4GFTA

Malaria invasion machinery protein-nanobody complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
63
Chain Sequence
b'NVEELIKMFAHFDNNSTGYLTKSQMKNILTTWALTDQEAIDALNAFSSEDNIDYKLFCEDILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin A tail domain interacting protein
publication title The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein binding, immune system
total genus 18
structure length 63
sequence length 65
ec nomenclature
pdb deposition date 2012-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gftA00
2H61A 3DVJA 2F8PA 3TUYB 2K8MB 2I2RE 2M1UA 1EH2A 2LHLA 2JOJA 1N65A 1JUOA 3CR2A 1UWOA 4MZKA 1BODA 1JFKA 1J7PA 1K93D 1RFJA 2L51A 1YRUB 2ZKMX 4R1EA 1M63B 2WCFA 4U8DA 4AQIA 2O60A 4CFQA 1IJ5A 1Q80A 2L0PA 4XJKA 1KCYA 2H61C 4YGEB 4MRYA 2BBMA 2ZRTA 3SG3A 3EK4A 1QATA 1S36A 1KFXL 1QV1A 1S1EA 2PVBA 1TIZA 1DVIA 3IF7A 4MN0A 2LCPA 1MR8A 1UHJA 3EVVA 1KFUS 1UHNA 4QJ5B 3I5GC 2K61A 2OTGB 1IQ3A 1WRZA 2KGRA 1SK6D 1UHIA 1F54A 1NX0A 1SCVA 2GGMA 2KBIA 4GUKA 2JC2A 2KI6C 3AAKA 1NYAA 2F3YA 3NSLA 1W7JB 4JPZB 2OS8B 5DKNA 3D0YA 1J1DA 1F55A 3OHMB 2MRDA 3KEVA 4PDZA 1KQMC 4A4CA 1Y6WA 1BU3A 1F4QA 2QACA 1DJZA 1DF0B 2LANA 3JTDB 1MQ1A 1C7WA 3CS1A 3WHTB 1B1GA 2KAXA 2L5XB 3ICBA 1KSOA 3A8RA 3EKJA 3I5IB 5IBWA 4ZCUA 4MVFA 5K89A 1QX7A 1YUSA 3BXKA 4A4BA 1K96A 3I5FC 4HSZA 2KYFA 4NQGA 1UURA 2LMUA 1W7IB 4HRGA 2HQWA 4PHKA 5I8NA 1NX1A 1ODBA 3F45A 2WCBA 1A03A 2MHHA 1RWYA 2G2BA 1BR4B 1EL4A 1QV0A 4N5XA 1SW8A 1DJHA 1VRKA 2PSRA 2JXCA 4PCWA 5HKWA 4YRUA 1SR6B 5PALA 1WY9A 2FOTA 1SMGA 1CDMA 1WRLA 1A75A 2MAZA 1U5IA 3O78A 4PHJA 1WLZA 1AUIB 1DJXA 1SY9A 2KI6D 1IWQA 2ZN9A 1JFJA 1KFUL 1S6IA 4M2QA 4M2OA 2LVVA 2DOQA 1QS7A 4C0JA 1DJYA 4DCKA 3C1VA 1QASA 1KFXS 1XFVO 1IQ5A 2LVIA 4MZLA 1KK7Y 2M1KB 4OV2A 2BBNA 1MF8B 2LLUA 1OMRA 1WRKA 1QIWA 1H8BA 3DVKA 1A29A 2LHIA 5CSFA 2M7LA 2LAPA 1CLLA 4CLNA 1KQVA 1B8LA 1KK8C 2LP2A 5B8IB 4M2PA 5HKZA 5I2OA 1GGZA 1PSBA 1PVBA 1K8UA 1QXPA 1SL8A 2LVKA 2M29A 3OB1B 3VRQA 1LVCD 2LVJA 4P2YB 4WRIA 2LV7A 1CFCA 1FF1A 1CDNA 2G9BA 1OE9B 2K7BA 2KYCA 3TDUA 3AKBA 1M31A 1UP5A 3VRNA 5HLVA 3PSRA 1D1OA 1PVAA 2CT9A 2OPOA 3I5HC 1GQMA 1XFWO 2Y1MA 3VGOA 2BL0C 1WDCC 1ALVA 1NIWA 2AMIA 2KQYA 4MZJA 1B8RA 1AK8A 2VRGA 1DGUA 4L9MA 3E3RA 4DRWA 2KFGA 1RECA 1KWOB 1UUSA 3LK0A 1NSHA 4DUQA 5JOLA 2K2FA 3BUWB 4HREE 1R6PA 1PSRA 3PFVA 1JBAA 1PULA 1S6JA 3O6BA 3PN7C 4PE7A 3NSKA 2HETA 1ZMZA 2KNEA 1TNQA 5I2LA 1RTP1 2F33A 3M0WA 3O2PA 1A4PA 2HF5A 2LUXA 3OX6A 1YRTB 1NWDA 3FWBA 3TS5B 1CM1A 4GPLB 4I5KA 3LL8B 1H4BA 1MXLC 1L7ZA 1R2UA 1YX8A 1SBJA 3VROA 2JWWA 3OB2B 1GGWA 5KSZA 1OQPA 3JVTC 1XVJA 1K95A 1SL9A 4HRHA 1XA5A 1S5GY 1SYMA 3HX4A 3WHUB 1U5IB 1JF2A 1QX2A 3RLZA 2LLSA 1AP4A 1QJTA 1TCOB 2CXJA 2K0JA 2Y4QA 1LA3A 5AERA 1S26D 1N0YA 2MBXA 1QIVA 4CFRA 2L2EA 4PHMA 1BMOA 2KBMA 1KK7Z 1M46A 1PK0D 1ZACA 4YGAA 1S6CA 3SG4A 3EK7A 1NUBA 2BKHB 4P5OE 2NCPA 2BECA 2MJWB 1DTLA 2ISDA 2LE9B 2BE6A 2LUCA 2Q91A 1FI5A 5DKRA 1KSMA 1XYDA 3EKHA 4QJ3B 4BY5A 2KI4B 3K21A 4YGBB 1N2DA 5HLOA 3GOFA 4IL1A 3PALA 2HQ8A 2COLB 4C0KA 1Y1AA 2EC6B 2F2OA 1BOCA 1TN4A 3DVEA 1IH0A 2A4JA 1FW4A 2FCDA 3CZTX 4BY4A 1FPWA 1YTZC 2LMTA 1L2OC 4USLA 2I18A 4ORAB 1IG5A 1JC2A 3DF0A 1DJWA 1JF0A 1M39A 4PE1A 1G4YR 1LKJA 4YI8A 4F0ZB 1CDLA 3NXAA 4JWQA 5D7FA 1TNWA 2K7DA 3QRXA 1JSAA 2K7OA 3VRPA 2AAOA 1CNPA 4DS7A 2JT8A 2Y5IA 1RROA 4GNKB 5TNCA 1B4CA 1PALA 4PE4A 5J3XA 2M97A 4WQ3A 1K90D 1CM4A 2BE4A 3EK8A 4AQJA 1JWDA 4XJKB 1J55A 5FYXA 4FTGA 3PM8A 1A2XA 5ER5A 2I94A 1B47A 1F8HA 1S5GZ 3I5GB 2Y1NA 3ZWHA 1AJ4A 2WCEA 1TCFA 1LXFC 2RGIA 3CLNA 4I5LB 5F6TA 3KF9A 4NDBA 1Y0VH 2BCBA 4QJ4B 3TUYC 1ZFSA 2WC8A 1TNPA 1GJYA 2F3ZA 1F70A 1EG3A 1XK4C 3FIAA 1XFYO 2LMVA 3BUXB 1KQMB 4YGCB 2L50A 2TN4A 2B1UA 1OMDA 4GGFC 1G33A 4PHNA 4OCIA 1SRAA 2JULA 4UPGA 1J7RA 3SG7A 2ZNEA 5AANA 1NX3A 1ALWA 3D0YB 5D69A 5AEQA 1RK9A 2L98A 1OOJA 1YR5A 3KPXA 2JRFA 4Q04A 3AAJA 4I5NB 1BF5A 1CFPA 1IJ6A 1X02A 2JT3A 1PRWA 3BUNB 1AVSA 1NX2A 4ORCB 2PASA 4YI9A 2CTNA 5AFPA 3BQ3A 5BPJA 2IS9A 1B7TZ 1AJ5A 3CGAA 3HCMA 2OTGC 4GFTA 2KFHA 1IGVA 2HPSA 1YVLA 4GAOA 1SPYA 1F71A 1K9PA 2KDHA 2V53A 4PE0A 4NDCA 3KO0A 2JNFA 1CKKA 2JPTA 1BT6A 4DIRA 1TTXA 4C0LA 2OS8C 2KFFA 1WLMA 2LP3A 3LLEA 2LNKA 2WORA 5CPVA 1NCXA 3CR5X 3JTDC 1OZSA 2FCEA 1EXRA 3IQOA 1V1FA 3H4SE 1LINA 1NP8A 2KOTA 2NXQA 1A75B 2AUCA 2JXLA 1AHRA 2ZFDA 1DJIA 3I5IC 4FQOA 1HQVA 1IRJA 4AOMA 2FJUB 1IKUA 2ZN8A 1QLSA 1Y1XA 2KAYA 1KK8B 1DT7B 1OMVA 1BLQA 3TDIA 1TOPA 1UHHA 3FWCA 1XFXO 2M9GA 4ETOA 1QX5B 2JT0A 1OSAA 2I7AA 2JU0A 3EVUA 3TZ1A 2GV5A 1M45A 1SCMB 2P6BB 4NDDA 2K7CA 1CMGA 1BG1A 5KU1A 2JNXA 3O4YA 1DJGA 3BUOB 1SR6C 3SG2A 1TRFA 3I5HB 3PLFB 4MRXA 1QVIZ 2BL0B 1WDCB 2M3WA 3MSEB 5HYDA 1CB1A 5GQQC 1K9KA 2BCAA 2ZNDA 3OX5A 2GGZA 2M8UA 3LCPC 1YUUA 4ORBB 4CIDA 3PATA 1XFUO 5CSNA 2R2IA 4YBHB 2CCMA 3EVRA 1UHKA 2JTTA 2MA2A 2L4IA 4MBEA 1CTRA 3PN7B 4MEWA 5ER4X 1B7TY 1SL7A 2M7NA 1J7QA 1YUTA 1CLMA 2MLFC 2PRUA 1BR1B 1MXEA 3LK1A 3BYAA 1QLKA 2WNDA 1EG4A 1ZUZA 3CWGA 3FS7A 1BJFA 5CSIA 1CFDA 2KSPA 3DD4A 4TNCA 3GK1A 3D10A 5G08A 1CLBA 3BOWA 1J1EA 3JVTB 3KHEA 4GBAA 3WXAA 2MLEC 3SIAA 3SG5A 1Y1UA 2D8NA 3RM1A 1F4OA 1EJ3A 2KHNA 4GGNA 4OVNF 3VRRA 1CMFA 2ZRSA 3SJSA 1NCYA 3WNXB 1TNXA 1NCZA 5KTYA 1XK4A 4D1EA 1KWOC 2WOSA 3OP0A 4GGFA 2Q4UA 2K2AA 4ICBA 1E8AA 1K94A 2SCPA 2NLNA 1C7VA 2O5GA 2PALA 1YURA 2SASA 3CTNA 3NSOA 2NCOA 4MSPA 4WQ2A 2EGDA 4OR9B 2CNPA 3TS5C 2E30A 1QVIY 2BCXA 1K9UA 1SKTA 2PMYA 1B9AA 1QTXA 5DKQA 2E6WA 1B8CA 1ZOTB 2M49B 3CR4X 1L2OB 1C07A 2KQ6A 3I5FB 2NZ0A 1K2HA 3SG6A 1DMOA 3DVMA 5CSJA 3SIBA 4E68A 1CDPA 1YX7A 3A4UB 5HKYA 4N1FA 2H2KA 2LLTA 2JTZA 4OKHA 1OZOA 3GK2A 2LC5A 3IQQA 4XYNA 1RJVA 1FBVA 1S3PA 2JQ6A 2CBLA 1DF0A 1SCMC 5JJGA 4PALA 1CFFA 1J7OA 1FI6A 2L4HA 1NPQA 3DF0B 1YVHA 3ZNIA 5I2QA 2JZIA 1MWNA 3AKAA 3BUMB 4JQ0D 2QPTA 3NSIA 1MHOA 1XFZO 1MUXA 4MLWA 5AXIA 4YGDB 2KI4C 1DGVA 1G8IA 2M0RA 3TDZA 2LM5A 4CPVA 3GK4X 4ZCVA 3BOWB 1HT9A 1SNLA 1LA0A 2EHBA 2KAVA 4N1GA 1XO5A 2BKIB 2EC6C 2KGBC 4I5JA 1V1GA 2F2PA
chains in the Genus database with same CATH superfamily
2H61A 3DVJA 2F8PA 3TUYB 2K8MB 2I2RE 2M1UA 1EH2A 2LHLA 2JOJA 1N65A 1JUOA 3CR2A 1UWOA 4MZKA 1BODA 1JFKA 1J7PA 1K93D 1RFJA 2L51A 1YRUB 2ZKMX 3CABA 1M63B 2WCFA 4R1EA 4U8DA 4AQIA 1GM0A 2O60A 3D74A 1IJ5A 1DEKA 1Q80A 4CFQA 2L0PA 4XJKA 4OZDA 2H61C 1KCYA 4YGEB 4MRYA 2BBMA 2ZRTA 3S0BA 3SG3A 3RZSA 2BAPA 3EK4A 1QATA 1S36A 3D77A 1KFXL 1QV1A 5HL1A 1S1EA 2PVBA 1TIZA 1DVIA 3IF7A 4MN0A 2LCPA 1MR8A 1UHJA 3EVVA 1KFUS 1UHNA 4QJ5B 2QEVA 3I5GC 2K61A 2OTGB 1IQ3A 1WRZA 2KGRA 1SK6D 1UHIA 1F54A 1NX0A 1SCVA 2GGMA 2KBIA 4GUKA 2JC2A 2KI6C 3SS4A 3AAKA 1NYAA 2F3YA 3NSLA 1SSEB 5FI6A 1W7JB 4JPZB 2OS8B 5DKNA 3D0YA 3NGVA 1J1DA 1F55A 3OHMB 2MRDA 2QEHA 3BFBA 1KQMC 3KEVA 1Y6WA 1BU3A 1F4QA 4PDZA 4A4CA 2QACA 1DJZA 1DF0B 2LANA 3JTDB 1MQ1A 1C7WA 2WC6A 3CS1A 3WHTB 2KAXA 1B1GA 2L5XB 3ICBA 1KSOA 3A8RA 3EKJA 3I5IB 5IBWA 4ZCUA 4MVFA 5K89A 4JKTA 1QX7A 1YUSA 2BNXA 3BXKA 4A4BA 1K96A 3I5FC 4HSZA 2KYFA 2JPOA 1UURA 2LMUA 1W7IB 4HRGA 4NQGA 2HQWA 4PHKA 5I8NA 1C3YA 1NX1A 3N7HA 1ODBA 3F45A 2WCBA 1A03A 2MHHA 1RWYA 2G2BA 1BR4B 1EL4A 1QV0A 4N5XA 1SW8A 1DJHA 1VRKA 2PSRA 2JXCA 4PCWA 5HKWA 4YRUA 1SR6B 5PALA 1WY9A 2FOTA 1SMGA 4INXA 5D3OA 1CDMA 1WRLA 1A75A 3DYEA 2MAZA 1U5IA 1OOFA 3O78A 4PHJA 1WLZA 1AUIB 1DJXA 1SY9A 2KI6D 1IWQA 2ZN9A 4FQTA 1JFJA 1KFUL 1S6IA 3R1OA 1OOGA 4M2QA 3DY9A 4M2OA 2LVVA 2PYQA 2DOQA 1QS7A 4C0JA 1DJYA 4DCKA 3C1VA 1QASA 1KFXS 1XFVO 1IQ5A 2LVIA 4MZLA 1KK7Y 2M1KB 2KPHA 4OV2A 2BBNA 1MF8B 2LLUA 1OMRA 1WRKA 1QIWA 1H8BA 3DVKA 1A29A 2LHIA 5CSFA 2M7LA 2LAPA 2KLDA 1CLLA 4CLNA 1KQVA 1B8LA 1KK8C 2LP2A 5B8IB 4M2PA 5HKZA 5I2OA 1GGZA 1PSBA 1PVBA 1K8UA 1QXPA 1SL8A 2LVKA 2M29A 3OB1B 3VRQA 2P71A 1LVCD 2LVJA 4P2YB 4WRIA 2LV7A 1CFCA 1FF1A 1CDNA 2G9BA 3L4LA 1OE9B 2K7BA 2KYCA 3FE9A 5DICA 3AKBA 1M31A 1UP5A 3SS3A 3CDNA 3PSRA 5HLVA 3TDUA 3VRNA 1PVAA 2CT9A 1D1OA 2OPOA 3I5HC 1GQMA 1XFWO 2Y1MA 3VGOA 2BL0C 1WDCC 1ALVA 1NIWA 2AMIA 2KQYA 4MZJA 1B8RA 2WCJA 2VRGA 1DGUA 4L9MA 1AK8A 3E3RA 4DRWA 2KFGA 1RECA 1LS8A 1KWOB 1UUSA 3LK0A 1NSHA 4DUQA 5JOLA 2K2FA 2WC5A 3BUWB 4HREE 1R6PA 1PSRA 3PFVA 1JBAA 1PULA 1S6JA 3O6BA 3PN7C 4PE7A 3NSKA 2HETA 3VB1A 1ZMZA 2KNEA 1TNQA 5I2LA 1RTP1 3S0EA 2F33A 3M0WA 3O2PA 1A4PA 2HF5A 2LUXA 3OX6A 1YRTB 1OW4A 1IIOA 1NWDA 3FWBA 3TS5B 1CM1A 4GPLB 4I5KA 3LL8B 1H4BA 1MXLC 1L7ZA 1R2UA 1YX8A 1SBJA 3S0AA 3VROA 3IVTA 2JWWA 3OB2B 1GGWA 5KSZA 1OQPA 3JVTC 1XVJA 1K95A 1SL9A 4HRHA 1XA5A 1S5GY 1SYMA 3HX4A 3WHUB 3R1PA 1U5IB 1JF2A 1QX2A 3RLZA 1ORGA 2LLSA 1AP4A 1QJTA 1TCOB 2CXJA 2QDIA 2K0JA 2Y4QA 1LA3A 5AERA 1S26D 1N0YA 2MBXA 1QIVA 4CFRA 2L2EA 4PHMA 1BMOA 2KBMA 1KK7Z 1M46A 1Z2CB 1PK0D 3OBVA 1ZACA 4YGAA 3PM2A 1S6CA 3SG4A 3EK7A 1NUBA 2BKHB 4P5OE 2NCPA 2BECA 3Q8IA 2MJWB 1DTLA 2ISDA 2LE9B 2BE6A 2LUCA 2Q91A 4IJ7A 1FI5A 3DZTA 5DKRA 1KSMA 1XYDA 3EKHA 4QJ3B 4BY5A 2KI4B 3K21A 4YGBB 1N2DA 4JD9A 5HLOA 3GOFA 4IL1A 2KLEA 3PALA 2HQ8A 2COLB 4C0KA 1Y1AA 2EC6B 2F2OA 1BOCA 3NHIA 1TN4A 3D78A 3DVEA 1IH0A 2A4JA 1FW4A 2FCDA 1P28A 3CZTX 2L2CA 1YTZC 4BY4A 1FPWA 2LMTA 2L5YA 1L2OC 4USLA 2I18A 4ORAB 1IG5A 1JC2A 3DF0A 1DJWA 1JF0A 1M39A 4PE1A 1G4YR 3O4XA 1LKJA 4YI8A 4F0ZB 1CDLA 3NXAA 4JWQA 5D7FA 1TNWA 2YGUA 2K7DA 3QRXA 1JSAA 2K7OA 3VRPA 2AAOA 1CNPA 4DS7A 2JT8A 2Y5IA 2ERBA 1RROA 4GNKB 5TNCA 1B4CA 1PALA 4PE4A 5J3XA 2M97A 4WQ3A 1K90D 3L4AA 1CM4A 2BE4A 3EK8A 4AQJA 1JWDA 4XJKB 1J55A 5FYXA 4FTGA 3PM8A 1A2XA 5ER5A 2I94A 1B47A 1F8HA 1T14A 1S5GZ 3I5GB 2P70A 2Y1NA 3ZWHA 1AJ4A 2WCEA 3CYZA 4KYNA 1TCFA 1LXFC 2RGIA 3B7AA 3CLNA 4I5LB 5F6TA 1OOIX 3KF9A 4NDBA 5EL2A 1Y0VH 2BCBA 4QJ4B 3TUYC 3FE6A 1DELA 1ZFSA 2WC8A 1TNPA 1GJYA 2F3ZA 1F70A 2WCLA 1EG3A 1XK4C 3FIAA 1XFYO 2LMVA 3BUXB 1KQMB 4YGCB 2L50A 2TN4A 2B1UA 3D76A 1TWOA 1OMDA 3R1VA 4GGFC 2QEBA 1G33A 4PHNA 4OCIA 1SRAA 2JULA 4UPGA 1J7RA 3SG7A 2ZNEA 5AANA 1NX3A 1ALWA 3D0YB 5D69A 5AEQA 1RK9A 2L98A 1OOJA 1YR5A 3KPXA 2JRFA 1Z4HA 4Q04A 3AAJA 4I5NB 1BF5A 2WCKA 1IJ6A 1X02A 1CFPA 2JT3A 1PRWA 3BUNB 1AVSA 1NX2A 4ORCB 2PASA 1TUZA 4YI9A 2CTNA 5AFPA 3BQ3A 3DXLA 1XFRA 3EG5B 2IS9A 3PJIA 5BPJA 1B7TZ 1AJ5A 3CGAA 3HCMA 2OTGC 4GFTA 2KFHA 1IGVA 2HPSA 1YVLA 4GAOA 1SPYA 1F71A 1K9PA 2KDHA 2V53A 4PE0A 4NDCA 2PQLA 2JNFA 3KO0A 1CKKA 2JPTA 1BT6A 4DIRA 1TTXA 4C0LA 2OS8C 2KFFA 1WLMA 2LP3A 3LLEA 2LNKA 2WORA 5CPVA 1NCXA 5FI7A 3V2LA 3CR5X 3JTDC 1OZSA 2FCEA 1EXRA 3IQOA 1V1FA 3H4SE 1LINA 1NP8A 2KOTA 2NXQA 1A75B 2AUCA 2JXLA 1AHRA 4F7FA 2ZFDA 1DJIA 3I5IC 4FQOA 1HQVA 1IRJA 4AOMA 2FJUB 4PT1A 1IKUA 2ZN8A 1QLSA 1Y1XA 2KAYA 3B87A 3S0FA 3D75A 1KK8B 1DT7B 1OMVA 1BLQA 3TDIA 1TOPA 1UHHA 3FWCA 1XFXO 2M9GA 4ETOA 1QX5B 2JT0A 2FJYA 1OSAA 3B88A 2I7AA 2JU0A 3EVUA 3TZ1A 2GV5A 1M45A 1SCMB 2P6BB 4NDDA 2K7CA 1CMGA 1BG1A 3CZ2A 5KU1A 1OOHA 2JNXA 3O4YA 1DJGA 3BUOB 1SR6C 3SG2A 1TRFA 3I5HB 3PLFB 4MRXA 1QVIZ 2BL0B 1WDCB 2M3WA 3MSEB 5HYDA 1CB1A 3FE8A 1C3ZA 5GQQC 1K9KA 2BCAA 2ZNDA 3OX5A 2GGZA 2M8UA 3LCPC 1YUUA 4ORBB 4CIDA 3PATA 1XFUO 5CSNA 2H8VA 2R2IA 4YBHB 2CCMA 3EVRA 1UHKA 2JTTA 2MA2A 3BFAA 3QMEA 2L4IA 4MBEA 1CTRA 3PN7B 4MEWA 5ER4X 1B7TY 1SL7A 2M7NA 1J7QA 3CZ0A 1YUTA 1CLMA 2MLFC 2PRUA 1BR1B 1MXEA 3LK1A 3BYAA 1QLKA 2WNDA 1EG4A 1ZUZA 3CWGA 3FS7A 1BJFA 5CSIA 1CFDA 2KSPA 3DD4A 4TNCA 3GK1A 3D10A 5G08A 3L47A 3BOWA 1J1EA 3JVTB 3KHEA 4GBAA 3WXAA 1CLBA 2MLEC 3SIAA 3SG5A 1Y1UA 2QEOA 2D8NA 3RM1A 1F4OA 1TUJA 1EJ3A 2KHNA 4GGNA 4OVNF 3VRRA 1CMFA 2ZRSA 3SJSA 1NCYA 3CZ1A 3WNXB 1TNXA 1NCZA 5KTYA 1XK4A 4D1EA 1KWOC 2WOSA 1QWVA 3OP0A 4GGFA 2Q4UA 3UO9A 2K2AA 4ICBA 1E8AA 1K94A 2SCPA 3D73A 4INWA 2NLNA 2WCHA 1C7VA 2O5GA 2PALA 1YURA 2SASA 3CTNA 3NSOA 2NCOA 3K1EA 4MSPA 4WQ2A 2EGDA 4OR9B 2CNPA 3TS5C 2E30A 1QVIY 2BCXA 3R72A 1K9UA 1SKTA 3OGNA 3S0DA 2PMYA 1B9AA 1W9ZA 1QTXA 5DKQA 2E6WA 1B8CA 3BFHA 1ZOTB 2M49B 3CR4X 1L2OB 1C07A 2KQ6A 3I5FB 2NZ0A 1DQEA 1K2HA 3SG6A 1DC1A 3DVMA 1DMOA 5CSJA 3SIBA 4E68A 1CDPA 1YX7A 3A4UB 5HKYA 3S0GA 4N1FA 2H2KA 2LLTA 2JTZA 4OKHA 2K60A 5I94A 3BJHA 1OZOA 3GK2A 2LC5A 3IQQA 4XYNA 1RJVA 1FBVA 1S3PA 2JQ6A 1DF0A 1SCMC 2CBLA 5JJGA 4PALA 1CFFA 1J7OA 1FI6A 2L4HA 1NPQA 3DF0B 1YVHA 3UNWA 3ZNIA 5I2QA 2JZIA 1MWNA 3AKAA 3BUMB 3NHTA 3B6XA 4JQ0D 2QPTA 2WCMA 3NSIA 1MHOA 1XFZO 1MUXA 4MLWA 3B86A 5AXIA 4YGDB 2KI4C 1DGVA 1G8IA 2M0RA 3TDZA 2LM5A 4CPVA 3GK4X 4ZCVA 5FI2A 3BOWB 3SS5A 1HT9A 1SNLA 1LA0A 2EHBA 2KAVA 4N1GA 1XO5A 2BKIB 2EC6C 2KGBC 4I5JA 2GTEA 1V1GA 2F2PA
chains in the Genus database with same CATH topology
2H61A 3DVJA 2F8PA 3TUYB 2K8MB 2I2RE 2M1UA 1EH2A 2LHLA 2JOJA 1N65A 1JUOA 3CR2A 1UWOA 4MZKA 1BODA 1JFKA 1J7PA 1K93D 1RFJA 2L51A 1YRUB 2ZKMX 4R1EA 1M63B 2WCFA 4U8DA 4AQIA 2O60A 4CFQA 1IJ5A 1Q80A 2L0PA 4XJKA 1KCYA 2H61C 4YGEB 4MRYA 2BBMA 2ZRTA 3SG3A 3EK4A 1QATA 1S36A 1KFXL 1QV1A 1S1EA 2PVBA 1TIZA 1DVIA 3IF7A 4MN0A 2LCPA 1MR8A 1UHJA 3EVVA 1KFUS 1UHNA 4QJ5B 3I5GC 2K61A 2OTGB 1IQ3A 1WRZA 2KGRA 1SK6D 1UHIA 1F54A 1NX0A 1SCVA 2GGMA 2KBIA 4GUKA 2JC2A 2KI6C 3AAKA 1NYAA 2F3YA 3NSLA 1W7JB 4JPZB 2OS8B 5DKNA 3D0YA 1J1DA 1F55A 3OHMB 2MRDA 3KEVA 4PDZA 1KQMC 4A4CA 1Y6WA 1BU3A 1F4QA 2QACA 1DJZA 1DF0B 2LANA 3JTDB 1MQ1A 1C7WA 3CS1A 3WHTB 1B1GA 2KAXA 2L5XB 3ICBA 1KSOA 3A8RA 3EKJA 3I5IB 5IBWA 4ZCUA 4MVFA 5K89A 1QX7A 1YUSA 3BXKA 4A4BA 1K96A 3I5FC 4HSZA 2KYFA 4NQGA 1UURA 2LMUA 1W7IB 4HRGA 2HQWA 4PHKA 5I8NA 1NX1A 1ODBA 3F45A 2WCBA 1A03A 2MHHA 1RWYA 2G2BA 1BR4B 1EL4A 1QV0A 4N5XA 1SW8A 1DJHA 1VRKA 2PSRA 2JXCA 4PCWA 5HKWA 4YRUA 1SR6B 5PALA 1WY9A 2FOTA 1SMGA 1CDMA 1WRLA 1A75A 2MAZA 1U5IA 3O78A 4PHJA 1WLZA 1AUIB 1DJXA 1SY9A 2KI6D 1IWQA 2ZN9A 1JFJA 1KFUL 1S6IA 4M2QA 4M2OA 2LVVA 2DOQA 1QS7A 4C0JA 1DJYA 4DCKA 3C1VA 1QASA 1KFXS 1XFVO 1IQ5A 2LVIA 4MZLA 1KK7Y 2M1KB 4OV2A 2BBNA 1MF8B 2LLUA 1OMRA 1WRKA 1QIWA 1H8BA 3DVKA 1A29A 2LHIA 5CSFA 2M7LA 2LAPA 1CLLA 4CLNA 1KQVA 1B8LA 1KK8C 2LP2A 5B8IB 4M2PA 5HKZA 5I2OA 1GGZA 1PSBA 1PVBA 1K8UA 1QXPA 1SL8A 2LVKA 2M29A 3OB1B 3VRQA 1LVCD 2LVJA 4P2YB 4WRIA 2LV7A 1CFCA 1FF1A 1CDNA 2G9BA 1OE9B 2K7BA 2KYCA 3TDUA 3AKBA 1M31A 1UP5A 3VRNA 5HLVA 3PSRA 1D1OA 1PVAA 2CT9A 2OPOA 3I5HC 1GQMA 1XFWO 2Y1MA 3VGOA 2BL0C 1WDCC 1ALVA 1NIWA 2AMIA 2KQYA 4MZJA 1B8RA 1AK8A 2VRGA 1DGUA 4L9MA 3E3RA 4DRWA 2KFGA 1RECA 1KWOB 1UUSA 3LK0A 1NSHA 4DUQA 5JOLA 2K2FA 3BUWB 4HREE 1R6PA 1PSRA 3PFVA 1JBAA 1PULA 1S6JA 3O6BA 3PN7C 4PE7A 3NSKA 2HETA 1ZMZA 2KNEA 1TNQA 5I2LA 1RTP1 2F33A 3M0WA 3O2PA 1A4PA 2HF5A 2LUXA 3OX6A 1YRTB 1NWDA 3FWBA 3TS5B 1CM1A 4GPLB 4I5KA 3LL8B 1H4BA 1MXLC 1L7ZA 1R2UA 1YX8A 1SBJA 3VROA 2JWWA 3OB2B 1GGWA 5KSZA 1OQPA 3JVTC 1XVJA 1K95A 1SL9A 4HRHA 1XA5A 1S5GY 1SYMA 3HX4A 3WHUB 1U5IB 1JF2A 1QX2A 3RLZA 2LLSA 1AP4A 1QJTA 1TCOB 2CXJA 2K0JA 2Y4QA 1LA3A 5AERA 1S26D 1N0YA 2MBXA 1QIVA 4CFRA 2L2EA 4PHMA 1BMOA 2KBMA 1KK7Z 1M46A 1PK0D 1ZACA 4YGAA 1S6CA 3SG4A 3EK7A 1NUBA 2BKHB 4P5OE 2NCPA 2BECA 2MJWB 1DTLA 2ISDA 2LE9B 2BE6A 2LUCA 2Q91A 1FI5A 5DKRA 1KSMA 1XYDA 3EKHA 4QJ3B 4BY5A 2KI4B 3K21A 4YGBB 1N2DA 5HLOA 3GOFA 4IL1A 3PALA 2HQ8A 2COLB 4C0KA 1Y1AA 2EC6B 2F2OA 1BOCA 1TN4A 3DVEA 1IH0A 2A4JA 1FW4A 2FCDA 3CZTX 4BY4A 1FPWA 1YTZC 2LMTA 1L2OC 4USLA 2I18A 4ORAB 1IG5A 1JC2A 3DF0A 1DJWA 1JF0A 1M39A 4PE1A 1G4YR 1LKJA 4YI8A 4F0ZB 1CDLA 3NXAA 4JWQA 5D7FA 1TNWA 2K7DA 3QRXA 1JSAA 2K7OA 3VRPA 2AAOA 1CNPA 4DS7A 2JT8A 2Y5IA 1RROA 4GNKB 5TNCA 1B4CA 1PALA 4PE4A 5J3XA 2M97A 4WQ3A 1K90D 1CM4A 2BE4A 3EK8A 4AQJA 1JWDA 4XJKB 1J55A 5FYXA 4FTGA 3PM8A 1A2XA 5ER5A 2I94A 1B47A 1F8HA 1S5GZ 3I5GB 2Y1NA 3ZWHA 1AJ4A 2WCEA 1TCFA 1LXFC 2RGIA 3CLNA 4I5LB 5F6TA 3KF9A 4NDBA 1Y0VH 2BCBA 4QJ4B 3TUYC 1ZFSA 2WC8A 1TNPA 1GJYA 2F3ZA 1F70A 1EG3A 1XK4C 3FIAA 1XFYO 2LMVA 3BUXB 1KQMB 4YGCB 2L50A 2TN4A 2B1UA 1OMDA 4GGFC 1G33A 4PHNA 4OCIA 1SRAA 2JULA 4UPGA 1J7RA 3SG7A 2ZNEA 5AANA 1NX3A 1ALWA 3D0YB 5D69A 5AEQA 1RK9A 2L98A 1OOJA 1YR5A 3KPXA 2JRFA 4Q04A 3AAJA 4I5NB 1BF5A 1CFPA 1IJ6A 1X02A 2JT3A 1PRWA 3BUNB 1AVSA 1NX2A 4ORCB 2PASA 4YI9A 2CTNA 5AFPA 3BQ3A 5BPJA 2IS9A 1B7TZ 1AJ5A 3CGAA 3HCMA 2OTGC 4GFTA 2KFHA 1IGVA 2HPSA 1YVLA 4GAOA 1SPYA 1F71A 1K9PA 2KDHA 2V53A 4PE0A 4NDCA 3KO0A 2JNFA 1CKKA 2JPTA 1BT6A 4DIRA 1TTXA 4C0LA 2OS8C 2KFFA 1WLMA 2LP3A 3LLEA 2LNKA 2WORA 5CPVA 1NCXA 3CR5X 3JTDC 1OZSA 2FCEA 1EXRA 3IQOA 1V1FA 3H4SE 1LINA 1NP8A 2KOTA 2NXQA 1A75B 2AUCA 2JXLA 1AHRA 2ZFDA 1DJIA 3I5IC 4FQOA 1HQVA 1IRJA 4AOMA 2FJUB 1IKUA 2ZN8A 1QLSA 1Y1XA 2KAYA 1KK8B 1DT7B 1OMVA 1BLQA 3TDIA 1TOPA 1UHHA 3FWCA 1XFXO 2M9GA 4ETOA 1QX5B 2JT0A 1OSAA 2I7AA 2JU0A 3EVUA 3TZ1A 2GV5A 1M45A 1SCMB 2P6BB 4NDDA 2K7CA 1CMGA 1BG1A 5KU1A 2JNXA 3O4YA 1DJGA 3BUOB 1SR6C 3SG2A 1TRFA 3I5HB 3PLFB 4MRXA 1QVIZ 2BL0B 1WDCB 2M3WA 3MSEB 5HYDA 1CB1A 5GQQC 1K9KA 2BCAA 2ZNDA 3OX5A 2GGZA 2M8UA 3LCPC 1YUUA 4ORBB 4CIDA 3PATA 1XFUO 5CSNA 2R2IA 4YBHB 2CCMA 3EVRA 1UHKA 2JTTA 2MA2A 2L4IA 4MBEA 1CTRA 3PN7B 4MEWA 5ER4X 1B7TY 1SL7A 2M7NA 1J7QA 1YUTA 1CLMA 2MLFC 2PRUA 1BR1B 1MXEA 3LK1A 3BYAA 1QLKA 2WNDA 1EG4A 1ZUZA 3CWGA 3FS7A 1BJFA 5CSIA 1CFDA 2KSPA 3DD4A 4TNCA 3GK1A 3D10A 5G08A 1CLBA 3BOWA 1J1EA 3JVTB 3KHEA 4GBAA 3WXAA 2MLEC 3SIAA 3SG5A 1Y1UA 2D8NA 3RM1A 1F4OA 1EJ3A 2KHNA 4GGNA 4OVNF 3VRRA 1CMFA 2ZRSA 3SJSA 1NCYA 3WNXB 1TNXA 1NCZA 5KTYA 1XK4A 4D1EA 1KWOC 2WOSA 3OP0A 4GGFA 2Q4UA 2K2AA 4ICBA 1E8AA 1K94A 2SCPA 2NLNA 1C7VA 2O5GA 2PALA 1YURA 2SASA 3CTNA 3NSOA 2NCOA 4MSPA 4WQ2A 2EGDA 4OR9B 2CNPA 3TS5C 2E30A 1QVIY 2BCXA 1K9UA 1SKTA 2PMYA 1B9AA 1QTXA 5DKQA 2E6WA 1B8CA 1ZOTB 2M49B 3CR4X 1L2OB 1C07A 2KQ6A 3I5FB 2NZ0A 1K2HA 3SG6A 1DMOA 3DVMA 5CSJA 3SIBA 4E68A 1CDPA 1YX7A 3A4UB 5HKYA 4N1FA 2H2KA 2LLTA 2JTZA 4OKHA 1OZOA 3GK2A 2LC5A 3IQQA 4XYNA 1RJVA 1FBVA 1S3PA 2JQ6A 2CBLA 1DF0A 1SCMC 5JJGA 4PALA 1CFFA 1J7OA 1FI6A 2L4HA 1NPQA 3DF0B 1YVHA 3ZNIA 5I2QA 2JZIA 1MWNA 3AKAA 3BUMB 4JQ0D 2QPTA 3NSIA 1MHOA 1XFZO 1MUXA 4MLWA 5AXIA 4YGDB 2KI4C 1DGVA 1G8IA 2M0RA 3TDZA 2LM5A 4CPVA 3GK4X 4ZCVA 3BOWB 1HT9A 1SNLA 1LA0A 2EHBA 2KAVA 4N1GA 1XO5A 2BKIB 2EC6C 2KGBC 4I5JA 1V1GA 2F2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H61 A;  3DVJ A;  2F8P A;  3TUY B;  2K8M B;  2I2R E;  2M1U A;  1EH2 A;  2LHL A;  2JOJ A;  1N65 A;  1JUO A;  3CR2 A;  1UWO A;  4MZK A;  1BOD A;  1JFK A;  1J7P A;  1K93 D;  1RFJ A;  2L51 A;  1YRU B;  2ZKM X;  4R1E A;  1M63 B;  2WCF A;  4U8D A;  4AQI A;  2O60 A;  4CFQ A;  1IJ5 A;  1Q80 A;  2L0P A;  4XJK A;  1KCY A;  2H61 C;  4YGE B;  4MRY A;  2BBM A;  2ZRT A;  3SG3 A;  3EK4 A;  1QAT A;  1S36 A;  1KFX L;  1QV1 A;  1S1E A;  2PVB A;  1TIZ A;  1DVI A;  3IF7 A;  4MN0 A;  2LCP A;  1MR8 A;  1UHJ A;  3EVV A;  1KFU S;  1UHN A;  4QJ5 B;  3I5G C;  2K61 A;  2OTG B;  1IQ3 A;  1WRZ A;  2KGR A;  1SK6 D;  1UHI A;  1F54 A;  1NX0 A;  1SCV A;  2GGM A;  2KBI A;  4GUK A;  2JC2 A;  2KI6 C;  3AAK A;  1NYA A;  2F3Y A;  3NSL A;  1W7J B;  4JPZ B;  2OS8 B;  5DKN A;  3D0Y A;  1J1D A;  1F55 A;  3OHM B;  2MRD A;  3KEV A;  4PDZ A;  1KQM C;  4A4C A;  1Y6W A;  1BU3 A;  1F4Q A;  2QAC A;  1DJZ A;  1DF0 B;  2LAN A;  3JTD B;  1MQ1 A;  1C7W A;  3CS1 A;  3WHT B;  1B1G A;  2KAX A;  2L5X B;  3ICB A;  1KSO A;  3A8R A;  3EKJ A;  3I5I B;  5IBW A;  4ZCU A;  4MVF A;  5K89 A;  1QX7 A;  1YUS A;  3BXK A;  4A4B A;  1K96 A;  3I5F C;  4HSZ A;  2KYF A;  4NQG A;  1UUR A;  2LMU A;  1W7I B;  4HRG A;  2HQW A;  4PHK A;  5I8N A;  1NX1 A;  1ODB A;  3F45 A;  2WCB A;  1A03 A;  2MHH A;  1RWY A;  2G2B A;  1BR4 B;  1EL4 A;  1QV0 A;  4N5X A;  1SW8 A;  1DJH A;  1VRK A;  2PSR A;  2JXC A;  4PCW A;  5HKW A;  4YRU A;  1SR6 B;  5PAL A;  1WY9 A;  2FOT A;  1SMG A;  1CDM A;  1WRL A;  1A75 A;  2MAZ A;  1U5I A;  3O78 A;  4PHJ A;  1WLZ A;  1AUI B;  1DJX A;  1SY9 A;  2KI6 D;  1IWQ A;  2ZN9 A;  1JFJ A;  1KFU L;  1S6I A;  4M2Q A;  4M2O A;  2LVV A;  2DOQ A;  1QS7 A;  4C0J A;  1DJY A;  4DCK A;  3C1V A;  1QAS A;  1KFX S;  1XFV O;  1IQ5 A;  2LVI A;  4MZL A;  1KK7 Y;  2M1K B;  4OV2 A;  2BBN A;  1MF8 B;  2LLU A;  1OMR A;  1WRK A;  1QIW A;  1H8B A;  3DVK A;  1A29 A;  2LHI A;  5CSF A;  2M7L A;  2LAP A;  1CLL A;  4CLN A;  1KQV A;  1B8L A;  1KK8 C;  2LP2 A;  5B8I B;  4M2P A;  5HKZ A;  5I2O A;  1GGZ A;  1PSB A;  1PVB A;  1K8U A;  1QXP A;  1SL8 A;  2LVK A;  2M29 A;  3OB1 B;  3VRQ A;  1LVC D;  2LVJ A;  4P2Y B;  4WRI A;  2LV7 A;  1CFC A;  1FF1 A;  1CDN A;  2G9B A;  1OE9 B;  2K7B A;  2KYC A;  3TDU A;  3AKB A;  1M31 A;  1UP5 A;  3VRN A;  5HLV A;  3PSR A;  1D1O A;  1PVA A;  2CT9 A;  2OPO A;  3I5H C;  1GQM A;  1XFW O;  2Y1M A;  3VGO A;  2BL0 C;  1WDC C;  1ALV A;  1NIW A;  2AMI A;  2KQY A;  4MZJ A;  1B8R A;  1AK8 A;  2VRG A;  1DGU A;  4L9M A;  3E3R A;  4DRW A;  2KFG A;  1REC A;  1KWO B;  1UUS A;  3LK0 A;  1NSH A;  4DUQ A;  5JOL A;  2K2F A;  3BUW B;  4HRE E;  1R6P A;  1PSR A;  3PFV A;  1JBA A;  1PUL A;  1S6J A;  3O6B A;  3PN7 C;  4PE7 A;  3NSK A;  2HET A;  1ZMZ A;  2KNE A;  1TNQ A;  5I2L A;  1RTP 1;  2F33 A;  3M0W A;  3O2P A;  1A4P A;  2HF5 A;  2LUX A;  3OX6 A;  1YRT B;  1NWD A;  3FWB A;  3TS5 B;  1CM1 A;  4GPL B;  4I5K A;  3LL8 B;  1H4B A;  1MXL C;  1L7Z A;  1R2U A;  1YX8 A;  1SBJ A;  3VRO A;  2JWW A;  3OB2 B;  1GGW A;  5KSZ A;  1OQP A;  3JVT C;  1XVJ A;  1K95 A;  1SL9 A;  4HRH A;  1XA5 A;  1S5G Y;  1SYM A;  3HX4 A;  3WHU B;  1U5I B;  1JF2 A;  1QX2 A;  3RLZ A;  2LLS A;  1AP4 A;  1QJT A;  1TCO B;  2CXJ A;  2K0J A;  2Y4Q A;  1LA3 A;  5AER A;  1S26 D;  1N0Y A;  2MBX A;  1QIV A;  4CFR A;  2L2E A;  4PHM A;  1BMO A;  2KBM A;  1KK7 Z;  1M46 A;  1PK0 D;  1ZAC A;  4YGA A;  1S6C A;  3SG4 A;  3EK7 A;  1NUB A;  2BKH B;  4P5O E;  2NCP A;  2BEC A;  2MJW B;  1DTL A;  2ISD A;  2LE9 B;  2BE6 A;  2LUC A;  2Q91 A;  1FI5 A;  5DKR A;  1KSM A;  1XYD A;  3EKH A;  4QJ3 B;  4BY5 A;  2KI4 B;  3K21 A;  4YGB B;  1N2D A;  5HLO A;  3GOF A;  4IL1 A;  3PAL A;  2HQ8 A;  2COL B;  4C0K A;  1Y1A A;  2EC6 B;  2F2O A;  1BOC A;  1TN4 A;  3DVE A;  1IH0 A;  2A4J A;  1FW4 A;  2FCD A;  3CZT X;  4BY4 A;  1FPW A;  1YTZ C;  2LMT A;  1L2O C;  4USL A;  2I18 A;  4ORA B;  1IG5 A;  1JC2 A;  3DF0 A;  1DJW A;  1JF0 A;  1M39 A;  4PE1 A;  1G4Y R;  1LKJ A;  4YI8 A;  4F0Z B;  1CDL A;  3NXA A;  4JWQ A;  5D7F A;  1TNW A;  2K7D A;  3QRX A;  1JSA A;  2K7O A;  3VRP A;  2AAO A;  1CNP A;  4DS7 A;  2JT8 A;  2Y5I A;  1RRO A;  4GNK B;  5TNC A;  1B4C A;  1PAL A;  4PE4 A;  5J3X A;  2M97 A;  4WQ3 A;  1K90 D;  1CM4 A;  2BE4 A;  3EK8 A;  4AQJ A;  1JWD A;  4XJK B;  1J55 A;  5FYX A;  4FTG A;  3PM8 A;  1A2X A;  5ER5 A;  2I94 A;  1B47 A;  1F8H A;  1S5G Z;  3I5G B;  2Y1N A;  3ZWH A;  1AJ4 A;  2WCE A;  1TCF A;  1LXF C;  2RGI A;  3CLN A;  4I5L B;  5F6T A;  3KF9 A;  4NDB A;  1Y0V H;  2BCB A;  4QJ4 B;  3TUY C;  1ZFS A;  2WC8 A;  1TNP A;  1GJY A;  2F3Z A;  1F70 A;  1EG3 A;  1XK4 C;  3FIA A;  1XFY O;  2LMV A;  3BUX B;  1KQM B;  4YGC B;  2L50 A;  2TN4 A;  2B1U A;  1OMD A;  4GGF C;  1G33 A;  4PHN A;  4OCI A;  1SRA A;  2JUL A;  4UPG A;  1J7R A;  3SG7 A;  2ZNE A;  5AAN A;  1NX3 A;  1ALW A;  3D0Y B;  5D69 A;  5AEQ A;  1RK9 A;  2L98 A;  1OOJ A;  1YR5 A;  3KPX A;  2JRF A;  4Q04 A;  3AAJ A;  4I5N B;  1BF5 A;  1CFP A;  1IJ6 A;  1X02 A;  2JT3 A;  1PRW A;  3BUN B;  1AVS A;  1NX2 A;  4ORC B;  2PAS A;  4YI9 A;  2CTN A;  5AFP A;  3BQ3 A;  5BPJ A;  2IS9 A;  1B7T Z;  1AJ5 A;  3CGA A;  3HCM A;  2OTG C;  4GFT A;  2KFH A;  1IGV A;  2HPS A;  1YVL A;  4GAO A;  1SPY A;  1F71 A;  1K9P A;  2KDH A;  2V53 A;  4PE0 A;  4NDC A;  3KO0 A;  2JNF A;  1CKK A;  2JPT A;  1BT6 A;  4DIR A;  1TTX A;  4C0L A;  2OS8 C;  2KFF A;  1WLM A;  2LP3 A;  3LLE A;  2LNK A;  2WOR A;  5CPV A;  1NCX A;  3CR5 X;  3JTD C;  1OZS A;  2FCE A;  1EXR A;  3IQO A;  1V1F A;  3H4S E;  1LIN A;  1NP8 A;  2KOT A;  2NXQ A;  1A75 B;  2AUC A;  2JXL A;  1AHR A;  2ZFD A;  1DJI A;  3I5I C;  4FQO A;  1HQV A;  1IRJ A;  4AOM A;  2FJU B;  1IKU A;  2ZN8 A;  1QLS A;  1Y1X A;  2KAY A;  1KK8 B;  1DT7 B;  1OMV A;  1BLQ A;  3TDI A;  1TOP A;  1UHH A;  3FWC A;  1XFX O;  2M9G A;  4ETO A;  1QX5 B;  2JT0 A;  1OSA A;  2I7A A;  2JU0 A;  3EVU A;  3TZ1 A;  2GV5 A;  1M45 A;  1SCM B;  2P6B B;  4NDD A;  2K7C A;  1CMG A;  1BG1 A;  5KU1 A;  2JNX A;  3O4Y A;  1DJG A;  3BUO B;  1SR6 C;  3SG2 A;  1TRF A;  3I5H B;  3PLF B;  4MRX A;  1QVI Z;  2BL0 B;  1WDC B;  2M3W A;  3MSE B;  5HYD A;  1CB1 A;  5GQQ C;  1K9K A;  2BCA A;  2ZND A;  3OX5 A;  2GGZ A;  2M8U A;  3LCP C;  1YUU A;  4ORB B;  4CID A;  3PAT A;  1XFU O;  5CSN A;  2R2I A;  4YBH B;  2CCM A;  3EVR A;  1UHK A;  2JTT A;  2MA2 A;  2L4I A;  4MBE A;  1CTR A;  3PN7 B;  4MEW A;  5ER4 X;  1B7T Y;  1SL7 A;  2M7N A;  1J7Q A;  1YUT A;  1CLM A;  2MLF C;  2PRU A;  1BR1 B;  1MXE A;  3LK1 A;  3BYA A;  1QLK A;  2WND A;  1EG4 A;  1ZUZ A;  3CWG A;  3FS7 A;  1BJF A;  5CSI A;  1CFD A;  2KSP A;  3DD4 A;  4TNC A;  3GK1 A;  3D10 A;  5G08 A;  1CLB A;  3BOW A;  1J1E A;  3JVT B;  3KHE A;  4GBA A;  3WXA A;  2MLE C;  3SIA A;  3SG5 A;  1Y1U A;  2D8N A;  3RM1 A;  1F4O A;  1EJ3 A;  2KHN A;  4GGN A;  4OVN F;  3VRR A;  1CMF A;  2ZRS A;  3SJS A;  1NCY A;  3WNX B;  1TNX A;  1NCZ A;  5KTY A;  1XK4 A;  4D1E A;  1KWO C;  2WOS A;  3OP0 A;  4GGF A;  2Q4U A;  2K2A A;  4ICB A;  1E8A A;  1K94 A;  2SCP A;  2NLN A;  1C7V A;  2O5G A;  2PAL A;  1YUR A;  2SAS A;  3CTN A;  3NSO A;  2NCO A;  4MSP A;  4WQ2 A;  2EGD A;  4OR9 B;  2CNP A;  3TS5 C;  2E30 A;  1QVI Y;  2BCX A;  1K9U A;  1SKT A;  2PMY A;  1B9A A;  1QTX A;  5DKQ A;  2E6W A;  1B8C A;  1ZOT B;  2M49 B;  3CR4 X;  1L2O B;  1C07 A;  2KQ6 A;  3I5F B;  2NZ0 A;  1K2H A;  3SG6 A;  1DMO A;  3DVM A;  5CSJ A;  3SIB A;  4E68 A;  1CDP A;  1YX7 A;  3A4U B;  5HKY A;  4N1F A;  2H2K A;  2LLT A;  2JTZ A;  4OKH A;  1OZO A;  3GK2 A;  2LC5 A;  3IQQ A;  4XYN A;  1RJV A;  1FBV A;  1S3P A;  2JQ6 A;  2CBL A;  1DF0 A;  1SCM C;  5JJG A;  4PAL A;  1CFF A;  1J7O A;  1FI6 A;  2L4H A;  1NPQ A;  3DF0 B;  1YVH A;  3ZNI A;  5I2Q A;  2JZI A;  1MWN A;  3AKA A;  3BUM B;  4JQ0 D;  2QPT A;  3NSI A;  1MHO A;  1XFZ O;  1MUX A;  4MLW A;  5AXI A;  4YGD B;  2KI4 C;  1DGV A;  1G8I A;  2M0R A;  3TDZ A;  2LM5 A;  4CPV A;  3GK4 X;  4ZCV A;  3BOW B;  1HT9 A;  1SNL A;  1LA0 A;  2EHB A;  2KAV A;  4N1G A;  1XO5 A;  2BKI B;  2EC6 C;  2KGB C;  4I5J A;  1V1G A;  2F2P A; 
#chains in the Genus database with same CATH topology
 2H61 A;  3DVJ A;  2F8P A;  3TUY B;  2K8M B;  2I2R E;  2M1U A;  1EH2 A;  2LHL A;  2JOJ A;  1N65 A;  1JUO A;  3CR2 A;  1UWO A;  4MZK A;  1BOD A;  1JFK A;  1J7P A;  1K93 D;  1RFJ A;  2L51 A;  1YRU B;  2ZKM X;  3CAB A;  1M63 B;  2WCF A;  4R1E A;  4U8D A;  4AQI A;  1GM0 A;  2O60 A;  3D74 A;  1IJ5 A;  1DEK A;  1Q80 A;  4CFQ A;  2L0P A;  4XJK A;  4OZD A;  2H61 C;  1KCY A;  4YGE B;  4MRY A;  2BBM A;  2ZRT A;  3S0B A;  3SG3 A;  3RZS A;  2BAP A;  3EK4 A;  1QAT A;  1S36 A;  3D77 A;  1KFX L;  1QV1 A;  5HL1 A;  1S1E A;  2PVB A;  1TIZ A;  1DVI A;  3IF7 A;  4MN0 A;  2LCP A;  1MR8 A;  1UHJ A;  3EVV A;  1KFU S;  1UHN A;  4QJ5 B;  2QEV A;  3I5G C;  2K61 A;  2OTG B;  1IQ3 A;  1WRZ A;  2KGR A;  1SK6 D;  1UHI A;  1F54 A;  1NX0 A;  1SCV A;  2GGM A;  2KBI A;  4GUK A;  2JC2 A;  2KI6 C;  3SS4 A;  3AAK A;  1NYA A;  2F3Y A;  3NSL A;  1SSE B;  5FI6 A;  1W7J B;  4JPZ B;  2OS8 B;  5DKN A;  3D0Y A;  3NGV A;  1J1D A;  1F55 A;  3OHM B;  2MRD A;  2QEH A;  3BFB A;  1KQM C;  3KEV A;  1Y6W A;  1BU3 A;  1F4Q A;  4PDZ A;  4A4C A;  2QAC A;  1DJZ A;  1DF0 B;  2LAN A;  3JTD B;  1MQ1 A;  1C7W A;  2WC6 A;  3CS1 A;  3WHT B;  2KAX A;  1B1G A;  2L5X B;  3ICB A;  1KSO A;  3A8R A;  3EKJ A;  3I5I B;  5IBW A;  4ZCU A;  4MVF A;  5K89 A;  4JKT A;  1QX7 A;  1YUS A;  2BNX A;  3BXK A;  4A4B A;  1K96 A;  3I5F C;  4HSZ A;  2KYF A;  2JPO A;  1UUR A;  2LMU A;  1W7I B;  4HRG A;  4NQG A;  2HQW A;  4PHK A;  5I8N A;  1C3Y A;  1NX1 A;  3N7H A;  1ODB A;  3F45 A;  2WCB A;  1A03 A;  2MHH A;  1RWY A;  2G2B A;  1BR4 B;  1EL4 A;  1QV0 A;  4N5X A;  1SW8 A;  1DJH A;  1VRK A;  2PSR A;  2JXC A;  4PCW A;  5HKW A;  4YRU A;  1SR6 B;  5PAL A;  1WY9 A;  2FOT A;  1SMG A;  4INX A;  5D3O A;  1CDM A;  1WRL A;  1A75 A;  3DYE A;  2MAZ A;  1U5I A;  1OOF A;  3O78 A;  4PHJ A;  1WLZ A;  1AUI B;  1DJX A;  1SY9 A;  2KI6 D;  1IWQ A;  2ZN9 A;  4FQT A;  1JFJ A;  1KFU L;  1S6I A;  3R1O A;  1OOG A;  4M2Q A;  3DY9 A;  4M2O A;  2LVV A;  2PYQ A;  2DOQ A;  1QS7 A;  4C0J A;  1DJY A;  4DCK A;  3C1V A;  1QAS A;  1KFX S;  1XFV O;  1IQ5 A;  2LVI A;  4MZL A;  1KK7 Y;  2M1K B;  2KPH A;  4OV2 A;  2BBN A;  1MF8 B;  2LLU A;  1OMR A;  1WRK A;  1QIW A;  1H8B A;  3DVK A;  1A29 A;  2LHI A;  5CSF A;  2M7L A;  2LAP A;  2KLD A;  1CLL A;  4CLN A;  1KQV A;  1B8L A;  1KK8 C;  2LP2 A;  5B8I B;  4M2P A;  5HKZ A;  5I2O A;  1GGZ A;  1PSB A;  1PVB A;  1K8U A;  1QXP A;  1SL8 A;  2LVK A;  2M29 A;  3OB1 B;  3VRQ A;  2P71 A;  1LVC D;  2LVJ A;  4P2Y B;  4WRI A;  2LV7 A;  1CFC A;  1FF1 A;  1CDN A;  2G9B A;  3L4L A;  1OE9 B;  2K7B A;  2KYC A;  3FE9 A;  5DIC A;  3AKB A;  1M31 A;  1UP5 A;  3SS3 A;  3CDN A;  3PSR A;  5HLV A;  3TDU A;  3VRN A;  1PVA A;  2CT9 A;  1D1O A;  2OPO A;  3I5H C;  1GQM A;  1XFW O;  2Y1M A;  3VGO A;  2BL0 C;  1WDC C;  1ALV A;  1NIW A;  2AMI A;  2KQY A;  4MZJ A;  1B8R A;  2WCJ A;  2VRG A;  1DGU A;  4L9M A;  1AK8 A;  3E3R A;  4DRW A;  2KFG A;  1REC A;  1LS8 A;  1KWO B;  1UUS A;  3LK0 A;  1NSH A;  4DUQ A;  5JOL A;  2K2F A;  2WC5 A;  3BUW B;  4HRE E;  1R6P A;  1PSR A;  3PFV A;  1JBA A;  1PUL A;  1S6J A;  3O6B A;  3PN7 C;  4PE7 A;  3NSK A;  2HET A;  3VB1 A;  1ZMZ A;  2KNE A;  1TNQ A;  5I2L A;  1RTP 1;  3S0E A;  2F33 A;  3M0W A;  3O2P A;  1A4P A;  2HF5 A;  2LUX A;  3OX6 A;  1YRT B;  1OW4 A;  1IIO A;  1NWD A;  3FWB A;  3TS5 B;  1CM1 A;  4GPL B;  4I5K A;  3LL8 B;  1H4B A;  1MXL C;  1L7Z A;  1R2U A;  1YX8 A;  1SBJ A;  3S0A A;  3VRO A;  3IVT A;  2JWW A;  3OB2 B;  1GGW A;  5KSZ A;  1OQP A;  3JVT C;  1XVJ A;  1K95 A;  1SL9 A;  4HRH A;  1XA5 A;  1S5G Y;  1SYM A;  3HX4 A;  3WHU B;  3R1P A;  1U5I B;  1JF2 A;  1QX2 A;  3RLZ A;  1ORG A;  2LLS A;  1AP4 A;  1QJT A;  1TCO B;  2CXJ A;  2QDI A;  2K0J A;  2Y4Q A;  1LA3 A;  5AER A;  1S26 D;  1N0Y A;  2MBX A;  1QIV A;  4CFR A;  2L2E A;  4PHM A;  1BMO A;  2KBM A;  1KK7 Z;  1M46 A;  1Z2C B;  1PK0 D;  3OBV A;  1ZAC A;  4YGA A;  3PM2 A;  1S6C A;  3SG4 A;  3EK7 A;  1NUB A;  2BKH B;  4P5O E;  2NCP A;  2BEC A;  3Q8I A;  2MJW B;  1DTL A;  2ISD A;  2LE9 B;  2BE6 A;  2LUC A;  2Q91 A;  4IJ7 A;  1FI5 A;  3DZT A;  5DKR A;  1KSM A;  1XYD A;  3EKH A;  4QJ3 B;  4BY5 A;  2KI4 B;  3K21 A;  4YGB B;  1N2D A;  4JD9 A;  5HLO A;  3GOF A;  4IL1 A;  2KLE A;  3PAL A;  2HQ8 A;  2COL B;  4C0K A;  1Y1A A;  2EC6 B;  2F2O A;  1BOC A;  3NHI A;  1TN4 A;  3D78 A;  3DVE A;  1IH0 A;  2A4J A;  1FW4 A;  2FCD A;  1P28 A;  3CZT X;  2L2C A;  1YTZ C;  4BY4 A;  1FPW A;  2LMT A;  2L5Y A;  1L2O C;  4USL A;  2I18 A;  4ORA B;  1IG5 A;  1JC2 A;  3DF0 A;  1DJW A;  1JF0 A;  1M39 A;  4PE1 A;  1G4Y R;  3O4X A;  1LKJ A;  4YI8 A;  4F0Z B;  1CDL A;  3NXA A;  4JWQ A;  5D7F A;  1TNW A;  2YGU A;  2K7D A;  3QRX A;  1JSA A;  2K7O A;  3VRP A;  2AAO A;  1CNP A;  4DS7 A;  2JT8 A;  2Y5I A;  2ERB A;  1RRO A;  4GNK B;  5TNC A;  1B4C A;  1PAL A;  4PE4 A;  5J3X A;  2M97 A;  4WQ3 A;  1K90 D;  3L4A A;  1CM4 A;  2BE4 A;  3EK8 A;  4AQJ A;  1JWD A;  4XJK B;  1J55 A;  5FYX A;  4FTG A;  3PM8 A;  1A2X A;  5ER5 A;  2I94 A;  1B47 A;  1F8H A;  1T14 A;  1S5G Z;  3I5G B;  2P70 A;  2Y1N A;  3ZWH A;  1AJ4 A;  2WCE A;  3CYZ A;  4KYN A;  1TCF A;  1LXF C;  2RGI A;  3B7A A;  3CLN A;  4I5L B;  5F6T A;  1OOI X;  3KF9 A;  4NDB A;  5EL2 A;  1Y0V H;  2BCB A;  4QJ4 B;  3TUY C;  3FE6 A;  1DEL A;  1ZFS A;  2WC8 A;  1TNP A;  1GJY A;  2F3Z A;  1F70 A;  2WCL A;  1EG3 A;  1XK4 C;  3FIA A;  1XFY O;  2LMV A;  3BUX B;  1KQM B;  4YGC B;  2L50 A;  2TN4 A;  2B1U A;  3D76 A;  1TWO A;  1OMD A;  3R1V A;  4GGF C;  2QEB A;  1G33 A;  4PHN A;  4OCI A;  1SRA A;  2JUL A;  4UPG A;  1J7R A;  3SG7 A;  2ZNE A;  5AAN A;  1NX3 A;  1ALW A;  3D0Y B;  5D69 A;  5AEQ A;  1RK9 A;  2L98 A;  1OOJ A;  1YR5 A;  3KPX A;  2JRF A;  1Z4H A;  4Q04 A;  3AAJ A;  4I5N B;  1BF5 A;  2WCK A;  1IJ6 A;  1X02 A;  1CFP A;  2JT3 A;  1PRW A;  3BUN B;  1AVS A;  1NX2 A;  4ORC B;  2PAS A;  1TUZ A;  4YI9 A;  2CTN A;  5AFP A;  3BQ3 A;  3DXL A;  1XFR A;  3EG5 B;  2IS9 A;  3PJI A;  5BPJ A;  1B7T Z;  1AJ5 A;  3CGA A;  3HCM A;  2OTG C;  4GFT A;  2KFH A;  1IGV A;  2HPS A;  1YVL A;  4GAO A;  1SPY A;  1F71 A;  1K9P A;  2KDH A;  2V53 A;  4PE0 A;  4NDC A;  2PQL A;  2JNF A;  3KO0 A;  1CKK A;  2JPT A;  1BT6 A;  4DIR A;  1TTX A;  4C0L A;  2OS8 C;  2KFF A;  1WLM A;  2LP3 A;  3LLE A;  2LNK A;  2WOR A;  5CPV A;  1NCX A;  5FI7 A;  3V2L A;  3CR5 X;  3JTD C;  1OZS A;  2FCE A;  1EXR A;  3IQO A;  1V1F A;  3H4S E;  1LIN A;  1NP8 A;  2KOT A;  2NXQ A;  1A75 B;  2AUC A;  2JXL A;  1AHR A;  4F7F A;  2ZFD A;  1DJI A;  3I5I C;  4FQO A;  1HQV A;  1IRJ A;  4AOM A;  2FJU B;  4PT1 A;  1IKU A;  2ZN8 A;  1QLS A;  1Y1X A;  2KAY A;  3B87 A;  3S0F A;  3D75 A;  1KK8 B;  1DT7 B;  1OMV A;  1BLQ A;  3TDI A;  1TOP A;  1UHH A;  3FWC A;  1XFX O;  2M9G A;  4ETO A;  1QX5 B;  2JT0 A;  2FJY A;  1OSA A;  3B88 A;  2I7A A;  2JU0 A;  3EVU A;  3TZ1 A;  2GV5 A;  1M45 A;  1SCM B;  2P6B B;  4NDD A;  2K7C A;  1CMG A;  1BG1 A;  3CZ2 A;  5KU1 A;  1OOH A;  2JNX A;  3O4Y A;  1DJG A;  3BUO B;  1SR6 C;  3SG2 A;  1TRF A;  3I5H B;  3PLF B;  4MRX A;  1QVI Z;  2BL0 B;  1WDC B;  2M3W A;  3MSE B;  5HYD A;  1CB1 A;  3FE8 A;  1C3Z A;  5GQQ C;  1K9K A;  2BCA A;  2ZND A;  3OX5 A;  2GGZ A;  2M8U A;  3LCP C;  1YUU A;  4ORB B;  4CID A;  3PAT A;  1XFU O;  5CSN A;  2H8V A;  2R2I A;  4YBH B;  2CCM A;  3EVR A;  1UHK A;  2JTT A;  2MA2 A;  3BFA A;  3QME A;  2L4I A;  4MBE A;  1CTR A;  3PN7 B;  4MEW A;  5ER4 X;  1B7T Y;  1SL7 A;  2M7N A;  1J7Q A;  3CZ0 A;  1YUT A;  1CLM A;  2MLF C;  2PRU A;  1BR1 B;  1MXE A;  3LK1 A;  3BYA A;  1QLK A;  2WND A;  1EG4 A;  1ZUZ A;  3CWG A;  3FS7 A;  1BJF A;  5CSI A;  1CFD A;  2KSP A;  3DD4 A;  4TNC A;  3GK1 A;  3D10 A;  5G08 A;  3L47 A;  3BOW A;  1J1E A;  3JVT B;  3KHE A;  4GBA A;  3WXA A;  1CLB A;  2MLE C;  3SIA A;  3SG5 A;  1Y1U A;  2QEO A;  2D8N A;  3RM1 A;  1F4O A;  1TUJ A;  1EJ3 A;  2KHN A;  4GGN A;  4OVN F;  3VRR A;  1CMF A;  2ZRS A;  3SJS A;  1NCY A;  3CZ1 A;  3WNX B;  1TNX A;  1NCZ A;  5KTY A;  1XK4 A;  4D1E A;  1KWO C;  2WOS A;  1QWV A;  3OP0 A;  4GGF A;  2Q4U A;  3UO9 A;  2K2A A;  4ICB A;  1E8A A;  1K94 A;  2SCP A;  3D73 A;  4INW A;  2NLN A;  2WCH A;  1C7V A;  2O5G A;  2PAL A;  1YUR A;  2SAS A;  3CTN A;  3NSO A;  2NCO A;  3K1E A;  4MSP A;  4WQ2 A;  2EGD A;  4OR9 B;  2CNP A;  3TS5 C;  2E30 A;  1QVI Y;  2BCX A;  3R72 A;  1K9U A;  1SKT A;  3OGN A;  3S0D A;  2PMY A;  1B9A A;  1W9Z A;  1QTX A;  5DKQ A;  2E6W A;  1B8C A;  3BFH A;  1ZOT B;  2M49 B;  3CR4 X;  1L2O B;  1C07 A;  2KQ6 A;  3I5F B;  2NZ0 A;  1DQE A;  1K2H A;  3SG6 A;  1DC1 A;  3DVM A;  1DMO A;  5CSJ A;  3SIB A;  4E68 A;  1CDP A;  1YX7 A;  3A4U B;  5HKY A;  3S0G A;  4N1F A;  2H2K A;  2LLT A;  2JTZ A;  4OKH A;  2K60 A;  5I94 A;  3BJH A;  1OZO A;  3GK2 A;  2LC5 A;  3IQQ A;  4XYN A;  1RJV A;  1FBV A;  1S3P A;  2JQ6 A;  1DF0 A;  1SCM C;  2CBL A;  5JJG A;  4PAL A;  1CFF A;  1J7O A;  1FI6 A;  2L4H A;  1NPQ A;  3DF0 B;  1YVH A;  3UNW A;  3ZNI A;  5I2Q A;  2JZI A;  1MWN A;  3AKA A;  3BUM B;  3NHT A;  3B6X A;  4JQ0 D;  2QPT A;  2WCM A;  3NSI A;  1MHO A;  1XFZ O;  1MUX A;  4MLW A;  3B86 A;  5AXI A;  4YGD B;  2KI4 C;  1DGV A;  1G8I A;  2M0R A;  3TDZ A;  2LM5 A;  4CPV A;  3GK4 X;  4ZCV A;  5FI2 A;  3BOW B;  3SS5 A;  1HT9 A;  1SNL A;  1LA0 A;  2EHB A;  2KAV A;  4N1G A;  1XO5 A;  2BKI B;  2EC6 C;  2KGB C;  4I5J A;  2GTE A;  1V1G A;  2F2P A; 
#chains in the Genus database with same CATH homology
 2H61 A;  3DVJ A;  2F8P A;  3TUY B;  2K8M B;  2I2R E;  2M1U A;  1EH2 A;  2LHL A;  2JOJ A;  1N65 A;  1JUO A;  3CR2 A;  1UWO A;  4MZK A;  1BOD A;  1JFK A;  1J7P A;  1K93 D;  1RFJ A;  2L51 A;  1YRU B;  2ZKM X;  4R1E A;  1M63 B;  2WCF A;  4U8D A;  4AQI A;  2O60 A;  4CFQ A;  1IJ5 A;  1Q80 A;  2L0P A;  4XJK A;  1KCY A;  2H61 C;  4YGE B;  4MRY A;  2BBM A;  2ZRT A;  3SG3 A;  3EK4 A;  1QAT A;  1S36 A;  1KFX L;  1QV1 A;  1S1E A;  2PVB A;  1TIZ A;  1DVI A;  3IF7 A;  4MN0 A;  2LCP A;  1MR8 A;  1UHJ A;  3EVV A;  1KFU S;  1UHN A;  4QJ5 B;  3I5G C;  2K61 A;  2OTG B;  1IQ3 A;  1WRZ A;  2KGR A;  1SK6 D;  1UHI A;  1F54 A;  1NX0 A;  1SCV A;  2GGM A;  2KBI A;  4GUK A;  2JC2 A;  2KI6 C;  3AAK A;  1NYA A;  2F3Y A;  3NSL A;  1W7J B;  4JPZ B;  2OS8 B;  5DKN A;  3D0Y A;  1J1D A;  1F55 A;  3OHM B;  2MRD A;  3KEV A;  4PDZ A;  1KQM C;  4A4C A;  1Y6W A;  1BU3 A;  1F4Q A;  2QAC A;  1DJZ A;  1DF0 B;  2LAN A;  3JTD B;  1MQ1 A;  1C7W A;  3CS1 A;  3WHT B;  1B1G A;  2KAX A;  2L5X B;  3ICB A;  1KSO A;  3A8R A;  3EKJ A;  3I5I B;  5IBW A;  4ZCU A;  4MVF A;  5K89 A;  1QX7 A;  1YUS A;  3BXK A;  4A4B A;  1K96 A;  3I5F C;  4HSZ A;  2KYF A;  4NQG A;  1UUR A;  2LMU A;  1W7I B;  4HRG A;  2HQW A;  4PHK A;  5I8N A;  1NX1 A;  1ODB A;  3F45 A;  2WCB A;  1A03 A;  2MHH A;  1RWY A;  2G2B A;  1BR4 B;  1EL4 A;  1QV0 A;  4N5X A;  1SW8 A;  1DJH A;  1VRK A;  2PSR A;  2JXC A;  4PCW A;  5HKW A;  4YRU A;  1SR6 B;  5PAL A;  1WY9 A;  2FOT A;  1SMG A;  1CDM A;  1WRL A;  1A75 A;  2MAZ A;  1U5I A;  3O78 A;  4PHJ A;  1WLZ A;  1AUI B;  1DJX A;  1SY9 A;  2KI6 D;  1IWQ A;  2ZN9 A;  1JFJ A;  1KFU L;  1S6I A;  4M2Q A;  4M2O A;  2LVV A;  2DOQ A;  1QS7 A;  4C0J A;  1DJY A;  4DCK A;  3C1V A;  1QAS A;  1KFX S;  1XFV O;  1IQ5 A;  2LVI A;  4MZL A;  1KK7 Y;  2M1K B;  4OV2 A;  2BBN A;  1MF8 B;  2LLU A;  1OMR A;  1WRK A;  1QIW A;  1H8B A;  3DVK A;  1A29 A;  2LHI A;  5CSF A;  2M7L A;  2LAP A;  1CLL A;  4CLN A;  1KQV A;  1B8L A;  1KK8 C;  2LP2 A;  5B8I B;  4M2P A;  5HKZ A;  5I2O A;  1GGZ A;  1PSB A;  1PVB A;  1K8U A;  1QXP A;  1SL8 A;  2LVK A;  2M29 A;  3OB1 B;  3VRQ A;  1LVC D;  2LVJ A;  4P2Y B;  4WRI A;  2LV7 A;  1CFC A;  1FF1 A;  1CDN A;  2G9B A;  1OE9 B;  2K7B A;  2KYC A;  3TDU A;  3AKB A;  1M31 A;  1UP5 A;  3VRN A;  5HLV A;  3PSR A;  1D1O A;  1PVA A;  2CT9 A;  2OPO A;  3I5H C;  1GQM A;  1XFW O;  2Y1M A;  3VGO A;  2BL0 C;  1WDC C;  1ALV A;  1NIW A;  2AMI A;  2KQY A;  4MZJ A;  1B8R A;  1AK8 A;  2VRG A;  1DGU A;  4L9M A;  3E3R A;  4DRW A;  2KFG A;  1REC A;  1KWO B;  1UUS A;  3LK0 A;  1NSH A;  4DUQ A;  5JOL A;  2K2F A;  3BUW B;  4HRE E;  1R6P A;  1PSR A;  3PFV A;  1JBA A;  1PUL A;  1S6J A;  3O6B A;  3PN7 C;  4PE7 A;  3NSK A;  2HET A;  1ZMZ A;  2KNE A;  1TNQ A;  5I2L A;  1RTP 1;  2F33 A;  3M0W A;  3O2P A;  1A4P A;  2HF5 A;  2LUX A;  3OX6 A;  1YRT B;  1NWD A;  3FWB A;  3TS5 B;  1CM1 A;  4GPL B;  4I5K A;  3LL8 B;  1H4B A;  1MXL C;  1L7Z A;  1R2U A;  1YX8 A;  1SBJ A;  3VRO A;  2JWW A;  3OB2 B;  1GGW A;  5KSZ A;  1OQP A;  3JVT C;  1XVJ A;  1K95 A;  1SL9 A;  4HRH A;  1XA5 A;  1S5G Y;  1SYM A;  3HX4 A;  3WHU B;  1U5I B;  1JF2 A;  1QX2 A;  3RLZ A;  2LLS A;  1AP4 A;  1QJT A;  1TCO B;  2CXJ A;  2K0J A;  2Y4Q A;  1LA3 A;  5AER A;  1S26 D;  1N0Y A;  2MBX A;  1QIV A;  4CFR A;  2L2E A;  4PHM A;  1BMO A;  2KBM A;  1KK7 Z;  1M46 A;  1PK0 D;  1ZAC A;  4YGA A;  1S6C A;  3SG4 A;  3EK7 A;  1NUB A;  2BKH B;  4P5O E;  2NCP A;  2BEC A;  2MJW B;  1DTL A;  2ISD A;  2LE9 B;  2BE6 A;  2LUC A;  2Q91 A;  1FI5 A;  5DKR A;  1KSM A;  1XYD A;  3EKH A;  4QJ3 B;  4BY5 A;  2KI4 B;  3K21 A;  4YGB B;  1N2D A;  5HLO A;  3GOF A;  4IL1 A;  3PAL A;  2HQ8 A;  2COL B;  4C0K A;  1Y1A A;  2EC6 B;  2F2O A;  1BOC A;  1TN4 A;  3DVE A;  1IH0 A;  2A4J A;  1FW4 A;  2FCD A;  3CZT X;  4BY4 A;  1FPW A;  1YTZ C;  2LMT A;  1L2O C;  4USL A;  2I18 A;  4ORA B;  1IG5 A;  1JC2 A;  3DF0 A;  1DJW A;  1JF0 A;  1M39 A;  4PE1 A;  1G4Y R;  1LKJ A;  4YI8 A;  4F0Z B;  1CDL A;  3NXA A;  4JWQ A;  5D7F A;  1TNW A;  2K7D A;  3QRX A;  1JSA A;  2K7O A;  3VRP A;  2AAO A;  1CNP A;  4DS7 A;  2JT8 A;  2Y5I A;  1RRO A;  4GNK B;  5TNC A;  1B4C A;  1PAL A;  4PE4 A;  5J3X A;  2M97 A;  4WQ3 A;  1K90 D;  1CM4 A;  2BE4 A;  3EK8 A;  4AQJ A;  1JWD A;  4XJK B;  1J55 A;  5FYX A;  4FTG A;  3PM8 A;  1A2X A;  5ER5 A;  2I94 A;  1B47 A;  1F8H A;  1S5G Z;  3I5G B;  2Y1N A;  3ZWH A;  1AJ4 A;  2WCE A;  1TCF A;  1LXF C;  2RGI A;  3CLN A;  4I5L B;  5F6T A;  3KF9 A;  4NDB A;  1Y0V H;  2BCB A;  4QJ4 B;  3TUY C;  1ZFS A;  2WC8 A;  1TNP A;  1GJY A;  2F3Z A;  1F70 A;  1EG3 A;  1XK4 C;  3FIA A;  1XFY O;  2LMV A;  3BUX B;  1KQM B;  4YGC B;  2L50 A;  2TN4 A;  2B1U A;  1OMD A;  4GGF C;  1G33 A;  4PHN A;  4OCI A;  1SRA A;  2JUL A;  4UPG A;  1J7R A;  3SG7 A;  2ZNE A;  5AAN A;  1NX3 A;  1ALW A;  3D0Y B;  5D69 A;  5AEQ A;  1RK9 A;  2L98 A;  1OOJ A;  1YR5 A;  3KPX A;  2JRF A;  4Q04 A;  3AAJ A;  4I5N B;  1BF5 A;  1CFP A;  1IJ6 A;  1X02 A;  2JT3 A;  1PRW A;  3BUN B;  1AVS A;  1NX2 A;  4ORC B;  2PAS A;  4YI9 A;  2CTN A;  5AFP A;  3BQ3 A;  5BPJ A;  2IS9 A;  1B7T Z;  1AJ5 A;  3CGA A;  3HCM A;  2OTG C;  4GFT A;  2KFH A;  1IGV A;  2HPS A;  1YVL A;  4GAO A;  1SPY A;  1F71 A;  1K9P A;  2KDH A;  2V53 A;  4PE0 A;  4NDC A;  3KO0 A;  2JNF A;  1CKK A;  2JPT A;  1BT6 A;  4DIR A;  1TTX A;  4C0L A;  2OS8 C;  2KFF A;  1WLM A;  2LP3 A;  3LLE A;  2LNK A;  2WOR A;  5CPV A;  1NCX A;  3CR5 X;  3JTD C;  1OZS A;  2FCE A;  1EXR A;  3IQO A;  1V1F A;  3H4S E;  1LIN A;  1NP8 A;  2KOT A;  2NXQ A;  1A75 B;  2AUC A;  2JXL A;  1AHR A;  2ZFD A;  1DJI A;  3I5I C;  4FQO A;  1HQV A;  1IRJ A;  4AOM A;  2FJU B;  1IKU A;  2ZN8 A;  1QLS A;  1Y1X A;  2KAY A;  1KK8 B;  1DT7 B;  1OMV A;  1BLQ A;  3TDI A;  1TOP A;  1UHH A;  3FWC A;  1XFX O;  2M9G A;  4ETO A;  1QX5 B;  2JT0 A;  1OSA A;  2I7A A;  2JU0 A;  3EVU A;  3TZ1 A;  2GV5 A;  1M45 A;  1SCM B;  2P6B B;  4NDD A;  2K7C A;  1CMG A;  1BG1 A;  5KU1 A;  2JNX A;  3O4Y A;  1DJG A;  3BUO B;  1SR6 C;  3SG2 A;  1TRF A;  3I5H B;  3PLF B;  4MRX A;  1QVI Z;  2BL0 B;  1WDC B;  2M3W A;  3MSE B;  5HYD A;  1CB1 A;  5GQQ C;  1K9K A;  2BCA A;  2ZND A;  3OX5 A;  2GGZ A;  2M8U A;  3LCP C;  1YUU A;  4ORB B;  4CID A;  3PAT A;  1XFU O;  5CSN A;  2R2I A;  4YBH B;  2CCM A;  3EVR A;  1UHK A;  2JTT A;  2MA2 A;  2L4I A;  4MBE A;  1CTR A;  3PN7 B;  4MEW A;  5ER4 X;  1B7T Y;  1SL7 A;  2M7N A;  1J7Q A;  1YUT A;  1CLM A;  2MLF C;  2PRU A;  1BR1 B;  1MXE A;  3LK1 A;  3BYA A;  1QLK A;  2WND A;  1EG4 A;  1ZUZ A;  3CWG A;  3FS7 A;  1BJF A;  5CSI A;  1CFD A;  2KSP A;  3DD4 A;  4TNC A;  3GK1 A;  3D10 A;  5G08 A;  1CLB A;  3BOW A;  1J1E A;  3JVT B;  3KHE A;  4GBA A;  3WXA A;  2MLE C;  3SIA A;  3SG5 A;  1Y1U A;  2D8N A;  3RM1 A;  1F4O A;  1EJ3 A;  2KHN A;  4GGN A;  4OVN F;  3VRR A;  1CMF A;  2ZRS A;  3SJS A;  1NCY A;  3WNX B;  1TNX A;  1NCZ A;  5KTY A;  1XK4 A;  4D1E A;  1KWO C;  2WOS A;  3OP0 A;  4GGF A;  2Q4U A;  2K2A A;  4ICB A;  1E8A A;  1K94 A;  2SCP A;  2NLN A;  1C7V A;  2O5G A;  2PAL A;  1YUR A;  2SAS A;  3CTN A;  3NSO A;  2NCO A;  4MSP A;  4WQ2 A;  2EGD A;  4OR9 B;  2CNP A;  3TS5 C;  2E30 A;  1QVI Y;  2BCX A;  1K9U A;  1SKT A;  2PMY A;  1B9A A;  1QTX A;  5DKQ A;  2E6W A;  1B8C A;  1ZOT B;  2M49 B;  3CR4 X;  1L2O B;  1C07 A;  2KQ6 A;  3I5F B;  2NZ0 A;  1K2H A;  3SG6 A;  1DMO A;  3DVM A;  5CSJ A;  3SIB A;  4E68 A;  1CDP A;  1YX7 A;  3A4U B;  5HKY A;  4N1F A;  2H2K A;  2LLT A;  2JTZ A;  4OKH A;  1OZO A;  3GK2 A;  2LC5 A;  3IQQ A;  4XYN A;  1RJV A;  1FBV A;  1S3P A;  2JQ6 A;  2CBL A;  1DF0 A;  1SCM C;  5JJG A;  4PAL A;  1CFF A;  1J7O A;  1FI6 A;  2L4H A;  1NPQ A;  3DF0 B;  1YVH A;  3ZNI A;  5I2Q A;  2JZI A;  1MWN A;  3AKA A;  3BUM B;  4JQ0 D;  2QPT A;  3NSI A;  1MHO A;  1XFZ O;  1MUX A;  4MLW A;  5AXI A;  4YGD B;  2KI4 C;  1DGV A;  1G8I A;  2M0R A;  3TDZ A;  2LM5 A;  4CPV A;  3GK4 X;  4ZCV A;  3BOW B;  1HT9 A;  1SNL A;  1LA0 A;  2EHB A;  2KAV A;  4N1G A;  1XO5 A;  2BKI B;  2EC6 C;  2KGB C;  4I5J A;  1V1G A;  2F2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...