4GFTA

Malaria invasion machinery protein-nanobody complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
63
Chain Sequence
NVEELIKMFAHFDNNSTGYLTKSQMKNILTTWALTDQEAIDALNAFSSEDNIDYKLFCEDILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin A tail domain interacting protein
publication title The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein binding, immune system
total genus 18
structure length 63
sequence length 65
ec nomenclature
pdb deposition date 2012-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gftA00
5F6TA 5CSFA 4BY4A 1JC2A 2E30A 3AAKA 2JTZA 1Y1XA 4BY5A 1TCFA 4DS7A 1BU3A 1OOJA 1YUTA 4YI9A 1CMFA 1K9UA 2ZNDA 4NDCA 1DJHA 4MRXA 1E8AA 2Q4UA 3FWCA 2BECA 1JFJA 4I5NB 4CFQA 2H2KA 1WDCB 2BKHB 5KU1A 1A75B 2JTTA 2K7CA 2JOJA 1EG3A 4I5JA 1SKTA 5HLOA 1OE9B 3E3RA 1FBVA 3PSRA 2ZKMX 1NCZA 2BBNA 4ICBA 2LE9B 2AMIA 1KWOB 1PK0D 2LLUA 1U5IA 4WRIA 1XO5A 2E6WA 1RFJA 4PCWA 1CDPA 2M49B 4C0KA 2PSRA 1QIVA 2WCEA 1OQPA 1RK9A 1SW8A 2KYFA 5I2QA 3AAJA 1V1GA 2HPSA 1CFDA 2OTGC 1PULA 2LP3A 2RGIA 2BCXA 1NSHA 3SG3A 1DJWA 2KFFA 2H61A 1QX5B 1F55A 1PRWA 3BUWB 2LHLA 3SIAA 1AJ5A 4QJ5B 2I94A 1KK7Z 1TRFA 3BUOB 1FW4A 1GGZA 1JF0A 2AAOA 2LMUA 4DCKA 2K7BA 1IH0A 2LHIA 1N0YA 3EK4A 3VRRA 2KAXA 1B4CA 1K2HA 3OX5A 4OCIA 2K2AA 3PM8A 5DKQA 3F45A 3I5HC 1IJ6A 1XA5A 1ODBA 2K7DA 1LVCD 2MBXA 3ZWHA 3LCPC 3WXAA 5IBWA 1IQ3A 2HETA 4GGNA 2JT8A 1HQVA 3IQOA 2JNFA 1CNPA 2AUCA 1S3PA 1MXEA 4CFRA 1XFUO 1U5IB 1XFZO 4PDZA 2OS8C 1BLQA 2F2PA 2PASA 4C0JA 3DVEA 1K9PA 1QTXA 1QJTA 1FPWA 2F33A 2BBMA 3OP0A 3FWBA 1OMRA 1KFUL 1FF1A 2L4IA 1QASA 2HQWA 3ICBA 1XK4A 3C1VA 4MVFA 1LA0A 3PALA 2EC6C 1SBJA 1ZACA 3ZNIA 1JUOA 1QATA 4DIRA 4PE0A 1MQ1A 1QX7A 1WY9A 2D8NA 2KFGA 3PATA 1UHJA 5HLVA 3KPXA 5G08A 1IKUA 2ZN8A 5B8IB 2FCEA 2MJWB 3SG6A 1UP5A 2L2EA 1DMOA 2JULA 3TDUA 1KK8C 3I5FC 1IJ5A 4YGBB 5GQQC 1DJIA 1A03A 4FTGA 1NX0A 2G2BA 2KHNA 3GOFA 2KQYA 1KFUS 1M63B 1NIWA 2PRUA 3M0WA 3EVVA 1SYMA 1SCVA 1EH2A 2GV5A 2OPOA 5AEQA 1CLMA 2LLSA 1TNQA 1DJGA 1TCOB 3O6BA 1SMGA 1TTXA 3CWGA 1JBAA 2KGRA 2L51A 1QLSA 1MF8B 4QJ3B 1MHOA 3DF0A 1BF5A 1F71A 1S6IA 5I2OA 4DRWA 3WHUB 1CDNA 1BJFA 3TS5C 2JRFA 4TNCA 2ZFDA 3I5GC 3VROA 1WLMA 2GGZA 1KQMC 2F8PA 1XFYO 1BG1A 2FJUB 3EK8A 1GGWA 1H8BA 2HF5A 2EHBA 3LL8B 3PLFB 3K21A 4GGFC 5KSZA 2PALA 1ALVA 2LM5A 2LANA 1DGUA 2L50A 3RLZA 1S6CA 2WCBA 1F54A 1HT9A 1KSMA 1AHRA 3JTDC 1QS7A 3BUMB 1DJXA 2LMVA 2WOSA 1TOPA 3DVJA 4CLNA 1K95A 4Q04A 2BKIB 4CIDA 2M7NA 1YVHA 2LVIA 1NP8A 1UHIA 3BYAA 3HX4A 2I7AA 4USLA 1KK7Y 1QXPA 1BR1B 1QV1A 2JT0A 2M9GA 2OTGB 3SIBA 4AQJA 2BE6A 3KEVA 3AKAA 2K8MB 3NSLA 4R1EA 2JNXA 1LXFC 3JVTC 1NX1A 2QACA 2QPTA 4N1FA 1S5GZ 4XJKA 3KO0A 1PVBA 2KAYA 1UUSA 1CDLA 1S26D 4OV2A 2WORA 4M2OA 1NPQA 1OZSA 1QX2A 1QVIZ 1ZMZA 2M29A 3DF0B 4I5LB 2LVKA 4YGCB 3CR2A 4GUKA 1PVAA 4YI8A 4ZCUA 1DJYA 1WRKA 1CLBA 4N5XA 5DKNA 1BOCA 3LK1A 2NXQA 1YX8A 2KNEA 3I5HB 1OZOA 1BMOA 2K7OA 1W7IB 2A4JA 2NLNA 3IQQA 4YGDB 1J55A 1ZOTB 2KAVA 1KCYA 3SG5A 1R6PA 1DTLA 3EVUA 3GK4X 1OMVA 1VRKA 4PHNA 1SR6B 3WHTB 2OS8B 1NCYA 4OVNF 1Y1UA 1DF0A 1TNXA 1X02A 4F0ZB 4MZKA 2KI6D 1CFCA 1CFFA 2SCPA 2LNKA 2SASA 1R2UA 3VRPA 1SNLA 3CS1A 4HSZA 3TZ1A 4GGFA 1TNWA 2KBIA 1C7VA 3SG2A 3SG4A 2I2RE 1B1GA 1UWOA 2ZRSA 4PHMA 3CGAA 1M46A 2JQ6A 2JPTA 2CNPA 2WC8A 1K90D 4XJKB 1QV0A 4PE4A 5JJGA 2F3YA 1XFXO 2V53A 3H4SE 5D7FA 5K89A 5HYDA 1KK8B 3I5FB 2M3WA 1IGVA 1EXRA 1NX2A 2BCAA 1D1OA 4IL1A 1EJ3A 2KI4B 1Y1AA 3LLEA 1ALWA 3AKBA 1UHKA 3A4UB 2LP2A 4L9MA 5AXIA 3O78A 1PSBA 1F8HA 2CCMA 1L2OC 4AQIA 4HRGA 1BT6A 5PALA 3MSEB 4P5OE 4YGEB 1ZFSA 2KSPA 4PE1A 4HRHA 3VRNA 3OHMB 4QJ4B 2M0RA 1SL9A 2JXCA 2NZ0A 3PN7B 1CMGA 3TDZA 2Y1MA 2BL0C 1B47A 1CFPA 4YBHB 3BOWA 1RTP1 1XYDA 1N65A 1DF0B 4MEWA 2M1KB 3TS5B 1CM4A 3EKJA 4CPVA 3I5GB 4ORCB 1B9AA 1KQMB 1S6JA 2LMTA 1CKKA 1SRAA 2CTNA 1SK6D 2LCPA 3EKHA 2L98A 2G9BA 1SCMC 1B8CA 2JWWA 1Y0VH 1J7PA 1FI6A 3SG7A 1IG5A 1YRUB 1A2XA 4MRYA 1L7ZA 1B7TZ 1K93D 2I18A 3OX6A 5KTYA 2Y1NA 1DGVA 1RECA 2WCFA 1RJVA 1M31A 3I5IC 4XYNA 3RM1A 1NX3A 3GK1A 3JTDB 3CR5X 4ETOA 1BODA 1JWDA 1PALA 2LC5A 2M7LA 1IRJA 1C07A 2KBMA 1RROA 3TUYC 1YTZC 1Q80A 1PSRA 5CPVA 3BXKA 2BCBA 2M8UA 4YGAA 5JOLA 2ZN9A 1TIZA 2WNDA 3OB2B 1YURA 3KHEA 2ZRTA 4UPGA 1BR4B 1W7JB 2KDHA 1IQ5A 1S36A 3JVTB 1QVIY 4GFTA 4ORAB 1NYAA 3QRXA 3DD4A 3CLNA 4GBAA 1WRLA 2JU0A 3D0YA 1A29A 1AUIB 1WLZA 3BUNB 4MSPA 5CSJA 3NSIA 2KOTA 1RWYA 1YX7A 3CR4X 5AERA 4OKHA 1V1FA 1Y6WA 2Y5IA 2Y4QA 1G4YR 1YUUA 1A4PA 3BOWB 4HREE 1JSAA 4E68A 3GK2A 4A4BA 4FQOA 1K9KA 3D10A 2PVBA 2TN4A 1NCXA 1B8LA 3FIAA 2JZIA 1F70A 2MLFC 1YRTB 2KGBC 3KF9A 2P6BB 2JT3A 2LV7A 3VGOA 5ER5A 1F4QA 2R2IA 4MBEA 1DJZA 1XK4C 5HKWA 4PE7A 3CTNA 4DUQA 1C7WA 3O2PA 1M45A 1XFWO 5I8NA 1YR5A 1SL7A 1EG4A 1SPYA 1WDCC 1K96A 1YVLA 2DOQA 4D1EA 1CB1A 1FI5A 1LKJA 2MA2A 5AFPA 3HCMA 2MHHA 1QLKA 3O4YA 4WQ2A 4ORBB 4C0LA 1J7OA 3CZTX 2PMYA 4MN0A 2K2FA 2LVVA 1J1DA 1K8UA 1AP4A 2K0JA 4AOMA 1UURA 3A8RA 4PALA 3TDIA 5AANA 1KWOC 2EGDA 5CSNA 2KI6C 2L0PA 1XFVO 4N1GA 4ZCVA 3D0YB 2GGMA 3EVRA 1UHHA 3VRQA 2JC2A 5HKZA 1LA3A 1QIWA 2O60A 1KFXL 2VRGA 1M39A 1TN4A 1WRZA 2O5GA 3LK0A 1CLLA 1JFKA 5BPJA 1F4OA 1XVJA 4GNKB 2MLEC 5ER4X 2EC6B 4PHKA 1K94A 1EL4A 5TNCA 1YUSA 3DVMA 1L2OB 1G33A 1S1EA 1UHNA 4JWQA 4MZJA 1J7QA 2LAPA 1MWNA 1KQVA 2ISDA 1OSAA 2BL0B 1MUXA 1DT7B 2L4HA 1KFXS 2BE4A 4A4CA 5J3XA 2CXJA 1SR6C 4YRUA 1CTRA 5HKYA 4GAOA 1OMDA 3NSOA 1DVIA 1B7TY 2KFHA 2Q91A 4P2YB 1CDMA 4MZLA 2LVJA 2LLTA 1LINA 1SCMB 1TNPA 4MLWA 3DVKA 2B1UA 3BUXB 4M2QA 2FCDA 2L5XB 4PHJA 2KYCA 1IWQA 3I5IB 1KSOA 3BQ3A 1NUBA 1MR8A 4WQ3A 3NXAA 5DKRA 3SJSA 4OR9B 2F2OA 4NDBA 2NCPA 2HQ8A 1A75A 3TUYB 2CT9A 1AK8A 2MRDA 1B8RA 4JPZB 1GQMA 1CM1A 1H4BA 5CSIA 4NQGA 2K61A 2NCOA 1SL8A 2KI4C 3NSKA 2H61C 3FS7A 2MAZA 1ZUZA 4M2PA 2IS9A 5FYXA 4JQ0D 2LUCA 1J1EA 3EK7A 1S5GY 2JXLA 3PFVA 4GPLB 4U8DA 1N2DA 1SY9A 4I5KA 2COLB 2ZNEA 2FOTA 2M1UA 1AVSA 3PN7C 1GJYA 3IF7A 3OB1B 4NDDA 3WNXB 2F3ZA 1G8IA 1JF2A 2CBLA 2LUXA 1MXLC 5I2LA 1J7RA 1NWDA 5D69A 1AJ4A 2KQ6A 2M97A
chains in the Genus database with same CATH superfamily
5F6TA 5CSFA 2K60A 4BY4A 1JC2A 2E30A 3AAKA 2JTZA 1Y1XA 4BY5A 1TCFA 4DS7A 1BU3A 1OOJA 1YUTA 4YI9A 1CMFA 1K9UA 2ZNDA 4NDCA 3L47A 1DJHA 2P71A 3D74A 4MRXA 1E8AA 2Q4UA 3FWCA 2BECA 1JFJA 4I5NB 4CFQA 2H2KA 1WDCB 2BKHB 3CZ0A 5KU1A 1QWVA 1A75B 2JTTA 2K7CA 2JOJA 1EG3A 4I5JA 1SKTA 5HLOA 3SS5A 1OE9B 3E3RA 1FBVA 3PSRA 2ZKMX 1NCZA 2BBNA 4ICBA 2LE9B 2AMIA 5FI6A 1KWOB 1PK0D 2LLUA 1U5IA 4WRIA 1XO5A 2E6WA 1RFJA 4PCWA 1CDPA 2QEVA 2M49B 2L5YA 4C0KA 5I94A 2PSRA 1QIVA 1T14A 2WCEA 1OQPA 1RK9A 1SW8A 3D73A 2KYFA 5I2QA 3AAJA 3CYZA 1V1GA 2HPSA 1CFDA 2OTGC 1PULA 2LP3A 2RGIA 2BCXA 1NSHA 3SG3A 1DJWA 2KFFA 2H61A 1QX5B 1F55A 1PRWA 3BUWB 2LHLA 3SIAA 1AJ5A 4QJ5B 2I94A 3K1EA 1KK7Z 1TRFA 3BUOB 1FW4A 1GGZA 1JF0A 2AAOA 2LMUA 4DCKA 2K7BA 1IH0A 3B7AA 2LHIA 1N0YA 1Z4HA 3EK4A 3VRRA 2KAXA 3FE6A 1XFRA 1B4CA 1K2HA 3OX5A 4OCIA 2K2AA 3PM8A 5DKQA 3F45A 3I5HC 1IJ6A 1XA5A 1ODBA 2K7DA 1LVCD 2MBXA 3ZWHA 3LCPC 1OOGA 3S0BA 3WXAA 5IBWA 2HETA 4GGNA 1IQ3A 2JT8A 1HQVA 3IQOA 5D3OA 2JNFA 3BFHA 1CNPA 2L2CA 4OZDA 2AUCA 1S3PA 3R1OA 3R1PA 1MXEA 4CFRA 1XFUO 1U5IB 1XFZO 4PDZA 2OS8C 1BLQA 2F2PA 2PASA 4C0JA 3DVEA 3Q8IA 1K9PA 1QTXA 1OOIX 1QJTA 3D75A 1FPWA 1TUJA 2F33A 4IJ7A 2BBMA 3OP0A 3FWBA 1OMRA 1KFUL 1FF1A 2L4IA 1QASA 2HQWA 3ICBA 3L4AA 1XK4A 3C1VA 4MVFA 1LA0A 3PALA 2EC6C 2JPOA 1SBJA 1ZACA 3ZNIA 1JUOA 1QATA 4DIRA 4PE0A 1MQ1A 1QX7A 1WY9A 2D8NA 2KFGA 3PATA 1UHJA 5DICA 3KPXA 5G08A 1IKUA 2ZN8A 5B8IB 2FCEA 2MJWB 3SG6A 1UP5A 2L2EA 1DMOA 2JULA 3TDUA 1KK8C 3I5FC 1IJ5A 4YGBB 5GQQC 1DJIA 1A03A 1GM0A 2WCLA 4FTGA 1NX0A 2G2BA 2KHNA 3GOFA 2KQYA 3S0EA 1KFUS 1M63B 1NIWA 2PRUA 4KYNA 3M0WA 3EVVA 1SYMA 4INWA 1SCVA 1EH2A 2GV5A 2OPOA 5AEQA 1CLMA 2LLSA 1TNQA 1DJGA 1TCOB 3O6BA 2WC6A 1SMGA 1TTXA 3CWGA 1JBAA 3DY9A 2KGRA 2L51A 1QLSA 2BAPA 1MF8B 4QJ3B 1MHOA 3DF0A 1BF5A 1F71A 1S6IA 5I2OA 1P28A 4DRWA 3WHUB 1OW4A 1BJFA 1CDNA 3TS5C 2JRFA 4TNCA 2ZFDA 3I5GC 3VROA 1WLMA 2GGZA 1KQMC 2F8PA 2WC5A 1XFYO 5EL2A 1BG1A 2FJUB 3EK8A 1GGWA 1H8BA 2HF5A 2EHBA 3LL8B 3PLFB 3K21A 4GGFC 5KSZA 2PALA 1ALVA 3S0GA 2LM5A 2LANA 1DGUA 2L50A 3RLZA 1S6CA 2WCBA 1F54A 1HT9A 1KSMA 3BFBA 1AHRA 3PM2A 3JTDC 1QS7A 3BUMB 1DJXA 2LMVA 2WOSA 1TOPA 3DVJA 4CLNA 1K95A 4Q04A 2BKIB 4CIDA 2M7NA 1YVHA 2LVIA 1NP8A 1UHIA 3BYAA 2QEHA 3HX4A 2I7AA 4USLA 1KK7Y 1QXPA 1BR1B 1QV1A 2JT0A 2M9GA 2OTGB 3SIBA 4AQJA 2BE6A 2QDIA 3KEVA 3AKAA 2K8MB 3NSLA 4R1EA 2JNXA 1LXFC 3JVTC 1NX1A 2QACA 2QPTA 3SS3A 4N1FA 1S5GZ 4XJKA 3KO0A 1PVBA 2KAYA 1UUSA 1CDLA 1S26D 4OV2A 3QMEA 2WORA 4M2OA 1NPQA 1OZSA 1QX2A 1QVIZ 1ZMZA 2M29A 3DF0B 1Z2CB 2LVKA 3NHTA 3CR2A 4I5LB 4GUKA 1PVAA 4YI8A 4YGCB 4ZCUA 1DJYA 1WRKA 1CLBA 4N5XA 5DKNA 1BOCA 3LK1A 2NXQA 5FI2A 1YX8A 2KNEA 3I5HB 1OZOA 1BMOA 2K7OA 1W7IB 2A4JA 3D76A 2NLNA 3IQQA 5HL1A 4YGDB 1J55A 1ZOTB 2KAVA 3S0DA 1KCYA 3SG5A 1R6PA 4INXA 1DTLA 3EVUA 3NHIA 3GK4X 1OMVA 4PT1A 1VRKA 4PHNA 1SR6B 3WHTB 3B86A 2OS8B 1NCYA 4OVNF 1Y1UA 1DF0A 1TNXA 1X02A 4F0ZB 4MZKA 1ORGA 2KI6D 1CFCA 1CFFA 2SCPA 1C3ZA 2LNKA 2SASA 1R2UA 3VRPA 1SNLA 2KLDA 3B87A 3CS1A 4HSZA 3TZ1A 4GGFA 1TNWA 2KBIA 1C7VA 3V2LA 3SG2A 3SG4A 2I2RE 1B1GA 3DZTA 1UWOA 2ZRSA 4PHMA 3CGAA 3CDNA 1M46A 2JQ6A 3OGNA 2JPTA 2CNPA 2WC8A 1K90D 4XJKB 1QV0A 4PE4A 5JJGA 2F3YA 1XFXO 2V53A 3EG5B 3H4SE 5D7FA 5K89A 5HYDA 1KK8B 1LS8A 3I5FB 2YGUA 2M3WA 1IGVA 1EXRA 1NX2A 2BCAA 1D1OA 4IL1A 1EJ3A 3NGVA 2KI4B 1Y1AA 3LLEA 1ALWA 3AKBA 1UHKA 3A4UB 2LP2A 1DELA 4L9MA 5AXIA 3O78A 1DQEA 1PSBA 3S0FA 2CCMA 1F8HA 1L2OC 3B6XA 4AQIA 4HRGA 4FQTA 1BT6A 5PALA 3MSEB 4P5OE 4YGEB 1ZFSA 2KSPA 3R1VA 4PE1A 4HRHA 3SS4A 3VRNA 3OHMB 4QJ4B 2M0RA 1SL9A 2JXCA 2NZ0A 3PN7B 1CMGA 3TDZA 2Y1MA 3L4LA 2BL0C 1B47A 1CFPA 4YBHB 3BOWA 1RTP1 1XYDA 1N65A 1DF0B 4MEWA 2M1KB 3TS5B 1CM4A 2WCJA 3EKJA 4CPVA 3I5GB 4ORCB 1B9AA 1KQMB 1S6JA 2LMTA 1CKKA 1SRAA 2CTNA 1SK6D 2LCPA 3EKHA 1C3YA 2L98A 2G9BA 1SCMC 1B8CA 2JWWA 1Y0VH 1J7PA 1FI6A 3SG7A 1IG5A 1TWOA 1A2XA 1YRUB 4MRYA 1L7ZA 1B7TZ 1K93D 2I18A 3FE9A 3OX6A 5KTYA 2Y1NA 1DGVA 1RECA 2WCFA 1RJVA 1M31A 3I5IC 4XYNA 3RM1A 1NX3A 3GK1A 3JTDB 3CR5X 4ETOA 1BODA 1JWDA 1PALA 2LC5A 2M7LA 3FE8A 1IRJA 1C07A 2KBMA 3DYEA 1RROA 3TUYC 1YTZC 1Q80A 1PSRA 5CPVA 3BXKA 2BCBA 2M8UA 4YGAA 5JOLA 2ZN9A 1TIZA 2WNDA 3OB2B 1YURA 3KHEA 2ZRTA 4F7FA 4UPGA 1BR4B 1W7JB 2KDHA 1IQ5A 1S36A 3JVTB 1QVIY 4GFTA 4ORAB 1NYAA 3QRXA 3DD4A 3CLNA 4GBAA 1WRLA 2JU0A 3D0YA 1A29A 1AUIB 1WLZA 3BUNB 4MSPA 5CSJA 3NSIA 2KOTA 1RWYA 1YX7A 3CR4X 5AERA 4OKHA 1V1FA 1Y6WA 2Y5IA 2Y4QA 1G4YR 1YUUA 1A4PA 3BOWB 4HREE 1JSAA 4E68A 3BFAA 1DEKA 3GK2A 4A4BA 4FQOA 1K9KA 3D10A 3UO9A 2PVBA 2TN4A 1NCXA 1B8LA 3FIAA 2JZIA 1OOFA 1F70A 2MLFC 1YRTB 2KGBC 3KF9A 2P6BB 2JT3A 2LV7A 2QEBA 5ER5A 3VGOA 1F4QA 2R2IA 4MBEA 1DJZA 1XK4C 5HKWA 4PE7A 3CTNA 4DUQA 1C7WA 3O2PA 2WCMA 1M45A 1XFWO 2QEOA 5I8NA 1YR5A 1SL7A 1EG4A 1SPYA 1WDCC 1K96A 1YVLA 2DOQA 4D1EA 1CB1A 5HLVA 1FI5A 3N7HA 1LKJA 2MA2A 5AFPA 3HCMA 2MHHA 1QLKA 3O4YA 4WQ2A 4ORBB 3B88A 4C0LA 1J7OA 3CZTX 2PMYA 4MN0A 1SSEB 2K2FA 2LVVA 1J1DA 4JKTA 1K8UA 1AP4A 2K0JA 4AOMA 1UURA 3A8RA 4PALA 3TDIA 2PYQA 5AANA 1KWOC 2EGDA 5CSNA 2KI6C 2L0PA 1XFVO 3IVTA 4N1GA 4ZCVA 3D0YB 3D77A 2GGMA 3EVRA 1UHHA 3VRQA 2JC2A 5HKZA 1LA3A 1QIWA 2O60A 1KFXL 2VRGA 1M39A 1TN4A 2PQLA 1WRZA 2O5GA 3LK0A 1CLLA 1JFKA 2FJYA 5BPJA 1F4OA 1XVJA 4GNKB 3OBVA 2MLEC 5ER4X 2EC6B 4PHKA 1K94A 1EL4A 3VB1A 5TNCA 2ERBA 1YUSA 2WCHA 1L2OB 3DVMA 1G33A 1S1EA 3O4XA 1UHNA 4JWQA 2H8VA 2P70A 4MZJA 1J7QA 2LAPA 1MWNA 1KQVA 2ISDA 2KPHA 1OSAA 2BL0B 1MUXA 1DT7B 2L4HA 1KFXS 2BE4A 4A4CA 5J3XA 3BJHA 2CXJA 1SR6C 3CZ2A 3UNWA 4JD9A 4YRUA 1CTRA 5HKYA 4GAOA 1OMDA 3NSOA 1DVIA 1B7TY 2KFHA 2Q91A 1DC1A 4P2YB 1CDMA 4MZLA 2LVJA 2LLTA 3DXLA 3PJIA 1LINA 1SCMB 1TNPA 4MLWA 3DVKA 3RZSA 2B1UA 3BUXB 4M2QA 2FCDA 2L5XB 4PHJA 2KYCA 1IWQA 1IIOA 3I5IB 1KSOA 3BQ3A 1NUBA 1MR8A 4WQ3A 3NXAA 5DKRA 3SJSA 4OR9B 2F2OA 4NDBA 2NCPA 2HQ8A 1A75A 3TUYB 2CT9A 1AK8A 2MRDA 1B8RA 2WCKA 4JPZB 1GQMA 1CM1A 1H4BA 3CZ1A 5CSIA 4NQGA 2K61A 1TUZA 1SL8A 2NCOA 2KI4C 3NSKA 2H61C 3FS7A 3CABA 2MAZA 1ZUZA 4M2PA 2GTEA 2IS9A 4JQ0D 5FYXA 2LUCA 1J1EA 3EK7A 3D78A 1S5GY 2JXLA 1OOHA 3PFVA 4GPLB 4U8DA 1N2DA 1SY9A 4I5KA 2COLB 2ZNEA 2FOTA 2KLEA 2M1UA 1AVSA 3PN7C 2BNXA 1W9ZA 1GJYA 5FI7A 3R72A 3IF7A 3OB1B 4NDDA 3WNXB 2F3ZA 1G8IA 1JF2A 2CBLA 2LUXA 1MXLC 5I2LA 1J7RA 1NWDA 5D69A 1AJ4A 2KQ6A 3S0AA 2M97A
chains in the Genus database with same CATH topology
5F6TA 5CSFA 4BY4A 1JC2A 2E30A 3AAKA 2JTZA 1Y1XA 4BY5A 1TCFA 4DS7A 1BU3A 1OOJA 1YUTA 4YI9A 1CMFA 1K9UA 2ZNDA 4NDCA 1DJHA 4MRXA 1E8AA 2Q4UA 3FWCA 2BECA 1JFJA 4I5NB 4CFQA 2H2KA 1WDCB 2BKHB 5KU1A 1A75B 2JTTA 2K7CA 2JOJA 1EG3A 4I5JA 1SKTA 5HLOA 1OE9B 3E3RA 1FBVA 3PSRA 2ZKMX 1NCZA 2BBNA 4ICBA 2LE9B 2AMIA 1KWOB 1PK0D 2LLUA 1U5IA 4WRIA 1XO5A 2E6WA 1RFJA 4PCWA 1CDPA 2M49B 4C0KA 2PSRA 1QIVA 2WCEA 1OQPA 1RK9A 1SW8A 2KYFA 5I2QA 3AAJA 1V1GA 2HPSA 1CFDA 2OTGC 1PULA 2LP3A 2RGIA 2BCXA 1NSHA 3SG3A 1DJWA 2KFFA 2H61A 1QX5B 1F55A 1PRWA 3BUWB 2LHLA 3SIAA 1AJ5A 4QJ5B 2I94A 1KK7Z 1TRFA 3BUOB 1FW4A 1GGZA 1JF0A 2AAOA 2LMUA 4DCKA 2K7BA 1IH0A 2LHIA 1N0YA 3EK4A 3VRRA 2KAXA 1B4CA 1K2HA 3OX5A 4OCIA 2K2AA 3PM8A 5DKQA 3F45A 3I5HC 1IJ6A 1XA5A 1ODBA 2K7DA 1LVCD 2MBXA 3ZWHA 3LCPC 3WXAA 5IBWA 1IQ3A 2HETA 4GGNA 2JT8A 1HQVA 3IQOA 2JNFA 1CNPA 2AUCA 1S3PA 1MXEA 4CFRA 1XFUO 1U5IB 1XFZO 4PDZA 2OS8C 1BLQA 2F2PA 2PASA 4C0JA 3DVEA 1K9PA 1QTXA 1QJTA 1FPWA 2F33A 2BBMA 3OP0A 3FWBA 1OMRA 1KFUL 1FF1A 2L4IA 1QASA 2HQWA 3ICBA 1XK4A 3C1VA 4MVFA 1LA0A 3PALA 2EC6C 1SBJA 1ZACA 3ZNIA 1JUOA 1QATA 4DIRA 4PE0A 1MQ1A 1QX7A 1WY9A 2D8NA 2KFGA 3PATA 1UHJA 5HLVA 3KPXA 5G08A 1IKUA 2ZN8A 5B8IB 2FCEA 2MJWB 3SG6A 1UP5A 2L2EA 1DMOA 2JULA 3TDUA 1KK8C 3I5FC 1IJ5A 4YGBB 5GQQC 1DJIA 1A03A 4FTGA 1NX0A 2G2BA 2KHNA 3GOFA 2KQYA 1KFUS 1M63B 1NIWA 2PRUA 3M0WA 3EVVA 1SYMA 1SCVA 1EH2A 2GV5A 2OPOA 5AEQA 1CLMA 2LLSA 1TNQA 1DJGA 1TCOB 3O6BA 1SMGA 1TTXA 3CWGA 1JBAA 2KGRA 2L51A 1QLSA 1MF8B 4QJ3B 1MHOA 3DF0A 1BF5A 1F71A 1S6IA 5I2OA 4DRWA 3WHUB 1CDNA 1BJFA 3TS5C 2JRFA 4TNCA 2ZFDA 3I5GC 3VROA 1WLMA 2GGZA 1KQMC 2F8PA 1XFYO 1BG1A 2FJUB 3EK8A 1GGWA 1H8BA 2HF5A 2EHBA 3LL8B 3PLFB 3K21A 4GGFC 5KSZA 2PALA 1ALVA 2LM5A 2LANA 1DGUA 2L50A 3RLZA 1S6CA 2WCBA 1F54A 1HT9A 1KSMA 1AHRA 3JTDC 1QS7A 3BUMB 1DJXA 2LMVA 2WOSA 1TOPA 3DVJA 4CLNA 1K95A 4Q04A 2BKIB 4CIDA 2M7NA 1YVHA 2LVIA 1NP8A 1UHIA 3BYAA 3HX4A 2I7AA 4USLA 1KK7Y 1QXPA 1BR1B 1QV1A 2JT0A 2M9GA 2OTGB 3SIBA 4AQJA 2BE6A 3KEVA 3AKAA 2K8MB 3NSLA 4R1EA 2JNXA 1LXFC 3JVTC 1NX1A 2QACA 2QPTA 4N1FA 1S5GZ 4XJKA 3KO0A 1PVBA 2KAYA 1UUSA 1CDLA 1S26D 4OV2A 2WORA 4M2OA 1NPQA 1OZSA 1QX2A 1QVIZ 1ZMZA 2M29A 3DF0B 4I5LB 2LVKA 4YGCB 3CR2A 4GUKA 1PVAA 4YI8A 4ZCUA 1DJYA 1WRKA 1CLBA 4N5XA 5DKNA 1BOCA 3LK1A 2NXQA 1YX8A 2KNEA 3I5HB 1OZOA 1BMOA 2K7OA 1W7IB 2A4JA 2NLNA 3IQQA 4YGDB 1J55A 1ZOTB 2KAVA 1KCYA 3SG5A 1R6PA 1DTLA 3EVUA 3GK4X 1OMVA 1VRKA 4PHNA 1SR6B 3WHTB 2OS8B 1NCYA 4OVNF 1Y1UA 1DF0A 1TNXA 1X02A 4F0ZB 4MZKA 2KI6D 1CFCA 1CFFA 2SCPA 2LNKA 2SASA 1R2UA 3VRPA 1SNLA 3CS1A 4HSZA 3TZ1A 4GGFA 1TNWA 2KBIA 1C7VA 3SG2A 3SG4A 2I2RE 1B1GA 1UWOA 2ZRSA 4PHMA 3CGAA 1M46A 2JQ6A 2JPTA 2CNPA 2WC8A 1K90D 4XJKB 1QV0A 4PE4A 5JJGA 2F3YA 1XFXO 2V53A 3H4SE 5D7FA 5K89A 5HYDA 1KK8B 3I5FB 2M3WA 1IGVA 1EXRA 1NX2A 2BCAA 1D1OA 4IL1A 1EJ3A 2KI4B 1Y1AA 3LLEA 1ALWA 3AKBA 1UHKA 3A4UB 2LP2A 4L9MA 5AXIA 3O78A 1PSBA 1F8HA 2CCMA 1L2OC 4AQIA 4HRGA 1BT6A 5PALA 3MSEB 4P5OE 4YGEB 1ZFSA 2KSPA 4PE1A 4HRHA 3VRNA 3OHMB 4QJ4B 2M0RA 1SL9A 2JXCA 2NZ0A 3PN7B 1CMGA 3TDZA 2Y1MA 2BL0C 1B47A 1CFPA 4YBHB 3BOWA 1RTP1 1XYDA 1N65A 1DF0B 4MEWA 2M1KB 3TS5B 1CM4A 3EKJA 4CPVA 3I5GB 4ORCB 1B9AA 1KQMB 1S6JA 2LMTA 1CKKA 1SRAA 2CTNA 1SK6D 2LCPA 3EKHA 2L98A 2G9BA 1SCMC 1B8CA 2JWWA 1Y0VH 1J7PA 1FI6A 3SG7A 1IG5A 1YRUB 1A2XA 4MRYA 1L7ZA 1B7TZ 1K93D 2I18A 3OX6A 5KTYA 2Y1NA 1DGVA 1RECA 2WCFA 1RJVA 1M31A 3I5IC 4XYNA 3RM1A 1NX3A 3GK1A 3JTDB 3CR5X 4ETOA 1BODA 1JWDA 1PALA 2LC5A 2M7LA 1IRJA 1C07A 2KBMA 1RROA 3TUYC 1YTZC 1Q80A 1PSRA 5CPVA 3BXKA 2BCBA 2M8UA 4YGAA 5JOLA 2ZN9A 1TIZA 2WNDA 3OB2B 1YURA 3KHEA 2ZRTA 4UPGA 1BR4B 1W7JB 2KDHA 1IQ5A 1S36A 3JVTB 1QVIY 4GFTA 4ORAB 1NYAA 3QRXA 3DD4A 3CLNA 4GBAA 1WRLA 2JU0A 3D0YA 1A29A 1AUIB 1WLZA 3BUNB 4MSPA 5CSJA 3NSIA 2KOTA 1RWYA 1YX7A 3CR4X 5AERA 4OKHA 1V1FA 1Y6WA 2Y5IA 2Y4QA 1G4YR 1YUUA 1A4PA 3BOWB 4HREE 1JSAA 4E68A 3GK2A 4A4BA 4FQOA 1K9KA 3D10A 2PVBA 2TN4A 1NCXA 1B8LA 3FIAA 2JZIA 1F70A 2MLFC 1YRTB 2KGBC 3KF9A 2P6BB 2JT3A 2LV7A 3VGOA 5ER5A 1F4QA 2R2IA 4MBEA 1DJZA 1XK4C 5HKWA 4PE7A 3CTNA 4DUQA 1C7WA 3O2PA 1M45A 1XFWO 5I8NA 1YR5A 1SL7A 1EG4A 1SPYA 1WDCC 1K96A 1YVLA 2DOQA 4D1EA 1CB1A 1FI5A 1LKJA 2MA2A 5AFPA 3HCMA 2MHHA 1QLKA 3O4YA 4WQ2A 4ORBB 4C0LA 1J7OA 3CZTX 2PMYA 4MN0A 2K2FA 2LVVA 1J1DA 1K8UA 1AP4A 2K0JA 4AOMA 1UURA 3A8RA 4PALA 3TDIA 5AANA 1KWOC 2EGDA 5CSNA 2KI6C 2L0PA 1XFVO 4N1GA 4ZCVA 3D0YB 2GGMA 3EVRA 1UHHA 3VRQA 2JC2A 5HKZA 1LA3A 1QIWA 2O60A 1KFXL 2VRGA 1M39A 1TN4A 1WRZA 2O5GA 3LK0A 1CLLA 1JFKA 5BPJA 1F4OA 1XVJA 4GNKB 2MLEC 5ER4X 2EC6B 4PHKA 1K94A 1EL4A 5TNCA 1YUSA 3DVMA 1L2OB 1G33A 1S1EA 1UHNA 4JWQA 4MZJA 1J7QA 2LAPA 1MWNA 1KQVA 2ISDA 1OSAA 2BL0B 1MUXA 1DT7B 2L4HA 1KFXS 2BE4A 4A4CA 5J3XA 2CXJA 1SR6C 4YRUA 1CTRA 5HKYA 4GAOA 1OMDA 3NSOA 1DVIA 1B7TY 2KFHA 2Q91A 4P2YB 1CDMA 4MZLA 2LVJA 2LLTA 1LINA 1SCMB 1TNPA 4MLWA 3DVKA 2B1UA 3BUXB 4M2QA 2FCDA 2L5XB 4PHJA 2KYCA 1IWQA 3I5IB 1KSOA 3BQ3A 1NUBA 1MR8A 4WQ3A 3NXAA 5DKRA 3SJSA 4OR9B 2F2OA 4NDBA 2NCPA 2HQ8A 1A75A 3TUYB 2CT9A 1AK8A 2MRDA 1B8RA 4JPZB 1GQMA 1CM1A 1H4BA 5CSIA 4NQGA 2K61A 2NCOA 1SL8A 2KI4C 3NSKA 2H61C 3FS7A 2MAZA 1ZUZA 4M2PA 2IS9A 5FYXA 4JQ0D 2LUCA 1J1EA 3EK7A 1S5GY 2JXLA 3PFVA 4GPLB 4U8DA 1N2DA 1SY9A 4I5KA 2COLB 2ZNEA 2FOTA 2M1UA 1AVSA 3PN7C 1GJYA 3IF7A 3OB1B 4NDDA 3WNXB 2F3ZA 1G8IA 1JF2A 2CBLA 2LUXA 1MXLC 5I2LA 1J7RA 1NWDA 5D69A 1AJ4A 2KQ6A 2M97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6T A;  5CSF A;  4BY4 A;  1JC2 A;  2E30 A;  3AAK A;  2JTZ A;  1Y1X A;  4BY5 A;  1TCF A;  4DS7 A;  1BU3 A;  1OOJ A;  1YUT A;  4YI9 A;  1CMF A;  1K9U A;  2ZND A;  4NDC A;  1DJH A;  4MRX A;  1E8A A;  2Q4U A;  3FWC A;  2BEC A;  1JFJ A;  4I5N B;  4CFQ A;  2H2K A;  1WDC B;  2BKH B;  5KU1 A;  1A75 B;  2JTT A;  2K7C A;  2JOJ A;  1EG3 A;  4I5J A;  1SKT A;  5HLO A;  1OE9 B;  3E3R A;  1FBV A;  3PSR A;  2ZKM X;  1NCZ A;  2BBN A;  4ICB A;  2LE9 B;  2AMI A;  1KWO B;  1PK0 D;  2LLU A;  1U5I A;  4WRI A;  1XO5 A;  2E6W A;  1RFJ A;  4PCW A;  1CDP A;  2M49 B;  4C0K A;  2PSR A;  1QIV A;  2WCE A;  1OQP A;  1RK9 A;  1SW8 A;  2KYF A;  5I2Q A;  3AAJ A;  1V1G A;  2HPS A;  1CFD A;  2OTG C;  1PUL A;  2LP3 A;  2RGI A;  2BCX A;  1NSH A;  3SG3 A;  1DJW A;  2KFF A;  2H61 A;  1QX5 B;  1F55 A;  1PRW A;  3BUW B;  2LHL A;  3SIA A;  1AJ5 A;  4QJ5 B;  2I94 A;  1KK7 Z;  1TRF A;  3BUO B;  1FW4 A;  1GGZ A;  1JF0 A;  2AAO A;  2LMU A;  4DCK A;  2K7B A;  1IH0 A;  2LHI A;  1N0Y A;  3EK4 A;  3VRR A;  2KAX A;  1B4C A;  1K2H A;  3OX5 A;  4OCI A;  2K2A A;  3PM8 A;  5DKQ A;  3F45 A;  3I5H C;  1IJ6 A;  1XA5 A;  1ODB A;  2K7D A;  1LVC D;  2MBX A;  3ZWH A;  3LCP C;  3WXA A;  5IBW A;  1IQ3 A;  2HET A;  4GGN A;  2JT8 A;  1HQV A;  3IQO A;  2JNF A;  1CNP A;  2AUC A;  1S3P A;  1MXE A;  4CFR A;  1XFU O;  1U5I B;  1XFZ O;  4PDZ A;  2OS8 C;  1BLQ A;  2F2P A;  2PAS A;  4C0J A;  3DVE A;  1K9P A;  1QTX A;  1QJT A;  1FPW A;  2F33 A;  2BBM A;  3OP0 A;  3FWB A;  1OMR A;  1KFU L;  1FF1 A;  2L4I A;  1QAS A;  2HQW A;  3ICB A;  1XK4 A;  3C1V A;  4MVF A;  1LA0 A;  3PAL A;  2EC6 C;  1SBJ A;  1ZAC A;  3ZNI A;  1JUO A;  1QAT A;  4DIR A;  4PE0 A;  1MQ1 A;  1QX7 A;  1WY9 A;  2D8N A;  2KFG A;  3PAT A;  1UHJ A;  5HLV A;  3KPX A;  5G08 A;  1IKU A;  2ZN8 A;  5B8I B;  2FCE A;  2MJW B;  3SG6 A;  1UP5 A;  2L2E A;  1DMO A;  2JUL A;  3TDU A;  1KK8 C;  3I5F C;  1IJ5 A;  4YGB B;  5GQQ C;  1DJI A;  1A03 A;  4FTG A;  1NX0 A;  2G2B A;  2KHN A;  3GOF A;  2KQY A;  1KFU S;  1M63 B;  1NIW A;  2PRU A;  3M0W A;  3EVV A;  1SYM A;  1SCV A;  1EH2 A;  2GV5 A;  2OPO A;  5AEQ A;  1CLM A;  2LLS A;  1TNQ A;  1DJG A;  1TCO B;  3O6B A;  1SMG A;  1TTX A;  3CWG A;  1JBA A;  2KGR A;  2L51 A;  1QLS A;  1MF8 B;  4QJ3 B;  1MHO A;  3DF0 A;  1BF5 A;  1F71 A;  1S6I A;  5I2O A;  4DRW A;  3WHU B;  1CDN A;  1BJF A;  3TS5 C;  2JRF A;  4TNC A;  2ZFD A;  3I5G C;  3VRO A;  1WLM A;  2GGZ A;  1KQM C;  2F8P A;  1XFY O;  1BG1 A;  2FJU B;  3EK8 A;  1GGW A;  1H8B A;  2HF5 A;  2EHB A;  3LL8 B;  3PLF B;  3K21 A;  4GGF C;  5KSZ A;  2PAL A;  1ALV A;  2LM5 A;  2LAN A;  1DGU A;  2L50 A;  3RLZ A;  1S6C A;  2WCB A;  1F54 A;  1HT9 A;  1KSM A;  1AHR A;  3JTD C;  1QS7 A;  3BUM B;  1DJX A;  2LMV A;  2WOS A;  1TOP A;  3DVJ A;  4CLN A;  1K95 A;  4Q04 A;  2BKI B;  4CID A;  2M7N A;  1YVH A;  2LVI A;  1NP8 A;  1UHI A;  3BYA A;  3HX4 A;  2I7A A;  4USL A;  1KK7 Y;  1QXP A;  1BR1 B;  1QV1 A;  2JT0 A;  2M9G A;  2OTG B;  3SIB A;  4AQJ A;  2BE6 A;  3KEV A;  3AKA A;  2K8M B;  3NSL A;  4R1E A;  2JNX A;  1LXF C;  3JVT C;  1NX1 A;  2QAC A;  2QPT A;  4N1F A;  1S5G Z;  4XJK A;  3KO0 A;  1PVB A;  2KAY A;  1UUS A;  1CDL A;  1S26 D;  4OV2 A;  2WOR A;  4M2O A;  1NPQ A;  1OZS A;  1QX2 A;  1QVI Z;  1ZMZ A;  2M29 A;  3DF0 B;  4I5L B;  2LVK A;  4YGC B;  3CR2 A;  4GUK A;  1PVA A;  4YI8 A;  4ZCU A;  1DJY A;  1WRK A;  1CLB A;  4N5X A;  5DKN A;  1BOC A;  3LK1 A;  2NXQ A;  1YX8 A;  2KNE A;  3I5H B;  1OZO A;  1BMO A;  2K7O A;  1W7I B;  2A4J A;  2NLN A;  3IQQ A;  4YGD B;  1J55 A;  1ZOT B;  2KAV A;  1KCY A;  3SG5 A;  1R6P A;  1DTL A;  3EVU A;  3GK4 X;  1OMV A;  1VRK A;  4PHN A;  1SR6 B;  3WHT B;  2OS8 B;  1NCY A;  4OVN F;  1Y1U A;  1DF0 A;  1TNX A;  1X02 A;  4F0Z B;  4MZK A;  2KI6 D;  1CFC A;  1CFF A;  2SCP A;  2LNK A;  2SAS A;  1R2U A;  3VRP A;  1SNL A;  3CS1 A;  4HSZ A;  3TZ1 A;  4GGF A;  1TNW A;  2KBI A;  1C7V A;  3SG2 A;  3SG4 A;  2I2R E;  1B1G A;  1UWO A;  2ZRS A;  4PHM A;  3CGA A;  1M46 A;  2JQ6 A;  2JPT A;  2CNP A;  2WC8 A;  1K90 D;  4XJK B;  1QV0 A;  4PE4 A;  5JJG A;  2F3Y A;  1XFX O;  2V53 A;  3H4S E;  5D7F A;  5K89 A;  5HYD A;  1KK8 B;  3I5F B;  2M3W A;  1IGV A;  1EXR A;  1NX2 A;  2BCA A;  1D1O A;  4IL1 A;  1EJ3 A;  2KI4 B;  1Y1A A;  3LLE A;  1ALW A;  3AKB A;  1UHK A;  3A4U B;  2LP2 A;  4L9M A;  5AXI A;  3O78 A;  1PSB A;  1F8H A;  2CCM A;  1L2O C;  4AQI A;  4HRG A;  1BT6 A;  5PAL A;  3MSE B;  4P5O E;  4YGE B;  1ZFS A;  2KSP A;  4PE1 A;  4HRH A;  3VRN A;  3OHM B;  4QJ4 B;  2M0R A;  1SL9 A;  2JXC A;  2NZ0 A;  3PN7 B;  1CMG A;  3TDZ A;  2Y1M A;  2BL0 C;  1B47 A;  1CFP A;  4YBH B;  3BOW A;  1RTP 1;  1XYD A;  1N65 A;  1DF0 B;  4MEW A;  2M1K B;  3TS5 B;  1CM4 A;  3EKJ A;  4CPV A;  3I5G B;  4ORC B;  1B9A A;  1KQM B;  1S6J A;  2LMT A;  1CKK A;  1SRA A;  2CTN A;  1SK6 D;  2LCP A;  3EKH A;  2L98 A;  2G9B A;  1SCM C;  1B8C A;  2JWW A;  1Y0V H;  1J7P A;  1FI6 A;  3SG7 A;  1IG5 A;  1YRU B;  1A2X A;  4MRY A;  1L7Z A;  1B7T Z;  1K93 D;  2I18 A;  3OX6 A;  5KTY A;  2Y1N A;  1DGV A;  1REC A;  2WCF A;  1RJV A;  1M31 A;  3I5I C;  4XYN A;  3RM1 A;  1NX3 A;  3GK1 A;  3JTD B;  3CR5 X;  4ETO A;  1BOD A;  1JWD A;  1PAL A;  2LC5 A;  2M7L A;  1IRJ A;  1C07 A;  2KBM A;  1RRO A;  3TUY C;  1YTZ C;  1Q80 A;  1PSR A;  5CPV A;  3BXK A;  2BCB A;  2M8U A;  4YGA A;  5JOL A;  2ZN9 A;  1TIZ A;  2WND A;  3OB2 B;  1YUR A;  3KHE A;  2ZRT A;  4UPG A;  1BR4 B;  1W7J B;  2KDH A;  1IQ5 A;  1S36 A;  3JVT B;  1QVI Y;  4GFT A;  4ORA B;  1NYA A;  3QRX A;  3DD4 A;  3CLN A;  4GBA A;  1WRL A;  2JU0 A;  3D0Y A;  1A29 A;  1AUI B;  1WLZ A;  3BUN B;  4MSP A;  5CSJ A;  3NSI A;  2KOT A;  1RWY A;  1YX7 A;  3CR4 X;  5AER A;  4OKH A;  1V1F A;  1Y6W A;  2Y5I A;  2Y4Q A;  1G4Y R;  1YUU A;  1A4P A;  3BOW B;  4HRE E;  1JSA A;  4E68 A;  3GK2 A;  4A4B A;  4FQO A;  1K9K A;  3D10 A;  2PVB A;  2TN4 A;  1NCX A;  1B8L A;  3FIA A;  2JZI A;  1F70 A;  2MLF C;  1YRT B;  2KGB C;  3KF9 A;  2P6B B;  2JT3 A;  2LV7 A;  3VGO A;  5ER5 A;  1F4Q A;  2R2I A;  4MBE A;  1DJZ A;  1XK4 C;  5HKW A;  4PE7 A;  3CTN A;  4DUQ A;  1C7W A;  3O2P A;  1M45 A;  1XFW O;  5I8N A;  1YR5 A;  1SL7 A;  1EG4 A;  1SPY A;  1WDC C;  1K96 A;  1YVL A;  2DOQ A;  4D1E A;  1CB1 A;  1FI5 A;  1LKJ A;  2MA2 A;  5AFP A;  3HCM A;  2MHH A;  1QLK A;  3O4Y A;  4WQ2 A;  4ORB B;  4C0L A;  1J7O A;  3CZT X;  2PMY A;  4MN0 A;  2K2F A;  2LVV A;  1J1D A;  1K8U A;  1AP4 A;  2K0J A;  4AOM A;  1UUR A;  3A8R A;  4PAL A;  3TDI A;  5AAN A;  1KWO C;  2EGD A;  5CSN A;  2KI6 C;  2L0P A;  1XFV O;  4N1G A;  4ZCV A;  3D0Y B;  2GGM A;  3EVR A;  1UHH A;  3VRQ A;  2JC2 A;  5HKZ A;  1LA3 A;  1QIW A;  2O60 A;  1KFX L;  2VRG A;  1M39 A;  1TN4 A;  1WRZ A;  2O5G A;  3LK0 A;  1CLL A;  1JFK A;  5BPJ A;  1F4O A;  1XVJ A;  4GNK B;  2MLE C;  5ER4 X;  2EC6 B;  4PHK A;  1K94 A;  1EL4 A;  5TNC A;  1YUS A;  3DVM A;  1L2O B;  1G33 A;  1S1E A;  1UHN A;  4JWQ A;  4MZJ A;  1J7Q A;  2LAP A;  1MWN A;  1KQV A;  2ISD A;  1OSA A;  2BL0 B;  1MUX A;  1DT7 B;  2L4H A;  1KFX S;  2BE4 A;  4A4C A;  5J3X A;  2CXJ A;  1SR6 C;  4YRU A;  1CTR A;  5HKY A;  4GAO A;  1OMD A;  3NSO A;  1DVI A;  1B7T Y;  2KFH A;  2Q91 A;  4P2Y B;  1CDM A;  4MZL A;  2LVJ A;  2LLT A;  1LIN A;  1SCM B;  1TNP A;  4MLW A;  3DVK A;  2B1U A;  3BUX B;  4M2Q A;  2FCD A;  2L5X B;  4PHJ A;  2KYC A;  1IWQ A;  3I5I B;  1KSO A;  3BQ3 A;  1NUB A;  1MR8 A;  4WQ3 A;  3NXA A;  5DKR A;  3SJS A;  4OR9 B;  2F2O A;  4NDB A;  2NCP A;  2HQ8 A;  1A75 A;  3TUY B;  2CT9 A;  1AK8 A;  2MRD A;  1B8R A;  4JPZ B;  1GQM A;  1CM1 A;  1H4B A;  5CSI A;  4NQG A;  2K61 A;  2NCO A;  1SL8 A;  2KI4 C;  3NSK A;  2H61 C;  3FS7 A;  2MAZ A;  1ZUZ A;  4M2P A;  2IS9 A;  5FYX A;  4JQ0 D;  2LUC A;  1J1E A;  3EK7 A;  1S5G Y;  2JXL A;  3PFV A;  4GPL B;  4U8D A;  1N2D A;  1SY9 A;  4I5K A;  2COL B;  2ZNE A;  2FOT A;  2M1U A;  1AVS A;  3PN7 C;  1GJY A;  3IF7 A;  3OB1 B;  4NDD A;  3WNX B;  2F3Z A;  1G8I A;  1JF2 A;  2CBL A;  2LUX A;  1MXL C;  5I2L A;  1J7R A;  1NWD A;  5D69 A;  1AJ4 A;  2KQ6 A;  2M97 A; 
#chains in the Genus database with same CATH topology
 5F6T A;  5CSF A;  2K60 A;  4BY4 A;  1JC2 A;  2E30 A;  3AAK A;  2JTZ A;  1Y1X A;  4BY5 A;  1TCF A;  4DS7 A;  1BU3 A;  1OOJ A;  1YUT A;  4YI9 A;  1CMF A;  1K9U A;  2ZND A;  4NDC A;  3L47 A;  1DJH A;  2P71 A;  3D74 A;  4MRX A;  1E8A A;  2Q4U A;  3FWC A;  2BEC A;  1JFJ A;  4I5N B;  4CFQ A;  2H2K A;  1WDC B;  2BKH B;  3CZ0 A;  5KU1 A;  1QWV A;  1A75 B;  2JTT A;  2K7C A;  2JOJ A;  1EG3 A;  4I5J A;  1SKT A;  5HLO A;  3SS5 A;  1OE9 B;  3E3R A;  1FBV A;  3PSR A;  2ZKM X;  1NCZ A;  2BBN A;  4ICB A;  2LE9 B;  2AMI A;  5FI6 A;  1KWO B;  1PK0 D;  2LLU A;  1U5I A;  4WRI A;  1XO5 A;  2E6W A;  1RFJ A;  4PCW A;  1CDP A;  2QEV A;  2M49 B;  2L5Y A;  4C0K A;  5I94 A;  2PSR A;  1QIV A;  1T14 A;  2WCE A;  1OQP A;  1RK9 A;  1SW8 A;  3D73 A;  2KYF A;  5I2Q A;  3AAJ A;  3CYZ A;  1V1G A;  2HPS A;  1CFD A;  2OTG C;  1PUL A;  2LP3 A;  2RGI A;  2BCX A;  1NSH A;  3SG3 A;  1DJW A;  2KFF A;  2H61 A;  1QX5 B;  1F55 A;  1PRW A;  3BUW B;  2LHL A;  3SIA A;  1AJ5 A;  4QJ5 B;  2I94 A;  3K1E A;  1KK7 Z;  1TRF A;  3BUO B;  1FW4 A;  1GGZ A;  1JF0 A;  2AAO A;  2LMU A;  4DCK A;  2K7B A;  1IH0 A;  3B7A A;  2LHI A;  1N0Y A;  1Z4H A;  3EK4 A;  3VRR A;  2KAX A;  3FE6 A;  1XFR A;  1B4C A;  1K2H A;  3OX5 A;  4OCI A;  2K2A A;  3PM8 A;  5DKQ A;  3F45 A;  3I5H C;  1IJ6 A;  1XA5 A;  1ODB A;  2K7D A;  1LVC D;  2MBX A;  3ZWH A;  3LCP C;  1OOG A;  3S0B A;  3WXA A;  5IBW A;  2HET A;  4GGN A;  1IQ3 A;  2JT8 A;  1HQV A;  3IQO A;  5D3O A;  2JNF A;  3BFH A;  1CNP A;  2L2C A;  4OZD A;  2AUC A;  1S3P A;  3R1O A;  3R1P A;  1MXE A;  4CFR A;  1XFU O;  1U5I B;  1XFZ O;  4PDZ A;  2OS8 C;  1BLQ A;  2F2P A;  2PAS A;  4C0J A;  3DVE A;  3Q8I A;  1K9P A;  1QTX A;  1OOI X;  1QJT A;  3D75 A;  1FPW A;  1TUJ A;  2F33 A;  4IJ7 A;  2BBM A;  3OP0 A;  3FWB A;  1OMR A;  1KFU L;  1FF1 A;  2L4I A;  1QAS A;  2HQW A;  3ICB A;  3L4A A;  1XK4 A;  3C1V A;  4MVF A;  1LA0 A;  3PAL A;  2EC6 C;  2JPO A;  1SBJ A;  1ZAC A;  3ZNI A;  1JUO A;  1QAT A;  4DIR A;  4PE0 A;  1MQ1 A;  1QX7 A;  1WY9 A;  2D8N A;  2KFG A;  3PAT A;  1UHJ A;  5DIC A;  3KPX A;  5G08 A;  1IKU A;  2ZN8 A;  5B8I B;  2FCE A;  2MJW B;  3SG6 A;  1UP5 A;  2L2E A;  1DMO A;  2JUL A;  3TDU A;  1KK8 C;  3I5F C;  1IJ5 A;  4YGB B;  5GQQ C;  1DJI A;  1A03 A;  1GM0 A;  2WCL A;  4FTG A;  1NX0 A;  2G2B A;  2KHN A;  3GOF A;  2KQY A;  3S0E A;  1KFU S;  1M63 B;  1NIW A;  2PRU A;  4KYN A;  3M0W A;  3EVV A;  1SYM A;  4INW A;  1SCV A;  1EH2 A;  2GV5 A;  2OPO A;  5AEQ A;  1CLM A;  2LLS A;  1TNQ A;  1DJG A;  1TCO B;  3O6B A;  2WC6 A;  1SMG A;  1TTX A;  3CWG A;  1JBA A;  3DY9 A;  2KGR A;  2L51 A;  1QLS A;  2BAP A;  1MF8 B;  4QJ3 B;  1MHO A;  3DF0 A;  1BF5 A;  1F71 A;  1S6I A;  5I2O A;  1P28 A;  4DRW A;  3WHU B;  1OW4 A;  1BJF A;  1CDN A;  3TS5 C;  2JRF A;  4TNC A;  2ZFD A;  3I5G C;  3VRO A;  1WLM A;  2GGZ A;  1KQM C;  2F8P A;  2WC5 A;  1XFY O;  5EL2 A;  1BG1 A;  2FJU B;  3EK8 A;  1GGW A;  1H8B A;  2HF5 A;  2EHB A;  3LL8 B;  3PLF B;  3K21 A;  4GGF C;  5KSZ A;  2PAL A;  1ALV A;  3S0G A;  2LM5 A;  2LAN A;  1DGU A;  2L50 A;  3RLZ A;  1S6C A;  2WCB A;  1F54 A;  1HT9 A;  1KSM A;  3BFB A;  1AHR A;  3PM2 A;  3JTD C;  1QS7 A;  3BUM B;  1DJX A;  2LMV A;  2WOS A;  1TOP A;  3DVJ A;  4CLN A;  1K95 A;  4Q04 A;  2BKI B;  4CID A;  2M7N A;  1YVH A;  2LVI A;  1NP8 A;  1UHI A;  3BYA A;  2QEH A;  3HX4 A;  2I7A A;  4USL A;  1KK7 Y;  1QXP A;  1BR1 B;  1QV1 A;  2JT0 A;  2M9G A;  2OTG B;  3SIB A;  4AQJ A;  2BE6 A;  2QDI A;  3KEV A;  3AKA A;  2K8M B;  3NSL A;  4R1E A;  2JNX A;  1LXF C;  3JVT C;  1NX1 A;  2QAC A;  2QPT A;  3SS3 A;  4N1F A;  1S5G Z;  4XJK A;  3KO0 A;  1PVB A;  2KAY A;  1UUS A;  1CDL A;  1S26 D;  4OV2 A;  3QME A;  2WOR A;  4M2O A;  1NPQ A;  1OZS A;  1QX2 A;  1QVI Z;  1ZMZ A;  2M29 A;  3DF0 B;  1Z2C B;  2LVK A;  3NHT A;  3CR2 A;  4I5L B;  4GUK A;  1PVA A;  4YI8 A;  4YGC B;  4ZCU A;  1DJY A;  1WRK A;  1CLB A;  4N5X A;  5DKN A;  1BOC A;  3LK1 A;  2NXQ A;  5FI2 A;  1YX8 A;  2KNE A;  3I5H B;  1OZO A;  1BMO A;  2K7O A;  1W7I B;  2A4J A;  3D76 A;  2NLN A;  3IQQ A;  5HL1 A;  4YGD B;  1J55 A;  1ZOT B;  2KAV A;  3S0D A;  1KCY A;  3SG5 A;  1R6P A;  4INX A;  1DTL A;  3EVU A;  3NHI A;  3GK4 X;  1OMV A;  4PT1 A;  1VRK A;  4PHN A;  1SR6 B;  3WHT B;  3B86 A;  2OS8 B;  1NCY A;  4OVN F;  1Y1U A;  1DF0 A;  1TNX A;  1X02 A;  4F0Z B;  4MZK A;  1ORG A;  2KI6 D;  1CFC A;  1CFF A;  2SCP A;  1C3Z A;  2LNK A;  2SAS A;  1R2U A;  3VRP A;  1SNL A;  2KLD A;  3B87 A;  3CS1 A;  4HSZ A;  3TZ1 A;  4GGF A;  1TNW A;  2KBI A;  1C7V A;  3V2L A;  3SG2 A;  3SG4 A;  2I2R E;  1B1G A;  3DZT A;  1UWO A;  2ZRS A;  4PHM A;  3CGA A;  3CDN A;  1M46 A;  2JQ6 A;  3OGN A;  2JPT A;  2CNP A;  2WC8 A;  1K90 D;  4XJK B;  1QV0 A;  4PE4 A;  5JJG A;  2F3Y A;  1XFX O;  2V53 A;  3EG5 B;  3H4S E;  5D7F A;  5K89 A;  5HYD A;  1KK8 B;  1LS8 A;  3I5F B;  2YGU A;  2M3W A;  1IGV A;  1EXR A;  1NX2 A;  2BCA A;  1D1O A;  4IL1 A;  1EJ3 A;  3NGV A;  2KI4 B;  1Y1A A;  3LLE A;  1ALW A;  3AKB A;  1UHK A;  3A4U B;  2LP2 A;  1DEL A;  4L9M A;  5AXI A;  3O78 A;  1DQE A;  1PSB A;  3S0F A;  2CCM A;  1F8H A;  1L2O C;  3B6X A;  4AQI A;  4HRG A;  4FQT A;  1BT6 A;  5PAL A;  3MSE B;  4P5O E;  4YGE B;  1ZFS A;  2KSP A;  3R1V A;  4PE1 A;  4HRH A;  3SS4 A;  3VRN A;  3OHM B;  4QJ4 B;  2M0R A;  1SL9 A;  2JXC A;  2NZ0 A;  3PN7 B;  1CMG A;  3TDZ A;  2Y1M A;  3L4L A;  2BL0 C;  1B47 A;  1CFP A;  4YBH B;  3BOW A;  1RTP 1;  1XYD A;  1N65 A;  1DF0 B;  4MEW A;  2M1K B;  3TS5 B;  1CM4 A;  2WCJ A;  3EKJ A;  4CPV A;  3I5G B;  4ORC B;  1B9A A;  1KQM B;  1S6J A;  2LMT A;  1CKK A;  1SRA A;  2CTN A;  1SK6 D;  2LCP A;  3EKH A;  1C3Y A;  2L98 A;  2G9B A;  1SCM C;  1B8C A;  2JWW A;  1Y0V H;  1J7P A;  1FI6 A;  3SG7 A;  1IG5 A;  1TWO A;  1A2X A;  1YRU B;  4MRY A;  1L7Z A;  1B7T Z;  1K93 D;  2I18 A;  3FE9 A;  3OX6 A;  5KTY A;  2Y1N A;  1DGV A;  1REC A;  2WCF A;  1RJV A;  1M31 A;  3I5I C;  4XYN A;  3RM1 A;  1NX3 A;  3GK1 A;  3JTD B;  3CR5 X;  4ETO A;  1BOD A;  1JWD A;  1PAL A;  2LC5 A;  2M7L A;  3FE8 A;  1IRJ A;  1C07 A;  2KBM A;  3DYE A;  1RRO A;  3TUY C;  1YTZ C;  1Q80 A;  1PSR A;  5CPV A;  3BXK A;  2BCB A;  2M8U A;  4YGA A;  5JOL A;  2ZN9 A;  1TIZ A;  2WND A;  3OB2 B;  1YUR A;  3KHE A;  2ZRT A;  4F7F A;  4UPG A;  1BR4 B;  1W7J B;  2KDH A;  1IQ5 A;  1S36 A;  3JVT B;  1QVI Y;  4GFT A;  4ORA B;  1NYA A;  3QRX A;  3DD4 A;  3CLN A;  4GBA A;  1WRL A;  2JU0 A;  3D0Y A;  1A29 A;  1AUI B;  1WLZ A;  3BUN B;  4MSP A;  5CSJ A;  3NSI A;  2KOT A;  1RWY A;  1YX7 A;  3CR4 X;  5AER A;  4OKH A;  1V1F A;  1Y6W A;  2Y5I A;  2Y4Q A;  1G4Y R;  1YUU A;  1A4P A;  3BOW B;  4HRE E;  1JSA A;  4E68 A;  3BFA A;  1DEK A;  3GK2 A;  4A4B A;  4FQO A;  1K9K A;  3D10 A;  3UO9 A;  2PVB A;  2TN4 A;  1NCX A;  1B8L A;  3FIA A;  2JZI A;  1OOF A;  1F70 A;  2MLF C;  1YRT B;  2KGB C;  3KF9 A;  2P6B B;  2JT3 A;  2LV7 A;  2QEB A;  5ER5 A;  3VGO A;  1F4Q A;  2R2I A;  4MBE A;  1DJZ A;  1XK4 C;  5HKW A;  4PE7 A;  3CTN A;  4DUQ A;  1C7W A;  3O2P A;  2WCM A;  1M45 A;  1XFW O;  2QEO A;  5I8N A;  1YR5 A;  1SL7 A;  1EG4 A;  1SPY A;  1WDC C;  1K96 A;  1YVL A;  2DOQ A;  4D1E A;  1CB1 A;  5HLV A;  1FI5 A;  3N7H A;  1LKJ A;  2MA2 A;  5AFP A;  3HCM A;  2MHH A;  1QLK A;  3O4Y A;  4WQ2 A;  4ORB B;  3B88 A;  4C0L A;  1J7O A;  3CZT X;  2PMY A;  4MN0 A;  1SSE B;  2K2F A;  2LVV A;  1J1D A;  4JKT A;  1K8U A;  1AP4 A;  2K0J A;  4AOM A;  1UUR A;  3A8R A;  4PAL A;  3TDI A;  2PYQ A;  5AAN A;  1KWO C;  2EGD A;  5CSN A;  2KI6 C;  2L0P A;  1XFV O;  3IVT A;  4N1G A;  4ZCV A;  3D0Y B;  3D77 A;  2GGM A;  3EVR A;  1UHH A;  3VRQ A;  2JC2 A;  5HKZ A;  1LA3 A;  1QIW A;  2O60 A;  1KFX L;  2VRG A;  1M39 A;  1TN4 A;  2PQL A;  1WRZ A;  2O5G A;  3LK0 A;  1CLL A;  1JFK A;  2FJY A;  5BPJ A;  1F4O A;  1XVJ A;  4GNK B;  3OBV A;  2MLE C;  5ER4 X;  2EC6 B;  4PHK A;  1K94 A;  1EL4 A;  3VB1 A;  5TNC A;  2ERB A;  1YUS A;  2WCH A;  1L2O B;  3DVM A;  1G33 A;  1S1E A;  3O4X A;  1UHN A;  4JWQ A;  2H8V A;  2P70 A;  4MZJ A;  1J7Q A;  2LAP A;  1MWN A;  1KQV A;  2ISD A;  2KPH A;  1OSA A;  2BL0 B;  1MUX A;  1DT7 B;  2L4H A;  1KFX S;  2BE4 A;  4A4C A;  5J3X A;  3BJH A;  2CXJ A;  1SR6 C;  3CZ2 A;  3UNW A;  4JD9 A;  4YRU A;  1CTR A;  5HKY A;  4GAO A;  1OMD A;  3NSO A;  1DVI A;  1B7T Y;  2KFH A;  2Q91 A;  1DC1 A;  4P2Y B;  1CDM A;  4MZL A;  2LVJ A;  2LLT A;  3DXL A;  3PJI A;  1LIN A;  1SCM B;  1TNP A;  4MLW A;  3DVK A;  3RZS A;  2B1U A;  3BUX B;  4M2Q A;  2FCD A;  2L5X B;  4PHJ A;  2KYC A;  1IWQ A;  1IIO A;  3I5I B;  1KSO A;  3BQ3 A;  1NUB A;  1MR8 A;  4WQ3 A;  3NXA A;  5DKR A;  3SJS A;  4OR9 B;  2F2O A;  4NDB A;  2NCP A;  2HQ8 A;  1A75 A;  3TUY B;  2CT9 A;  1AK8 A;  2MRD A;  1B8R A;  2WCK A;  4JPZ B;  1GQM A;  1CM1 A;  1H4B A;  3CZ1 A;  5CSI A;  4NQG A;  2K61 A;  1TUZ A;  1SL8 A;  2NCO A;  2KI4 C;  3NSK A;  2H61 C;  3FS7 A;  3CAB A;  2MAZ A;  1ZUZ A;  4M2P A;  2GTE A;  2IS9 A;  4JQ0 D;  5FYX A;  2LUC A;  1J1E A;  3EK7 A;  3D78 A;  1S5G Y;  2JXL A;  1OOH A;  3PFV A;  4GPL B;  4U8D A;  1N2D A;  1SY9 A;  4I5K A;  2COL B;  2ZNE A;  2FOT A;  2KLE A;  2M1U A;  1AVS A;  3PN7 C;  2BNX A;  1W9Z A;  1GJY A;  5FI7 A;  3R72 A;  3IF7 A;  3OB1 B;  4NDD A;  3WNX B;  2F3Z A;  1G8I A;  1JF2 A;  2CBL A;  2LUX A;  1MXL C;  5I2L A;  1J7R A;  1NWD A;  5D69 A;  1AJ4 A;  2KQ6 A;  3S0A A;  2M97 A; 
#chains in the Genus database with same CATH homology
 5F6T A;  5CSF A;  4BY4 A;  1JC2 A;  2E30 A;  3AAK A;  2JTZ A;  1Y1X A;  4BY5 A;  1TCF A;  4DS7 A;  1BU3 A;  1OOJ A;  1YUT A;  4YI9 A;  1CMF A;  1K9U A;  2ZND A;  4NDC A;  1DJH A;  4MRX A;  1E8A A;  2Q4U A;  3FWC A;  2BEC A;  1JFJ A;  4I5N B;  4CFQ A;  2H2K A;  1WDC B;  2BKH B;  5KU1 A;  1A75 B;  2JTT A;  2K7C A;  2JOJ A;  1EG3 A;  4I5J A;  1SKT A;  5HLO A;  1OE9 B;  3E3R A;  1FBV A;  3PSR A;  2ZKM X;  1NCZ A;  2BBN A;  4ICB A;  2LE9 B;  2AMI A;  1KWO B;  1PK0 D;  2LLU A;  1U5I A;  4WRI A;  1XO5 A;  2E6W A;  1RFJ A;  4PCW A;  1CDP A;  2M49 B;  4C0K A;  2PSR A;  1QIV A;  2WCE A;  1OQP A;  1RK9 A;  1SW8 A;  2KYF A;  5I2Q A;  3AAJ A;  1V1G A;  2HPS A;  1CFD A;  2OTG C;  1PUL A;  2LP3 A;  2RGI A;  2BCX A;  1NSH A;  3SG3 A;  1DJW A;  2KFF A;  2H61 A;  1QX5 B;  1F55 A;  1PRW A;  3BUW B;  2LHL A;  3SIA A;  1AJ5 A;  4QJ5 B;  2I94 A;  1KK7 Z;  1TRF A;  3BUO B;  1FW4 A;  1GGZ A;  1JF0 A;  2AAO A;  2LMU A;  4DCK A;  2K7B A;  1IH0 A;  2LHI A;  1N0Y A;  3EK4 A;  3VRR A;  2KAX A;  1B4C A;  1K2H A;  3OX5 A;  4OCI A;  2K2A A;  3PM8 A;  5DKQ A;  3F45 A;  3I5H C;  1IJ6 A;  1XA5 A;  1ODB A;  2K7D A;  1LVC D;  2MBX A;  3ZWH A;  3LCP C;  3WXA A;  5IBW A;  1IQ3 A;  2HET A;  4GGN A;  2JT8 A;  1HQV A;  3IQO A;  2JNF A;  1CNP A;  2AUC A;  1S3P A;  1MXE A;  4CFR A;  1XFU O;  1U5I B;  1XFZ O;  4PDZ A;  2OS8 C;  1BLQ A;  2F2P A;  2PAS A;  4C0J A;  3DVE A;  1K9P A;  1QTX A;  1QJT A;  1FPW A;  2F33 A;  2BBM A;  3OP0 A;  3FWB A;  1OMR A;  1KFU L;  1FF1 A;  2L4I A;  1QAS A;  2HQW A;  3ICB A;  1XK4 A;  3C1V A;  4MVF A;  1LA0 A;  3PAL A;  2EC6 C;  1SBJ A;  1ZAC A;  3ZNI A;  1JUO A;  1QAT A;  4DIR A;  4PE0 A;  1MQ1 A;  1QX7 A;  1WY9 A;  2D8N A;  2KFG A;  3PAT A;  1UHJ A;  5HLV A;  3KPX A;  5G08 A;  1IKU A;  2ZN8 A;  5B8I B;  2FCE A;  2MJW B;  3SG6 A;  1UP5 A;  2L2E A;  1DMO A;  2JUL A;  3TDU A;  1KK8 C;  3I5F C;  1IJ5 A;  4YGB B;  5GQQ C;  1DJI A;  1A03 A;  4FTG A;  1NX0 A;  2G2B A;  2KHN A;  3GOF A;  2KQY A;  1KFU S;  1M63 B;  1NIW A;  2PRU A;  3M0W A;  3EVV A;  1SYM A;  1SCV A;  1EH2 A;  2GV5 A;  2OPO A;  5AEQ A;  1CLM A;  2LLS A;  1TNQ A;  1DJG A;  1TCO B;  3O6B A;  1SMG A;  1TTX A;  3CWG A;  1JBA A;  2KGR A;  2L51 A;  1QLS A;  1MF8 B;  4QJ3 B;  1MHO A;  3DF0 A;  1BF5 A;  1F71 A;  1S6I A;  5I2O A;  4DRW A;  3WHU B;  1CDN A;  1BJF A;  3TS5 C;  2JRF A;  4TNC A;  2ZFD A;  3I5G C;  3VRO A;  1WLM A;  2GGZ A;  1KQM C;  2F8P A;  1XFY O;  1BG1 A;  2FJU B;  3EK8 A;  1GGW A;  1H8B A;  2HF5 A;  2EHB A;  3LL8 B;  3PLF B;  3K21 A;  4GGF C;  5KSZ A;  2PAL A;  1ALV A;  2LM5 A;  2LAN A;  1DGU A;  2L50 A;  3RLZ A;  1S6C A;  2WCB A;  1F54 A;  1HT9 A;  1KSM A;  1AHR A;  3JTD C;  1QS7 A;  3BUM B;  1DJX A;  2LMV A;  2WOS A;  1TOP A;  3DVJ A;  4CLN A;  1K95 A;  4Q04 A;  2BKI B;  4CID A;  2M7N A;  1YVH A;  2LVI A;  1NP8 A;  1UHI A;  3BYA A;  3HX4 A;  2I7A A;  4USL A;  1KK7 Y;  1QXP A;  1BR1 B;  1QV1 A;  2JT0 A;  2M9G A;  2OTG B;  3SIB A;  4AQJ A;  2BE6 A;  3KEV A;  3AKA A;  2K8M B;  3NSL A;  4R1E A;  2JNX A;  1LXF C;  3JVT C;  1NX1 A;  2QAC A;  2QPT A;  4N1F A;  1S5G Z;  4XJK A;  3KO0 A;  1PVB A;  2KAY A;  1UUS A;  1CDL A;  1S26 D;  4OV2 A;  2WOR A;  4M2O A;  1NPQ A;  1OZS A;  1QX2 A;  1QVI Z;  1ZMZ A;  2M29 A;  3DF0 B;  4I5L B;  2LVK A;  4YGC B;  3CR2 A;  4GUK A;  1PVA A;  4YI8 A;  4ZCU A;  1DJY A;  1WRK A;  1CLB A;  4N5X A;  5DKN A;  1BOC A;  3LK1 A;  2NXQ A;  1YX8 A;  2KNE A;  3I5H B;  1OZO A;  1BMO A;  2K7O A;  1W7I B;  2A4J A;  2NLN A;  3IQQ A;  4YGD B;  1J55 A;  1ZOT B;  2KAV A;  1KCY A;  3SG5 A;  1R6P A;  1DTL A;  3EVU A;  3GK4 X;  1OMV A;  1VRK A;  4PHN A;  1SR6 B;  3WHT B;  2OS8 B;  1NCY A;  4OVN F;  1Y1U A;  1DF0 A;  1TNX A;  1X02 A;  4F0Z B;  4MZK A;  2KI6 D;  1CFC A;  1CFF A;  2SCP A;  2LNK A;  2SAS A;  1R2U A;  3VRP A;  1SNL A;  3CS1 A;  4HSZ A;  3TZ1 A;  4GGF A;  1TNW A;  2KBI A;  1C7V A;  3SG2 A;  3SG4 A;  2I2R E;  1B1G A;  1UWO A;  2ZRS A;  4PHM A;  3CGA A;  1M46 A;  2JQ6 A;  2JPT A;  2CNP A;  2WC8 A;  1K90 D;  4XJK B;  1QV0 A;  4PE4 A;  5JJG A;  2F3Y A;  1XFX O;  2V53 A;  3H4S E;  5D7F A;  5K89 A;  5HYD A;  1KK8 B;  3I5F B;  2M3W A;  1IGV A;  1EXR A;  1NX2 A;  2BCA A;  1D1O A;  4IL1 A;  1EJ3 A;  2KI4 B;  1Y1A A;  3LLE A;  1ALW A;  3AKB A;  1UHK A;  3A4U B;  2LP2 A;  4L9M A;  5AXI A;  3O78 A;  1PSB A;  1F8H A;  2CCM A;  1L2O C;  4AQI A;  4HRG A;  1BT6 A;  5PAL A;  3MSE B;  4P5O E;  4YGE B;  1ZFS A;  2KSP A;  4PE1 A;  4HRH A;  3VRN A;  3OHM B;  4QJ4 B;  2M0R A;  1SL9 A;  2JXC A;  2NZ0 A;  3PN7 B;  1CMG A;  3TDZ A;  2Y1M A;  2BL0 C;  1B47 A;  1CFP A;  4YBH B;  3BOW A;  1RTP 1;  1XYD A;  1N65 A;  1DF0 B;  4MEW A;  2M1K B;  3TS5 B;  1CM4 A;  3EKJ A;  4CPV A;  3I5G B;  4ORC B;  1B9A A;  1KQM B;  1S6J A;  2LMT A;  1CKK A;  1SRA A;  2CTN A;  1SK6 D;  2LCP A;  3EKH A;  2L98 A;  2G9B A;  1SCM C;  1B8C A;  2JWW A;  1Y0V H;  1J7P A;  1FI6 A;  3SG7 A;  1IG5 A;  1YRU B;  1A2X A;  4MRY A;  1L7Z A;  1B7T Z;  1K93 D;  2I18 A;  3OX6 A;  5KTY A;  2Y1N A;  1DGV A;  1REC A;  2WCF A;  1RJV A;  1M31 A;  3I5I C;  4XYN A;  3RM1 A;  1NX3 A;  3GK1 A;  3JTD B;  3CR5 X;  4ETO A;  1BOD A;  1JWD A;  1PAL A;  2LC5 A;  2M7L A;  1IRJ A;  1C07 A;  2KBM A;  1RRO A;  3TUY C;  1YTZ C;  1Q80 A;  1PSR A;  5CPV A;  3BXK A;  2BCB A;  2M8U A;  4YGA A;  5JOL A;  2ZN9 A;  1TIZ A;  2WND A;  3OB2 B;  1YUR A;  3KHE A;  2ZRT A;  4UPG A;  1BR4 B;  1W7J B;  2KDH A;  1IQ5 A;  1S36 A;  3JVT B;  1QVI Y;  4GFT A;  4ORA B;  1NYA A;  3QRX A;  3DD4 A;  3CLN A;  4GBA A;  1WRL A;  2JU0 A;  3D0Y A;  1A29 A;  1AUI B;  1WLZ A;  3BUN B;  4MSP A;  5CSJ A;  3NSI A;  2KOT A;  1RWY A;  1YX7 A;  3CR4 X;  5AER A;  4OKH A;  1V1F A;  1Y6W A;  2Y5I A;  2Y4Q A;  1G4Y R;  1YUU A;  1A4P A;  3BOW B;  4HRE E;  1JSA A;  4E68 A;  3GK2 A;  4A4B A;  4FQO A;  1K9K A;  3D10 A;  2PVB A;  2TN4 A;  1NCX A;  1B8L A;  3FIA A;  2JZI A;  1F70 A;  2MLF C;  1YRT B;  2KGB C;  3KF9 A;  2P6B B;  2JT3 A;  2LV7 A;  3VGO A;  5ER5 A;  1F4Q A;  2R2I A;  4MBE A;  1DJZ A;  1XK4 C;  5HKW A;  4PE7 A;  3CTN A;  4DUQ A;  1C7W A;  3O2P A;  1M45 A;  1XFW O;  5I8N A;  1YR5 A;  1SL7 A;  1EG4 A;  1SPY A;  1WDC C;  1K96 A;  1YVL A;  2DOQ A;  4D1E A;  1CB1 A;  1FI5 A;  1LKJ A;  2MA2 A;  5AFP A;  3HCM A;  2MHH A;  1QLK A;  3O4Y A;  4WQ2 A;  4ORB B;  4C0L A;  1J7O A;  3CZT X;  2PMY A;  4MN0 A;  2K2F A;  2LVV A;  1J1D A;  1K8U A;  1AP4 A;  2K0J A;  4AOM A;  1UUR A;  3A8R A;  4PAL A;  3TDI A;  5AAN A;  1KWO C;  2EGD A;  5CSN A;  2KI6 C;  2L0P A;  1XFV O;  4N1G A;  4ZCV A;  3D0Y B;  2GGM A;  3EVR A;  1UHH A;  3VRQ A;  2JC2 A;  5HKZ A;  1LA3 A;  1QIW A;  2O60 A;  1KFX L;  2VRG A;  1M39 A;  1TN4 A;  1WRZ A;  2O5G A;  3LK0 A;  1CLL A;  1JFK A;  5BPJ A;  1F4O A;  1XVJ A;  4GNK B;  2MLE C;  5ER4 X;  2EC6 B;  4PHK A;  1K94 A;  1EL4 A;  5TNC A;  1YUS A;  3DVM A;  1L2O B;  1G33 A;  1S1E A;  1UHN A;  4JWQ A;  4MZJ A;  1J7Q A;  2LAP A;  1MWN A;  1KQV A;  2ISD A;  1OSA A;  2BL0 B;  1MUX A;  1DT7 B;  2L4H A;  1KFX S;  2BE4 A;  4A4C A;  5J3X A;  2CXJ A;  1SR6 C;  4YRU A;  1CTR A;  5HKY A;  4GAO A;  1OMD A;  3NSO A;  1DVI A;  1B7T Y;  2KFH A;  2Q91 A;  4P2Y B;  1CDM A;  4MZL A;  2LVJ A;  2LLT A;  1LIN A;  1SCM B;  1TNP A;  4MLW A;  3DVK A;  2B1U A;  3BUX B;  4M2Q A;  2FCD A;  2L5X B;  4PHJ A;  2KYC A;  1IWQ A;  3I5I B;  1KSO A;  3BQ3 A;  1NUB A;  1MR8 A;  4WQ3 A;  3NXA A;  5DKR A;  3SJS A;  4OR9 B;  2F2O A;  4NDB A;  2NCP A;  2HQ8 A;  1A75 A;  3TUY B;  2CT9 A;  1AK8 A;  2MRD A;  1B8R A;  4JPZ B;  1GQM A;  1CM1 A;  1H4B A;  5CSI A;  4NQG A;  2K61 A;  2NCO A;  1SL8 A;  2KI4 C;  3NSK A;  2H61 C;  3FS7 A;  2MAZ A;  1ZUZ A;  4M2P A;  2IS9 A;  5FYX A;  4JQ0 D;  2LUC A;  1J1E A;  3EK7 A;  1S5G Y;  2JXL A;  3PFV A;  4GPL B;  4U8D A;  1N2D A;  1SY9 A;  4I5K A;  2COL B;  2ZNE A;  2FOT A;  2M1U A;  1AVS A;  3PN7 C;  1GJY A;  3IF7 A;  3OB1 B;  4NDD A;  3WNX B;  2F3Z A;  1G8I A;  1JF2 A;  2CBL A;  2LUX A;  1MXL C;  5I2L A;  1J7R A;  1NWD A;  5D69 A;  1AJ4 A;  2KQ6 A;  2M97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...