1PALA

Ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
107
structure length
107
Chain Sequence
SFAGLKDADVAAALAACSAADSFKHKEFFAKVGLASKSLDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSPSARALTDAETKAFLADGDKDGDGMIGVDEFAAMIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords PARVALBUMIN
publication title Ionic interactions with parvalbumins. Crystal structure determination of pike 4.10 parvalbumin in four different ionic environments.
pubmed doi rcsb
source organism Esox lucius
total genus 39
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 1990-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1palA00
1LA0A 1MXLC 2JT0A 3VGOA 2HQ8A 2KYCA 3RLZA 1CLBA 1DJGA 3KO0A 3IF7A 1M31A 2R2IA 1DVIA 1EH2A 1OMRA 1A03A 4MLWA 1UHNA 3D10A 2BBNA 2TN4A 3VRNA 2JXCA 1DF0B 4QJ3B 1KK7Y 1WLMA 4DS7A 4NDBA 2MJWB 1QX2A 1YR5A 2L2EA 1SL9A 1KK7Z 2AAOA 1DGUA 3CR4X 4JPZB 2KAXA 3FWCA 1KK8B 3SG7A 1DF0A 1CM4A 2K0JA 1QJTA 1ALWA 3PLFB 1AUIB 4UPGA 1PVAA 4ICBA 1XO5A 1BF5A 2Q91A 2D8NA 1LINA 5ER4X 1TCFA 2KQ6A 1F8HA 2F8PA 2L51A 1N65A 2H61A 1A2XA 5AEQA 2LMUA 1YUTA 2H61C 5CSNA 1CDMA 1XFZO 2P6BB 1KK8C 1X02A 2KSPA 2HF5A 2MAZA 1LVCD 2LMVA 3BQ3A 1B7TY 3GK1A 5HKZA 1UWOA 2HQWA 1TN4A 3C1VA 5PALA 1BR1B 4M2PA 2CXJA 1XA5A 2K8MB 1SKTA 1B8LA 1F54A 2GGZA 2FOTA 2MHHA 4FTGA 1EG3A 1R6PA 1NCZA 3ICBA 1PVBA 3HX4A 2NXQA 1Q80A 1UP5A 4HRGA 1S5GY 2M0RA 3CR2A 4C0LA 4PE1A 4MBEA 1J7PA 4Q04A 1S3PA 3WXAA 1UHIA 1S5GZ 2KDHA 4OVNF 4GAOA 2LMTA 3FIAA 1FPWA 2KAVA 1JUOA 1OSAA 3LLEA 3AAJA 2CTNA 2MBXA 4ZCVA 1G33A 1UUSA 3SG2A 1XFUO 1QV0A 2F33A 2WORA 1EG4A 3CR5X 3FWBA 2AUCA 1QATA 1UHKA 3DVEA 1J7QA 2PVBA 1RTP1 1Y0VH 4PE0A 1FI5A 3A8RA 3H4SE 2LHLA 2RGIA 1YTZC 3IQOA 1JBAA 1QTXA 2K61A 1MHOA 5IBWA 2MLFC 2Y1NA 5HLVA 2L5XB 2K2FA 1YRUB 1MR8A 1D1OA 2JT8A 3VRQA 1CMGA 1NUBA 2ISDA 4AOMA 1PULA 4I5KA 2JNXA 5DKQA 1K90D 3CS1A 1CDLA 1RROA 2KOTA 3JTDB 1AP4A 1F4OA 1OMVA 1KFUL 4I5LB 1CLLA 3O78A 4CFQA 1U5IB 1F70A 4XJKB 1BU3A 2AMIA 4AQJA 2V53A 1QS7A 1KCYA 1YX7A 3JTDC 1IJ6A 5CSIA 2O5GA 3NSLA 1GJYA 3BYAA 4N1FA 1QASA 1C7WA 3BXKA 2JXLA 2PRUA 4PHKA 1U5IA 3BUXB 2O60A 2WCFA 4XJKA 5CPVA 3BUNB 4PE7A 1DJZA 3KHEA 3AAKA 5K89A 1H8BA 2LCPA 1HQVA 2QACA 3K21A 4GFTA 2KFFA 2LV7A 1YRTB 4HREE 4WQ3A 2MRDA 1SW8A 2KFHA 3WHTB 1K94A 2BECA 2GGMA 2LLSA 3E3RA 4PHJA 1CLMA 1CFFA 4TNCA 5HKWA 3QRXA 2I2RE 3OHMB 5CSJA 2WCBA 2BL0B 5TNCA 5KTYA 3SJSA 3BOWB 4CIDA 2OPOA 1IKUA 4HRHA 2KGRA 1OZSA 2ZN8A 4USLA 1JWDA 1SNLA 1JF0A 3TDIA 1KQVA 1WDCB 1DJHA 1IG5A 1KQMB 2LVVA 1S36A 3LK1A 1YURA 3EVRA 2BL0C 3BOWA 3NSIA 4PALA 4WRIA 5ER5A 1M39A 1J55A 4YI9A 2K7OA 1CMFA 1K95A 1Y1XA 2L4HA 1BLQA 1F55A 1LKJA 1CFDA 2ZN9A 3D0YB 1S1EA 4GPLB 4YGCB 1JSAA 1QX7A 1TCOB 1VRKA 3PM8A 1B1GA 1XFXO 1BOCA 1GGWA 1SL8A 2G9BA 1AHRA 1WDCC 1KQMC 3KF9A 2LC5A 2BCBA 1IH0A 5D7FA 2BBMA 2L0PA 3I5FB 2WC8A 2LVJA 3O2PA 3OP0A 2JZIA 1KFXL 1PK0D 2EHBA 2SASA 4XYNA 3D0YA 1YVLA 2LANA 1K8UA 1QLSA 2A4JA 2NZ0A 3NSKA 4CFRA 2LLUA 1C07A 3BUWB 2K7BA 1DT7B 5FYXA 3RM1A 2M1UA 2ZFDA 4MRXA 3HCMA 1N0YA 2L50A 2CT9A 5F6TA 3I5FC 1IGVA 3DF0A 1TNPA 2E6WA 2KAYA 1TTXA 4JQ0D 1TOPA 1RWYA 1FW4A 2LVKA 2M29A 1TNXA 1M46A 1OOJA 1YVHA 3JVTB 4GBAA 1AJ4A 4MVFA 1R2UA 3EVUA 5AFPA 1ZACA 4E68A 1NIWA 1K9UA 4CPVA 1SYMA 1CFPA 1JC2A 2Y1MA 4WQ2A 2L4IA 1NCXA 2ZNEA 5HYDA 2JTZA 5HLOA 1K9KA 1NYAA 1NPQA 4NDCA 1IJ5A 1XK4A 1NSHA 1UHHA 3JVTC 1XFVO 3VRRA 1XK4C 2PMYA 4ETOA 2HPSA 1C7VA 2M3WA 1SBJA 1W7IB 1KFUS 3VROA 2KBMA 1CFCA 3DVMA 3EK7A 4AQIA 1DJXA 3WNXB 1JFJA 1QIVA 2F2OA 1HT9A 3TDUA 3EK8A 4DCKA 2PASA 4D1EA 5D69A 1A29A 1IRJA 3CLNA 3DVJA 3EVVA 1BODA 5KSZA 1IWQA 3KEVA 1TNQA 2ZRSA 1DJIA 2M7LA 3DVKA 3CWGA 1BMOA 2LP2A 3AKBA 4QJ4B 2M8UA 1FI6A 1B8CA 2K7CA 3F45A 1UHJA 1YUUA 1XVJA 2BKHB 1XYDA 1CTRA 1Y1AA 5AANA 1E8AA 5BPJA 2JWWA 2B1UA 4OCIA 4C0JA 2KNEA 4R1EA 2K7DA 3M0WA 4I5JA 1SR6B 3ZNIA 2MA2A 3BUOB 2KI4C 1JFKA 1LXFC 2G2BA 2NCPA 2EGDA 1MF8B 2LUXA 2LM5A 1PRWA 2LAPA 4GGNA 2F3YA 2NLNA 2JT3A 3WHUB 3SIAA 3I5IB 1NX2A 4ORBB 3SG4A 1TIZA 2KI6D 2M7NA 1SR6C 2F2PA 4YBHB 5DKRA 5HKYA 1DMOA 2M1KB 2I18A 4DRWA 4YGBB 1EXRA 1BJFA 3TS5B 4PCWA 4YRUA 1FBVA 1YUSA 1WY9A 1Y6WA 1N2DA 2KGBC 4PHNA 1SY9A 1SPYA 3TDZA 3I5IC 1G8IA 1F4QA 4JWQA 3LL8B 5I8NA 1M45A 1NX1A 3CZTX 3PALA 3SIBA 2I7AA 3TS5C 2CCMA 4GNKB 1RK9A 4I5NB 1OE9B 2KI6C 2BCXA 1EL4A 1B8RA 1QLKA 2LLTA 4MSPA 4DIRA 1IQ3A 2BKIB 2KBIA 1M63B 3EKJA 1KFXS 2E30A 3PATA 2Y4QA 1TRFA 1BT6A 1WRKA 2DOQA 1ZFSA 3CGAA 1PALA 3I5HB 2PSRA 4MN0A 2FJUB 4A4BA 2JU0A 1SL7A 3OB2B 3SG5A 2EC6B 2JOJA 4F0ZB 2L98A 3FS7A 2BE6A 2PALA 1YX8A 4MZJA 5I2LA 1KSOA 3LK0A 1IQ5A 3I5GB 1XFWO 1FF1A 3PSRA 1ALVA 1S6CA 1MWNA 1H4BA 3I5HC 2IS9A 1F71A 2WCEA 1S6JA 1NCYA 2EC6C 1PSRA 3DF0B 2CBLA 3OB1B 4NQGA 1A4PA 3AKAA 1MQ1A 3SG3A 1BR4B 2GV5A 2NCOA 3TUYB 3OX5A 4BY5A 1JF2A 3I5GC 3SG6A 3O6BA 3OX6A 2WNDA 1S26D 1Y1UA 2LVIA 3MSEB 1RFJA 2JC2A 4IL1A 3A4UB 1CDNA 1L7ZA 1GQMA 1QIWA 3EKHA 1DJWA 3O4YA 1KWOB 2M97A 5G08A 2BE4A 1K2HA 5AXIA 4YI8A 1QV1A 1V1FA 1J7OA 4HSZA 3DD4A 5AERA 3TUYC 2QPTA 4P5OE 1PSBA 2FCEA 2JRFA 2ZKMX 4L9MA 1G4YR 1LA3A 3GK4X 1AVSA 1QVIY 1V1GA 4CLNA 1ODBA 3GOFA 4OV2A 5I2OA 1KWOC 4YGEB 2LE9B 4GUKA 4C0KA 1L2OB 1B7TZ 1OMDA 1QX5B 1WLZA 1NP8A 1CB1A 1QVIZ 2KFGA 3KPXA 1ZUZA 1SK6D 1J1EA 4YGAA 4ORAB 5I2QA 2ZNDA 1EJ3A 1NX0A 1CM1A 1RECA 2M49B 1ZMZA 3NXAA 1B47A 1L2OC 2LHIA 2SCPA 4N1GA 1S6IA 1SCMB 5GQQC 3GK2A 1J1DA 2JNFA 1K93D 2COLB 1B9AA 2KI4B 1WRLA 1SRAA 1K96A 2KHNA 1TNWA 1DJYA 4MZKA 1MXEA 4MEWA 1J7RA 2M9GA 4DUQA 5KU1A 5J3XA 1ZOTB 4N5XA 3CTNA 4PDZA 3NSOA 1K9PA 1SCMC 5JJGA 1WRZA 2F3ZA 1UURA 2BCAA 2JPTA 1DTLA 2WOSA 3VRPA 1CKKA 3BUMB 1CDPA 5DKNA 1BG1A 1SMGA 4OR9B 2LUCA 1DGVA 4FQOA 4A4CA 1W7JB 1CNPA 4M2OA 2MLEC 4PHMA 4U8DA 2JTTA 2OTGB 2K2AA 1RJVA 1SCVA 2JULA 2KYFA 3PFVA 2OS8B 2ZRTA 1QXPA 1AJ5A 1AK8A 3TZ1A 2FCDA 3EK4A 2Y5IA 2LNKA 2VRGA 3PN7B 1KSMA 5B8IB 4ORCB 2HETA 4NDDA 4QJ5B 4OKHA 2JQ6A 2Q4UA 3LCPC 1OQPA 2KQYA 4PE4A 2OTGC 1MUXA 4GGFA 5JOLA 1A75B 4GGFC 2OS8C 4ZCUA 2I94A 3PN7C 1NX3A 1XFYO 2LP3A 1GGZA 4M2QA 1OZOA 4P2YB 3IQQA 1B4CA 4BY4A 4MRYA 1A75A 4MZLA 3ZWHA 1NWDA 2CNPA 4YGDB 5CSFA 2H2KA
chains in the Genus database with same CATH superfamily
1LA0A 3B87A 1MXLC 5FI2A 2JT0A 3VGOA 2HQ8A 2KYCA 3RLZA 1LS8A 1CLBA 1DJGA 3KO0A 3IF7A 1M31A 2R2IA 1DVIA 1EH2A 1OMRA 1A03A 4MLWA 1UHNA 3D10A 2BBNA 2TN4A 3VRNA 2JXCA 1DF0B 4QJ3B 1KK7Y 1WLMA 4DS7A 3SS4A 4NDBA 2MJWB 1YR5A 1QX2A 2L2EA 1SL9A 1KK7Z 2AAOA 1DGUA 3CR4X 4JPZB 2KAXA 3FWCA 1KK8B 3SG7A 1DF0A 1CM4A 1TUZA 2K0JA 1QJTA 1ALWA 3PLFB 1AUIB 4JKTA 3BFHA 4UPGA 4F7FA 1PVAA 4ICBA 1XO5A 1BF5A 2Q91A 2D8NA 1LINA 5ER4X 1TCFA 2KQ6A 3B86A 1F8HA 2F8PA 2L51A 1N65A 2H61A 1A2XA 5AEQA 2LMUA 4OZDA 1YUTA 2H61C 5CSNA 1CDMA 1XFZO 2P6BB 1KK8C 1X02A 2KSPA 2HF5A 2MAZA 1LVCD 2LMVA 3BQ3A 3CZ2A 1B7TY 3GK1A 5HKZA 1UWOA 2HQWA 1TN4A 2P71A 3C1VA 3D75A 1ORGA 5PALA 1BR1B 3B88A 4M2PA 2CXJA 1XA5A 2K8MB 1SKTA 1B8LA 1F54A 3PM2A 2GGZA 2FOTA 2MHHA 4FTGA 1EG3A 1R6PA 1NCZA 3ICBA 1PVBA 3DYEA 3HX4A 2NXQA 1Q80A 3PJIA 1UP5A 4HRGA 1S5GY 3L4LA 2M0RA 3CR2A 4C0LA 2QEBA 4PE1A 4MBEA 1J7PA 4Q04A 1S3PA 3WXAA 1UHIA 1S5GZ 2KDHA 4OVNF 4GAOA 2LMTA 3FIAA 1FPWA 2KAVA 1JUOA 1OSAA 3D78A 3LLEA 3AAJA 5EL2A 1Z4HA 3S0BA 2CTNA 2MBXA 4ZCVA 5HL1A 1G33A 1UUSA 3SG2A 1XFUO 1QV0A 2F33A 2WORA 1EG4A 3CR5X 3FWBA 2AUCA 1QATA 1UHKA 3DVEA 1J7QA 2PVBA 1RTP1 1Y0VH 4PE0A 1FI5A 3A8RA 3H4SE 2LHLA 2RGIA 1YTZC 3IQOA 3R1VA 3UNWA 5D3OA 3K1EA 1QTXA 2K61A 1MHOA 2KLEA 5IBWA 1JBAA 2MLFC 2Y1NA 5HLVA 2L5XB 5I94A 2K2FA 1YRUB 1MR8A 1D1OA 2JT8A 1DEKA 3L4AA 3VRQA 1CMGA 1NUBA 2ISDA 4AOMA 1PULA 4I5KA 2JNXA 5DKQA 1K90D 3D76A 3CS1A 1CDLA 1RROA 2KOTA 2WCJA 3RZSA 3JTDB 3BFBA 1F4OA 1OMVA 1AP4A 1KFUL 1Z2CB 4I5LB 1CLLA 3NHTA 3O78A 4CFQA 1U5IB 1F70A 4XJKB 1BU3A 2AMIA 3R72A 4AQJA 2V53A 1QS7A 1QWVA 1KCYA 2BAPA 1YX7A 3JTDC 1IJ6A 3IVTA 5CSIA 2O5GA 3NSLA 1GJYA 3BYAA 4N1FA 1QASA 1C7WA 3BXKA 2JXLA 2PRUA 4PHKA 1U5IA 3BUXB 2O60A 2WCFA 4XJKA 5CPVA 3L47A 1C3YA 3BUNB 4PE7A 1XFRA 1DJZA 3KHEA 3AAKA 5K89A 1H8BA 2LCPA 1HQVA 2QACA 3K21A 4GFTA 2KFFA 2LV7A 1YRTB 4HREE 4WQ3A 2MRDA 1SW8A 2KFHA 4KYNA 1K94A 2BECA 2GGMA 2LLSA 3E3RA 4PHJA 1CLMA 1CFFA 4TNCA 5HKWA 3QRXA 2I2RE 3OHMB 3SS5A 5CSJA 2WCBA 3NHIA 2BL0B 5TNCA 5KTYA 3SJSA 3BOWB 4CIDA 2OPOA 1IKUA 4HRHA 2KGRA 1OZSA 2ZN8A 1OW4A 4USLA 2QEOA 1JWDA 1SNLA 1JF0A 3TDIA 1KQVA 1WDCB 1DJHA 1IG5A 1KQMB 2LVVA 1S36A 3LK1A 1YURA 3EVRA 2BL0C 3BOWA 3NSIA 4PALA 4WRIA 1OOGA 5ER5A 1M39A 1J55A 4YI9A 2K7OA 1CMFA 1K95A 1Y1XA 2L4HA 2L5YA 1BLQA 1F55A 1LKJA 3BJHA 1CFDA 2ZN9A 3D0YB 1S1EA 4GPLB 4YGCB 1JSAA 1OOIX 1QX7A 1TCOB 1VRKA 3PM8A 1B1GA 1XFXO 1BOCA 1GGWA 1SL8A 2G9BA 1AHRA 1WDCC 1KQMC 3KF9A 2LC5A 2BCBA 1IH0A 5D7FA 2BBMA 2L0PA 3I5FB 2WC8A 2LVJA 3O2PA 3OP0A 3SS3A 2JZIA 1KFXL 1PK0D 2EHBA 2SASA 3R1OA 4XYNA 3D0YA 1YVLA 2LANA 3FE9A 1K8UA 1QLSA 2A4JA 2NZ0A 3NSKA 4CFRA 3V2LA 2LLUA 1C07A 3BUWB 2K7BA 1DT7B 5FYXA 3RM1A 2M1UA 2ZFDA 4MRXA 3HCMA 1N0YA 2L50A 3S0AA 2CT9A 5F6TA 3I5FC 1IGVA 3DF0A 1TNPA 2E6WA 2KAYA 2WCKA 1TTXA 4JQ0D 1TOPA 1RWYA 1FW4A 2LVKA 2M29A 1TNXA 1M46A 1OOJA 1YVHA 3JVTB 4GBAA 3S0FA 1AJ4A 2WCHA 4MVFA 1R2UA 3EVUA 5AFPA 1ZACA 4E68A 3DZTA 1NIWA 1K9UA 4CPVA 1SYMA 1CFPA 1JC2A 2Y1MA 4WQ2A 2L4IA 1NCXA 2ZNEA 5HYDA 2JTZA 3B6XA 5HLOA 1K9KA 1NYAA 1NPQA 2P70A 1IJ5A 4NDCA 1XK4A 1NSHA 1UHHA 3JVTC 5FI7A 1XFVO 3VRRA 1XK4C 2PMYA 4ETOA 2HPSA 1C7VA 2M3WA 1SBJA 1W7IB 1KFUS 3VROA 2KBMA 1CFCA 3DVMA 3EK7A 4AQIA 1DJXA 3WNXB 3CZ0A 1JFJA 1QIVA 2F2OA 1HT9A 3TDUA 3EK8A 4DCKA 2PASA 4D1EA 5D69A 1A29A 3O4XA 1IRJA 3CLNA 3DVJA 3EVVA 1BODA 2WCMA 5KSZA 1IWQA 3KEVA 1TNQA 2ZRSA 1DJIA 2M7LA 3DVKA 3CWGA 1BMOA 2LP2A 3AKBA 4QJ4B 2M8UA 1FI6A 1B8CA 2H8VA 2K7CA 3F45A 1UHJA 2BNXA 1YUUA 1XVJA 2BKHB 1XYDA 1CTRA 1Y1AA 5AANA 1E8AA 5BPJA 2JWWA 3CABA 2B1UA 3B7AA 4OCIA 2KNEA 4C0JA 4R1EA 2K7DA 3M0WA 4I5JA 1SR6B 3ZNIA 2MA2A 3BUOB 1DELA 2KI4C 1JFKA 1LXFC 2G2BA 2NCPA 2EGDA 1MF8B 2LUXA 2LM5A 1PRWA 2LAPA 4GGNA 2F3YA 2NLNA 2JT3A 3WHUB 3SIAA 3I5IB 1NX2A 4ORBB 3SG4A 1TIZA 1W9ZA 2KI6D 2M7NA 1SR6C 1OOFA 2F2PA 4YBHB 5DKRA 5HKYA 1DMOA 2M1KB 2I18A 4DRWA 4YGBB 1EXRA 1BJFA 3N7HA 3TS5B 4PCWA 1TWOA 4YRUA 1FBVA 3D74A 1YUSA 3S0GA 1WY9A 1Y6WA 1N2DA 2KGBC 4PHNA 1SY9A 1SPYA 3TDZA 3I5IC 1SSEB 1G8IA 1F4QA 4JWQA 3LL8B 5I8NA 1M45A 1NX1A 3CZTX 3PALA 3SIBA 3D77A 2I7AA 3TS5C 2CCMA 4GNKB 1RK9A 4I5NB 1OE9B 3OGNA 2KI6C 2BCXA 3S0DA 1EL4A 1B8RA 1QLKA 2LLTA 3CYZA 4MSPA 4DIRA 1IQ3A 2BKIB 2KBIA 1M63B 3EKJA 1KFXS 2E30A 3PATA 1T14A 2Y4QA 1TRFA 1BT6A 1WRKA 2DOQA 1ZFSA 3CGAA 1PALA 3I5HB 2PSRA 4MN0A 2FJUB 3S0EA 4A4BA 2JU0A 1SL7A 3OB2B 3SG5A 2EC6B 2JOJA 4F0ZB 2ERBA 2L98A 3FS7A 2BE6A 2PALA 1YX8A 3BFAA 4MZJA 1KSOA 5I2LA 4JD9A 3LK0A 1IQ5A 2K60A 3I5GB 1XFWO 1FF1A 3PSRA 1ALVA 1S6CA 1MWNA 1OOHA 1H4BA 3I5HC 2IS9A 1F71A 2WCEA 1S6JA 1NCYA 2EC6C 1PSRA 3DF0B 2CBLA 3UO9A 3OB1B 4NQGA 1A4PA 3AKAA 1MQ1A 4INXA 3SG3A 1BR4B 2GV5A 2NCOA 3TUYB 3OX5A 4BY5A 1JF2A 3I5GC 3SG6A 3O6BA 3OX6A 2WNDA 1S26D 1Y1UA 2LVIA 3MSEB 1RFJA 2JC2A 3QMEA 4IL1A 3A4UB 5FI6A 1CDNA 3DY9A 1L7ZA 1GQMA 1QIWA 2GTEA 2L2CA 3EKHA 1DJWA 3O4YA 1GM0A 1KWOB 2M97A 5G08A 2BE4A 2WCLA 1K2HA 5AXIA 4YI8A 1DC1A 1QV1A 1V1FA 1J7OA 4HSZA 3DD4A 5AERA 3TUYC 2QPTA 2WC6A 4P5OE 1PSBA 2FCEA 2JRFA 2ZKMX 4L9MA 1G4YR 1LA3A 3GK4X 1AVSA 1QVIY 1V1GA 2QDIA 4CLNA 1ODBA 1DQEA 2JPOA 3FE8A 1TUJA 1KWOC 3GOFA 4OV2A 4YGEB 5I2OA 2LE9B 4GUKA 4C0KA 1L2OB 1B7TZ 1OMDA 1QX5B 1WLZA 1NP8A 1CB1A 1QVIZ 2KFGA 3KPXA 1ZUZA 1SK6D 1J1EA 4YGAA 1C3ZA 4ORAB 3VB1A 5I2QA 2ZNDA 1EJ3A 1NX0A 1CM1A 1RECA 2M49B 1ZMZA 4INWA 3NXAA 3R1PA 1B47A 1L2OC 2WC5A 2LHIA 2SCPA 4N1GA 2QEVA 1S6IA 1SCMB 5GQQC 3GK2A 1J1DA 2JNFA 1K93D 2COLB 1B9AA 2KI4B 1WRLA 1SRAA 1K96A 2KHNA 1TNWA 1DJYA 4MZKA 1MXEA 2KLDA 3OBVA 4MEWA 1J7RA 2M9GA 4DUQA 5KU1A 5J3XA 4IJ7A 1ZOTB 4N5XA 3DXLA 3CTNA 4PDZA 2FJYA 3NSOA 1K9PA 1SCMC 2QEHA 1WRZA 2F3ZA 5JJGA 1UURA 2BCAA 2JPTA 1DTLA 2WOSA 3CDNA 3VRPA 1CKKA 3BUMB 1CDPA 5DKNA 1BG1A 1SMGA 4OR9B 2LUCA 5DICA 1DGVA 4FQOA 4A4CA 1W7JB 4PT1A 1CNPA 4M2OA 2MLEC 4PHMA 2YGUA 4U8DA 2JTTA 2OTGB 2K2AA 1RJVA 1SCVA 3NGVA 2JULA 1IIOA 2KYFA 3PFVA 2PYQA 2OS8B 2ZRTA 1QXPA 1AJ5A 1AK8A 3TZ1A 2FCDA 3EK4A 2Y5IA 3FE6A 2LNKA 2VRGA 3PN7B 1KSMA 5B8IB 4ORCB 2HETA 4NDDA 3CZ1A 4QJ5B 4OKHA 2JQ6A 2Q4UA 3LCPC 1OQPA 2KQYA 4PE4A 2OTGC 1MUXA 4GGFA 5JOLA 3WHTB 1A75B 4GGFC 2OS8C 4FQTA 4ZCUA 3Q8IA 2I94A 3PN7C 1P28A 3D73A 1NX3A 1XFYO 2LP3A 1GGZA 4M2QA 3EG5B 2KPHA 1OZOA 4P2YB 3IQQA 1B4CA 2PQLA 4BY4A 4MRYA 1A75A 4MZLA 3ZWHA 1NWDA 2CNPA 4YGDB 5CSFA 2H2KA
chains in the Genus database with same CATH topology
1LA0A 1MXLC 2JT0A 3VGOA 2HQ8A 2KYCA 3RLZA 1CLBA 1DJGA 3KO0A 3IF7A 1M31A 2R2IA 1DVIA 1EH2A 1OMRA 1A03A 4MLWA 1UHNA 3D10A 2BBNA 2TN4A 3VRNA 2JXCA 1DF0B 4QJ3B 1KK7Y 1WLMA 4DS7A 4NDBA 2MJWB 1QX2A 1YR5A 2L2EA 1SL9A 1KK7Z 2AAOA 1DGUA 3CR4X 4JPZB 2KAXA 3FWCA 1KK8B 3SG7A 1DF0A 1CM4A 2K0JA 1QJTA 1ALWA 3PLFB 1AUIB 4UPGA 1PVAA 4ICBA 1XO5A 1BF5A 2Q91A 2D8NA 1LINA 5ER4X 1TCFA 2KQ6A 1F8HA 2F8PA 2L51A 1N65A 2H61A 1A2XA 5AEQA 2LMUA 1YUTA 2H61C 5CSNA 1CDMA 1XFZO 2P6BB 1KK8C 1X02A 2KSPA 2HF5A 2MAZA 1LVCD 2LMVA 3BQ3A 1B7TY 3GK1A 5HKZA 1UWOA 2HQWA 1TN4A 3C1VA 5PALA 1BR1B 4M2PA 2CXJA 1XA5A 2K8MB 1SKTA 1B8LA 1F54A 2GGZA 2FOTA 2MHHA 4FTGA 1EG3A 1R6PA 1NCZA 3ICBA 1PVBA 3HX4A 2NXQA 1Q80A 1UP5A 4HRGA 1S5GY 2M0RA 3CR2A 4C0LA 4PE1A 4MBEA 1J7PA 4Q04A 1S3PA 3WXAA 1UHIA 1S5GZ 2KDHA 4OVNF 4GAOA 2LMTA 3FIAA 1FPWA 2KAVA 1JUOA 1OSAA 3LLEA 3AAJA 2CTNA 2MBXA 4ZCVA 1G33A 1UUSA 3SG2A 1XFUO 1QV0A 2F33A 2WORA 1EG4A 3CR5X 3FWBA 2AUCA 1QATA 1UHKA 3DVEA 1J7QA 2PVBA 1RTP1 1Y0VH 4PE0A 1FI5A 3A8RA 3H4SE 2LHLA 2RGIA 1YTZC 3IQOA 1JBAA 1QTXA 2K61A 1MHOA 5IBWA 2MLFC 2Y1NA 5HLVA 2L5XB 2K2FA 1YRUB 1MR8A 1D1OA 2JT8A 3VRQA 1CMGA 1NUBA 2ISDA 4AOMA 1PULA 4I5KA 2JNXA 5DKQA 1K90D 3CS1A 1CDLA 1RROA 2KOTA 3JTDB 1AP4A 1F4OA 1OMVA 1KFUL 4I5LB 1CLLA 3O78A 4CFQA 1U5IB 1F70A 4XJKB 1BU3A 2AMIA 4AQJA 2V53A 1QS7A 1KCYA 1YX7A 3JTDC 1IJ6A 5CSIA 2O5GA 3NSLA 1GJYA 3BYAA 4N1FA 1QASA 1C7WA 3BXKA 2JXLA 2PRUA 4PHKA 1U5IA 3BUXB 2O60A 2WCFA 4XJKA 5CPVA 3BUNB 4PE7A 1DJZA 3KHEA 3AAKA 5K89A 1H8BA 2LCPA 1HQVA 2QACA 3K21A 4GFTA 2KFFA 2LV7A 1YRTB 4HREE 4WQ3A 2MRDA 1SW8A 2KFHA 3WHTB 1K94A 2BECA 2GGMA 2LLSA 3E3RA 4PHJA 1CLMA 1CFFA 4TNCA 5HKWA 3QRXA 2I2RE 3OHMB 5CSJA 2WCBA 2BL0B 5TNCA 5KTYA 3SJSA 3BOWB 4CIDA 2OPOA 1IKUA 4HRHA 2KGRA 1OZSA 2ZN8A 4USLA 1JWDA 1SNLA 1JF0A 3TDIA 1KQVA 1WDCB 1DJHA 1IG5A 1KQMB 2LVVA 1S36A 3LK1A 1YURA 3EVRA 2BL0C 3BOWA 3NSIA 4PALA 4WRIA 5ER5A 1M39A 1J55A 4YI9A 2K7OA 1CMFA 1K95A 1Y1XA 2L4HA 1BLQA 1F55A 1LKJA 1CFDA 2ZN9A 3D0YB 1S1EA 4GPLB 4YGCB 1JSAA 1QX7A 1TCOB 1VRKA 3PM8A 1B1GA 1XFXO 1BOCA 1GGWA 1SL8A 2G9BA 1AHRA 1WDCC 1KQMC 3KF9A 2LC5A 2BCBA 1IH0A 5D7FA 2BBMA 2L0PA 3I5FB 2WC8A 2LVJA 3O2PA 3OP0A 2JZIA 1KFXL 1PK0D 2EHBA 2SASA 4XYNA 3D0YA 1YVLA 2LANA 1K8UA 1QLSA 2A4JA 2NZ0A 3NSKA 4CFRA 2LLUA 1C07A 3BUWB 2K7BA 1DT7B 5FYXA 3RM1A 2M1UA 2ZFDA 4MRXA 3HCMA 1N0YA 2L50A 2CT9A 5F6TA 3I5FC 1IGVA 3DF0A 1TNPA 2E6WA 2KAYA 1TTXA 4JQ0D 1TOPA 1RWYA 1FW4A 2LVKA 2M29A 1TNXA 1M46A 1OOJA 1YVHA 3JVTB 4GBAA 1AJ4A 4MVFA 1R2UA 3EVUA 5AFPA 1ZACA 4E68A 1NIWA 1K9UA 4CPVA 1SYMA 1CFPA 1JC2A 2Y1MA 4WQ2A 2L4IA 1NCXA 2ZNEA 5HYDA 2JTZA 5HLOA 1K9KA 1NYAA 1NPQA 4NDCA 1IJ5A 1XK4A 1NSHA 1UHHA 3JVTC 1XFVO 3VRRA 1XK4C 2PMYA 4ETOA 2HPSA 1C7VA 2M3WA 1SBJA 1W7IB 1KFUS 3VROA 2KBMA 1CFCA 3DVMA 3EK7A 4AQIA 1DJXA 3WNXB 1JFJA 1QIVA 2F2OA 1HT9A 3TDUA 3EK8A 4DCKA 2PASA 4D1EA 5D69A 1A29A 1IRJA 3CLNA 3DVJA 3EVVA 1BODA 5KSZA 1IWQA 3KEVA 1TNQA 2ZRSA 1DJIA 2M7LA 3DVKA 3CWGA 1BMOA 2LP2A 3AKBA 4QJ4B 2M8UA 1FI6A 1B8CA 2K7CA 3F45A 1UHJA 1YUUA 1XVJA 2BKHB 1XYDA 1CTRA 1Y1AA 5AANA 1E8AA 5BPJA 2JWWA 2B1UA 4OCIA 4C0JA 2KNEA 4R1EA 2K7DA 3M0WA 4I5JA 1SR6B 3ZNIA 2MA2A 3BUOB 2KI4C 1JFKA 1LXFC 2G2BA 2NCPA 2EGDA 1MF8B 2LUXA 2LM5A 1PRWA 2LAPA 4GGNA 2F3YA 2NLNA 2JT3A 3WHUB 3SIAA 3I5IB 1NX2A 4ORBB 3SG4A 1TIZA 2KI6D 2M7NA 1SR6C 2F2PA 4YBHB 5DKRA 5HKYA 1DMOA 2M1KB 2I18A 4DRWA 4YGBB 1EXRA 1BJFA 3TS5B 4PCWA 4YRUA 1FBVA 1YUSA 1WY9A 1Y6WA 1N2DA 2KGBC 4PHNA 1SY9A 1SPYA 3TDZA 3I5IC 1G8IA 1F4QA 4JWQA 3LL8B 5I8NA 1M45A 1NX1A 3CZTX 3PALA 3SIBA 2I7AA 3TS5C 2CCMA 4GNKB 1RK9A 4I5NB 1OE9B 2KI6C 2BCXA 1EL4A 1B8RA 1QLKA 2LLTA 4MSPA 4DIRA 1IQ3A 2BKIB 2KBIA 1M63B 3EKJA 1KFXS 2E30A 3PATA 2Y4QA 1TRFA 1BT6A 1WRKA 2DOQA 1ZFSA 3CGAA 1PALA 3I5HB 2PSRA 4MN0A 2FJUB 4A4BA 2JU0A 1SL7A 3OB2B 3SG5A 2EC6B 2JOJA 4F0ZB 2L98A 3FS7A 2BE6A 2PALA 1YX8A 4MZJA 5I2LA 1KSOA 3LK0A 1IQ5A 3I5GB 1XFWO 1FF1A 3PSRA 1ALVA 1S6CA 1MWNA 1H4BA 3I5HC 2IS9A 1F71A 2WCEA 1S6JA 1NCYA 2EC6C 1PSRA 3DF0B 2CBLA 3OB1B 4NQGA 1A4PA 3AKAA 1MQ1A 3SG3A 1BR4B 2GV5A 2NCOA 3TUYB 3OX5A 4BY5A 1JF2A 3I5GC 3SG6A 3O6BA 3OX6A 2WNDA 1S26D 1Y1UA 2LVIA 3MSEB 1RFJA 2JC2A 4IL1A 3A4UB 1CDNA 1L7ZA 1GQMA 1QIWA 3EKHA 1DJWA 3O4YA 1KWOB 2M97A 5G08A 2BE4A 1K2HA 5AXIA 4YI8A 1QV1A 1V1FA 1J7OA 4HSZA 3DD4A 5AERA 3TUYC 2QPTA 4P5OE 1PSBA 2FCEA 2JRFA 2ZKMX 4L9MA 1G4YR 1LA3A 3GK4X 1AVSA 1QVIY 1V1GA 4CLNA 1ODBA 3GOFA 4OV2A 5I2OA 1KWOC 4YGEB 2LE9B 4GUKA 4C0KA 1L2OB 1B7TZ 1OMDA 1QX5B 1WLZA 1NP8A 1CB1A 1QVIZ 2KFGA 3KPXA 1ZUZA 1SK6D 1J1EA 4YGAA 4ORAB 5I2QA 2ZNDA 1EJ3A 1NX0A 1CM1A 1RECA 2M49B 1ZMZA 3NXAA 1B47A 1L2OC 2LHIA 2SCPA 4N1GA 1S6IA 1SCMB 5GQQC 3GK2A 1J1DA 2JNFA 1K93D 2COLB 1B9AA 2KI4B 1WRLA 1SRAA 1K96A 2KHNA 1TNWA 1DJYA 4MZKA 1MXEA 4MEWA 1J7RA 2M9GA 4DUQA 5KU1A 5J3XA 1ZOTB 4N5XA 3CTNA 4PDZA 3NSOA 1K9PA 1SCMC 5JJGA 1WRZA 2F3ZA 1UURA 2BCAA 2JPTA 1DTLA 2WOSA 3VRPA 1CKKA 3BUMB 1CDPA 5DKNA 1BG1A 1SMGA 4OR9B 2LUCA 1DGVA 4FQOA 4A4CA 1W7JB 1CNPA 4M2OA 2MLEC 4PHMA 4U8DA 2JTTA 2OTGB 2K2AA 1RJVA 1SCVA 2JULA 2KYFA 3PFVA 2OS8B 2ZRTA 1QXPA 1AJ5A 1AK8A 3TZ1A 2FCDA 3EK4A 2Y5IA 2LNKA 2VRGA 3PN7B 1KSMA 5B8IB 4ORCB 2HETA 4NDDA 4QJ5B 4OKHA 2JQ6A 2Q4UA 3LCPC 1OQPA 2KQYA 4PE4A 2OTGC 1MUXA 4GGFA 5JOLA 1A75B 4GGFC 2OS8C 4ZCUA 2I94A 3PN7C 1NX3A 1XFYO 2LP3A 1GGZA 4M2QA 1OZOA 4P2YB 3IQQA 1B4CA 4BY4A 4MRYA 1A75A 4MZLA 3ZWHA 1NWDA 2CNPA 4YGDB 5CSFA 2H2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LA0 A;  1MXL C;  2JT0 A;  3VGO A;  2HQ8 A;  2KYC A;  3RLZ A;  1CLB A;  1DJG A;  3KO0 A;  3IF7 A;  1M31 A;  2R2I A;  1DVI A;  1EH2 A;  1OMR A;  1A03 A;  4MLW A;  1UHN A;  3D10 A;  2BBN A;  2TN4 A;  3VRN A;  2JXC A;  1DF0 B;  4QJ3 B;  1KK7 Y;  1WLM A;  4DS7 A;  4NDB A;  2MJW B;  1QX2 A;  1YR5 A;  2L2E A;  1SL9 A;  1KK7 Z;  2AAO A;  1DGU A;  3CR4 X;  4JPZ B;  2KAX A;  3FWC A;  1KK8 B;  3SG7 A;  1DF0 A;  1CM4 A;  2K0J A;  1QJT A;  1ALW A;  3PLF B;  1AUI B;  4UPG A;  1PVA A;  4ICB A;  1XO5 A;  1BF5 A;  2Q91 A;  2D8N A;  1LIN A;  5ER4 X;  1TCF A;  2KQ6 A;  1F8H A;  2F8P A;  2L51 A;  1N65 A;  2H61 A;  1A2X A;  5AEQ A;  2LMU A;  1YUT A;  2H61 C;  5CSN A;  1CDM A;  1XFZ O;  2P6B B;  1KK8 C;  1X02 A;  2KSP A;  2HF5 A;  2MAZ A;  1LVC D;  2LMV A;  3BQ3 A;  1B7T Y;  3GK1 A;  5HKZ A;  1UWO A;  2HQW A;  1TN4 A;  3C1V A;  5PAL A;  1BR1 B;  4M2P A;  2CXJ A;  1XA5 A;  2K8M B;  1SKT A;  1B8L A;  1F54 A;  2GGZ A;  2FOT A;  2MHH A;  4FTG A;  1EG3 A;  1R6P A;  1NCZ A;  3ICB A;  1PVB A;  3HX4 A;  2NXQ A;  1Q80 A;  1UP5 A;  4HRG A;  1S5G Y;  2M0R A;  3CR2 A;  4C0L A;  4PE1 A;  4MBE A;  1J7P A;  4Q04 A;  1S3P A;  3WXA A;  1UHI A;  1S5G Z;  2KDH A;  4OVN F;  4GAO A;  2LMT A;  3FIA A;  1FPW A;  2KAV A;  1JUO A;  1OSA A;  3LLE A;  3AAJ A;  2CTN A;  2MBX A;  4ZCV A;  1G33 A;  1UUS A;  3SG2 A;  1XFU O;  1QV0 A;  2F33 A;  2WOR A;  1EG4 A;  3CR5 X;  3FWB A;  2AUC A;  1QAT A;  1UHK A;  3DVE A;  1J7Q A;  2PVB A;  1RTP 1;  1Y0V H;  4PE0 A;  1FI5 A;  3A8R A;  3H4S E;  2LHL A;  2RGI A;  1YTZ C;  3IQO A;  1JBA A;  1QTX A;  2K61 A;  1MHO A;  5IBW A;  2MLF C;  2Y1N A;  5HLV A;  2L5X B;  2K2F A;  1YRU B;  1MR8 A;  1D1O A;  2JT8 A;  3VRQ A;  1CMG A;  1NUB A;  2ISD A;  4AOM A;  1PUL A;  4I5K A;  2JNX A;  5DKQ A;  1K90 D;  3CS1 A;  1CDL A;  1RRO A;  2KOT A;  3JTD B;  1AP4 A;  1F4O A;  1OMV A;  1KFU L;  4I5L B;  1CLL A;  3O78 A;  4CFQ A;  1U5I B;  1F70 A;  4XJK B;  1BU3 A;  2AMI A;  4AQJ A;  2V53 A;  1QS7 A;  1KCY A;  1YX7 A;  3JTD C;  1IJ6 A;  5CSI A;  2O5G A;  3NSL A;  1GJY A;  3BYA A;  4N1F A;  1QAS A;  1C7W A;  3BXK A;  2JXL A;  2PRU A;  4PHK A;  1U5I A;  3BUX B;  2O60 A;  2WCF A;  4XJK A;  5CPV A;  3BUN B;  4PE7 A;  1DJZ A;  3KHE A;  3AAK A;  5K89 A;  1H8B A;  2LCP A;  1HQV A;  2QAC A;  3K21 A;  4GFT A;  2KFF A;  2LV7 A;  1YRT B;  4HRE E;  4WQ3 A;  2MRD A;  1SW8 A;  2KFH A;  3WHT B;  1K94 A;  2BEC A;  2GGM A;  2LLS A;  3E3R A;  4PHJ A;  1CLM A;  1CFF A;  4TNC A;  5HKW A;  3QRX A;  2I2R E;  3OHM B;  5CSJ A;  2WCB A;  2BL0 B;  5TNC A;  5KTY A;  3SJS A;  3BOW B;  4CID A;  2OPO A;  1IKU A;  4HRH A;  2KGR A;  1OZS A;  2ZN8 A;  4USL A;  1JWD A;  1SNL A;  1JF0 A;  3TDI A;  1KQV A;  1WDC B;  1DJH A;  1IG5 A;  1KQM B;  2LVV A;  1S36 A;  3LK1 A;  1YUR A;  3EVR A;  2BL0 C;  3BOW A;  3NSI A;  4PAL A;  4WRI A;  5ER5 A;  1M39 A;  1J55 A;  4YI9 A;  2K7O A;  1CMF A;  1K95 A;  1Y1X A;  2L4H A;  1BLQ A;  1F55 A;  1LKJ A;  1CFD A;  2ZN9 A;  3D0Y B;  1S1E A;  4GPL B;  4YGC B;  1JSA A;  1QX7 A;  1TCO B;  1VRK A;  3PM8 A;  1B1G A;  1XFX O;  1BOC A;  1GGW A;  1SL8 A;  2G9B A;  1AHR A;  1WDC C;  1KQM C;  3KF9 A;  2LC5 A;  2BCB A;  1IH0 A;  5D7F A;  2BBM A;  2L0P A;  3I5F B;  2WC8 A;  2LVJ A;  3O2P A;  3OP0 A;  2JZI A;  1KFX L;  1PK0 D;  2EHB A;  2SAS A;  4XYN A;  3D0Y A;  1YVL A;  2LAN A;  1K8U A;  1QLS A;  2A4J A;  2NZ0 A;  3NSK A;  4CFR A;  2LLU A;  1C07 A;  3BUW B;  2K7B A;  1DT7 B;  5FYX A;  3RM1 A;  2M1U A;  2ZFD A;  4MRX A;  3HCM A;  1N0Y A;  2L50 A;  2CT9 A;  5F6T A;  3I5F C;  1IGV A;  3DF0 A;  1TNP A;  2E6W A;  2KAY A;  1TTX A;  4JQ0 D;  1TOP A;  1RWY A;  1FW4 A;  2LVK A;  2M29 A;  1TNX A;  1M46 A;  1OOJ A;  1YVH A;  3JVT B;  4GBA A;  1AJ4 A;  4MVF A;  1R2U A;  3EVU A;  5AFP A;  1ZAC A;  4E68 A;  1NIW A;  1K9U A;  4CPV A;  1SYM A;  1CFP A;  1JC2 A;  2Y1M A;  4WQ2 A;  2L4I A;  1NCX A;  2ZNE A;  5HYD A;  2JTZ A;  5HLO A;  1K9K A;  1NYA A;  1NPQ A;  4NDC A;  1IJ5 A;  1XK4 A;  1NSH A;  1UHH A;  3JVT C;  1XFV O;  3VRR A;  1XK4 C;  2PMY A;  4ETO A;  2HPS A;  1C7V A;  2M3W A;  1SBJ A;  1W7I B;  1KFU S;  3VRO A;  2KBM A;  1CFC A;  3DVM A;  3EK7 A;  4AQI A;  1DJX A;  3WNX B;  1JFJ A;  1QIV A;  2F2O A;  1HT9 A;  3TDU A;  3EK8 A;  4DCK A;  2PAS A;  4D1E A;  5D69 A;  1A29 A;  1IRJ A;  3CLN A;  3DVJ A;  3EVV A;  1BOD A;  5KSZ A;  1IWQ A;  3KEV A;  1TNQ A;  2ZRS A;  1DJI A;  2M7L A;  3DVK A;  3CWG A;  1BMO A;  2LP2 A;  3AKB A;  4QJ4 B;  2M8U A;  1FI6 A;  1B8C A;  2K7C A;  3F45 A;  1UHJ A;  1YUU A;  1XVJ A;  2BKH B;  1XYD A;  1CTR A;  1Y1A A;  5AAN A;  1E8A A;  5BPJ A;  2JWW A;  2B1U A;  4OCI A;  4C0J A;  2KNE A;  4R1E A;  2K7D A;  3M0W A;  4I5J A;  1SR6 B;  3ZNI A;  2MA2 A;  3BUO B;  2KI4 C;  1JFK A;  1LXF C;  2G2B A;  2NCP A;  2EGD A;  1MF8 B;  2LUX A;  2LM5 A;  1PRW A;  2LAP A;  4GGN A;  2F3Y A;  2NLN A;  2JT3 A;  3WHU B;  3SIA A;  3I5I B;  1NX2 A;  4ORB B;  3SG4 A;  1TIZ A;  2KI6 D;  2M7N A;  1SR6 C;  2F2P A;  4YBH B;  5DKR A;  5HKY A;  1DMO A;  2M1K B;  2I18 A;  4DRW A;  4YGB B;  1EXR A;  1BJF A;  3TS5 B;  4PCW A;  4YRU A;  1FBV A;  1YUS A;  1WY9 A;  1Y6W A;  1N2D A;  2KGB C;  4PHN A;  1SY9 A;  1SPY A;  3TDZ A;  3I5I C;  1G8I A;  1F4Q A;  4JWQ A;  3LL8 B;  5I8N A;  1M45 A;  1NX1 A;  3CZT X;  3PAL A;  3SIB A;  2I7A A;  3TS5 C;  2CCM A;  4GNK B;  1RK9 A;  4I5N B;  1OE9 B;  2KI6 C;  2BCX A;  1EL4 A;  1B8R A;  1QLK A;  2LLT A;  4MSP A;  4DIR A;  1IQ3 A;  2BKI B;  2KBI A;  1M63 B;  3EKJ A;  1KFX S;  2E30 A;  3PAT A;  2Y4Q A;  1TRF A;  1BT6 A;  1WRK A;  2DOQ A;  1ZFS A;  3CGA A;  1PAL A;  3I5H B;  2PSR A;  4MN0 A;  2FJU B;  4A4B A;  2JU0 A;  1SL7 A;  3OB2 B;  3SG5 A;  2EC6 B;  2JOJ A;  4F0Z B;  2L98 A;  3FS7 A;  2BE6 A;  2PAL A;  1YX8 A;  4MZJ A;  5I2L A;  1KSO A;  3LK0 A;  1IQ5 A;  3I5G B;  1XFW O;  1FF1 A;  3PSR A;  1ALV A;  1S6C A;  1MWN A;  1H4B A;  3I5H C;  2IS9 A;  1F71 A;  2WCE A;  1S6J A;  1NCY A;  2EC6 C;  1PSR A;  3DF0 B;  2CBL A;  3OB1 B;  4NQG A;  1A4P A;  3AKA A;  1MQ1 A;  3SG3 A;  1BR4 B;  2GV5 A;  2NCO A;  3TUY B;  3OX5 A;  4BY5 A;  1JF2 A;  3I5G C;  3SG6 A;  3O6B A;  3OX6 A;  2WND A;  1S26 D;  1Y1U A;  2LVI A;  3MSE B;  1RFJ A;  2JC2 A;  4IL1 A;  3A4U B;  1CDN A;  1L7Z A;  1GQM A;  1QIW A;  3EKH A;  1DJW A;  3O4Y A;  1KWO B;  2M97 A;  5G08 A;  2BE4 A;  1K2H A;  5AXI A;  4YI8 A;  1QV1 A;  1V1F A;  1J7O A;  4HSZ A;  3DD4 A;  5AER A;  3TUY C;  2QPT A;  4P5O E;  1PSB A;  2FCE A;  2JRF A;  2ZKM X;  4L9M A;  1G4Y R;  1LA3 A;  3GK4 X;  1AVS A;  1QVI Y;  1V1G A;  4CLN A;  1ODB A;  3GOF A;  4OV2 A;  5I2O A;  1KWO C;  4YGE B;  2LE9 B;  4GUK A;  4C0K A;  1L2O B;  1B7T Z;  1OMD A;  1QX5 B;  1WLZ A;  1NP8 A;  1CB1 A;  1QVI Z;  2KFG A;  3KPX A;  1ZUZ A;  1SK6 D;  1J1E A;  4YGA A;  4ORA B;  5I2Q A;  2ZND A;  1EJ3 A;  1NX0 A;  1CM1 A;  1REC A;  2M49 B;  1ZMZ A;  3NXA A;  1B47 A;  1L2O C;  2LHI A;  2SCP A;  4N1G A;  1S6I A;  1SCM B;  5GQQ C;  3GK2 A;  1J1D A;  2JNF A;  1K93 D;  2COL B;  1B9A A;  2KI4 B;  1WRL A;  1SRA A;  1K96 A;  2KHN A;  1TNW A;  1DJY A;  4MZK A;  1MXE A;  4MEW A;  1J7R A;  2M9G A;  4DUQ A;  5KU1 A;  5J3X A;  1ZOT B;  4N5X A;  3CTN A;  4PDZ A;  3NSO A;  1K9P A;  1SCM C;  5JJG A;  1WRZ A;  2F3Z A;  1UUR A;  2BCA A;  2JPT A;  1DTL A;  2WOS A;  3VRP A;  1CKK A;  3BUM B;  1CDP A;  5DKN A;  1BG1 A;  1SMG A;  4OR9 B;  2LUC A;  1DGV A;  4FQO A;  4A4C A;  1W7J B;  1CNP A;  4M2O A;  2MLE C;  4PHM A;  4U8D A;  2JTT A;  2OTG B;  2K2A A;  1RJV A;  1SCV A;  2JUL A;  2KYF A;  3PFV A;  2OS8 B;  2ZRT A;  1QXP A;  1AJ5 A;  1AK8 A;  3TZ1 A;  2FCD A;  3EK4 A;  2Y5I A;  2LNK A;  2VRG A;  3PN7 B;  1KSM A;  5B8I B;  4ORC B;  2HET A;  4NDD A;  4QJ5 B;  4OKH A;  2JQ6 A;  2Q4U A;  3LCP C;  1OQP A;  2KQY A;  4PE4 A;  2OTG C;  1MUX A;  4GGF A;  5JOL A;  1A75 B;  4GGF C;  2OS8 C;  4ZCU A;  2I94 A;  3PN7 C;  1NX3 A;  1XFY O;  2LP3 A;  1GGZ A;  4M2Q A;  1OZO A;  4P2Y B;  3IQQ A;  1B4C A;  4BY4 A;  4MRY A;  1A75 A;  4MZL A;  3ZWH A;  1NWD A;  2CNP A;  4YGD B;  5CSF A;  2H2K A; 
#chains in the Genus database with same CATH topology
 1LA0 A;  3B87 A;  1MXL C;  5FI2 A;  2JT0 A;  3VGO A;  2HQ8 A;  2KYC A;  3RLZ A;  1LS8 A;  1CLB A;  1DJG A;  3KO0 A;  3IF7 A;  1M31 A;  2R2I A;  1DVI A;  1EH2 A;  1OMR A;  1A03 A;  4MLW A;  1UHN A;  3D10 A;  2BBN A;  2TN4 A;  3VRN A;  2JXC A;  1DF0 B;  4QJ3 B;  1KK7 Y;  1WLM A;  4DS7 A;  3SS4 A;  4NDB A;  2MJW B;  1YR5 A;  1QX2 A;  2L2E A;  1SL9 A;  1KK7 Z;  2AAO A;  1DGU A;  3CR4 X;  4JPZ B;  2KAX A;  3FWC A;  1KK8 B;  3SG7 A;  1DF0 A;  1CM4 A;  1TUZ A;  2K0J A;  1QJT A;  1ALW A;  3PLF B;  1AUI B;  4JKT A;  3BFH A;  4UPG A;  4F7F A;  1PVA A;  4ICB A;  1XO5 A;  1BF5 A;  2Q91 A;  2D8N A;  1LIN A;  5ER4 X;  1TCF A;  2KQ6 A;  3B86 A;  1F8H A;  2F8P A;  2L51 A;  1N65 A;  2H61 A;  1A2X A;  5AEQ A;  2LMU A;  4OZD A;  1YUT A;  2H61 C;  5CSN A;  1CDM A;  1XFZ O;  2P6B B;  1KK8 C;  1X02 A;  2KSP A;  2HF5 A;  2MAZ A;  1LVC D;  2LMV A;  3BQ3 A;  3CZ2 A;  1B7T Y;  3GK1 A;  5HKZ A;  1UWO A;  2HQW A;  1TN4 A;  2P71 A;  3C1V A;  3D75 A;  1ORG A;  5PAL A;  1BR1 B;  3B88 A;  4M2P A;  2CXJ A;  1XA5 A;  2K8M B;  1SKT A;  1B8L A;  1F54 A;  3PM2 A;  2GGZ A;  2FOT A;  2MHH A;  4FTG A;  1EG3 A;  1R6P A;  1NCZ A;  3ICB A;  1PVB A;  3DYE A;  3HX4 A;  2NXQ A;  1Q80 A;  3PJI A;  1UP5 A;  4HRG A;  1S5G Y;  3L4L A;  2M0R A;  3CR2 A;  4C0L A;  2QEB A;  4PE1 A;  4MBE A;  1J7P A;  4Q04 A;  1S3P A;  3WXA A;  1UHI A;  1S5G Z;  2KDH A;  4OVN F;  4GAO A;  2LMT A;  3FIA A;  1FPW A;  2KAV A;  1JUO A;  1OSA A;  3D78 A;  3LLE A;  3AAJ A;  5EL2 A;  1Z4H A;  3S0B A;  2CTN A;  2MBX A;  4ZCV A;  5HL1 A;  1G33 A;  1UUS A;  3SG2 A;  1XFU O;  1QV0 A;  2F33 A;  2WOR A;  1EG4 A;  3CR5 X;  3FWB A;  2AUC A;  1QAT A;  1UHK A;  3DVE A;  1J7Q A;  2PVB A;  1RTP 1;  1Y0V H;  4PE0 A;  1FI5 A;  3A8R A;  3H4S E;  2LHL A;  2RGI A;  1YTZ C;  3IQO A;  3R1V A;  3UNW A;  5D3O A;  3K1E A;  1QTX A;  2K61 A;  1MHO A;  2KLE A;  5IBW A;  1JBA A;  2MLF C;  2Y1N A;  5HLV A;  2L5X B;  5I94 A;  2K2F A;  1YRU B;  1MR8 A;  1D1O A;  2JT8 A;  1DEK A;  3L4A A;  3VRQ A;  1CMG A;  1NUB A;  2ISD A;  4AOM A;  1PUL A;  4I5K A;  2JNX A;  5DKQ A;  1K90 D;  3D76 A;  3CS1 A;  1CDL A;  1RRO A;  2KOT A;  2WCJ A;  3RZS A;  3JTD B;  3BFB A;  1F4O A;  1OMV A;  1AP4 A;  1KFU L;  1Z2C B;  4I5L B;  1CLL A;  3NHT A;  3O78 A;  4CFQ A;  1U5I B;  1F70 A;  4XJK B;  1BU3 A;  2AMI A;  3R72 A;  4AQJ A;  2V53 A;  1QS7 A;  1QWV A;  1KCY A;  2BAP A;  1YX7 A;  3JTD C;  1IJ6 A;  3IVT A;  5CSI A;  2O5G A;  3NSL A;  1GJY A;  3BYA A;  4N1F A;  1QAS A;  1C7W A;  3BXK A;  2JXL A;  2PRU A;  4PHK A;  1U5I A;  3BUX B;  2O60 A;  2WCF A;  4XJK A;  5CPV A;  3L47 A;  1C3Y A;  3BUN B;  4PE7 A;  1XFR A;  1DJZ A;  3KHE A;  3AAK A;  5K89 A;  1H8B A;  2LCP A;  1HQV A;  2QAC A;  3K21 A;  4GFT A;  2KFF A;  2LV7 A;  1YRT B;  4HRE E;  4WQ3 A;  2MRD A;  1SW8 A;  2KFH A;  4KYN A;  1K94 A;  2BEC A;  2GGM A;  2LLS A;  3E3R A;  4PHJ A;  1CLM A;  1CFF A;  4TNC A;  5HKW A;  3QRX A;  2I2R E;  3OHM B;  3SS5 A;  5CSJ A;  2WCB A;  3NHI A;  2BL0 B;  5TNC A;  5KTY A;  3SJS A;  3BOW B;  4CID A;  2OPO A;  1IKU A;  4HRH A;  2KGR A;  1OZS A;  2ZN8 A;  1OW4 A;  4USL A;  2QEO A;  1JWD A;  1SNL A;  1JF0 A;  3TDI A;  1KQV A;  1WDC B;  1DJH A;  1IG5 A;  1KQM B;  2LVV A;  1S36 A;  3LK1 A;  1YUR A;  3EVR A;  2BL0 C;  3BOW A;  3NSI A;  4PAL A;  4WRI A;  1OOG A;  5ER5 A;  1M39 A;  1J55 A;  4YI9 A;  2K7O A;  1CMF A;  1K95 A;  1Y1X A;  2L4H A;  2L5Y A;  1BLQ A;  1F55 A;  1LKJ A;  3BJH A;  1CFD A;  2ZN9 A;  3D0Y B;  1S1E A;  4GPL B;  4YGC B;  1JSA A;  1OOI X;  1QX7 A;  1TCO B;  1VRK A;  3PM8 A;  1B1G A;  1XFX O;  1BOC A;  1GGW A;  1SL8 A;  2G9B A;  1AHR A;  1WDC C;  1KQM C;  3KF9 A;  2LC5 A;  2BCB A;  1IH0 A;  5D7F A;  2BBM A;  2L0P A;  3I5F B;  2WC8 A;  2LVJ A;  3O2P A;  3OP0 A;  3SS3 A;  2JZI A;  1KFX L;  1PK0 D;  2EHB A;  2SAS A;  3R1O A;  4XYN A;  3D0Y A;  1YVL A;  2LAN A;  3FE9 A;  1K8U A;  1QLS A;  2A4J A;  2NZ0 A;  3NSK A;  4CFR A;  3V2L A;  2LLU A;  1C07 A;  3BUW B;  2K7B A;  1DT7 B;  5FYX A;  3RM1 A;  2M1U A;  2ZFD A;  4MRX A;  3HCM A;  1N0Y A;  2L50 A;  3S0A A;  2CT9 A;  5F6T A;  3I5F C;  1IGV A;  3DF0 A;  1TNP A;  2E6W A;  2KAY A;  2WCK A;  1TTX A;  4JQ0 D;  1TOP A;  1RWY A;  1FW4 A;  2LVK A;  2M29 A;  1TNX A;  1M46 A;  1OOJ A;  1YVH A;  3JVT B;  4GBA A;  3S0F A;  1AJ4 A;  2WCH A;  4MVF A;  1R2U A;  3EVU A;  5AFP A;  1ZAC A;  4E68 A;  3DZT A;  1NIW A;  1K9U A;  4CPV A;  1SYM A;  1CFP A;  1JC2 A;  2Y1M A;  4WQ2 A;  2L4I A;  1NCX A;  2ZNE A;  5HYD A;  2JTZ A;  3B6X A;  5HLO A;  1K9K A;  1NYA A;  1NPQ A;  2P70 A;  1IJ5 A;  4NDC A;  1XK4 A;  1NSH A;  1UHH A;  3JVT C;  5FI7 A;  1XFV O;  3VRR A;  1XK4 C;  2PMY A;  4ETO A;  2HPS A;  1C7V A;  2M3W A;  1SBJ A;  1W7I B;  1KFU S;  3VRO A;  2KBM A;  1CFC A;  3DVM A;  3EK7 A;  4AQI A;  1DJX A;  3WNX B;  3CZ0 A;  1JFJ A;  1QIV A;  2F2O A;  1HT9 A;  3TDU A;  3EK8 A;  4DCK A;  2PAS A;  4D1E A;  5D69 A;  1A29 A;  3O4X A;  1IRJ A;  3CLN A;  3DVJ A;  3EVV A;  1BOD A;  2WCM A;  5KSZ A;  1IWQ A;  3KEV A;  1TNQ A;  2ZRS A;  1DJI A;  2M7L A;  3DVK A;  3CWG A;  1BMO A;  2LP2 A;  3AKB A;  4QJ4 B;  2M8U A;  1FI6 A;  1B8C A;  2H8V A;  2K7C A;  3F45 A;  1UHJ A;  2BNX A;  1YUU A;  1XVJ A;  2BKH B;  1XYD A;  1CTR A;  1Y1A A;  5AAN A;  1E8A A;  5BPJ A;  2JWW A;  3CAB A;  2B1U A;  3B7A A;  4OCI A;  2KNE A;  4C0J A;  4R1E A;  2K7D A;  3M0W A;  4I5J A;  1SR6 B;  3ZNI A;  2MA2 A;  3BUO B;  1DEL A;  2KI4 C;  1JFK A;  1LXF C;  2G2B A;  2NCP A;  2EGD A;  1MF8 B;  2LUX A;  2LM5 A;  1PRW A;  2LAP A;  4GGN A;  2F3Y A;  2NLN A;  2JT3 A;  3WHU B;  3SIA A;  3I5I B;  1NX2 A;  4ORB B;  3SG4 A;  1TIZ A;  1W9Z A;  2KI6 D;  2M7N A;  1SR6 C;  1OOF A;  2F2P A;  4YBH B;  5DKR A;  5HKY A;  1DMO A;  2M1K B;  2I18 A;  4DRW A;  4YGB B;  1EXR A;  1BJF A;  3N7H A;  3TS5 B;  4PCW A;  1TWO A;  4YRU A;  1FBV A;  3D74 A;  1YUS A;  3S0G A;  1WY9 A;  1Y6W A;  1N2D A;  2KGB C;  4PHN A;  1SY9 A;  1SPY A;  3TDZ A;  3I5I C;  1SSE B;  1G8I A;  1F4Q A;  4JWQ A;  3LL8 B;  5I8N A;  1M45 A;  1NX1 A;  3CZT X;  3PAL A;  3SIB A;  3D77 A;  2I7A A;  3TS5 C;  2CCM A;  4GNK B;  1RK9 A;  4I5N B;  1OE9 B;  3OGN A;  2KI6 C;  2BCX A;  3S0D A;  1EL4 A;  1B8R A;  1QLK A;  2LLT A;  3CYZ A;  4MSP A;  4DIR A;  1IQ3 A;  2BKI B;  2KBI A;  1M63 B;  3EKJ A;  1KFX S;  2E30 A;  3PAT A;  1T14 A;  2Y4Q A;  1TRF A;  1BT6 A;  1WRK A;  2DOQ A;  1ZFS A;  3CGA A;  1PAL A;  3I5H B;  2PSR A;  4MN0 A;  2FJU B;  3S0E A;  4A4B A;  2JU0 A;  1SL7 A;  3OB2 B;  3SG5 A;  2EC6 B;  2JOJ A;  4F0Z B;  2ERB A;  2L98 A;  3FS7 A;  2BE6 A;  2PAL A;  1YX8 A;  3BFA A;  4MZJ A;  1KSO A;  5I2L A;  4JD9 A;  3LK0 A;  1IQ5 A;  2K60 A;  3I5G B;  1XFW O;  1FF1 A;  3PSR A;  1ALV A;  1S6C A;  1MWN A;  1OOH A;  1H4B A;  3I5H C;  2IS9 A;  1F71 A;  2WCE A;  1S6J A;  1NCY A;  2EC6 C;  1PSR A;  3DF0 B;  2CBL A;  3UO9 A;  3OB1 B;  4NQG A;  1A4P A;  3AKA A;  1MQ1 A;  4INX A;  3SG3 A;  1BR4 B;  2GV5 A;  2NCO A;  3TUY B;  3OX5 A;  4BY5 A;  1JF2 A;  3I5G C;  3SG6 A;  3O6B A;  3OX6 A;  2WND A;  1S26 D;  1Y1U A;  2LVI A;  3MSE B;  1RFJ A;  2JC2 A;  3QME A;  4IL1 A;  3A4U B;  5FI6 A;  1CDN A;  3DY9 A;  1L7Z A;  1GQM A;  1QIW A;  2GTE A;  2L2C A;  3EKH A;  1DJW A;  3O4Y A;  1GM0 A;  1KWO B;  2M97 A;  5G08 A;  2BE4 A;  2WCL A;  1K2H A;  5AXI A;  4YI8 A;  1DC1 A;  1QV1 A;  1V1F A;  1J7O A;  4HSZ A;  3DD4 A;  5AER A;  3TUY C;  2QPT A;  2WC6 A;  4P5O E;  1PSB A;  2FCE A;  2JRF A;  2ZKM X;  4L9M A;  1G4Y R;  1LA3 A;  3GK4 X;  1AVS A;  1QVI Y;  1V1G A;  2QDI A;  4CLN A;  1ODB A;  1DQE A;  2JPO A;  3FE8 A;  1TUJ A;  1KWO C;  3GOF A;  4OV2 A;  4YGE B;  5I2O A;  2LE9 B;  4GUK A;  4C0K A;  1L2O B;  1B7T Z;  1OMD A;  1QX5 B;  1WLZ A;  1NP8 A;  1CB1 A;  1QVI Z;  2KFG A;  3KPX A;  1ZUZ A;  1SK6 D;  1J1E A;  4YGA A;  1C3Z A;  4ORA B;  3VB1 A;  5I2Q A;  2ZND A;  1EJ3 A;  1NX0 A;  1CM1 A;  1REC A;  2M49 B;  1ZMZ A;  4INW A;  3NXA A;  3R1P A;  1B47 A;  1L2O C;  2WC5 A;  2LHI A;  2SCP A;  4N1G A;  2QEV A;  1S6I A;  1SCM B;  5GQQ C;  3GK2 A;  1J1D A;  2JNF A;  1K93 D;  2COL B;  1B9A A;  2KI4 B;  1WRL A;  1SRA A;  1K96 A;  2KHN A;  1TNW A;  1DJY A;  4MZK A;  1MXE A;  2KLD A;  3OBV A;  4MEW A;  1J7R A;  2M9G A;  4DUQ A;  5KU1 A;  5J3X A;  4IJ7 A;  1ZOT B;  4N5X A;  3DXL A;  3CTN A;  4PDZ A;  2FJY A;  3NSO A;  1K9P A;  1SCM C;  2QEH A;  1WRZ A;  2F3Z A;  5JJG A;  1UUR A;  2BCA A;  2JPT A;  1DTL A;  2WOS A;  3CDN A;  3VRP A;  1CKK A;  3BUM B;  1CDP A;  5DKN A;  1BG1 A;  1SMG A;  4OR9 B;  2LUC A;  5DIC A;  1DGV A;  4FQO A;  4A4C A;  1W7J B;  4PT1 A;  1CNP A;  4M2O A;  2MLE C;  4PHM A;  2YGU A;  4U8D A;  2JTT A;  2OTG B;  2K2A A;  1RJV A;  1SCV A;  3NGV A;  2JUL A;  1IIO A;  2KYF A;  3PFV A;  2PYQ A;  2OS8 B;  2ZRT A;  1QXP A;  1AJ5 A;  1AK8 A;  3TZ1 A;  2FCD A;  3EK4 A;  2Y5I A;  3FE6 A;  2LNK A;  2VRG A;  3PN7 B;  1KSM A;  5B8I B;  4ORC B;  2HET A;  4NDD A;  3CZ1 A;  4QJ5 B;  4OKH A;  2JQ6 A;  2Q4U A;  3LCP C;  1OQP A;  2KQY A;  4PE4 A;  2OTG C;  1MUX A;  4GGF A;  5JOL A;  3WHT B;  1A75 B;  4GGF C;  2OS8 C;  4FQT A;  4ZCU A;  3Q8I A;  2I94 A;  3PN7 C;  1P28 A;  3D73 A;  1NX3 A;  1XFY O;  2LP3 A;  1GGZ A;  4M2Q A;  3EG5 B;  2KPH A;  1OZO A;  4P2Y B;  3IQQ A;  1B4C A;  2PQL A;  4BY4 A;  4MRY A;  1A75 A;  4MZL A;  3ZWH A;  1NWD A;  2CNP A;  4YGD B;  5CSF A;  2H2K A; 
#chains in the Genus database with same CATH homology
 1LA0 A;  1MXL C;  2JT0 A;  3VGO A;  2HQ8 A;  2KYC A;  3RLZ A;  1CLB A;  1DJG A;  3KO0 A;  3IF7 A;  1M31 A;  2R2I A;  1DVI A;  1EH2 A;  1OMR A;  1A03 A;  4MLW A;  1UHN A;  3D10 A;  2BBN A;  2TN4 A;  3VRN A;  2JXC A;  1DF0 B;  4QJ3 B;  1KK7 Y;  1WLM A;  4DS7 A;  4NDB A;  2MJW B;  1QX2 A;  1YR5 A;  2L2E A;  1SL9 A;  1KK7 Z;  2AAO A;  1DGU A;  3CR4 X;  4JPZ B;  2KAX A;  3FWC A;  1KK8 B;  3SG7 A;  1DF0 A;  1CM4 A;  2K0J A;  1QJT A;  1ALW A;  3PLF B;  1AUI B;  4UPG A;  1PVA A;  4ICB A;  1XO5 A;  1BF5 A;  2Q91 A;  2D8N A;  1LIN A;  5ER4 X;  1TCF A;  2KQ6 A;  1F8H A;  2F8P A;  2L51 A;  1N65 A;  2H61 A;  1A2X A;  5AEQ A;  2LMU A;  1YUT A;  2H61 C;  5CSN A;  1CDM A;  1XFZ O;  2P6B B;  1KK8 C;  1X02 A;  2KSP A;  2HF5 A;  2MAZ A;  1LVC D;  2LMV A;  3BQ3 A;  1B7T Y;  3GK1 A;  5HKZ A;  1UWO A;  2HQW A;  1TN4 A;  3C1V A;  5PAL A;  1BR1 B;  4M2P A;  2CXJ A;  1XA5 A;  2K8M B;  1SKT A;  1B8L A;  1F54 A;  2GGZ A;  2FOT A;  2MHH A;  4FTG A;  1EG3 A;  1R6P A;  1NCZ A;  3ICB A;  1PVB A;  3HX4 A;  2NXQ A;  1Q80 A;  1UP5 A;  4HRG A;  1S5G Y;  2M0R A;  3CR2 A;  4C0L A;  4PE1 A;  4MBE A;  1J7P A;  4Q04 A;  1S3P A;  3WXA A;  1UHI A;  1S5G Z;  2KDH A;  4OVN F;  4GAO A;  2LMT A;  3FIA A;  1FPW A;  2KAV A;  1JUO A;  1OSA A;  3LLE A;  3AAJ A;  2CTN A;  2MBX A;  4ZCV A;  1G33 A;  1UUS A;  3SG2 A;  1XFU O;  1QV0 A;  2F33 A;  2WOR A;  1EG4 A;  3CR5 X;  3FWB A;  2AUC A;  1QAT A;  1UHK A;  3DVE A;  1J7Q A;  2PVB A;  1RTP 1;  1Y0V H;  4PE0 A;  1FI5 A;  3A8R A;  3H4S E;  2LHL A;  2RGI A;  1YTZ C;  3IQO A;  1JBA A;  1QTX A;  2K61 A;  1MHO A;  5IBW A;  2MLF C;  2Y1N A;  5HLV A;  2L5X B;  2K2F A;  1YRU B;  1MR8 A;  1D1O A;  2JT8 A;  3VRQ A;  1CMG A;  1NUB A;  2ISD A;  4AOM A;  1PUL A;  4I5K A;  2JNX A;  5DKQ A;  1K90 D;  3CS1 A;  1CDL A;  1RRO A;  2KOT A;  3JTD B;  1AP4 A;  1F4O A;  1OMV A;  1KFU L;  4I5L B;  1CLL A;  3O78 A;  4CFQ A;  1U5I B;  1F70 A;  4XJK B;  1BU3 A;  2AMI A;  4AQJ A;  2V53 A;  1QS7 A;  1KCY A;  1YX7 A;  3JTD C;  1IJ6 A;  5CSI A;  2O5G A;  3NSL A;  1GJY A;  3BYA A;  4N1F A;  1QAS A;  1C7W A;  3BXK A;  2JXL A;  2PRU A;  4PHK A;  1U5I A;  3BUX B;  2O60 A;  2WCF A;  4XJK A;  5CPV A;  3BUN B;  4PE7 A;  1DJZ A;  3KHE A;  3AAK A;  5K89 A;  1H8B A;  2LCP A;  1HQV A;  2QAC A;  3K21 A;  4GFT A;  2KFF A;  2LV7 A;  1YRT B;  4HRE E;  4WQ3 A;  2MRD A;  1SW8 A;  2KFH A;  3WHT B;  1K94 A;  2BEC A;  2GGM A;  2LLS A;  3E3R A;  4PHJ A;  1CLM A;  1CFF A;  4TNC A;  5HKW A;  3QRX A;  2I2R E;  3OHM B;  5CSJ A;  2WCB A;  2BL0 B;  5TNC A;  5KTY A;  3SJS A;  3BOW B;  4CID A;  2OPO A;  1IKU A;  4HRH A;  2KGR A;  1OZS A;  2ZN8 A;  4USL A;  1JWD A;  1SNL A;  1JF0 A;  3TDI A;  1KQV A;  1WDC B;  1DJH A;  1IG5 A;  1KQM B;  2LVV A;  1S36 A;  3LK1 A;  1YUR A;  3EVR A;  2BL0 C;  3BOW A;  3NSI A;  4PAL A;  4WRI A;  5ER5 A;  1M39 A;  1J55 A;  4YI9 A;  2K7O A;  1CMF A;  1K95 A;  1Y1X A;  2L4H A;  1BLQ A;  1F55 A;  1LKJ A;  1CFD A;  2ZN9 A;  3D0Y B;  1S1E A;  4GPL B;  4YGC B;  1JSA A;  1QX7 A;  1TCO B;  1VRK A;  3PM8 A;  1B1G A;  1XFX O;  1BOC A;  1GGW A;  1SL8 A;  2G9B A;  1AHR A;  1WDC C;  1KQM C;  3KF9 A;  2LC5 A;  2BCB A;  1IH0 A;  5D7F A;  2BBM A;  2L0P A;  3I5F B;  2WC8 A;  2LVJ A;  3O2P A;  3OP0 A;  2JZI A;  1KFX L;  1PK0 D;  2EHB A;  2SAS A;  4XYN A;  3D0Y A;  1YVL A;  2LAN A;  1K8U A;  1QLS A;  2A4J A;  2NZ0 A;  3NSK A;  4CFR A;  2LLU A;  1C07 A;  3BUW B;  2K7B A;  1DT7 B;  5FYX A;  3RM1 A;  2M1U A;  2ZFD A;  4MRX A;  3HCM A;  1N0Y A;  2L50 A;  2CT9 A;  5F6T A;  3I5F C;  1IGV A;  3DF0 A;  1TNP A;  2E6W A;  2KAY A;  1TTX A;  4JQ0 D;  1TOP A;  1RWY A;  1FW4 A;  2LVK A;  2M29 A;  1TNX A;  1M46 A;  1OOJ A;  1YVH A;  3JVT B;  4GBA A;  1AJ4 A;  4MVF A;  1R2U A;  3EVU A;  5AFP A;  1ZAC A;  4E68 A;  1NIW A;  1K9U A;  4CPV A;  1SYM A;  1CFP A;  1JC2 A;  2Y1M A;  4WQ2 A;  2L4I A;  1NCX A;  2ZNE A;  5HYD A;  2JTZ A;  5HLO A;  1K9K A;  1NYA A;  1NPQ A;  4NDC A;  1IJ5 A;  1XK4 A;  1NSH A;  1UHH A;  3JVT C;  1XFV O;  3VRR A;  1XK4 C;  2PMY A;  4ETO A;  2HPS A;  1C7V A;  2M3W A;  1SBJ A;  1W7I B;  1KFU S;  3VRO A;  2KBM A;  1CFC A;  3DVM A;  3EK7 A;  4AQI A;  1DJX A;  3WNX B;  1JFJ A;  1QIV A;  2F2O A;  1HT9 A;  3TDU A;  3EK8 A;  4DCK A;  2PAS A;  4D1E A;  5D69 A;  1A29 A;  1IRJ A;  3CLN A;  3DVJ A;  3EVV A;  1BOD A;  5KSZ A;  1IWQ A;  3KEV A;  1TNQ A;  2ZRS A;  1DJI A;  2M7L A;  3DVK A;  3CWG A;  1BMO A;  2LP2 A;  3AKB A;  4QJ4 B;  2M8U A;  1FI6 A;  1B8C A;  2K7C A;  3F45 A;  1UHJ A;  1YUU A;  1XVJ A;  2BKH B;  1XYD A;  1CTR A;  1Y1A A;  5AAN A;  1E8A A;  5BPJ A;  2JWW A;  2B1U A;  4OCI A;  4C0J A;  2KNE A;  4R1E A;  2K7D A;  3M0W A;  4I5J A;  1SR6 B;  3ZNI A;  2MA2 A;  3BUO B;  2KI4 C;  1JFK A;  1LXF C;  2G2B A;  2NCP A;  2EGD A;  1MF8 B;  2LUX A;  2LM5 A;  1PRW A;  2LAP A;  4GGN A;  2F3Y A;  2NLN A;  2JT3 A;  3WHU B;  3SIA A;  3I5I B;  1NX2 A;  4ORB B;  3SG4 A;  1TIZ A;  2KI6 D;  2M7N A;  1SR6 C;  2F2P A;  4YBH B;  5DKR A;  5HKY A;  1DMO A;  2M1K B;  2I18 A;  4DRW A;  4YGB B;  1EXR A;  1BJF A;  3TS5 B;  4PCW A;  4YRU A;  1FBV A;  1YUS A;  1WY9 A;  1Y6W A;  1N2D A;  2KGB C;  4PHN A;  1SY9 A;  1SPY A;  3TDZ A;  3I5I C;  1G8I A;  1F4Q A;  4JWQ A;  3LL8 B;  5I8N A;  1M45 A;  1NX1 A;  3CZT X;  3PAL A;  3SIB A;  2I7A A;  3TS5 C;  2CCM A;  4GNK B;  1RK9 A;  4I5N B;  1OE9 B;  2KI6 C;  2BCX A;  1EL4 A;  1B8R A;  1QLK A;  2LLT A;  4MSP A;  4DIR A;  1IQ3 A;  2BKI B;  2KBI A;  1M63 B;  3EKJ A;  1KFX S;  2E30 A;  3PAT A;  2Y4Q A;  1TRF A;  1BT6 A;  1WRK A;  2DOQ A;  1ZFS A;  3CGA A;  1PAL A;  3I5H B;  2PSR A;  4MN0 A;  2FJU B;  4A4B A;  2JU0 A;  1SL7 A;  3OB2 B;  3SG5 A;  2EC6 B;  2JOJ A;  4F0Z B;  2L98 A;  3FS7 A;  2BE6 A;  2PAL A;  1YX8 A;  4MZJ A;  5I2L A;  1KSO A;  3LK0 A;  1IQ5 A;  3I5G B;  1XFW O;  1FF1 A;  3PSR A;  1ALV A;  1S6C A;  1MWN A;  1H4B A;  3I5H C;  2IS9 A;  1F71 A;  2WCE A;  1S6J A;  1NCY A;  2EC6 C;  1PSR A;  3DF0 B;  2CBL A;  3OB1 B;  4NQG A;  1A4P A;  3AKA A;  1MQ1 A;  3SG3 A;  1BR4 B;  2GV5 A;  2NCO A;  3TUY B;  3OX5 A;  4BY5 A;  1JF2 A;  3I5G C;  3SG6 A;  3O6B A;  3OX6 A;  2WND A;  1S26 D;  1Y1U A;  2LVI A;  3MSE B;  1RFJ A;  2JC2 A;  4IL1 A;  3A4U B;  1CDN A;  1L7Z A;  1GQM A;  1QIW A;  3EKH A;  1DJW A;  3O4Y A;  1KWO B;  2M97 A;  5G08 A;  2BE4 A;  1K2H A;  5AXI A;  4YI8 A;  1QV1 A;  1V1F A;  1J7O A;  4HSZ A;  3DD4 A;  5AER A;  3TUY C;  2QPT A;  4P5O E;  1PSB A;  2FCE A;  2JRF A;  2ZKM X;  4L9M A;  1G4Y R;  1LA3 A;  3GK4 X;  1AVS A;  1QVI Y;  1V1G A;  4CLN A;  1ODB A;  3GOF A;  4OV2 A;  5I2O A;  1KWO C;  4YGE B;  2LE9 B;  4GUK A;  4C0K A;  1L2O B;  1B7T Z;  1OMD A;  1QX5 B;  1WLZ A;  1NP8 A;  1CB1 A;  1QVI Z;  2KFG A;  3KPX A;  1ZUZ A;  1SK6 D;  1J1E A;  4YGA A;  4ORA B;  5I2Q A;  2ZND A;  1EJ3 A;  1NX0 A;  1CM1 A;  1REC A;  2M49 B;  1ZMZ A;  3NXA A;  1B47 A;  1L2O C;  2LHI A;  2SCP A;  4N1G A;  1S6I A;  1SCM B;  5GQQ C;  3GK2 A;  1J1D A;  2JNF A;  1K93 D;  2COL B;  1B9A A;  2KI4 B;  1WRL A;  1SRA A;  1K96 A;  2KHN A;  1TNW A;  1DJY A;  4MZK A;  1MXE A;  4MEW A;  1J7R A;  2M9G A;  4DUQ A;  5KU1 A;  5J3X A;  1ZOT B;  4N5X A;  3CTN A;  4PDZ A;  3NSO A;  1K9P A;  1SCM C;  5JJG A;  1WRZ A;  2F3Z A;  1UUR A;  2BCA A;  2JPT A;  1DTL A;  2WOS A;  3VRP A;  1CKK A;  3BUM B;  1CDP A;  5DKN A;  1BG1 A;  1SMG A;  4OR9 B;  2LUC A;  1DGV A;  4FQO A;  4A4C A;  1W7J B;  1CNP A;  4M2O A;  2MLE C;  4PHM A;  4U8D A;  2JTT A;  2OTG B;  2K2A A;  1RJV A;  1SCV A;  2JUL A;  2KYF A;  3PFV A;  2OS8 B;  2ZRT A;  1QXP A;  1AJ5 A;  1AK8 A;  3TZ1 A;  2FCD A;  3EK4 A;  2Y5I A;  2LNK A;  2VRG A;  3PN7 B;  1KSM A;  5B8I B;  4ORC B;  2HET A;  4NDD A;  4QJ5 B;  4OKH A;  2JQ6 A;  2Q4U A;  3LCP C;  1OQP A;  2KQY A;  4PE4 A;  2OTG C;  1MUX A;  4GGF A;  5JOL A;  1A75 B;  4GGF C;  2OS8 C;  4ZCU A;  2I94 A;  3PN7 C;  1NX3 A;  1XFY O;  2LP3 A;  1GGZ A;  4M2Q A;  1OZO A;  4P2Y B;  3IQQ A;  1B4C A;  4BY4 A;  4MRY A;  1A75 A;  4MZL A;  3ZWH A;  1NWD A;  2CNP A;  4YGD B;  5CSF A;  2H2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...