;  2D8N A;  2CTN A;  3FIA A;  1KCY A;  1S3P A;  1MF8 B;  1B9A A;  4MZL A;  2O5G A;  2KFH A;  1ZMZ A;  4XYN A;  3PM8 A;  4AOM A;  3VRP A;  1SCV A;  2KI6 D;  3O4Y A;  4AQJ A;  3HX4 A;  2ISD A;  2LP2 A;  3IQO A;  1DJG A;  5HLV A;  1KK7 Z;  2AAO A;  1SY9 A;  1KFU L;  3E3R A;  4PE0 A;  3TS5 C;  1XA5 A;  4WQ2 A;  5K89 A;  2JOJ A;  1K96 A;  2MBX A;  4L9M A;  4DCK A;  3EK8 A;  3JVT C;  2K7B A;  1LA0 A;  2JRF A;  2A4J A;  1GQM A;  1QV1 A;  5JOL A;  2NZ0 A;  3PLF B;  1J7O A;  5I2Q A;  1YUU A;  2M9G A;  1NCY A;  1M45 A;  4P2Y B;  2K7D A;  1CM1 A;  1YRT B;  4ZCV A;  2OS8 B;  1MUX A;  4JWQ A;  2AUC A;  4MLW A;  1BOC A;  4DUQ A;  1NCZ A;  4I5N B;  1IH0 A;  4R1E A;  2O60 A;  3I5H B;  5CSJ A;  2M7L A;  2M8U A;  1FBV A;  2NLN A;  2NCP A;  3I5G C;  4I5K A;  3WNX B;  1N0Y A;  1EJ3 A;  1PVA A;  1U5I B;  2ZFD A;  4FTG A;  4A4C A;  4D1E A;  2JC2 A;  1DT7 B;  3TZ1 A;  1CDP A;  3NXA A;  4YGD B;  2HPS A;  2ZN9 A;  2LAN A;  2HF5 A;  1SPY A;  1JFK A; 
#chains in the Genus database with same CATH topology
 4PHK A;  1IKU A;  1RK9 A;  1CMG A;  1QLS A;  2M7N A;  2Y5I A;  3AAJ A;  1RRO A;  2LVV A;  2BNX A;  3O78 A;  4BY4 A;  4N5X A;  3WHT B;  1ALV A;  4M2O A;  1WDC B;  1B8C A;  2NXQ A;  4E68 A;  1LVC D;  1YUT A;  1PSB A;  3BUO B;  1YUR A;  2KSP A;  2L2C A;  1F71 A;  2IS9 A;  1N65 A;  3SG4 A;  1K95 A;  3D0Y B;  2KQY A;  1BF5 A;  2L5Y A;  1RJV A;  2BL0 C;  2KI4 C;  1SCM B;  1J1E A;  1ZOT B;  2KAX A;  5HKZ A;  1DJI A;  1M31 A;  3GOF A;  3I5F B;  4WQ3 A;  1DEK A;  2LLS A;  2M29 A;  2QEV A;  2MLE C;  1EL4 A;  3JTD B;  4PE4 A;  4N1G A;  1JF0 A;  2EGD A;  2K7O A;  1CB1 A;  1KQM B;  3RM1 A;  2VRG A;  2LMV A;  1DGV A;  3TUY B;  2PVB A;  1Y1X A;  3EKH A;  4MRY A;  2KBM A;  4U8D A;  1GM0 A;  3EKJ A;  1Y1A A;  3FWC A;  1KWO B;  3VGO A;  1IJ5 A;  1V1G A;  1AP4 A;  5HYD A;  2QEH A;  1NX1 A;  1QX5 B;  1SRA A;  2I18 A;  1DEL A;  1FF1 A;  1DGU A;  5D69 A;  1KQV A;  3EG5 B;  1W7I B;  3BQ3 A;  3SG7 A;  4I5J A;  1FPW A;  1J1D A;  2CXJ A;  1TCO B;  2G2B A;  4YBH B;  4YRU A;  4CLN A;  4ORB B;  3BFH A;  1K9P A;  3EVV A;  2MLF C;  4PE7 A;  4XJK A;  3SG3 A;  2LMT A;  3KEV A;  2JU0 A;  3DYE A;  1OMV A;  4NDD A;  3D10 A;  2WCH A;  3L47 A;  1KSO A;  1A75 B;  1PUL A;  2F2O A;  1JF2 A;  3CWG A;  2HET A;  2PAS A;  2ZRT A;  1BT6 A;  1AJ5 A;  4HSZ A;  1G4Y R;  5AAN A;  3L4L A;  1YUS A;  2KI6 C;  4DRW A;  1QIW A;  2ZRS A;  2KFF A;  1D1O A;  1TNP A;  1V1F A;  2LP3 A;  3A4U B;  3KHE A;  3DZT A;  4GAO A;  2Q4U A;  1UWO A;  1RWY A;  2PSR A;  2GTE A;  4HRE E;  4CFQ A;  2H2K A;  2MA2 A;  3DVM A;  3S0D A;  1TN4 A;  2ZND A;  1KK8 B;  2JNX A;  5HL1 A;  1SR6 C;  2BKI B;  1J7P A;  5CPV A;  3R1V A;  5I94 A;  1R2U A;  5CSI A;  3OGN A;  3PJI A;  1QWV A;  4N1F A;  2P70 A;  3BUM B;  1G33 A;  3BOW B;  2K2A A;  4YGB B;  1TUJ A;  1NP8 A;  2WCB A;  3K21 A;  4HRG A;  2BBN A;  5ER4 X;  1A2X A;  1TOP A;  3PSR A;  1IGV A;  1M39 A;  2BBM A;  1AHR A;  1M46 A;  1S1E A;  4C0J A;  1BJF A;  1BU3 A;  1YVH A;  1TIZ A;  1J55 A;  2JT0 A;  2BE4 A;  5AER A;  1WY9 A;  4YGE B;  3SS5 A;  1Q80 A;  4NDB A;  4YI8 A;  2I94 A;  2LVK A;  3OX6 A;  4IJ7 A;  3QME A;  5D3O A;  2FJU B;  4MN0 A;  1YVL A;  2Y1M A;  1PK0 D;  3LL8 B;  4MVF A;  2E6W A;  2L4H A;  1CLL A;  1NIW A;  2LCP A;  1IWQ A;  1SBJ A;  2F2P A;  2FJY A;  3A8R A;  4MSP A;  2L4I A;  4YGA A;  5AFP A;  1F4Q A;  1S26 D;  4ETO A;  1B7T Z;  2H8V A;  3TS5 B;  1K90 D;  1CDM A;  1J7R A;  1QV0 A;  2KYF A;  3GK1 A;  3CR5 X;  1EXR A;  1C07 A;  1RTP 1;  5EL2 A;  3JVT B;  1BMO A;  4DS7 A;  1LKJ A;  1MXE A;  2WC8 A;  3PN7 C;  2M3W A;  3NSO A;  1Y1U A;  1YRU B;  2M1K B;  3TDU A;  4NQG A;  2JNF A;  1XO5 A;  2JTT A;  1S5G Z;  3AKA A;  4M2P A;  3RZS A;  2WND A;  3CZ1 A;  2B1U A;  4OVN F;  3LLE A;  4GNK B;  2PAL A;  1KFX S;  4GGN A;  2K2F A;  3AAK A;  3I5G B;  2CCM A;  2PRU A;  2KLD A;  4JQ0 D;  3DVE A;  3CDN A;  4YGC B;  3M0W A;  1CNP A;  1LS8 A;  1NPQ A;  1CLB A;  1WLM A;  4OV2 A;  2I2R E;  2GGM A;  3BFA A;  2PMY A;  2R2I A;  4QJ3 B;  3S0F A;  2WCK A;  4PHN A;  3KPX A;  1TCF A;  1TTX A;  3CLN A;  3BYA A;  2P71 A;  3DF0 B;  3ZNI A;  2JQ6 A;  1UP5 A;  1DVI A;  1K9U A;  2L98 A;  1ZUZ A;  3DXL A;  2LMU A;  4JPZ B;  1S6C A;  2MJW B;  2KGB C;  2FCE A;  3SG2 A;  4MBE A;  3FE8 A;  1B7T Y;  1OOF A;  4MZK A;  2F8P A;  1X02 A;  2AMI A;  2BL0 B;  2M0R A;  2KI4 B;  2PQL A;  2WCJ A;  2ZKM X;  2L51 A;  1OE9 B;  2WCE A;  3BUW B;  3DVJ A;  3EVU A;  1SL8 A;  1ORG A;  3IQQ A;  4CID A;  1GGW A;  1XFU O;  2QEO A;  3K1E A;  4AQI A;  3CAB A;  1MR8 A;  2EC6 C;  1Z2C B;  1DJW A;  5KTY A;  3O4X A;  1Y6W A;  4ORC B;  1A03 A;  3L4A A;  1EG3 A;  4F0Z B;  1QX2 A;  1XFX O;  2ERB A;  1BG1 A;  1S5G Y;  1DJZ A;  2LAP A;  5J3X A;  3EK7 A;  2JT8 A;  5G08 A;  1JSA A;  2BCB A;  3NSK A;  1UHK A;  1MQ1 A;  1QAS A;  2LE9 B;  2LUX A;  4FQT A;  5JJG A;  1DF0 B;  1OOJ A;  2K0J A;  2QEB A;  1JUO A;  3D76 A;  1CFP A;  2KHN A;  1CDN A;  3OHM B;  3SG5 A;  3WXA A;  1LA3 A;  1NYA A;  3MSE B;  4CPV A;  2WOS A;  2JUL A;  1W7J B;  1L2O C;  3HCM A;  3FS7 A;  3OP0 A;  5AEQ A;  1QX7 A;  2KYC A;  1S6I A;  1U5I A;  5DIC A;  4F7F A;  3GK2 A;  3O6B A;  1DMO A;  2M97 A;  1OMR A;  3OX5 A;  1XVJ A;  2CBL A;  3VRO A;  1CKK A;  4GUK A;  1XYD A;  2BAP A;  2LM5 A;  1FI6 A;  3CZ0 A;  1R6P A;  1OOG A;  2LLT A;  3IVT A;  2KAV A;  3N7H A;  1AUI B;  1C7W A;  1KFU S;  1WRK A;  2QPT A;  1UHI A;  4ORA B;  5B8I B;  1J7Q A;  2BCA A;  3B7A A;  4WRI A;  1K94 A;  1XK4 C;  1CTR A;  5FYX A;  1M63 B;  3VB1 A;  3D0Y A;  1TNX A;  2KNE A;  2Y1N A;  1NWD A;  2K60 A;  3UNW A;  2BE6 A;  1EG4 A;  2TN4 A;  1IJ6 A;  1E8A A;  1UUS A;  1SNL A;  2E30 A;  1PAL A;  2OTG C;  2P6B B;  4GBA A;  4Q04 A;  1SKT A;  2JWW A;  3I5I C;  2RGI A;  1XFR A;  5DKQ A;  1K93 D;  1TNW A;  1PRW A;  5DKR A;  3BJH A;  1K9K A;  3OB1 B;  4P5O E;  5PAL A;  1W9Z A;  2SCP A;  2MAZ A;  1YTZ C;  1CM4 A;  1DJX A;  1LXF C;  1XFW O;  2KGR A;  2ZNE A;  3LCP C;  5HKY A;  2FOT A;  4PAL A;  1HT9 A;  1UHH A;  1DJH A;  4YI9 A;  1PSR A;  1XFZ O;  2KDH A;  1TRF A;  2L2E A;  3SG6 A;  4C0K A;  1NX2 A;  5ER5 A;  5KU1 A;  4DIR A;  1YR5 A;  1KSM A;  2JZI A;  2KQ6 A;  2BEC A;  3AKB A;  3S0G A;  1B1G A;  4USL A;  1Y0V H;  1LIN A;  2MRD A;  5I2O A;  1JWD A;  1F55 A;  2F3Z A;  1GJY A;  2GV5 A;  4OCI A;  2K7C A;  1XK4 A;  1S36 A;  3QRX A;  3SS4 A;  1VRK A;  1RFJ A;  2LNK A;  2WOR A;  1IRJ A;  4MEW A;  3NGV A;  1TUZ A;  3PN7 B;  4ICB A;  2JPT A;  1OQP A;  4CFR A;  1B8R A;  1OSA A;  1OZO A;  1DTL A;  2MHH A;  2PYQ A;  1QLK A;  4C0L A;  1FI5 A;  1GGZ A;  1OOH A;  3B6X A;  1ZAC A;  1C3Z A;  2WC5 A;  5I8N A;  1F4O A;  3TDI A;  1HQV A;  2F3Y A;  3CZT X;  2LVJ A;  2LLU A;  4JKT A;  4BY5 A;  4GGF C;  1JBA A;  1DJY A;  3CR2 A;  3ZWH A;  4IL1 A;  4MZJ A;  2HQ8 A;  2Q91 A;  2LC5 A;  1K2H A;  2LHL A;  4OR9 B;  1IG5 A;  4INW A;  5DKN A;  1NSH A;  1WRZ A;  1BLQ A;  1L7Z A;  2BCX A;  2QAC A;  2Y4Q A;  3BOW A;  1OZS A;  2JT3 A;  3KO0 A;  4FQO A;  3FWB A;  4MRX A;  5HKW A;  2LV7 A;  2ZN8 A;  1A29 A;  1YX7 A;  1DQE A;  2OS8 C;  1SL9 A;  2LVI A;  2CNP A;  4XJK B;  3I5H C;  1A4P A;  1QVI Y;  1ZFS A;  3SIA A;  1H4B A;  1MHO A;  3F45 A;  3PFV A;  4TNC A;  1B4C A;  1UHJ A;  1CLM A;  1MWN A;  3D74 A;  1WRL A;  3CGA A;  2F33 A;  3NSL A;  1CFD A;  3VRN A;  2G9B A;  1CMF A;  1NCX A;  2CT9 A;  3LK0 A;  1F8H A;  2K61 A;  3BUN B;  4A4B A;  2KBI A;  2EC6 B;  1WDC C;  1N2D A;  2JXL A;  3KF9 A;  3PM2 A;  1IIO A;  1XFY O;  3BUX B;  3CYZ A;  3C1V A;  2M49 B;  1OW4 A;  4JD9 A;  4NDC A;  4GGF A;  3R72 A;  3UO9 A;  2H61 C;  3IF7 A;  1JFJ A;  1KK7 Y;  5CSN A;  3WHU B;  1OMD A;  3H4S E;  1SCM C;  1F70 A;  1FW4 A;  3I5F C;  5CSF A;  3DVK A;  4INX A;  1NX0 A;  1QXP A;  1XFV O;  3Q8I A;  5BPJ A;  2BKH B;  1IQ3 A;  2L5X B;  2WCF A;  1BOD A;  3JTD C;  2K8M B;  4OKH A;  1QIV A;  3BXK A;  2LHI A;  1KFX L;  1KQM C;  3S0B A;  4QJ4 B;  1C7V A;  1SK6 D;  1F54 A;  1JC2 A;  3VRQ A;  3S0E A;  1AVS A;  3TUY C;  5IBW A;  1G8I A;  4M2Q A;  2NCO A;  1KWO C;  1ODB A;  3SS3 A;  1L2O B;  1MXL C;  1UUR A;  1K8U A;  3D73 A;  1REC A;  1SW8 A;  2M1U A;  1B47 A;  4UPG A;  3CS1 A;  5GQQ C;  4QJ5 B;  1OOI X;  3ICB A;  2GGZ A;  2WCM A;  3B87 A;  5F6T A;  3CR4 X;  3DD4 A;  1NX3 A;  2OPO A;  2KLE A;  3SIB A;  2KFG A;  1CFC A;  3SJS A;  4I5L B;  3FE9 A;  3DF0 A;  5AXI A;  4ZCU A;  2L50 A;  1AJ4 A;  1SYM A;  1QTX A;  1SMG A;  3CTN A;  4GFT A;  3RLZ A;  2H61 A;  1SR6 B;  2FCD A;  1QAT A;  2KAY A;  2YGU A;  3NHT A;  4PDZ A;  2KOT A;  3GK4 X;  1YX8 A;  5I2L A;  1H8B A;  5TNC A;  1PVB A;  2HQW A;  3EK4 A;  4PT1 A;  1CDL A;  4PE1 A;  1EH2 A;  2COL B;  2OTG B;  1TNQ A;  3DY9 A;  1WLZ A;  3NSI A;  3I5I B;  3OB2 B;  5KSZ A;  2JXC A;  3S0A A;  2JTZ A;  2EHB A;  2QDI A;  1T14 A;  1TWO A;  2LUC A;  1BR4 B;  1IQ5 A;  1SSE B;  5D7F A;  2DOQ A;  2V53 A;  3TDZ A;  1S6J A;  3VRR A;  1AK8 A;  1KK8 C;  1SL7 A;  3B88 A;  4GPL B;  4PHJ A;  4HRH A;  2L0P A;  3B86 A;  3NHI A;  1QJT A;  3BFB A;  4PCW A;  2SAS A;  1QVI Z;  4PHM A;  2I7A A;  3PAT A;  1DC1 A;  1QS7 A;  1UHN A;  5HLO A;  1DF0 A;  3EVR A;  1CFF A;  3FE6 A;  3D77 A;  3O2P A;  1B8L A;  1NUB A;  3LK1 A;  3PAL A;  1BR1 B;  1A75 A;  1ALW A;  2D8N A;  2CTN A;  3FIA A;  1KCY A;  1S3P A;  1MF8 B;  1B9A A;  2JPO A;  4MZL A;  2O5G A;  2KFH A;  1ZMZ A;  3D78 A;  3PM8 A;  4XYN A;  4AOM A;  3OBV A;  3VRP A;  1SCV A;  2KI6 D;  3O4Y A;  3R1P A;  4AQJ A;  3HX4 A;  2ISD A;  4KYN A;  2LP2 A;  3IQO A;  1DJG A;  2KPH A;  1KK7 Z;  5HLV A;  2AAO A;  1SY9 A;  1KFU L;  1Z4H A;  3E3R A;  4PE0 A;  3TS5 C;  1XA5 A;  4WQ2 A;  5K89 A;  2JOJ A;  4OZD A;  1K96 A;  2MBX A;  5FI6 A;  4L9M A;  4DCK A;  1C3Y A;  3EK8 A;  1P28 A;  3JVT C;  2K7B A;  1LA0 A;  2JRF A;  2A4J A;  1GQM A;  3CZ2 A;  1QV1 A;  5JOL A;  2NZ0 A;  3PLF B;  2WCL A;  5FI2 A;  3V2L A;  1J7O A;  5I2Q A;  1YUU A;  2M9G A;  1NCY A;  1M45 A;  4P2Y B;  2K7D A;  1CM1 A;  1YRT B;  4ZCV A;  2OS8 B;  3D75 A;  3R1O A;  1MUX A;  4JWQ A;  2AUC A;  4MLW A;  1BOC A;  5FI7 A;  1NCZ A;  4I5N B;  4DUQ A;  4R1E A;  1IH0 A;  2O60 A;  3I5H B;  5CSJ A;  2M7L A;  2M8U A;  1FBV A;  2NLN A;  2NCP A;  3I5G C;  4I5K A;  3WNX B;  2WC6 A;  1N0Y A;  1EJ3 A;  1PVA A;  1U5I B;  2ZFD A;  4FTG A;  4A4C A;  4D1E A;  2JC2 A;  1DT7 B;  3TZ1 A;  1CDP A;  3NXA A;  4YGD B;  2HPS A;  2ZN9 A;  2LAN A;  2HF5 A;  1SPY A;  1JFK A; 
#chains in the Genus database with same CATH homology
 4PHK A;  1IKU A;  1RK9 A;  1CMG A;  1QLS A;  2M7N A;  2Y5I A;  3AAJ A;  1RRO A;  2LVV A;  3O78 A;  4BY4 A;  4N5X A;  3WHT B;  1ALV A;  4M2O A;  1WDC B;  1B8C A;  2NXQ A;  4E68 A;  1LVC D;  1YUT A;  1PSB A;  3BUO B;  1YUR A;  2KSP A;  1F71 A;  2IS9 A;  1N65 A;  3SG4 A;  1K95 A;  3D0Y B;  2KQY A;  1BF5 A;  1RJV A;  2BL0 C;  2KI4 C;  1SCM B;  1J1E A;  1ZOT B;  2KAX A;  5HKZ A;  1DJI A;  1M31 A;  3GOF A;  3I5F B;  4WQ3 A;  2LLS A;  2M29 A;  2MLE C;  1EL4 A;  3JTD B;  4PE4 A;  4N1G A;  1JF0 A;  2EGD A;  2K7O A;  1CB1 A;  1KQM B;  3RM1 A;  2VRG A;  2LMV A;  1DGV A;  3TUY B;  2PVB A;  1Y1X A;  3EKH A;  4MRY A;  2KBM A;  4U8D A;  3EKJ A;  1Y1A A;  3FWC A;  1KWO B;  3VGO A;  1IJ5 A;  1V1G A;  1AP4 A;  5HYD A;  1NX1 A;  1QX5 B;  1SRA A;  2I18 A;  1FF1 A;  1DGU A;  5D69 A;  1KQV A;  1W7I B;  3BQ3 A;  3SG7 A;  4I5J A;  1FPW A;  1J1D A;  2CXJ A;  1TCO B;  2G2B A;  4YBH B;  4YRU A;  4CLN A;  4ORB B;  1K9P A;  3EVV A;  2MLF C;  4PE7 A;  4XJK A;  3SG3 A;  2LMT A;  3KEV A;  2JU0 A;  1OMV A;  4NDD A;  3D10 A;  1KSO A;  1A75 B;  1PUL A;  2F2O A;  1JF2 A;  3CWG A;  2HET A;  2PAS A;  2ZRT A;  1BT6 A;  1AJ5 A;  4HSZ A;  1G4Y R;  5AAN A;  1YUS A;  2KI6 C;  4DRW A;  1QIW A;  2ZRS A;  2KFF A;  1D1O A;  1TNP A;  1V1F A;  2LP3 A;  3A4U B;  3KHE A;  4GAO A;  2Q4U A;  1UWO A;  1RWY A;  2PSR A;  4HRE E;  4CFQ A;  2H2K A;  2MA2 A;  3DVM A;  1TN4 A;  2ZND A;  1KK8 B;  2JNX A;  1J7P A;  1SR6 C;  2BKI B;  5CPV A;  1R2U A;  5CSI A;  4N1F A;  3BUM B;  1G33 A;  3BOW B;  2K2A A;  4YGB B;  1NP8 A;  2WCB A;  3K21 A;  4HRG A;  2BBN A;  5ER4 X;  1A2X A;  1TOP A;  3PSR A;  1IGV A;  1M39 A;  2BBM A;  1AHR A;  1M46 A;  1S1E A;  4C0J A;  1BJF A;  1BU3 A;  1YVH A;  1TIZ A;  1J55 A;  2JT0 A;  2BE4 A;  5AER A;  1WY9 A;  4YGE B;  1Q80 A;  4NDB A;  4YI8 A;  2I94 A;  2LVK A;  3OX6 A;  2FJU B;  4MN0 A;  1YVL A;  2Y1M A;  1PK0 D;  3LL8 B;  4MVF A;  2E6W A;  2L4H A;  1CLL A;  1NIW A;  2LCP A;  1IWQ A;  1SBJ A;  2F2P A;  4MSP A;  3A8R A;  2L4I A;  4YGA A;  5AFP A;  1F4Q A;  1S26 D;  4ETO A;  1B7T Z;  3TS5 B;  1K90 D;  1CDM A;  1J7R A;  1QV0 A;  2KYF A;  3GK1 A;  3CR5 X;  1EXR A;  1C07 A;  1RTP 1;  4DS7 A;  3JVT B;  1BMO A;  1LKJ A;  1MXE A;  2WC8 A;  3PN7 C;  2M3W A;  3NSO A;  1Y1U A;  1YRU B;  2M1K B;  3TDU A;  4NQG A;  2JNF A;  1XO5 A;  2JTT A;  1S5G Z;  3AKA A;  4M2P A;  2WND A;  2B1U A;  4OVN F;  3LLE A;  4GNK B;  2PAL A;  1KFX S;  4GGN A;  2K2F A;  3AAK A;  3I5G B;  2CCM A;  2PRU A;  4JQ0 D;  3DVE A;  4YGC B;  3M0W A;  1CNP A;  1NPQ A;  1CLB A;  1WLM A;  4OV2 A;  2I2R E;  2GGM A;  2PMY A;  2R2I A;  4QJ3 B;  4PHN A;  3KPX A;  1TCF A;  1TTX A;  3CLN A;  3BYA A;  3DF0 B;  3ZNI A;  2JQ6 A;  1UP5 A;  1DVI A;  1K9U A;  2L98 A;  1ZUZ A;  2LMU A;  4JPZ B;  1S6C A;  2MJW B;  2KGB C;  2FCE A;  3SG2 A;  4MBE A;  1B7T Y;  4MZK A;  2F8P A;  1X02 A;  2AMI A;  2BL0 B;  2M0R A;  2KI4 B;  2ZKM X;  2L51 A;  1OE9 B;  2WCE A;  3BUW B;  3DVJ A;  3EVU A;  1SL8 A;  3IQQ A;  4CID A;  1GGW A;  1XFU O;  4AQI A;  1MR8 A;  2EC6 C;  5KTY A;  1DJW A;  1A03 A;  4ORC B;  1Y6W A;  1EG3 A;  4F0Z B;  1QX2 A;  1XFX O;  1BG1 A;  1S5G Y;  1DJZ A;  2LAP A;  5J3X A;  3EK7 A;  2JT8 A;  5G08 A;  1JSA A;  2BCB A;  3NSK A;  1UHK A;  1MQ1 A;  1QAS A;  2LE9 B;  2LUX A;  5JJG A;  1DF0 B;  1OOJ A;  2K0J A;  1JUO A;  1CFP A;  2KHN A;  1CDN A;  3OHM B;  3SG5 A;  3WXA A;  1LA3 A;  1NYA A;  3MSE B;  4CPV A;  2WOS A;  2JUL A;  1W7J B;  1L2O C;  3HCM A;  3FS7 A;  3OP0 A;  5AEQ A;  1QX7 A;  2KYC A;  1S6I A;  1U5I A;  3GK2 A;  3O6B A;  1DMO A;  2M97 A;  1OMR A;  3OX5 A;  1XVJ A;  2CBL A;  3VRO A;  1CKK A;  4GUK A;  1XYD A;  2LM5 A;  1FI6 A;  1R6P A;  2LLT A;  2KAV A;  1AUI B;  1C7W A;  1KFU S;  1WRK A;  2QPT A;  1UHI A;  4ORA B;  5B8I B;  1J7Q A;  2BCA A;  4WRI A;  1K94 A;  1XK4 C;  1CTR A;  5FYX A;  1M63 B;  3D0Y A;  1TNX A;  2KNE A;  2Y1N A;  1NWD A;  2BE6 A;  1EG4 A;  2TN4 A;  1IJ6 A;  1E8A A;  1UUS A;  1SNL A;  2E30 A;  1PAL A;  2OTG C;  2P6B B;  4GBA A;  4Q04 A;  1SKT A;  2JWW A;  3I5I C;  2RGI A;  5DKQ A;  1K93 D;  1TNW A;  1PRW A;  5DKR A;  1K9K A;  3OB1 B;  4P5O E;  5PAL A;  2SCP A;  2MAZ A;  1YTZ C;  1CM4 A;  1DJX A;  1LXF C;  1XFW O;  2KGR A;  2ZNE A;  3LCP C;  5HKY A;  2FOT A;  4PAL A;  1HT9 A;  1UHH A;  1DJH A;  4YI9 A;  1PSR A;  1XFZ O;  2KDH A;  1TRF A;  2L2E A;  3SG6 A;  4C0K A;  1NX2 A;  5ER5 A;  5KU1 A;  4DIR A;  1YR5 A;  1KSM A;  2JZI A;  2KQ6 A;  2BEC A;  3AKB A;  1B1G A;  4USL A;  1Y0V H;  1LIN A;  2MRD A;  5I2O A;  1JWD A;  1F55 A;  2F3Z A;  1GJY A;  2GV5 A;  4OCI A;  2K7C A;  1XK4 A;  1S36 A;  3QRX A;  1VRK A;  1RFJ A;  2LNK A;  2WOR A;  1IRJ A;  4MEW A;  3PN7 B;  4ICB A;  2JPT A;  1OQP A;  4CFR A;  1B8R A;  1OSA A;  1OZO A;  1DTL A;  2MHH A;  1QLK A;  4C0L A;  1FI5 A;  1GGZ A;  1ZAC A;  5I8N A;  1F4O A;  3TDI A;  1HQV A;  2F3Y A;  3CZT X;  2LVJ A;  2LLU A;  4BY5 A;  4GGF C;  1JBA A;  1DJY A;  3CR2 A;  3ZWH A;  4IL1 A;  4MZJ A;  2HQ8 A;  2Q91 A;  2LC5 A;  1K2H A;  2LHL A;  4OR9 B;  1IG5 A;  5DKN A;  1BLQ A;  1NSH A;  1WRZ A;  1L7Z A;  2BCX A;  2QAC A;  2Y4Q A;  3BOW A;  1OZS A;  2JT3 A;  3KO0 A;  4FQO A;  3FWB A;  4MRX A;  5HKW A;  2LV7 A;  2ZN8 A;  1A29 A;  1YX7 A;  2OS8 C;  1SL9 A;  2LVI A;  2CNP A;  4XJK B;  3I5H C;  1A4P A;  1QVI Y;  1ZFS A;  3SIA A;  1H4B A;  1MHO A;  3F45 A;  3PFV A;  4TNC A;  1B4C A;  1UHJ A;  1CLM A;  1MWN A;  1WRL A;  3CGA A;  2F33 A;  3NSL A;  1CFD A;  3VRN A;  2G9B A;  1CMF A;  1NCX A;  2CT9 A;  3LK0 A;  1F8H A;  2K61 A;  3BUN B;  4A4B A;  2KBI A;  2EC6 B;  1WDC C;  1N2D A;  2JXL A;  3KF9 A;  1XFY O;  3BUX B;  3C1V A;  2M49 B;  4NDC A;  4GGF A;  2H61 C;  3IF7 A;  1JFJ A;  1KK7 Y;  5CSN A;  3WHU B;  1OMD A;  3H4S E;  1SCM C;  1F70 A;  1FW4 A;  3I5F C;  5CSF A;  3DVK A;  1NX0 A;  1QXP A;  1XFV O;  5BPJ A;  2BKH B;  1IQ3 A;  2L5X B;  2WCF A;  1BOD A;  3JTD C;  2K8M B;  4OKH A;  1QIV A;  3BXK A;  2LHI A;  1KFX L;  1KQM C;  4QJ4 B;  1C7V A;  1F54 A;  1SK6 D;  1JC2 A;  3VRQ A;  1AVS A;  3TUY C;  5IBW A;  1G8I A;  4M2Q A;  2NCO A;  1KWO C;  1ODB A;  1L2O B;  1MXL C;  1UUR A;  1K8U A;  1REC A;  1SW8 A;  2M1U A;  1B47 A;  4UPG A;  3CS1 A;  5GQQ C;  4QJ5 B;  3ICB A;  2GGZ A;  5F6T A;  3CR4 X;  3DD4 A;  1NX3 A;  2OPO A;  3SIB A;  2KFG A;  1CFC A;  3SJS A;  4I5L B;  3DF0 A;  5AXI A;  4ZCU A;  2L50 A;  1AJ4 A;  1SYM A;  1QTX A;  1SMG A;  3CTN A;  4GFT A;  3RLZ A;  2H61 A;  1SR6 B;  2FCD A;  1QAT A;  2KAY A;  4PDZ A;  2KOT A;  3GK4 X;  1YX8 A;  5I2L A;  1H8B A;  5TNC A;  1PVB A;  2HQW A;  3EK4 A;  1EH2 A;  1CDL A;  4PE1 A;  2COL B;  2OTG B;  1TNQ A;  1WLZ A;  3NSI A;  3I5I B;  3OB2 B;  5KSZ A;  2JXC A;  2JTZ A;  2EHB A;  2LUC A;  1BR4 B;  1IQ5 A;  5D7F A;  2DOQ A;  2V53 A;  3TDZ A;  1S6J A;  3VRR A;  1AK8 A;  1KK8 C;  1SL7 A;  4GPL B;  4PHJ A;  4HRH A;  2L0P A;  1QJT A;  4PCW A;  2SAS A;  1QVI Z;  4PHM A;  2I7A A;  3PAT A;  1QS7 A;  1UHN A;  5HLO A;  1DF0 A;  3EVR A;  1CFF A;  3O2P A;  1B8L A;  1NUB A;  3LK1 A;  3PAL A;  1BR1 B;  1A75 A;  1ALW A;  2D8N A;  2CTN A;  3FIA A;  1KCY A;  1S3P A;  1MF8 B;  1B9A A;  4MZL A;  2O5G A;  2KFH A;  1ZMZ A;  4XYN A;  3PM8 A;  4AOM A;  3VRP A;  1SCV A;  2KI6 D;  3O4Y A;  4AQJ A;  3HX4 A;  2ISD A;  2LP2 A;  3IQO A;  1DJG A;  5HLV A;  1KK7 Z;  2AAO A;  1SY9 A;  1KFU L;  3E3R A;  4PE0 A;  3TS5 C;  1XA5 A;  4WQ2 A;  5K89 A;  2JOJ A;  1K96 A;  2MBX A;  4L9M A;  4DCK A;  3EK8 A;  3JVT C;  2K7B A;  1LA0 A;  2JRF A;  2A4J A;  1GQM A;  1QV1 A;  5JOL A;  2NZ0 A;  3PLF B;  1J7O A;  5I2Q A;  1YUU A;  2M9G A;  1NCY A;  1M45 A;  4P2Y B;  2K7D A;  1CM1 A;  1YRT B;  4ZCV A;  2OS8 B;  1MUX A;  4JWQ A;  2AUC A;  4MLW A;  1BOC A;  4DUQ A;  1NCZ A;  4I5N B;  1IH0 A;  4R1E A;  2O60 A;  3I5H B;  5CSJ A;  2M7L A;  2M8U A;  1FBV A;  2NLN A;  2NCP A;  3I5G C;  4I5K A;  3WNX B;  1N0Y A;  1EJ3 A;  1PVA A;  1U5I B;  2ZFD A;  4FTG A;  4A4C A;  4D1E A;  2JC2 A;  1DT7 B;  3TZ1 A;  1CDP A;  3NXA A;  4YGD B;  2HPS A;  2ZN9 A;  2LAN A;  2HF5 A;  1SPY A;  1JFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...