4GFTA

Malaria invasion machinery protein-nanobody complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
65
structure length
63
Chain Sequence
NVEELIKMFAHFDNNSTGYLTKSQMKNILTTWALTDQEAIDALNAFSSEDNIDYKLFCEDILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Protein binding, immune system
molecule keywords Myosin A tail domain interacting protein
total genus 18
structure length 63
sequence length 65
ec nomenclature
pdb deposition date 2012-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gftA00
1S5GY 3SG4A 1IRJA 1LKJA 3CWGA 2OTGB 2BECA 2CT9A 1DTLA 1JSAA 1B8CA 4YI9A 2AAOA 4YGCB 3NSOA 1S3PA 1WDCC 1CDLA 1UURA 2LVJA 1CTRA 1OOJA 1CDNA 3NXAA 3RLZA 1R6PA 4QJ4B 2KDHA 4JQ0D 4GUKA 2JXLA 2KFFA 2MAZA 4ETOA 2JT0A 2F3YA 2I94A 3SJSA 1LA0A 1QVIY 2Q91A 2JXCA 3FS7A 4F0ZB 1CB1A 3BUXB 2L4IA 1A29A 2L4HA 2MHHA 1OZOA 1AUIB 1YRUB 2LC5A 2K2AA 2LMUA 3D0YB 3M0WA 2LV7A 1AJ4A 2QACA 2A4JA 2OS8C 1NIWA 4M2OA 3ZNIA 2M29A 2KSPA 2ZN8A 1QX5B 3PM8A 3FWBA 1S26D 5D7FA 5CSNA 4PE1A 2B1UA 1EXRA 2NXQA 1KQMB 1XYDA 1EH2A 2QPTA 2FOTA 2JT8A 1WRLA 1AK8A 1NX2A 1Y0VH 2LLTA 4AOMA 2WCEA 1UHIA 1CM4A 2Y5IA 2L98A 1CLBA 4GPLB 1IH0A 1PALA 2K2FA 1DJXA 4BY5A 2LLSA 3D10A 4ORAB 3SG5A 2JOJA 1MF8B 4PHMA 4M2PA 1XFWO 1RFJA 1RWYA 1NCZA 3JVTB 2NCPA 1S36A 5B8IB 1RROA 4R1EA 2BE6A 3BXKA 4HSZA 2LANA 1VRKA 4MVFA 4M2QA 1EL4A 2M3WA 3QRXA 5DKQA 3I5FC 3SIAA 1K9KA 1AP4A 4XYNA 2JPTA 5CSFA 1XFVO 1K90D 2L51A 2NCOA 1B7TY 1G33A 2KFGA 4MRXA 3TUYB 2JQ6A 4OR9B 4WQ3A 1HQVA 5I8NA 1K95A 2ZKMX 2GGMA 1YUUA 1JWDA 1UWOA 3AAJA 3IQOA 2WOSA 1B4CA 2G9BA 1K2HA 2LNKA 4YGEB 4NDDA 5CSJA 4PHJA 5ER4X 2KI4C 4MZLA 1J7OA 3LK1A 1NSHA 2EHBA 1F70A 3VRPA 1PVBA 1B9AA 1BOCA 3CZTX 1WY9A 4GFTA 1WLMA 1QJTA 1M46A 4NDCA 3WHUB 1TTXA 3CLNA 4MBEA 5JOLA 1C7WA 3DVJA 1XK4A 4DCKA 2MLEC 1GJYA 4JPZB 2PRUA 1J7PA 2CNPA 1JF2A 1S6CA 3OX5A 2MBXA 3TDZA 1TNPA 2BL0B 4I5JA 1DT7B 1F71A 4GGNA 1NYAA 3VGOA 3DVEA 4N1GA 1BR1B 1TNXA 1BG1A 1WRZA 1V1GA 4DS7A 2KBMA 2WC8A 4D1EA 3SIBA 1K94A 2M7NA 1KSOA 1QVIZ 1UHNA 1YR5A 2BCBA 2E6WA 2COLB 2GV5A 3KO0A 1X02A 1CFDA 2OTGC 4MZKA 1KK8B 2M9GA 1K9UA 4QJ3B 2KBIA 5BPJA 2Y1MA 3DVMA 1B7TZ 1PULA 1KK8C 2LM5A 4DIRA 3DVKA 1NUBA 4XJKA 1SR6C 2EC6C 1ZFSA 4IL1A 3SG6A 1IWQA 1YX7A 3VRNA 1H8BA 3KEVA 1OMRA 2AUCA 4ORCB 5JJGA 2LUXA 3CR4X 1QV1A 1FI5A 1LVCD 2JNXA 1A03A 2L2EA 1PSRA 2JWWA 2JULA 1QXPA 1CM1A 1IJ5A 3D0YA 4I5NB 1CFFA 1BT6A 1QATA 2WCFA 1XFUO 3GK1A 4GNKB 1KQMC 2F2PA 2Y4QA 2LHIA 3DF0B 2AMIA 4NQGA 4PDZA 1B1GA 1NX3A 1S6JA 3CR2A 5DKNA 2KGRA 3CGAA 1GGZA 1IQ3A 1DF0B 1H4BA 5IBWA 1JFJA 1NX0A 3CR5X 2KYCA 4I5KA 2GGZA 3WHTB 2IS9A 2KYFA 1ZUZA 3WXAA 1OQPA 1AHRA 1K9PA 2H2KA 1F4QA 1K8UA 1FW4A 2KNEA 3BYAA 2JTZA 3GOFA 2I18A 1RECA 1SPYA 4CFQA 3OHMB 3TUYC 4WQ2A 1TN4A 3VROA 5I2LA 4P5OE 1JBAA 5HKWA 4CIDA 4QJ5B 1SNLA 1WRKA 1A75B 2SCPA 3NSLA 2CXJA 5DKRA 5FYXA 1Y1UA 1DGUA 1K93D 3BUMB 4E68A 1MQ1A 1Y1XA 2HETA 2O60A 2LLUA 4MSPA 1A2XA 1SRAA 1NX1A 1YUTA 2KOTA 2SASA 3I5HB 3I5IB 2CTNA 2LUCA 3O6BA 1CFPA 5ER5A 4HREE 5KTYA 5I2OA 2CCMA 1IKUA 1SYMA 1L7ZA 2LVVA 1OZSA 2PVBA 2WCBA 3OB1B 3EVVA 1N0YA 1OSAA 1Y6WA 4MN0A 4MEWA 4AQJA 1C07A 1B8LA 2FCDA 3A8RA 1YUSA 2WNDA 1DMOA 1S5GZ 2H61C 2I2RE 4JWQA 2LP3A 2ISDA 1Y1AA 2MA2A 2F3ZA 2MJWB 3DF0A 3VRRA 2DOQA 1EG3A 2V53A 3I5IC 1DJZA 3I5HC 2EGDA 3JVTC 5KU1A 4ICBA 1LXFC 2BCXA 2JTTA 1DVIA 1YVLA 1SMGA 4C0LA 2LE9B 3PN7B 1QS7A 1W7IB 2ZNEA 2Q4UA 5K89A 4FQOA 3SG2A 5AXIA 3PN7C 1KSMA 4PHNA 1DJIA 3GK4X 3PATA 1XA5A 2HQWA 2KAVA 3ZWHA 1QIVA 2LP2A 2JRFA 1EJ3A 2F2OA 3GK2A 2JT3A 4GBAA 5J3XA 3A4UB 1SL7A 2FJUB 2Y1NA 4A4BA 1V1FA 1ZACA 3OB2B 4CLNA 1KFXL 1RTP1 1KFUL 2E30A 1A4PA 2ZN9A 4MZJA 1FI6A 3EK4A 1QV0A 2TN4A 1CDPA 1M31A 3ICBA 1NCXA 2NZ0A 1J55A 4PE7A 4XJKB 5PALA 1M39A 4YGBB 1JFKA 1YTZC 3FWCA 3PLFB 2PSRA 3NSIA 3CS1A 1TNQA 1OMDA 1DJYA 3SG3A 1ALWA 1A75A 2BBMA 1M63B 1U5IB 4PCWA 1KK7Z 5D69A 1LINA 2JNFA 1PVAA 2O5GA 1SCMC 1FBVA 3K21A 2L5XB 1NP8A 1MXEA 2KAYA 2CBLA 4MLWA 1K96A 1TCFA 5AANA 1QTXA 4OKHA 3DD4A 1FPWA 2PASA 1WLZA 1SL9A 3KF9A 2ZNDA 4HRHA 1C7VA 4GAOA 5I2QA 2LMTA 1F4OA 4BY4A 1KQVA 1UHJA 5CPVA 3EVRA 1PRWA 1YVHA 2VRGA 1CFCA 5AFPA 4OV2A 4DRWA 1FF1A 1OMVA 1MXLC 1TIZA 4N1FA 1YRTB 1KWOB 5TNCA 2JU0A 1CNPA 1DJGA 1R2UA 1XFYO 1EG4A 2JZIA 4OCIA 3I5GB 2KGBC 1D1OA 1GGWA 4YRUA 1QX2A 4NDBA 1CMFA 1HT9A 2K7DA 2D8NA 3I5GC 1NCYA 1SY9A 4PE0A 2LVKA 4YBHB 4USLA 2BL0C 2HQ8A 1JUOA 1TNWA 2HF5A 2WORA 1J7RA 1SKTA 1ALVA 1DGVA 4ORBB 1PK0D 3JTDC 4P2YB 1CLLA 4FTGA 3EKJA 1CDMA 1YX8A 1RJVA 2K7CA 3BUWB 2K7BA 1B47A 2HPSA 2LMVA 4YI8A 1M45A 5HYDA 1KK7Y 1F54A 2BE4A 2BKIB 1BLQA 5GQQC 1NWDA 1BJFA 4YGAA 1ZOTB 1YURA 1S1EA 1ZMZA 1JF0A 3KPXA 5CSIA 1DJWA 2BBNA 2G2BA 3PSRA 2ZRTA 3BUNB 1BF5A 2M97A 2K0JA 4ZCUA 2MRDA 2F8PA 2LVIA 4PHKA 1UUSA 1XK4C 1BU3A 4GGFA 1QASA 1KFXS 5HLVA 4GGFC 3HCMA 3SG7A 1AJ5A 4CPVA 1OE9B 3NSKA 3IF7A 1TOPA 1QX7A 4I5LB 2L0PA 1KCYA 5HKYA 1F55A 1QLKA 3LLEA 4U8DA 2PALA 4TNCA 1SK6D 3HX4A 1U5IA 1BODA 1F8HA 5HKZA 5AERA 3OP0A 2M0RA 2K61A 1L2OB 1PSBA 1CMGA 1UHKA 2H61A 2I7AA 1W7JB 1SL8A 4PE4A 1MUXA 2P6BB 1E8AA 5HLOA 4CFRA 3WNXB 3LCPC 1J7QA 1MHOA 2LHLA 4OVNF 4ZCVA 1BMOA 1SBJA 1SR6B 2EC6B 2PMYA 2OS8B 3PFVA 2RGIA 2KI6C 1DF0A 3C1VA 3TZ1A 2KAXA 3O2PA 2KQ6A 2KFHA 1NPQA 3BOWA 1L2OC 2KHNA 1DJHA 3O78A 1JC2A 2FCEA 1XFZO 3LK0A 3TDIA 3E3RA 5F6TA 1CKKA 2M49B 4AQIA 4N5XA 4PALA 1J1EA 1XO5A 3FIAA 3O4YA 2ZFDA 5G08A 3OX6A 3LL8B 2M1UA 3EVUA 1UHHA 1LA3A 3BQ3A 2NLNA 1B8RA 2KI4B 5KSZA 3KHEA 1SCVA 3JTDB 3BUOB 3IQQA 1KFUS 3MSEB 4Q04A 2KQYA 1TRFA 2LCPA 2L50A 4A4CA 4DUQA 2BCAA 3VRQA 1IQ5A 1MR8A 2BKHB 1J1DA 3EK8A 1SCMB 2F33A 2MLFC 3RM1A 5AEQA 2K7OA 3F45A 1CLMA 2M7LA 4C0JA 1S6IA 3EKHA 1IGVA 1AVSA 3PALA 1XVJA 2M1KB 1TCOB 4MRYA 4HRGA 3H4SE 1RK9A 1WDCB 4L9MA 4YGDB 2ZRSA 1IG5A 1QLSA 3TDUA 1G8IA 2JC2A 1MWNA 1ODBA 1XFXO 4UPGA 2R2IA 1GQMA 3AKBA 3EK7A 1IJ6A 1N65A 1G4YR 1Q80A 2LAPA 2OPOA 4C0KA 1BR4B 3AAKA 3AKAA 3TS5C 1QIWA 2K8MB 2M8UA 1SW8A 3CTNA 2KI6D 3BOWB 1N2DA 4WRIA 3TS5B 1KWOC 3I5FB 1UP5A
chains in the Genus database with same CATH superfamily
1S5GY 3SG4A 1IRJA 1LKJA 3CWGA 2OTGB 3VB1A 2BECA 2CT9A 1DTLA 1JSAA 1B8CA 2WC5A 4YI9A 1OOGA 2AAOA 4YGCB 3NSOA 1S3PA 1WDCC 1CDLA 2P70A 2K60A 1UURA 2WCHA 2LVJA 1CTRA 1OOJA 1CDNA 3NXAA 3RLZA 1R6PA 4QJ4B 4OZDA 3CZ1A 2KLDA 2KDHA 2FJYA 4JQ0D 4GUKA 2JXLA 2KFFA 2MAZA 3FE9A 2JT0A 2F3YA 2I94A 4ETOA 3SJSA 1GM0A 1LA0A 1QVIY 2Q91A 2JXCA 3FS7A 4JKTA 4F0ZB 1DEKA 3BUXB 3CZ2A 2YGUA 2L4IA 1A29A 2L4HA 2MHHA 2WCMA 3D77A 1OZOA 1AUIB 1YRUB 2LC5A 2K2AA 2LMUA 3D0YB 3M0WA 2LV7A 1AJ4A 2QACA 2A4JA 2OS8C 1NIWA 4M2OA 3ZNIA 2M29A 2KSPA 2ZN8A 1QX5B 3PM8A 3FWBA 1S26D 5D7FA 5CSNA 3D74A 4PE1A 2B1UA 1EXRA 2NXQA 1KQMB 1XFRA 1XYDA 1EH2A 2QPTA 2FOTA 2JT8A 1C3YA 1WRLA 1AK8A 1NX2A 1Y0VH 2LLTA 4AOMA 2PQLA 2WCEA 1UHIA 1CM4A 2Y5IA 2L98A 3S0DA 1CLBA 4GPLB 1IH0A 1PALA 2K2FA 1T14A 1DJXA 3L4LA 4BY5A 2LLSA 3SS3A 2BNXA 4FQTA 3D10A 4ORAB 3SG5A 3DXLA 2P71A 2L5YA 2JOJA 1MF8B 4PHMA 4M2PA 1XFWO 1RFJA 1RWYA 1NCZA 5FI6A 3JVTB 2NCPA 2KLEA 1S36A 5B8IB 1RROA 4R1EA 2BE6A 3BXKA 4HSZA 2LANA 1VRKA 4MVFA 4M2QA 1EL4A 2M3WA 3QRXA 5DKQA 3I5FC 3SIAA 1K9KA 1AP4A 4XYNA 2JPTA 5CSFA 1XFVO 1K90D 2L51A 2NCOA 1B7TY 1G33A 2KFGA 4MRXA 3TUYB 3S0FA 2JQ6A 4OR9B 4WQ3A 1HQVA 5I8NA 1K95A 2ZKMX 2GGMA 1YUUA 1JWDA 1UWOA 1TWOA 3AAJA 3IQOA 2WOSA 1B4CA 2G9BA 1K2HA 2LNKA 4YGEB 4NDDA 5CSJA 4PHJA 5ER4X 2KI4C 4MZLA 1J7OA 3LK1A 1NSHA 2EHBA 1F70A 3VRPA 1PVBA 1B9AA 1BOCA 3CZTX 1WY9A 4GFTA 1WLMA 1QJTA 1CB1A 1M46A 4NDCA 3WHUB 1TTXA 3CLNA 4MBEA 5JOLA 3OGNA 1C7WA 3DVJA 1XK4A 4DCKA 2MLEC 1GJYA 4JPZB 2PRUA 1J7PA 2CNPA 1JF2A 1S6CA 3OX5A 2MBXA 3TDZA 1TNPA 2BL0B 4I5JA 1DT7B 1F71A 4GGNA 1NYAA 3VGOA 3DVEA 3B88A 1BR1B 4N1GA 1TNXA 3L47A 1BG1A 1WRZA 1V1GA 4DS7A 1ORGA 2KBMA 2WC8A 4D1EA 3SIBA 1K94A 2M7NA 1KSOA 1QVIZ 1UHNA 1YR5A 2BCBA 2E6WA 2COLB 1OOHA 2GV5A 3KO0A 1X02A 1CFDA 2OTGC 4MZKA 1KK8B 1OW4A 1K9UA 2M9GA 4QJ3B 2KBIA 5BPJA 2Y1MA 3B7AA 3NHTA 3DVMA 1B7TZ 1PULA 1KK8C 2LM5A 4DIRA 3DVKA 1NUBA 5FI7A 4XJKA 1SR6C 2EC6C 1ZFSA 4IL1A 3SG6A 1IWQA 1DELA 1YX7A 3VRNA 1H8BA 3KEVA 3R1VA 1OMRA 2AUCA 3UNWA 4ORCB 5JJGA 2LUXA 3CR4X 1QV1A 5DICA 1FI5A 1LVCD 2JNXA 1A03A 2QEHA 2L2EA 1PSRA 2JWWA 2JULA 1QXPA 1CM1A 1IJ5A 3D0YA 4I5NB 1CFFA 1BT6A 1QATA 2WCFA 1XFUO 3GK1A 4GNKB 2QDIA 1KQMC 1P28A 2F2PA 2LHIA 2Y4QA 2AMIA 3DF0B 4INWA 4NQGA 4PDZA 1B1GA 1NX3A 1S6JA 3CR2A 5DKNA 2KGRA 3CGAA 1GGZA 1IQ3A 1DF0B 1H4BA 5IBWA 1JFJA 1NX0A 3CR5X 2KYCA 4I5KA 2GGZA 3WHTB 2IS9A 2KYFA 1ZUZA 3WXAA 1OQPA 1AHRA 1K9PA 2H2KA 1F4QA 1K8UA 1FW4A 2KNEA 3BYAA 2JTZA 3GOFA 2I18A 1RECA 1SPYA 1DC1A 4CFQA 3OHMB 3TUYC 4WQ2A 1TN4A 3VROA 5I2LA 4P5OE 1JBAA 5HKWA 4CIDA 4QJ5B 1SNLA 1WRKA 1A75B 3BFAA 2SCPA 3NSLA 3R1PA 3S0EA 2CXJA 5DKRA 5FYXA 3S0GA 1Y1UA 1DGUA 1K93D 3BUMB 4E68A 1MQ1A 1Y1XA 2HETA 2O60A 2LLUA 4MSPA 1A2XA 1SRAA 1NX1A 1YUTA 2KOTA 2SASA 3I5HB 3I5IB 2CTNA 2LUCA 3O6BA 5D3OA 5ER5A 1CFPA 4HREE 5KTYA 3QMEA 5I2OA 2CCMA 1IKUA 1SYMA 1L7ZA 2LVVA 1OZSA 2PVBA 2WCBA 3OB1B 3EVVA 1N0YA 1OSAA 1Y6WA 4MN0A 4MEWA 4AQJA 3DY9A 1B8LA 1C07A 2FCDA 3A8RA 3RZSA 1YUSA 2WNDA 1DMOA 1S5GZ 2H61C 2I2RE 4JWQA 2LP3A 2ISDA 1Y1AA 2H8VA 2F3ZA 2MA2A 2MJWB 3DF0A 3VRRA 2DOQA 1EG3A 2V53A 3BFHA 1DJZA 3I5IC 3I5HC 2EGDA 3JVTC 5KU1A 4ICBA 1LXFC 4INXA 2BCXA 5HL1A 2JPOA 2JTTA 1DVIA 1YVLA 1SMGA 4C0LA 2LE9B 3PN7B 1QS7A 1W7IB 2ZNEA 3CZ0A 2Q4UA 5K89A 4FQOA 3SG2A 3S0BA 5AXIA 3PN7C 1KSMA 4PHNA 1DJIA 3GK4X 3PATA 1XA5A 2HQWA 2KAVA 2GTEA 1QIVA 2LP2A 2WCKA 2JRFA 3ZWHA 1EJ3A 2F2OA 3GK2A 2JT3A 4GBAA 5J3XA 1Z4HA 3A4UB 1SL7A 2FJUB 2Y1NA 4A4BA 1V1FA 1ZACA 3OB2B 4CLNA 1KFXL 1RTP1 1KFUL 2E30A 1A4PA 2ZN9A 1DQEA 4MZJA 1FI6A 3UO9A 3EK4A 1QV0A 2TN4A 1CDPA 1M31A 3ICBA 1NCXA 2NZ0A 1J55A 4PE7A 4XJKB 1W9ZA 3CYZA 3D75A 5PALA 1M39A 4YGBB 4JD9A 1JFKA 1YTZC 3FWCA 3PLFB 2PSRA 3K1EA 2L2CA 3NSIA 3CS1A 1TNQA 1OMDA 1DJYA 3SG3A 1ALWA 1A75A 2BBMA 1M63B 1U5IB 4PCWA 1KK7Z 5D69A 1LINA 2JNFA 1PVAA 2O5GA 1SCMC 1FBVA 3K21A 2L5XB 1NP8A 1MXEA 2KAYA 2CBLA 4MLWA 1K96A 1TCFA 5AANA 1QTXA 4OKHA 3DD4A 3O4XA 2PASA 1FPWA 1WLZA 1SL9A 3FE8A 2ZNDA 3KF9A 4HRHA 1C7VA 4GAOA 5I2QA 2LMTA 1F4OA 4BY4A 1KQVA 1UHJA 5CPVA 3EVRA 1PRWA 1YVHA 2VRGA 1CFCA 5AFPA 4OV2A 4DRWA 1FF1A 1OMVA 1MXLC 1TIZA 4N1FA 1YRTB 1KWOB 5TNCA 2JU0A 1CNPA 1DJGA 1R2UA 1XFYO 3PJIA 1EG4A 2JZIA 4OCIA 1QWVA 3I5GB 2KGBC 3NGVA 5FI2A 4YRUA 1D1OA 1QX2A 1GGWA 4NDBA 1CMFA 1HT9A 2K7DA 2D8NA 3I5GC 3D76A 1NCYA 1C3ZA 1SY9A 3B86A 2LVKA 4PE0A 4YBHB 4USLA 2BL0C 2HQ8A 5EL2A 4F7FA 1JUOA 1TNWA 2HF5A 2WORA 1J7RA 1SKTA 3BJHA 1ALVA 1DGVA 4ORBB 4PT1A 1PK0D 3JTDC 4P2YB 1CLLA 3V2LA 4FTGA 3EKJA 1CDMA 3CDNA 1YX8A 3SS5A 1RJVA 2K7CA 3BUWB 2K7BA 1B47A 2HPSA 2LMVA 4YI8A 1M45A 5HYDA 1KK7Y 1F54A 2BE4A 2BKIB 3NHIA 5GQQC 1BLQA 1NWDA 1BJFA 4YGAA 1ZOTB 1YURA 1S1EA 1ZMZA 1JF0A 3KPXA 5CSIA 1DJWA 1SSEB 2BBNA 2G2BA 2ZRTA 3PSRA 4IJ7A 3BUNB 1BF5A 2M97A 2K0JA 4ZCUA 2MRDA 2F8PA 2LVIA 4PHKA 1UUSA 1XK4C 3OBVA 3D78A 1BU3A 3BFBA 4GGFA 1QASA 1KFXS 5HLVA 4GGFC 3HCMA 3SG7A 1LS8A 1OOFA 1AJ5A 4CPVA 1OE9B 3NSKA 3IF7A 1TOPA 1QX7A 5I94A 4I5LB 2L0PA 1KCYA 5HKYA 1F55A 1QLKA 3LLEA 4U8DA 2PALA 4TNCA 1SK6D 3HX4A 3R1OA 1U5IA 1BODA 1F8HA 5HKZA 3R72A 5AERA 3OP0A 2M0RA 2K61A 3FE6A 1L2OB 1PSBA 1CMGA 1UHKA 2H61A 2I7AA 1W7JB 3Q8IA 1SL8A 2QEVA 4PE4A 1MUXA 2P6BB 1E8AA 5HLOA 4CFRA 2PYQA 3WNXB 3LCPC 1J7QA 1MHOA 2LHLA 4OVNF 4ZCVA 1BMOA 1SBJA 1SR6B 2EC6B 2PMYA 2OS8B 3PFVA 2RGIA 2KI6C 1DF0A 3C1VA 3TZ1A 2KAXA 3O2PA 2KQ6A 2KFHA 1NPQA 3BOWA 3EG5B 1L2OC 2KHNA 1DJHA 3D73A 3O78A 1JC2A 2FCEA 2WC6A 1XFZO 3LK0A 3L4AA 3TDIA 1OOIX 1TUJA 3E3RA 5F6TA 1CKKA 2M49B 4AQIA 4KYNA 2ERBA 4N5XA 4PALA 1J1EA 1XO5A 3FIAA 2WCLA 2ZFDA 3O4YA 5G08A 3OX6A 3LL8B 2M1UA 3EVUA 1UHHA 3DYEA 1LA3A 3BQ3A 2NLNA 2QEBA 1B8RA 2KI4B 5KSZA 3B87A 3KHEA 1SCVA 3JTDB 3BUOB 3IQQA 1KFUS 3MSEB 4Q04A 2KQYA 1TRFA 2LCPA 2L50A 4A4CA 4DUQA 2BCAA 3VRQA 1IQ5A 1MR8A 2BKHB 1J1DA 3EK8A 3SS4A 1SCMB 2F33A 3N7HA 2MLFC 3RM1A 2QEOA 2BAPA 5AEQA 2K7OA 3F45A 1CLMA 2M7LA 4C0JA 1S6IA 3EKHA 1IGVA 2KPHA 3IVTA 1AVSA 3PALA 1XVJA 2M1KB 1TCOB 2WCJA 4MRYA 4HRGA 3H4SE 1TUZA 1RK9A 1WDCB 3B6XA 4L9MA 4YGDB 2ZRSA 1IG5A 1QLSA 3TDUA 1Z2CB 1G8IA 2JC2A 1MWNA 3PM2A 1ODBA 1XFXO 4UPGA 2R2IA 1GQMA 3AKBA 3EK7A 1IJ6A 1N65A 1G4YR 1Q80A 3S0AA 2LAPA 2OPOA 4C0KA 1BR4B 3DZTA 3AAKA 3AKAA 3TS5C 1QIWA 2K8MB 2M8UA 1SW8A 3CTNA 2KI6D 3BOWB 1N2DA 4WRIA 3CABA 3TS5B 1KWOC 3I5FB 1IIOA 1UP5A
chains in the Genus database with same CATH topology
1S5GY 3SG4A 1IRJA 1LKJA 3CWGA 2OTGB 2BECA 2CT9A 1DTLA 1JSAA 1B8CA 4YI9A 2AAOA 4YGCB 3NSOA 1S3PA 1WDCC 1CDLA 1UURA 2LVJA 1CTRA 1OOJA 1CDNA 3NXAA 3RLZA 1R6PA 4QJ4B 2KDHA 4JQ0D 4GUKA 2JXLA 2KFFA 2MAZA 4ETOA 2JT0A 2F3YA 2I94A 3SJSA 1LA0A 1QVIY 2Q91A 2JXCA 3FS7A 4F0ZB 1CB1A 3BUXB 2L4IA 1A29A 2L4HA 2MHHA 1OZOA 1AUIB 1YRUB 2LC5A 2K2AA 2LMUA 3D0YB 3M0WA 2LV7A 1AJ4A 2QACA 2A4JA 2OS8C 1NIWA 4M2OA 3ZNIA 2M29A 2KSPA 2ZN8A 1QX5B 3PM8A 3FWBA 1S26D 5D7FA 5CSNA 4PE1A 2B1UA 1EXRA 2NXQA 1KQMB 1XYDA 1EH2A 2QPTA 2FOTA 2JT8A 1WRLA 1AK8A 1NX2A 1Y0VH 2LLTA 4AOMA 2WCEA 1UHIA 1CM4A 2Y5IA 2L98A 1CLBA 4GPLB 1IH0A 1PALA 2K2FA 1DJXA 4BY5A 2LLSA 3D10A 4ORAB 3SG5A 2JOJA 1MF8B 4PHMA 4M2PA 1XFWO 1RFJA 1RWYA 1NCZA 3JVTB 2NCPA 1S36A 5B8IB 1RROA 4R1EA 2BE6A 3BXKA 4HSZA 2LANA 1VRKA 4MVFA 4M2QA 1EL4A 2M3WA 3QRXA 5DKQA 3I5FC 3SIAA 1K9KA 1AP4A 4XYNA 2JPTA 5CSFA 1XFVO 1K90D 2L51A 2NCOA 1B7TY 1G33A 2KFGA 4MRXA 3TUYB 2JQ6A 4OR9B 4WQ3A 1HQVA 5I8NA 1K95A 2ZKMX 2GGMA 1YUUA 1JWDA 1UWOA 3AAJA 3IQOA 2WOSA 1B4CA 2G9BA 1K2HA 2LNKA 4YGEB 4NDDA 5CSJA 4PHJA 5ER4X 2KI4C 4MZLA 1J7OA 3LK1A 1NSHA 2EHBA 1F70A 3VRPA 1PVBA 1B9AA 1BOCA 3CZTX 1WY9A 4GFTA 1WLMA 1QJTA 1M46A 4NDCA 3WHUB 1TTXA 3CLNA 4MBEA 5JOLA 1C7WA 3DVJA 1XK4A 4DCKA 2MLEC 1GJYA 4JPZB 2PRUA 1J7PA 2CNPA 1JF2A 1S6CA 3OX5A 2MBXA 3TDZA 1TNPA 2BL0B 4I5JA 1DT7B 1F71A 4GGNA 1NYAA 3VGOA 3DVEA 4N1GA 1BR1B 1TNXA 1BG1A 1WRZA 1V1GA 4DS7A 2KBMA 2WC8A 4D1EA 3SIBA 1K94A 2M7NA 1KSOA 1QVIZ 1UHNA 1YR5A 2BCBA 2E6WA 2COLB 2GV5A 3KO0A 1X02A 1CFDA 2OTGC 4MZKA 1KK8B 2M9GA 1K9UA 4QJ3B 2KBIA 5BPJA 2Y1MA 3DVMA 1B7TZ 1PULA 1KK8C 2LM5A 4DIRA 3DVKA 1NUBA 4XJKA 1SR6C 2EC6C 1ZFSA 4IL1A 3SG6A 1IWQA 1YX7A 3VRNA 1H8BA 3KEVA 1OMRA 2AUCA 4ORCB 5JJGA 2LUXA 3CR4X 1QV1A 1FI5A 1LVCD 2JNXA 1A03A 2L2EA 1PSRA 2JWWA 2JULA 1QXPA 1CM1A 1IJ5A 3D0YA 4I5NB 1CFFA 1BT6A 1QATA 2WCFA 1XFUO 3GK1A 4GNKB 1KQMC 2F2PA 2Y4QA 2LHIA 3DF0B 2AMIA 4NQGA 4PDZA 1B1GA 1NX3A 1S6JA 3CR2A 5DKNA 2KGRA 3CGAA 1GGZA 1IQ3A 1DF0B 1H4BA 5IBWA 1JFJA 1NX0A 3CR5X 2KYCA 4I5KA 2GGZA 3WHTB 2IS9A 2KYFA 1ZUZA 3WXAA 1OQPA 1AHRA 1K9PA 2H2KA 1F4QA 1K8UA 1FW4A 2KNEA 3BYAA 2JTZA 3GOFA 2I18A 1RECA 1SPYA 4CFQA 3OHMB 3TUYC 4WQ2A 1TN4A 3VROA 5I2LA 4P5OE 1JBAA 5HKWA 4CIDA 4QJ5B 1SNLA 1WRKA 1A75B 2SCPA 3NSLA 2CXJA 5DKRA 5FYXA 1Y1UA 1DGUA 1K93D 3BUMB 4E68A 1MQ1A 1Y1XA 2HETA 2O60A 2LLUA 4MSPA 1A2XA 1SRAA 1NX1A 1YUTA 2KOTA 2SASA 3I5HB 3I5IB 2CTNA 2LUCA 3O6BA 1CFPA 5ER5A 4HREE 5KTYA 5I2OA 2CCMA 1IKUA 1SYMA 1L7ZA 2LVVA 1OZSA 2PVBA 2WCBA 3OB1B 3EVVA 1N0YA 1OSAA 1Y6WA 4MN0A 4MEWA 4AQJA 1C07A 1B8LA 2FCDA 3A8RA 1YUSA 2WNDA 1DMOA 1S5GZ 2H61C 2I2RE 4JWQA 2LP3A 2ISDA 1Y1AA 2MA2A 2F3ZA 2MJWB 3DF0A 3VRRA 2DOQA 1EG3A 2V53A 3I5IC 1DJZA 3I5HC 2EGDA 3JVTC 5KU1A 4ICBA 1LXFC 2BCXA 2JTTA 1DVIA 1YVLA 1SMGA 4C0LA 2LE9B 3PN7B 1QS7A 1W7IB 2ZNEA 2Q4UA 5K89A 4FQOA 3SG2A 5AXIA 3PN7C 1KSMA 4PHNA 1DJIA 3GK4X 3PATA 1XA5A 2HQWA 2KAVA 3ZWHA 1QIVA 2LP2A 2JRFA 1EJ3A 2F2OA 3GK2A 2JT3A 4GBAA 5J3XA 3A4UB 1SL7A 2FJUB 2Y1NA 4A4BA 1V1FA 1ZACA 3OB2B 4CLNA 1KFXL 1RTP1 1KFUL 2E30A 1A4PA 2ZN9A 4MZJA 1FI6A 3EK4A 1QV0A 2TN4A 1CDPA 1M31A 3ICBA 1NCXA 2NZ0A 1J55A 4PE7A 4XJKB 5PALA 1M39A 4YGBB 1JFKA 1YTZC 3FWCA 3PLFB 2PSRA 3NSIA 3CS1A 1TNQA 1OMDA 1DJYA 3SG3A 1ALWA 1A75A 2BBMA 1M63B 1U5IB 4PCWA 1KK7Z 5D69A 1LINA 2JNFA 1PVAA 2O5GA 1SCMC 1FBVA 3K21A 2L5XB 1NP8A 1MXEA 2KAYA 2CBLA 4MLWA 1K96A 1TCFA 5AANA 1QTXA 4OKHA 3DD4A 1FPWA 2PASA 1WLZA 1SL9A 3KF9A 2ZNDA 4HRHA 1C7VA 4GAOA 5I2QA 2LMTA 1F4OA 4BY4A 1KQVA 1UHJA 5CPVA 3EVRA 1PRWA 1YVHA 2VRGA 1CFCA 5AFPA 4OV2A 4DRWA 1FF1A 1OMVA 1MXLC 1TIZA 4N1FA 1YRTB 1KWOB 5TNCA 2JU0A 1CNPA 1DJGA 1R2UA 1XFYO 1EG4A 2JZIA 4OCIA 3I5GB 2KGBC 1D1OA 1GGWA 4YRUA 1QX2A 4NDBA 1CMFA 1HT9A 2K7DA 2D8NA 3I5GC 1NCYA 1SY9A 4PE0A 2LVKA 4YBHB 4USLA 2BL0C 2HQ8A 1JUOA 1TNWA 2HF5A 2WORA 1J7RA 1SKTA 1ALVA 1DGVA 4ORBB 1PK0D 3JTDC 4P2YB 1CLLA 4FTGA 3EKJA 1CDMA 1YX8A 1RJVA 2K7CA 3BUWB 2K7BA 1B47A 2HPSA 2LMVA 4YI8A 1M45A 5HYDA 1KK7Y 1F54A 2BE4A 2BKIB 1BLQA 5GQQC 1NWDA 1BJFA 4YGAA 1ZOTB 1YURA 1S1EA 1ZMZA 1JF0A 3KPXA 5CSIA 1DJWA 2BBNA 2G2BA 3PSRA 2ZRTA 3BUNB 1BF5A 2M97A 2K0JA 4ZCUA 2MRDA 2F8PA 2LVIA 4PHKA 1UUSA 1XK4C 1BU3A 4GGFA 1QASA 1KFXS 5HLVA 4GGFC 3HCMA 3SG7A 1AJ5A 4CPVA 1OE9B 3NSKA 3IF7A 1TOPA 1QX7A 4I5LB 2L0PA 1KCYA 5HKYA 1F55A 1QLKA 3LLEA 4U8DA 2PALA 4TNCA 1SK6D 3HX4A 1U5IA 1BODA 1F8HA 5HKZA 5AERA 3OP0A 2M0RA 2K61A 1L2OB 1PSBA 1CMGA 1UHKA 2H61A 2I7AA 1W7JB 1SL8A 4PE4A 1MUXA 2P6BB 1E8AA 5HLOA 4CFRA 3WNXB 3LCPC 1J7QA 1MHOA 2LHLA 4OVNF 4ZCVA 1BMOA 1SBJA 1SR6B 2EC6B 2PMYA 2OS8B 3PFVA 2RGIA 2KI6C 1DF0A 3C1VA 3TZ1A 2KAXA 3O2PA 2KQ6A 2KFHA 1NPQA 3BOWA 1L2OC 2KHNA 1DJHA 3O78A 1JC2A 2FCEA 1XFZO 3LK0A 3TDIA 3E3RA 5F6TA 1CKKA 2M49B 4AQIA 4N5XA 4PALA 1J1EA 1XO5A 3FIAA 3O4YA 2ZFDA 5G08A 3OX6A 3LL8B 2M1UA 3EVUA 1UHHA 1LA3A 3BQ3A 2NLNA 1B8RA 2KI4B 5KSZA 3KHEA 1SCVA 3JTDB 3BUOB 3IQQA 1KFUS 3MSEB 4Q04A 2KQYA 1TRFA 2LCPA 2L50A 4A4CA 4DUQA 2BCAA 3VRQA 1IQ5A 1MR8A 2BKHB 1J1DA 3EK8A 1SCMB 2F33A 2MLFC 3RM1A 5AEQA 2K7OA 3F45A 1CLMA 2M7LA 4C0JA 1S6IA 3EKHA 1IGVA 1AVSA 3PALA 1XVJA 2M1KB 1TCOB 4MRYA 4HRGA 3H4SE 1RK9A 1WDCB 4L9MA 4YGDB 2ZRSA 1IG5A 1QLSA 3TDUA 1G8IA 2JC2A 1MWNA 1ODBA 1XFXO 4UPGA 2R2IA 1GQMA 3AKBA 3EK7A 1IJ6A 1N65A 1G4YR 1Q80A 2LAPA 2OPOA 4C0KA 1BR4B 3AAKA 3AKAA 3TS5C 1QIWA 2K8MB 2M8UA 1SW8A 3CTNA 2KI6D 3BOWB 1N2DA 4WRIA 3TS5B 1KWOC 3I5FB 1UP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5G Y;  3SG4 A;  1IRJ A;  1LKJ A;  3CWG A;  2OTG B;  2BEC A;  2CT9 A;  1DTL A;  1JSA A;  1B8C A;  4YI9 A;  2AAO A;  4YGC B;  3NSO A;  1S3P A;  1WDC C;  1CDL A;  1UUR A;  2LVJ A;  1CTR A;  1OOJ A;  1CDN A;  3NXA A;  3RLZ A;  1R6P A;  4QJ4 B;  2KDH A;  4JQ0 D;  4GUK A;  2JXL A;  2KFF A;  2MAZ A;  4ETO A;  2JT0 A;  2F3Y A;  2I94 A;  3SJS A;  1LA0 A;  1QVI Y;  2Q91 A;  2JXC A;  3FS7 A;  4F0Z B;  1CB1 A;  3BUX B;  2L4I A;  1A29 A;  2L4H A;  2MHH A;  1OZO A;  1AUI B;  1YRU B;  2LC5 A;  2K2A A;  2LMU A;  3D0Y B;  3M0W A;  2LV7 A;  1AJ4 A;  2QAC A;  2A4J A;  2OS8 C;  1NIW A;  4M2O A;  3ZNI A;  2M29 A;  2KSP A;  2ZN8 A;  1QX5 B;  3PM8 A;  3FWB A;  1S26 D;  5D7F A;  5CSN A;  4PE1 A;  2B1U A;  1EXR A;  2NXQ A;  1KQM B;  1XYD A;  1EH2 A;  2QPT A;  2FOT A;  2JT8 A;  1WRL A;  1AK8 A;  1NX2 A;  1Y0V H;  2LLT A;  4AOM A;  2WCE A;  1UHI A;  1CM4 A;  2Y5I A;  2L98 A;  1CLB A;  4GPL B;  1IH0 A;  1PAL A;  2K2F A;  1DJX A;  4BY5 A;  2LLS A;  3D10 A;  4ORA B;  3SG5 A;  2JOJ A;  1MF8 B;  4PHM A;  4M2P A;  1XFW O;  1RFJ A;  1RWY A;  1NCZ A;  3JVT B;  2NCP A;  1S36 A;  5B8I B;  1RRO A;  4R1E A;  2BE6 A;  3BXK A;  4HSZ A;  2LAN A;  1VRK A;  4MVF A;  4M2Q A;  1EL4 A;  2M3W A;  3QRX A;  5DKQ A;  3I5F C;  3SIA A;  1K9K A;  1AP4 A;  4XYN A;  2JPT A;  5CSF A;  1XFV O;  1K90 D;  2L51 A;  2NCO A;  1B7T Y;  1G33 A;  2KFG A;  4MRX A;  3TUY B;  2JQ6 A;  4OR9 B;  4WQ3 A;  1HQV A;  5I8N A;  1K95 A;  2ZKM X;  2GGM A;  1YUU A;  1JWD A;  1UWO A;  3AAJ A;  3IQO A;  2WOS A;  1B4C A;  2G9B A;  1K2H A;  2LNK A;  4YGE B;  4NDD A;  5CSJ A;  4PHJ A;  5ER4 X;  2KI4 C;  4MZL A;  1J7O A;  3LK1 A;  1NSH A;  2EHB A;  1F70 A;  3VRP A;  1PVB A;  1B9A A;  1BOC A;  3CZT X;  1WY9 A;  4GFT A;  1WLM A;  1QJT A;  1M46 A;  4NDC A;  3WHU B;  1TTX A;  3CLN A;  4MBE A;  5JOL A;  1C7W A;  3DVJ A;  1XK4 A;  4DCK A;  2MLE C;  1GJY A;  4JPZ B;  2PRU A;  1J7P A;  2CNP A;  1JF2 A;  1S6C A;  3OX5 A;  2MBX A;  3TDZ A;  1TNP A;  2BL0 B;  4I5J A;  1DT7 B;  1F71 A;  4GGN A;  1NYA A;  3VGO A;  3DVE A;  4N1G A;  1BR1 B;  1TNX A;  1BG1 A;  1WRZ A;  1V1G A;  4DS7 A;  2KBM A;  2WC8 A;  4D1E A;  3SIB A;  1K94 A;  2M7N A;  1KSO A;  1QVI Z;  1UHN A;  1YR5 A;  2BCB A;  2E6W A;  2COL B;  2GV5 A;  3KO0 A;  1X02 A;  1CFD A;  2OTG C;  4MZK A;  1KK8 B;  2M9G A;  1K9U A;  4QJ3 B;  2KBI A;  5BPJ A;  2Y1M A;  3DVM A;  1B7T Z;  1PUL A;  1KK8 C;  2LM5 A;  4DIR A;  3DVK A;  1NUB A;  4XJK A;  1SR6 C;  2EC6 C;  1ZFS A;  4IL1 A;  3SG6 A;  1IWQ A;  1YX7 A;  3VRN A;  1H8B A;  3KEV A;  1OMR A;  2AUC A;  4ORC B;  5JJG A;  2LUX A;  3CR4 X;  1QV1 A;  1FI5 A;  1LVC D;  2JNX A;  1A03 A;  2L2E A;  1PSR A;  2JWW A;  2JUL A;  1QXP A;  1CM1 A;  1IJ5 A;  3D0Y A;  4I5N B;  1CFF A;  1BT6 A;  1QAT A;  2WCF A;  1XFU O;  3GK1 A;  4GNK B;  1KQM C;  2F2P A;  2Y4Q A;  2LHI A;  3DF0 B;  2AMI A;  4NQG A;  4PDZ A;  1B1G A;  1NX3 A;  1S6J A;  3CR2 A;  5DKN A;  2KGR A;  3CGA A;  1GGZ A;  1IQ3 A;  1DF0 B;  1H4B A;  5IBW A;  1JFJ A;  1NX0 A;  3CR5 X;  2KYC A;  4I5K A;  2GGZ A;  3WHT B;  2IS9 A;  2KYF A;  1ZUZ A;  3WXA A;  1OQP A;  1AHR A;  1K9P A;  2H2K A;  1F4Q A;  1K8U A;  1FW4 A;  2KNE A;  3BYA A;  2JTZ A;  3GOF A;  2I18 A;  1REC A;  1SPY A;  4CFQ A;  3OHM B;  3TUY C;  4WQ2 A;  1TN4 A;  3VRO A;  5I2L A;  4P5O E;  1JBA A;  5HKW A;  4CID A;  4QJ5 B;  1SNL A;  1WRK A;  1A75 B;  2SCP A;  3NSL A;  2CXJ A;  5DKR A;  5FYX A;  1Y1U A;  1DGU A;  1K93 D;  3BUM B;  4E68 A;  1MQ1 A;  1Y1X A;  2HET A;  2O60 A;  2LLU A;  4MSP A;  1A2X A;  1SRA A;  1NX1 A;  1YUT A;  2KOT A;  2SAS A;  3I5H B;  3I5I B;  2CTN A;  2LUC A;  3O6B A;  1CFP A;  5ER5 A;  4HRE E;  5KTY A;  5I2O A;  2CCM A;  1IKU A;  1SYM A;  1L7Z A;  2LVV A;  1OZS A;  2PVB A;  2WCB A;  3OB1 B;  3EVV A;  1N0Y A;  1OSA A;  1Y6W A;  4MN0 A;  4MEW A;  4AQJ A;  1C07 A;  1B8L A;  2FCD A;  3A8R A;  1YUS A;  2WND A;  1DMO A;  1S5G Z;  2H61 C;  2I2R E;  4JWQ A;  2LP3 A;  2ISD A;  1Y1A A;  2MA2 A;  2F3Z A;  2MJW B;  3DF0 A;  3VRR A;  2DOQ A;  1EG3 A;  2V53 A;  3I5I C;  1DJZ A;  3I5H C;  2EGD A;  3JVT C;  5KU1 A;  4ICB A;  1LXF C;  2BCX A;  2JTT A;  1DVI A;  1YVL A;  1SMG A;  4C0L A;  2LE9 B;  3PN7 B;  1QS7 A;  1W7I B;  2ZNE A;  2Q4U A;  5K89 A;  4FQO A;  3SG2 A;  5AXI A;  3PN7 C;  1KSM A;  4PHN A;  1DJI A;  3GK4 X;  3PAT A;  1XA5 A;  2HQW A;  2KAV A;  3ZWH A;  1QIV A;  2LP2 A;  2JRF A;  1EJ3 A;  2F2O A;  3GK2 A;  2JT3 A;  4GBA A;  5J3X A;  3A4U B;  1SL7 A;  2FJU B;  2Y1N A;  4A4B A;  1V1F A;  1ZAC A;  3OB2 B;  4CLN A;  1KFX L;  1RTP 1;  1KFU L;  2E30 A;  1A4P A;  2ZN9 A;  4MZJ A;  1FI6 A;  3EK4 A;  1QV0 A;  2TN4 A;  1CDP A;  1M31 A;  3ICB A;  1NCX A;  2NZ0 A;  1J55 A;  4PE7 A;  4XJK B;  5PAL A;  1M39 A;  4YGB B;  1JFK A;  1YTZ C;  3FWC A;  3PLF B;  2PSR A;  3NSI A;  3CS1 A;  1TNQ A;  1OMD A;  1DJY A;  3SG3 A;  1ALW A;  1A75 A;  2BBM A;  1M63 B;  1U5I B;  4PCW A;  1KK7 Z;  5D69 A;  1LIN A;  2JNF A;  1PVA A;  2O5G A;  1SCM C;  1FBV A;  3K21 A;  2L5X B;  1NP8 A;  1MXE A;  2KAY A;  2CBL A;  4MLW A;  1K96 A;  1TCF A;  5AAN A;  1QTX A;  4OKH A;  3DD4 A;  1FPW A;  2PAS A;  1WLZ A;  1SL9 A;  3KF9 A;  2ZND A;  4HRH A;  1C7V A;  4GAO A;  5I2Q A;  2LMT A;  1F4O A;  4BY4 A;  1KQV A;  1UHJ A;  5CPV A;  3EVR A;  1PRW A;  1YVH A;  2VRG A;  1CFC A;  5AFP A;  4OV2 A;  4DRW A;  1FF1 A;  1OMV A;  1MXL C;  1TIZ A;  4N1F A;  1YRT B;  1KWO B;  5TNC A;  2JU0 A;  1CNP A;  1DJG A;  1R2U A;  1XFY O;  1EG4 A;  2JZI A;  4OCI A;  3I5G B;  2KGB C;  1D1O A;  1GGW A;  4YRU A;  1QX2 A;  4NDB A;  1CMF A;  1HT9 A;  2K7D A;  2D8N A;  3I5G C;  1NCY A;  1SY9 A;  4PE0 A;  2LVK A;  4YBH B;  4USL A;  2BL0 C;  2HQ8 A;  1JUO A;  1TNW A;  2HF5 A;  2WOR A;  1J7R A;  1SKT A;  1ALV A;  1DGV A;  4ORB B;  1PK0 D;  3JTD C;  4P2Y B;  1CLL A;  4FTG A;  3EKJ A;  1CDM A;  1YX8 A;  1RJV A;  2K7C A;  3BUW B;  2K7B A;  1B47 A;  2HPS A;  2LMV A;  4YI8 A;  1M45 A;  5HYD A;  1KK7 Y;  1F54 A;  2BE4 A;  2BKI B;  1BLQ A;  5GQQ C;  1NWD A;  1BJF A;  4YGA A;  1ZOT B;  1YUR A;  1S1E A;  1ZMZ A;  1JF0 A;  3KPX A;  5CSI A;  1DJW A;  2BBN A;  2G2B A;  3PSR A;  2ZRT A;  3BUN B;  1BF5 A;  2M97 A;  2K0J A;  4ZCU A;  2MRD A;  2F8P A;  2LVI A;  4PHK A;  1UUS A;  1XK4 C;  1BU3 A;  4GGF A;  1QAS A;  1KFX S;  5HLV A;  4GGF C;  3HCM A;  3SG7 A;  1AJ5 A;  4CPV A;  1OE9 B;  3NSK A;  3IF7 A;  1TOP A;  1QX7 A;  4I5L B;  2L0P A;  1KCY A;  5HKY A;  1F55 A;  1QLK A;  3LLE A;  4U8D A;  2PAL A;  4TNC A;  1SK6 D;  3HX4 A;  1U5I A;  1BOD A;  1F8H A;  5HKZ A;  5AER A;  3OP0 A;  2M0R A;  2K61 A;  1L2O B;  1PSB A;  1CMG A;  1UHK A;  2H61 A;  2I7A A;  1W7J B;  1SL8 A;  4PE4 A;  1MUX A;  2P6B B;  1E8A A;  5HLO A;  4CFR A;  3WNX B;  3LCP C;  1J7Q A;  1MHO A;  2LHL A;  4OVN F;  4ZCV A;  1BMO A;  1SBJ A;  1SR6 B;  2EC6 B;  2PMY A;  2OS8 B;  3PFV A;  2RGI A;  2KI6 C;  1DF0 A;  3C1V A;  3TZ1 A;  2KAX A;  3O2P A;  2KQ6 A;  2KFH A;  1NPQ A;  3BOW A;  1L2O C;  2KHN A;  1DJH A;  3O78 A;  1JC2 A;  2FCE A;  1XFZ O;  3LK0 A;  3TDI A;  3E3R A;  5F6T A;  1CKK A;  2M49 B;  4AQI A;  4N5X A;  4PAL A;  1J1E A;  1XO5 A;  3FIA A;  3O4Y A;  2ZFD A;  5G08 A;  3OX6 A;  3LL8 B;  2M1U A;  3EVU A;  1UHH A;  1LA3 A;  3BQ3 A;  2NLN A;  1B8R A;  2KI4 B;  5KSZ A;  3KHE A;  1SCV A;  3JTD B;  3BUO B;  3IQQ A;  1KFU S;  3MSE B;  4Q04 A;  2KQY A;  1TRF A;  2LCP A;  2L50 A;  4A4C A;  4DUQ A;  2BCA A;  3VRQ A;  1IQ5 A;  1MR8 A;  2BKH B;  1J1D A;  3EK8 A;  1SCM B;  2F33 A;  2MLF C;  3RM1 A;  5AEQ A;  2K7O A;  3F45 A;  1CLM A;  2M7L A;  4C0J A;  1S6I A;  3EKH A;  1IGV A;  1AVS A;  3PAL A;  1XVJ A;  2M1K B;  1TCO B;  4MRY A;  4HRG A;  3H4S E;  1RK9 A;  1WDC B;  4L9M A;  4YGD B;  2ZRS A;  1IG5 A;  1QLS A;  3TDU A;  1G8I A;  2JC2 A;  1MWN A;  1ODB A;  1XFX O;  4UPG A;  2R2I A;  1GQM A;  3AKB A;  3EK7 A;  1IJ6 A;  1N65 A;  1G4Y R;  1Q80 A;  2LAP A;  2OPO A;  4C0K A;  1BR4 B;  3AAK A;  3AKA A;  3TS5 C;  1QIW A;  2K8M B;  2M8U A;  1SW8 A;  3CTN A;  2KI6 D;  3BOW B;  1N2D A;  4WRI A;  3TS5 B;  1KWO C;  3I5F B;  1UP5 A; 
#chains in the Genus database with same CATH topology
 1S5G Y;  3SG4 A;  1IRJ A;  1LKJ A;  3CWG A;  2OTG B;  3VB1 A;  2BEC A;  2CT9 A;  1DTL A;  1JSA A;  1B8C A;  2WC5 A;  4YI9 A;  1OOG A;  2AAO A;  4YGC B;  3NSO A;  1S3P A;  1WDC C;  1CDL A;  2P70 A;  2K60 A;  1UUR A;  2WCH A;  2LVJ A;  1CTR A;  1OOJ A;  1CDN A;  3NXA A;  3RLZ A;  1R6P A;  4QJ4 B;  4OZD A;  3CZ1 A;  2KLD A;  2KDH A;  2FJY A;  4JQ0 D;  4GUK A;  2JXL A;  2KFF A;  2MAZ A;  3FE9 A;  2JT0 A;  2F3Y A;  2I94 A;  4ETO A;  3SJS A;  1GM0 A;  1LA0 A;  1QVI Y;  2Q91 A;  2JXC A;  3FS7 A;  4JKT A;  4F0Z B;  1DEK A;  3BUX B;  3CZ2 A;  2YGU A;  2L4I A;  1A29 A;  2L4H A;  2MHH A;  2WCM A;  3D77 A;  1OZO A;  1AUI B;  1YRU B;  2LC5 A;  2K2A A;  2LMU A;  3D0Y B;  3M0W A;  2LV7 A;  1AJ4 A;  2QAC A;  2A4J A;  2OS8 C;  1NIW A;  4M2O A;  3ZNI A;  2M29 A;  2KSP A;  2ZN8 A;  1QX5 B;  3PM8 A;  3FWB A;  1S26 D;  5D7F A;  5CSN A;  3D74 A;  4PE1 A;  2B1U A;  1EXR A;  2NXQ A;  1KQM B;  1XFR A;  1XYD A;  1EH2 A;  2QPT A;  2FOT A;  2JT8 A;  1C3Y A;  1WRL A;  1AK8 A;  1NX2 A;  1Y0V H;  2LLT A;  4AOM A;  2PQL A;  2WCE A;  1UHI A;  1CM4 A;  2Y5I A;  2L98 A;  3S0D A;  1CLB A;  4GPL B;  1IH0 A;  1PAL A;  2K2F A;  1T14 A;  1DJX A;  3L4L A;  4BY5 A;  2LLS A;  3SS3 A;  2BNX A;  4FQT A;  3D10 A;  4ORA B;  3SG5 A;  3DXL A;  2P71 A;  2L5Y A;  2JOJ A;  1MF8 B;  4PHM A;  4M2P A;  1XFW O;  1RFJ A;  1RWY A;  1NCZ A;  5FI6 A;  3JVT B;  2NCP A;  2KLE A;  1S36 A;  5B8I B;  1RRO A;  4R1E A;  2BE6 A;  3BXK A;  4HSZ A;  2LAN A;  1VRK A;  4MVF A;  4M2Q A;  1EL4 A;  2M3W A;  3QRX A;  5DKQ A;  3I5F C;  3SIA A;  1K9K A;  1AP4 A;  4XYN A;  2JPT A;  5CSF A;  1XFV O;  1K90 D;  2L51 A;  2NCO A;  1B7T Y;  1G33 A;  2KFG A;  4MRX A;  3TUY B;  3S0F A;  2JQ6 A;  4OR9 B;  4WQ3 A;  1HQV A;  5I8N A;  1K95 A;  2ZKM X;  2GGM A;  1YUU A;  1JWD A;  1UWO A;  1TWO A;  3AAJ A;  3IQO A;  2WOS A;  1B4C A;  2G9B A;  1K2H A;  2LNK A;  4YGE B;  4NDD A;  5CSJ A;  4PHJ A;  5ER4 X;  2KI4 C;  4MZL A;  1J7O A;  3LK1 A;  1NSH A;  2EHB A;  1F70 A;  3VRP A;  1PVB A;  1B9A A;  1BOC A;  3CZT X;  1WY9 A;  4GFT A;  1WLM A;  1QJT A;  1CB1 A;  1M46 A;  4NDC A;  3WHU B;  1TTX A;  3CLN A;  4MBE A;  5JOL A;  3OGN A;  1C7W A;  3DVJ A;  1XK4 A;  4DCK A;  2MLE C;  1GJY A;  4JPZ B;  2PRU A;  1J7P A;  2CNP A;  1JF2 A;  1S6C A;  3OX5 A;  2MBX A;  3TDZ A;  1TNP A;  2BL0 B;  4I5J A;  1DT7 B;  1F71 A;  4GGN A;  1NYA A;  3VGO A;  3DVE A;  3B88 A;  1BR1 B;  4N1G A;  1TNX A;  3L47 A;  1BG1 A;  1WRZ A;  1V1G A;  4DS7 A;  1ORG A;  2KBM A;  2WC8 A;  4D1E A;  3SIB A;  1K94 A;  2M7N A;  1KSO A;  1QVI Z;  1UHN A;  1YR5 A;  2BCB A;  2E6W A;  2COL B;  1OOH A;  2GV5 A;  3KO0 A;  1X02 A;  1CFD A;  2OTG C;  4MZK A;  1KK8 B;  1OW4 A;  1K9U A;  2M9G A;  4QJ3 B;  2KBI A;  5BPJ A;  2Y1M A;  3B7A A;  3NHT A;  3DVM A;  1B7T Z;  1PUL A;  1KK8 C;  2LM5 A;  4DIR A;  3DVK A;  1NUB A;  5FI7 A;  4XJK A;  1SR6 C;  2EC6 C;  1ZFS A;  4IL1 A;  3SG6 A;  1IWQ A;  1DEL A;  1YX7 A;  3VRN A;  1H8B A;  3KEV A;  3R1V A;  1OMR A;  2AUC A;  3UNW A;  4ORC B;  5JJG A;  2LUX A;  3CR4 X;  1QV1 A;  5DIC A;  1FI5 A;  1LVC D;  2JNX A;  1A03 A;  2QEH A;  2L2E A;  1PSR A;  2JWW A;  2JUL A;  1QXP A;  1CM1 A;  1IJ5 A;  3D0Y A;  4I5N B;  1CFF A;  1BT6 A;  1QAT A;  2WCF A;  1XFU O;  3GK1 A;  4GNK B;  2QDI A;  1KQM C;  1P28 A;  2F2P A;  2LHI A;  2Y4Q A;  2AMI A;  3DF0 B;  4INW A;  4NQG A;  4PDZ A;  1B1G A;  1NX3 A;  1S6J A;  3CR2 A;  5DKN A;  2KGR A;  3CGA A;  1GGZ A;  1IQ3 A;  1DF0 B;  1H4B A;  5IBW A;  1JFJ A;  1NX0 A;  3CR5 X;  2KYC A;  4I5K A;  2GGZ A;  3WHT B;  2IS9 A;  2KYF A;  1ZUZ A;  3WXA A;  1OQP A;  1AHR A;  1K9P A;  2H2K A;  1F4Q A;  1K8U A;  1FW4 A;  2KNE A;  3BYA A;  2JTZ A;  3GOF A;  2I18 A;  1REC A;  1SPY A;  1DC1 A;  4CFQ A;  3OHM B;  3TUY C;  4WQ2 A;  1TN4 A;  3VRO A;  5I2L A;  4P5O E;  1JBA A;  5HKW A;  4CID A;  4QJ5 B;  1SNL A;  1WRK A;  1A75 B;  3BFA A;  2SCP A;  3NSL A;  3R1P A;  3S0E A;  2CXJ A;  5DKR A;  5FYX A;  3S0G A;  1Y1U A;  1DGU A;  1K93 D;  3BUM B;  4E68 A;  1MQ1 A;  1Y1X A;  2HET A;  2O60 A;  2LLU A;  4MSP A;  1A2X A;  1SRA A;  1NX1 A;  1YUT A;  2KOT A;  2SAS A;  3I5H B;  3I5I B;  2CTN A;  2LUC A;  3O6B A;  5D3O A;  5ER5 A;  1CFP A;  4HRE E;  5KTY A;  3QME A;  5I2O A;  2CCM A;  1IKU A;  1SYM A;  1L7Z A;  2LVV A;  1OZS A;  2PVB A;  2WCB A;  3OB1 B;  3EVV A;  1N0Y A;  1OSA A;  1Y6W A;  4MN0 A;  4MEW A;  4AQJ A;  3DY9 A;  1B8L A;  1C07 A;  2FCD A;  3A8R A;  3RZS A;  1YUS A;  2WND A;  1DMO A;  1S5G Z;  2H61 C;  2I2R E;  4JWQ A;  2LP3 A;  2ISD A;  1Y1A A;  2H8V A;  2F3Z A;  2MA2 A;  2MJW B;  3DF0 A;  3VRR A;  2DOQ A;  1EG3 A;  2V53 A;  3BFH A;  1DJZ A;  3I5I C;  3I5H C;  2EGD A;  3JVT C;  5KU1 A;  4ICB A;  1LXF C;  4INX A;  2BCX A;  5HL1 A;  2JPO A;  2JTT A;  1DVI A;  1YVL A;  1SMG A;  4C0L A;  2LE9 B;  3PN7 B;  1QS7 A;  1W7I B;  2ZNE A;  3CZ0 A;  2Q4U A;  5K89 A;  4FQO A;  3SG2 A;  3S0B A;  5AXI A;  3PN7 C;  1KSM A;  4PHN A;  1DJI A;  3GK4 X;  3PAT A;  1XA5 A;  2HQW A;  2KAV A;  2GTE A;  1QIV A;  2LP2 A;  2WCK A;  2JRF A;  3ZWH A;  1EJ3 A;  2F2O A;  3GK2 A;  2JT3 A;  4GBA A;  5J3X A;  1Z4H A;  3A4U B;  1SL7 A;  2FJU B;  2Y1N A;  4A4B A;  1V1F A;  1ZAC A;  3OB2 B;  4CLN A;  1KFX L;  1RTP 1;  1KFU L;  2E30 A;  1A4P A;  2ZN9 A;  1DQE A;  4MZJ A;  1FI6 A;  3UO9 A;  3EK4 A;  1QV0 A;  2TN4 A;  1CDP A;  1M31 A;  3ICB A;  1NCX A;  2NZ0 A;  1J55 A;  4PE7 A;  4XJK B;  1W9Z A;  3CYZ A;  3D75 A;  5PAL A;  1M39 A;  4YGB B;  4JD9 A;  1JFK A;  1YTZ C;  3FWC A;  3PLF B;  2PSR A;  3K1E A;  2L2C A;  3NSI A;  3CS1 A;  1TNQ A;  1OMD A;  1DJY A;  3SG3 A;  1ALW A;  1A75 A;  2BBM A;  1M63 B;  1U5I B;  4PCW A;  1KK7 Z;  5D69 A;  1LIN A;  2JNF A;  1PVA A;  2O5G A;  1SCM C;  1FBV A;  3K21 A;  2L5X B;  1NP8 A;  1MXE A;  2KAY A;  2CBL A;  4MLW A;  1K96 A;  1TCF A;  5AAN A;  1QTX A;  4OKH A;  3DD4 A;  3O4X A;  2PAS A;  1FPW A;  1WLZ A;  1SL9 A;  3FE8 A;  2ZND A;  3KF9 A;  4HRH A;  1C7V A;  4GAO A;  5I2Q A;  2LMT A;  1F4O A;  4BY4 A;  1KQV A;  1UHJ A;  5CPV A;  3EVR A;  1PRW A;  1YVH A;  2VRG A;  1CFC A;  5AFP A;  4OV2 A;  4DRW A;  1FF1 A;  1OMV A;  1MXL C;  1TIZ A;  4N1F A;  1YRT B;  1KWO B;  5TNC A;  2JU0 A;  1CNP A;  1DJG A;  1R2U A;  1XFY O;  3PJI A;  1EG4 A;  2JZI A;  4OCI A;  1QWV A;  3I5G B;  2KGB C;  3NGV A;  5FI2 A;  4YRU A;  1D1O A;  1QX2 A;  1GGW A;  4NDB A;  1CMF A;  1HT9 A;  2K7D A;  2D8N A;  3I5G C;  3D76 A;  1NCY A;  1C3Z A;  1SY9 A;  3B86 A;  2LVK A;  4PE0 A;  4YBH B;  4USL A;  2BL0 C;  2HQ8 A;  5EL2 A;  4F7F A;  1JUO A;  1TNW A;  2HF5 A;  2WOR A;  1J7R A;  1SKT A;  3BJH A;  1ALV A;  1DGV A;  4ORB B;  4PT1 A;  1PK0 D;  3JTD C;  4P2Y B;  1CLL A;  3V2L A;  4FTG A;  3EKJ A;  1CDM A;  3CDN A;  1YX8 A;  3SS5 A;  1RJV A;  2K7C A;  3BUW B;  2K7B A;  1B47 A;  2HPS A;  2LMV A;  4YI8 A;  1M45 A;  5HYD A;  1KK7 Y;  1F54 A;  2BE4 A;  2BKI B;  3NHI A;  5GQQ C;  1BLQ A;  1NWD A;  1BJF A;  4YGA A;  1ZOT B;  1YUR A;  1S1E A;  1ZMZ A;  1JF0 A;  3KPX A;  5CSI A;  1DJW A;  1SSE B;  2BBN A;  2G2B A;  2ZRT A;  3PSR A;  4IJ7 A;  3BUN B;  1BF5 A;  2M97 A;  2K0J A;  4ZCU A;  2MRD A;  2F8P A;  2LVI A;  4PHK A;  1UUS A;  1XK4 C;  3OBV A;  3D78 A;  1BU3 A;  3BFB A;  4GGF A;  1QAS A;  1KFX S;  5HLV A;  4GGF C;  3HCM A;  3SG7 A;  1LS8 A;  1OOF A;  1AJ5 A;  4CPV A;  1OE9 B;  3NSK A;  3IF7 A;  1TOP A;  1QX7 A;  5I94 A;  4I5L B;  2L0P A;  1KCY A;  5HKY A;  1F55 A;  1QLK A;  3LLE A;  4U8D A;  2PAL A;  4TNC A;  1SK6 D;  3HX4 A;  3R1O A;  1U5I A;  1BOD A;  1F8H A;  5HKZ A;  3R72 A;  5AER A;  3OP0 A;  2M0R A;  2K61 A;  3FE6 A;  1L2O B;  1PSB A;  1CMG A;  1UHK A;  2H61 A;  2I7A A;  1W7J B;  3Q8I A;  1SL8 A;  2QEV A;  4PE4 A;  1MUX A;  2P6B B;  1E8A A;  5HLO A;  4CFR A;  2PYQ A;  3WNX B;  3LCP C;  1J7Q A;  1MHO A;  2LHL A;  4OVN F;  4ZCV A;  1BMO A;  1SBJ A;  1SR6 B;  2EC6 B;  2PMY A;  2OS8 B;  3PFV A;  2RGI A;  2KI6 C;  1DF0 A;  3C1V A;  3TZ1 A;  2KAX A;  3O2P A;  2KQ6 A;  2KFH A;  1NPQ A;  3BOW A;  3EG5 B;  1L2O C;  2KHN A;  1DJH A;  3D73 A;  3O78 A;  1JC2 A;  2FCE A;  2WC6 A;  1XFZ O;  3LK0 A;  3L4A A;  3TDI A;  1OOI X;  1TUJ A;  3E3R A;  5F6T A;  1CKK A;  2M49 B;  4AQI A;  4KYN A;  2ERB A;  4N5X A;  4PAL A;  1J1E A;  1XO5 A;  3FIA A;  2WCL A;  2ZFD A;  3O4Y A;  5G08 A;  3OX6 A;  3LL8 B;  2M1U A;  3EVU A;  1UHH A;  3DYE A;  1LA3 A;  3BQ3 A;  2NLN A;  2QEB A;  1B8R A;  2KI4 B;  5KSZ A;  3B87 A;  3KHE A;  1SCV A;  3JTD B;  3BUO B;  3IQQ A;  1KFU S;  3MSE B;  4Q04 A;  2KQY A;  1TRF A;  2LCP A;  2L50 A;  4A4C A;  4DUQ A;  2BCA A;  3VRQ A;  1IQ5 A;  1MR8 A;  2BKH B;  1J1D A;  3EK8 A;  3SS4 A;  1SCM B;  2F33 A;  3N7H A;  2MLF C;  3RM1 A;  2QEO A;  2BAP A;  5AEQ A;  2K7O A;  3F45 A;  1CLM A;  2M7L A;  4C0J A;  1S6I A;  3EKH A;  1IGV A;  2KPH A;  3IVT A;  1AVS A;  3PAL A;  1XVJ A;  2M1K B;  1TCO B;  2WCJ A;  4MRY A;  4HRG A;  3H4S E;  1TUZ A;  1RK9 A;  1WDC B;  3B6X A;  4L9M A;  4YGD B;  2ZRS A;  1IG5 A;  1QLS A;  3TDU A;  1Z2C B;  1G8I A;  2JC2 A;  1MWN A;  3PM2 A;  1ODB A;  1XFX O;  4UPG A;  2R2I A;  1GQM A;  3AKB A;  3EK7 A;  1IJ6 A;  1N65 A;  1G4Y R;  1Q80 A;  3S0A A;  2LAP A;  2OPO A;  4C0K A;  1BR4 B;  3DZT A;  3AAK A;  3AKA A;  3TS5 C;  1QIW A;  2K8M B;  2M8U A;  1SW8 A;  3CTN A;  2KI6 D;  3BOW B;  1N2D A;  4WRI A;  3CAB A;  3TS5 B;  1KWO C;  3I5F B;  1IIO A;  1UP5 A; 
#chains in the Genus database with same CATH homology
 1S5G Y;  3SG4 A;  1IRJ A;  1LKJ A;  3CWG A;  2OTG B;  2BEC A;  2CT9 A;  1DTL A;  1JSA A;  1B8C A;  4YI9 A;  2AAO A;  4YGC B;  3NSO A;  1S3P A;  1WDC C;  1CDL A;  1UUR A;  2LVJ A;  1CTR A;  1OOJ A;  1CDN A;  3NXA A;  3RLZ A;  1R6P A;  4QJ4 B;  2KDH A;  4JQ0 D;  4GUK A;  2JXL A;  2KFF A;  2MAZ A;  4ETO A;  2JT0 A;  2F3Y A;  2I94 A;  3SJS A;  1LA0 A;  1QVI Y;  2Q91 A;  2JXC A;  3FS7 A;  4F0Z B;  1CB1 A;  3BUX B;  2L4I A;  1A29 A;  2L4H A;  2MHH A;  1OZO A;  1AUI B;  1YRU B;  2LC5 A;  2K2A A;  2LMU A;  3D0Y B;  3M0W A;  2LV7 A;  1AJ4 A;  2QAC A;  2A4J A;  2OS8 C;  1NIW A;  4M2O A;  3ZNI A;  2M29 A;  2KSP A;  2ZN8 A;  1QX5 B;  3PM8 A;  3FWB A;  1S26 D;  5D7F A;  5CSN A;  4PE1 A;  2B1U A;  1EXR A;  2NXQ A;  1KQM B;  1XYD A;  1EH2 A;  2QPT A;  2FOT A;  2JT8 A;  1WRL A;  1AK8 A;  1NX2 A;  1Y0V H;  2LLT A;  4AOM A;  2WCE A;  1UHI A;  1CM4 A;  2Y5I A;  2L98 A;  1CLB A;  4GPL B;  1IH0 A;  1PAL A;  2K2F A;  1DJX A;  4BY5 A;  2LLS A;  3D10 A;  4ORA B;  3SG5 A;  2JOJ A;  1MF8 B;  4PHM A;  4M2P A;  1XFW O;  1RFJ A;  1RWY A;  1NCZ A;  3JVT B;  2NCP A;  1S36 A;  5B8I B;  1RRO A;  4R1E A;  2BE6 A;  3BXK A;  4HSZ A;  2LAN A;  1VRK A;  4MVF A;  4M2Q A;  1EL4 A;  2M3W A;  3QRX A;  5DKQ A;  3I5F C;  3SIA A;  1K9K A;  1AP4 A;  4XYN A;  2JPT A;  5CSF A;  1XFV O;  1K90 D;  2L51 A;  2NCO A;  1B7T Y;  1G33 A;  2KFG A;  4MRX A;  3TUY B;  2JQ6 A;  4OR9 B;  4WQ3 A;  1HQV A;  5I8N A;  1K95 A;  2ZKM X;  2GGM A;  1YUU A;  1JWD A;  1UWO A;  3AAJ A;  3IQO A;  2WOS A;  1B4C A;  2G9B A;  1K2H A;  2LNK A;  4YGE B;  4NDD A;  5CSJ A;  4PHJ A;  5ER4 X;  2KI4 C;  4MZL A;  1J7O A;  3LK1 A;  1NSH A;  2EHB A;  1F70 A;  3VRP A;  1PVB A;  1B9A A;  1BOC A;  3CZT X;  1WY9 A;  4GFT A;  1WLM A;  1QJT A;  1M46 A;  4NDC A;  3WHU B;  1TTX A;  3CLN A;  4MBE A;  5JOL A;  1C7W A;  3DVJ A;  1XK4 A;  4DCK A;  2MLE C;  1GJY A;  4JPZ B;  2PRU A;  1J7P A;  2CNP A;  1JF2 A;  1S6C A;  3OX5 A;  2MBX A;  3TDZ A;  1TNP A;  2BL0 B;  4I5J A;  1DT7 B;  1F71 A;  4GGN A;  1NYA A;  3VGO A;  3DVE A;  4N1G A;  1BR1 B;  1TNX A;  1BG1 A;  1WRZ A;  1V1G A;  4DS7 A;  2KBM A;  2WC8 A;  4D1E A;  3SIB A;  1K94 A;  2M7N A;  1KSO A;  1QVI Z;  1UHN A;  1YR5 A;  2BCB A;  2E6W A;  2COL B;  2GV5 A;  3KO0 A;  1X02 A;  1CFD A;  2OTG C;  4MZK A;  1KK8 B;  2M9G A;  1K9U A;  4QJ3 B;  2KBI A;  5BPJ A;  2Y1M A;  3DVM A;  1B7T Z;  1PUL A;  1KK8 C;  2LM5 A;  4DIR A;  3DVK A;  1NUB A;  4XJK A;  1SR6 C;  2EC6 C;  1ZFS A;  4IL1 A;  3SG6 A;  1IWQ A;  1YX7 A;  3VRN A;  1H8B A;  3KEV A;  1OMR A;  2AUC A;  4ORC B;  5JJG A;  2LUX A;  3CR4 X;  1QV1 A;  1FI5 A;  1LVC D;  2JNX A;  1A03 A;  2L2E A;  1PSR A;  2JWW A;  2JUL A;  1QXP A;  1CM1 A;  1IJ5 A;  3D0Y A;  4I5N B;  1CFF A;  1BT6 A;  1QAT A;  2WCF A;  1XFU O;  3GK1 A;  4GNK B;  1KQM C;  2F2P A;  2Y4Q A;  2LHI A;  3DF0 B;  2AMI A;  4NQG A;  4PDZ A;  1B1G A;  1NX3 A;  1S6J A;  3CR2 A;  5DKN A;  2KGR A;  3CGA A;  1GGZ A;  1IQ3 A;  1DF0 B;  1H4B A;  5IBW A;  1JFJ A;  1NX0 A;  3CR5 X;  2KYC A;  4I5K A;  2GGZ A;  3WHT B;  2IS9 A;  2KYF A;  1ZUZ A;  3WXA A;  1OQP A;  1AHR A;  1K9P A;  2H2K A;  1F4Q A;  1K8U A;  1FW4 A;  2KNE A;  3BYA A;  2JTZ A;  3GOF A;  2I18 A;  1REC A;  1SPY A;  4CFQ A;  3OHM B;  3TUY C;  4WQ2 A;  1TN4 A;  3VRO A;  5I2L A;  4P5O E;  1JBA A;  5HKW A;  4CID A;  4QJ5 B;  1SNL A;  1WRK A;  1A75 B;  2SCP A;  3NSL A;  2CXJ A;  5DKR A;  5FYX A;  1Y1U A;  1DGU A;  1K93 D;  3BUM B;  4E68 A;  1MQ1 A;  1Y1X A;  2HET A;  2O60 A;  2LLU A;  4MSP A;  1A2X A;  1SRA A;  1NX1 A;  1YUT A;  2KOT A;  2SAS A;  3I5H B;  3I5I B;  2CTN A;  2LUC A;  3O6B A;  1CFP A;  5ER5 A;  4HRE E;  5KTY A;  5I2O A;  2CCM A;  1IKU A;  1SYM A;  1L7Z A;  2LVV A;  1OZS A;  2PVB A;  2WCB A;  3OB1 B;  3EVV A;  1N0Y A;  1OSA A;  1Y6W A;  4MN0 A;  4MEW A;  4AQJ A;  1C07 A;  1B8L A;  2FCD A;  3A8R A;  1YUS A;  2WND A;  1DMO A;  1S5G Z;  2H61 C;  2I2R E;  4JWQ A;  2LP3 A;  2ISD A;  1Y1A A;  2MA2 A;  2F3Z A;  2MJW B;  3DF0 A;  3VRR A;  2DOQ A;  1EG3 A;  2V53 A;  3I5I C;  1DJZ A;  3I5H C;  2EGD A;  3JVT C;  5KU1 A;  4ICB A;  1LXF C;  2BCX A;  2JTT A;  1DVI A;  1YVL A;  1SMG A;  4C0L A;  2LE9 B;  3PN7 B;  1QS7 A;  1W7I B;  2ZNE A;  2Q4U A;  5K89 A;  4FQO A;  3SG2 A;  5AXI A;  3PN7 C;  1KSM A;  4PHN A;  1DJI A;  3GK4 X;  3PAT A;  1XA5 A;  2HQW A;  2KAV A;  3ZWH A;  1QIV A;  2LP2 A;  2JRF A;  1EJ3 A;  2F2O A;  3GK2 A;  2JT3 A;  4GBA A;  5J3X A;  3A4U B;  1SL7 A;  2FJU B;  2Y1N A;  4A4B A;  1V1F A;  1ZAC A;  3OB2 B;  4CLN A;  1KFX L;  1RTP 1;  1KFU L;  2E30 A;  1A4P A;  2ZN9 A;  4MZJ A;  1FI6 A;  3EK4 A;  1QV0 A;  2TN4 A;  1CDP A;  1M31 A;  3ICB A;  1NCX A;  2NZ0 A;  1J55 A;  4PE7 A;  4XJK B;  5PAL A;  1M39 A;  4YGB B;  1JFK A;  1YTZ C;  3FWC A;  3PLF B;  2PSR A;  3NSI A;  3CS1 A;  1TNQ A;  1OMD A;  1DJY A;  3SG3 A;  1ALW A;  1A75 A;  2BBM A;  1M63 B;  1U5I B;  4PCW A;  1KK7 Z;  5D69 A;  1LIN A;  2JNF A;  1PVA A;  2O5G A;  1SCM C;  1FBV A;  3K21 A;  2L5X B;  1NP8 A;  1MXE A;  2KAY A;  2CBL A;  4MLW A;  1K96 A;  1TCF A;  5AAN A;  1QTX A;  4OKH A;  3DD4 A;  1FPW A;  2PAS A;  1WLZ A;  1SL9 A;  3KF9 A;  2ZND A;  4HRH A;  1C7V A;  4GAO A;  5I2Q A;  2LMT A;  1F4O A;  4BY4 A;  1KQV A;  1UHJ A;  5CPV A;  3EVR A;  1PRW A;  1YVH A;  2VRG A;  1CFC A;  5AFP A;  4OV2 A;  4DRW A;  1FF1 A;  1OMV A;  1MXL C;  1TIZ A;  4N1F A;  1YRT B;  1KWO B;  5TNC A;  2JU0 A;  1CNP A;  1DJG A;  1R2U A;  1XFY O;  1EG4 A;  2JZI A;  4OCI A;  3I5G B;  2KGB C;  1D1O A;  1GGW A;  4YRU A;  1QX2 A;  4NDB A;  1CMF A;  1HT9 A;  2K7D A;  2D8N A;  3I5G C;  1NCY A;  1SY9 A;  4PE0 A;  2LVK A;  4YBH B;  4USL A;  2BL0 C;  2HQ8 A;  1JUO A;  1TNW A;  2HF5 A;  2WOR A;  1J7R A;  1SKT A;  1ALV A;  1DGV A;  4ORB B;  1PK0 D;  3JTD C;  4P2Y B;  1CLL A;  4FTG A;  3EKJ A;  1CDM A;  1YX8 A;  1RJV A;  2K7C A;  3BUW B;  2K7B A;  1B47 A;  2HPS A;  2LMV A;  4YI8 A;  1M45 A;  5HYD A;  1KK7 Y;  1F54 A;  2BE4 A;  2BKI B;  1BLQ A;  5GQQ C;  1NWD A;  1BJF A;  4YGA A;  1ZOT B;  1YUR A;  1S1E A;  1ZMZ A;  1JF0 A;  3KPX A;  5CSI A;  1DJW A;  2BBN A;  2G2B A;  3PSR A;  2ZRT A;  3BUN B;  1BF5 A;  2M97 A;  2K0J A;  4ZCU A;  2MRD A;  2F8P A;  2LVI A;  4PHK A;  1UUS A;  1XK4 C;  1BU3 A;  4GGF A;  1QAS A;  1KFX S;  5HLV A;  4GGF C;  3HCM A;  3SG7 A;  1AJ5 A;  4CPV A;  1OE9 B;  3NSK A;  3IF7 A;  1TOP A;  1QX7 A;  4I5L B;  2L0P A;  1KCY A;  5HKY A;  1F55 A;  1QLK A;  3LLE A;  4U8D A;  2PAL A;  4TNC A;  1SK6 D;  3HX4 A;  1U5I A;  1BOD A;  1F8H A;  5HKZ A;  5AER A;  3OP0 A;  2M0R A;  2K61 A;  1L2O B;  1PSB A;  1CMG A;  1UHK A;  2H61 A;  2I7A A;  1W7J B;  1SL8 A;  4PE4 A;  1MUX A;  2P6B B;  1E8A A;  5HLO A;  4CFR A;  3WNX B;  3LCP C;  1J7Q A;  1MHO A;  2LHL A;  4OVN F;  4ZCV A;  1BMO A;  1SBJ A;  1SR6 B;  2EC6 B;  2PMY A;  2OS8 B;  3PFV A;  2RGI A;  2KI6 C;  1DF0 A;  3C1V A;  3TZ1 A;  2KAX A;  3O2P A;  2KQ6 A;  2KFH A;  1NPQ A;  3BOW A;  1L2O C;  2KHN A;  1DJH A;  3O78 A;  1JC2 A;  2FCE A;  1XFZ O;  3LK0 A;  3TDI A;  3E3R A;  5F6T A;  1CKK A;  2M49 B;  4AQI A;  4N5X A;  4PAL A;  1J1E A;  1XO5 A;  3FIA A;  3O4Y A;  2ZFD A;  5G08 A;  3OX6 A;  3LL8 B;  2M1U A;  3EVU A;  1UHH A;  1LA3 A;  3BQ3 A;  2NLN A;  1B8R A;  2KI4 B;  5KSZ A;  3KHE A;  1SCV A;  3JTD B;  3BUO B;  3IQQ A;  1KFU S;  3MSE B;  4Q04 A;  2KQY A;  1TRF A;  2LCP A;  2L50 A;  4A4C A;  4DUQ A;  2BCA A;  3VRQ A;  1IQ5 A;  1MR8 A;  2BKH B;  1J1D A;  3EK8 A;  1SCM B;  2F33 A;  2MLF C;  3RM1 A;  5AEQ A;  2K7O A;  3F45 A;  1CLM A;  2M7L A;  4C0J A;  1S6I A;  3EKH A;  1IGV A;  1AVS A;  3PAL A;  1XVJ A;  2M1K B;  1TCO B;  4MRY A;  4HRG A;  3H4S E;  1RK9 A;  1WDC B;  4L9M A;  4YGD B;  2ZRS A;  1IG5 A;  1QLS A;  3TDU A;  1G8I A;  2JC2 A;  1MWN A;  1ODB A;  1XFX O;  4UPG A;  2R2I A;  1GQM A;  3AKB A;  3EK7 A;  1IJ6 A;  1N65 A;  1G4Y R;  1Q80 A;  2LAP A;  2OPO A;  4C0K A;  1BR4 B;  3AAK A;  3AKA A;  3TS5 C;  1QIW A;  2K8M B;  2M8U A;  1SW8 A;  3CTN A;  2KI6 D;  3BOW B;  1N2D A;  4WRI A;  3TS5 B;  1KWO C;  3I5F B;  1UP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...