2CCMA

X-ray structure of calexcitin from loligo pealeii at 1.8a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
190
structure length
190
Chain Sequence
AAHQLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARATLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGTLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALEXCITIN
publication title Structure of the Neuronal Protein Calexcitin Suggests a Mode of Interaction in Signalling Pathways of Learning and Memory.
pubmed doi rcsb
source organism Loligo pealeii
molecule tags Signaling protein
total genus 80
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ccmA00
1GQMA 1S5GY 4U8DA 4GGNA 1N2DA 4MN0A 3TDUA 1SY9A 2KBMA 3BQ3A 1B1GA 1K9PA 4M2PA 1FI6A 1NWDA 2KGRA 4I5NB 3SIBA 3BXKA 4DUQA 1S26D 5I2OA 2KSPA 2F3YA 1G33A 2VRGA 2KQ6A 1OOJA 4C0KA 1YUSA 3ZNIA 3D0YA 1SW8A 3I5IB 3PALA 1AP4A 4DS7A 1PVAA 1RJVA 2LVKA 3WNXB 1KFUL 3I5IC 3GK2A 2L2EA 2LLUA 2JXCA 1RK9A 2BCBA 5HKZA 4PCWA 4JPZB 3OX5A 2JT8A 1XK4A 2PMYA 2M7NA 2NZ0A 1JSAA 2SASA 2ZRSA 1C7WA 2OTGC 4ZCUA 4UPGA 1JC2A 2KGBC 2KFHA 1JBAA 2KFFA 2L98A 5TNCA 1JUOA 4CFRA 1K96A 4MSPA 2LC5A 2L4HA 3WXAA 2L5XB 3IF7A 2KI6C 3EVRA 3TS5C 2LE9B 1NCXA 1QV1A 2EC6B 2LMVA 1AJ5A 3CR5X 4NDCA 4YGEB 2F2OA 2WC8A 3EK8A 1UHKA 1ZOTB 4PALA 4CFQA 1FF1A 1KFUS 2KAVA 4WQ3A 3DVMA 1S36A 3RM1A 1BR1B 2K2AA 4HRHA 1CFDA 1QIVA 1QLSA 1SL8A 2MLFC 3FIAA 2JXLA 1FI5A 1PULA 4OCIA 1PALA 1ZMZA 4PHKA 2JNXA 1DJGA 1QVIY 1UP5A 4BY4A 2JRFA 3OB1B 2WORA 3JTDC 1DJIA 2NCOA 1F8HA 1EXRA 1A75B 4YBHB 4ZCVA 2PRUA 3TDIA 4FTGA 1YVHA 3CLNA 2LCPA 1KQMC 1S5GZ 5CSJA 3C1VA 1GJYA 1L7ZA 1XA5A 1M31A 2LVVA 3DVEA 1AJ4A 3NSLA 4NDBA 1HT9A 3EK4A 3VRPA 2JU0A 1KK8C 4Q04A 3SG4A 4PE4A 4PE7A 1RFJA 3HX4A 3NSKA 4P2YB 1XFZO 2BKIB 2KI6D 2H61C 4D1EA 2ZKMX 1SK6D 3BUNB 3F45A 1QX5B 1MF8B 1FW4A 4GGFC 1AHRA 4MZKA 1TRFA 3FWCA 1PSBA 5HLOA 1EL4A 1GGZA 1J7QA 1YUTA 1IWQA 1KQVA 1CB1A 3D0YB 3CR2A 1LINA 1CTRA 2JT3A 2JULA 2Q4UA 2M1UA 4N1GA 1XFWO 3PN7C 2EGDA 1V1FA 1CFFA 1DF0A 5CSNA 5ER5A 4A4BA 1SNLA 1TTXA 4HREE 1JFJA 1IQ3A 1ALVA 1NYAA 2F3ZA 1DTLA 5PALA 1NCYA 1UHHA 1K8UA 1TNXA 3EKHA 1CM1A 1F55A 2FCDA 1SPYA 1MQ1A 5IBWA 1U5IA 2ZFDA 2ZN8A 5DKRA 2LLSA 1XYDA 2BBMA 3I5HC 2PALA 3EKJA 3ZWHA 3EVUA 3SG6A 1SR6C 3OB2B 3LCPC 2I2RE 3DVKA 3IQQA 3LK1A 1QVIZ 1CLBA 4NDDA 2K8MB 1E8AA 2HF5A 4XJKA 1NSHA 1F70A 1EJ3A 1K94A 1SRAA 1F4OA 1KWOB 2HETA 2WCBA 4MLWA 3RLZA 1L2OB 2DOQA 3BOWA 5D7FA 1BF5A 1BODA 2BCAA 1NX3A 2K7DA 2BE6A 2MRDA 2QACA 1N0YA 4GBAA 4DCKA 1NPQA 1DMOA 2CTNA 2JNFA 2NCPA 4JWQA 1L2OC 2KFGA 4MRYA 3CR4X 2WOSA 1UURA 1TN4A 2KDHA 5AANA 5HKYA 5CSIA 3SIAA 1QX7A 1W7IB 2JT0A 1H8BA 2COLB 2FJUB 1KCYA 2JC2A 1NUBA 3JVTB 5G08A 1QJTA 1CNPA 3SG7A 1S3PA 1ALWA 3LLEA 2I94A 1Y1XA 1EH2A 1KFXL 1YRTB 2EHBA 1TOPA 2F2PA 2KAYA 2LMUA 4FQOA 5AEQA 1CDNA 1B8RA 2M8UA 1LXFC 1R2UA 1MUXA 3TDZA 1Y1UA 1TIZA 5FYXA 4HRGA 2AUCA 1CM4A 1DJXA 1OSAA 2LVIA 4CIDA 3D10A 3BYAA 4ORAB 5I8NA 1S6IA 2Q91A 1CFCA 5B8IB 3DVJA 3H4SE 1YVLA 1WY9A 2EC6C 1MWNA 1MR8A 3BUMB 1DT7B 2GV5A 3SJSA 1CDPA 5D69A 1J7OA 2LM5A 1DGUA 4YI8A 3KF9A 4OVNF 2CBLA 3AKAA 1LA3A 1JWDA 2BKHB 1A29A 5CSFA 1NX0A 1AUIB 2Y4QA 1YX7A 2G2BA 1KFXS 1RWYA 1WRLA 1WRKA 3IQOA 3SG5A 1IJ5A 1FBVA 2BBNA 1G4YR 1CLMA 1XFXO 2MHHA 2LUXA 3LK0A 2MA2A 1GGWA 4PHNA 2LLTA 1B8CA 2ZRTA 4XYNA 3TZ1A 1SCVA 4YI9A 1ZFSA 2KHNA 2H2KA 2CT9A 2PSRA 4MBEA 1NX1A 1ZUZA 1WLMA 4XJKB 5JJGA 1UHNA 4M2OA 1K90D 3VROA 2NLNA 1X02A 1CMGA 3M0WA 1QIWA 1C7VA 1RECA 3BOWB 4C0JA 2LUCA 2E6WA 1JF2A 1SYMA 2LAPA 2F8PA 4OR9B 1OE9B 1S1EA 4I5JA 2GGZA 4PE1A 1A03A 1M45A 1QX2A 1K9KA 2L50A 4ORBB 1IKUA 4YGBB 1CDMA 2KBIA 1QXPA 2MLEC 4AOMA 1G8IA 4PHMA 1IGVA 1B8LA 1DJYA 1IRJA 2D8NA 2F33A 3I5FB 3O78A 4R1EA 2K7OA 1CKKA 1CFPA 1XFYO 4MVFA 2PVBA 1XK4C 1Y6WA 1SKTA 4YGCB 1Q80A 1BG1A 1YR5A 1XO5A 1F4QA 1UUSA 1PK0D 2R2IA 1OQPA 1UWOA 2I18A 2ZN9A 4F0ZB 1JFKA 2A4JA 1A2XA 1XVJA 5KTYA 2JWWA 5J3XA 1DVIA 4CPVA 3CWGA 3DD4A 2PASA 1SL9A 3O2PA 1B4CA 1B47A 1NIWA 3EK7A 4AQJA 4I5KA 2K7BA 4P5OE 3VRRA 1NP8A 1UHIA 1K93D 1BMOA 2FOTA 4DRWA 2JTTA 1J55A 4YRUA 1DJZA 1EG4A 2BCXA 1M39A 2LMTA 2KOTA 1WDCB 1S6JA 5AERA 1FPWA 1CLLA 2WNDA 1EG3A 4NQGA 1TNQA 2M3WA 3BUOB 1YX8A 1LVCD 1KSMA 3BUWB 1J1EA 1KWOC 3KEVA 2AMIA 1CMFA 1OZSA 4DIRA 2BL0B 2K2FA 1A4PA 2M7LA 1KSOA 1H4BA 3CTNA 2L4IA 3K21A 2BL0C 3WHTB 4E68A 2H61A 2LNKA 2LV7A 4C0LA 4L9MA 1QTXA 1BR4B 3PM8A 5I2LA 1J7RA 2M97A 3KPXA 4GGFA 4MEWA 1BJFA 1BT6A 3GOFA 4PHJA 3NSIA 1Y0VH 3AAJA 5HKWA 2KQYA 2L51A 2HQWA 3JVTC 3GK1A 4GNKB 2SCPA 4ICBA 1TCOB 5BPJA 1LA0A 4OKHA 3E3RA 4BY5A 2ZNEA 3CGAA 1B7TZ 1J1DA 2KAXA 1QATA 2GGMA 1AVSA 3HCMA 5AXIA 3DF0A 3O4YA 1YUUA 4HSZA 1QV0A 3PLFB 2WCEA 3FWBA 1WRZA 1XFUO 2OPOA 3AAKA 4QJ4B 2OTGB 1ZACA 2JPTA 2MJWB 1K2HA 1SBJA 1V1GA 3WHUB 4CLNA 2HQ8A 3I5GB 5JOLA 1LKJA 1M63B 2CXJA 1TCFA 4GAOA 4GFTA 3O6BA 5DKQA 1DF0B 3I5GC 1IQ5A 2KI4B 1UHJA 3TS5B 1NX2A 2JQ6A 3OP0A 1MXEA 4WQ2A 4A4CA 1K9UA 2LHIA 2KI4C 3SG2A 2L0PA 1KK7Y 1MHOA 1TNWA 3OX6A 5CPVA 4YGDB 4MZLA 5KU1A 2KNEA 1SCMB 3SG3A 1U5IB 3GK4X 1IH0A 1BU3A 1Y1AA 4QJ3B 2MBXA 1YTZC 1SCMC 1B9AA 3NXAA 1C07A 1IG5A 2ISDA 2E30A 2WCFA 2G9BA 2M29A 4ORCB 1VRKA 1OMDA 4MZJA 5HLVA 5K89A 5DKNA 3JTDB 3PFVA 1PSRA 1OMVA 1W7JB 4ETOA 2KYCA 1D1OA 3PATA 2LP2A 2M0RA 2Y1MA 4IL1A 5I2QA 2O60A 3MSEB 1OZOA 1K95A 1KQMB 3QRXA 3VGOA 1AK8A 4WRIA 1DJHA 5HYDA 2ZNDA 3TUYB 4PDZA 3CZTX 1IJ6A 2TN4A 3BUXB 2M49B 4QJ5B 2M1KB 4OV2A 1YRUB 3TUYC 4N5XA 1WLZA 2Y1NA 1B7TY 4USLA 5ER4X 1F71A 1KK8B 4N1FA 4I5LB 2JTZA 3A4UB 1OMRA 1HQVA 2OS8B 4YGAA 1YURA 2BE4A 2QPTA 4JQ0D 5GQQC 2MAZA 2CCMA 1DGVA 2OS8C 2Y5IA 2B1UA 3PSRA 3KO0A 1BLQA 4TNCA 4PE0A 2KYFA 2AAOA 2LANA 4AQIA 3OHMB 5F6TA 1QLKA 3I5FC 2O5GA 4MRXA 2IS9A 1S6CA 3VRNA 1M46A 2HPSA 1JF0A 3NSOA 1N65A 3PN7B 1CDLA 2RGIA 4M2QA 2K0JA 1NCZA 1QS7A 1TNPA 3DF0B 2I7AA 2K61A 1DJWA 1SL7A 2K7CA 5AFPA 1BOCA 4GPLB 2JOJA 1XFVO 1RTP1 2LVJA 2NXQA 3A8RA 1F54A 3KHEA 1RROA 3CS1A 3AKBA 2P6BB 1QASA 3ICBA 1J7PA 1R6PA 3EVVA 1KK7Z 2JZIA 3FS7A 2CNPA 2V53A 1A75A 1PRWA 5KSZA 2M9GA 3I5HB 1WDCC 1MXLC 3VRQA 1SMGA 1SR6B 1ODBA 3LL8B 2LP3A 1PVBA 4GUKA 2LHLA 2BECA 2FCEA
chains in the Genus database with same CATH superfamily
1GQMA 1S5GY 4U8DA 4GGNA 1N2DA 4MN0A 3TDUA 1SY9A 2KBMA 3BQ3A 1B1GA 1K9PA 3CABA 4M2PA 1FI6A 1NWDA 2KGRA 4I5NB 3SIBA 3BXKA 4DUQA 3N7HA 1S26D 5I2OA 2KSPA 2F3YA 1G33A 2VRGA 2KQ6A 1OOJA 4C0KA 1IIOA 1YUSA 3ZNIA 3D0YA 1SW8A 3I5IB 3PALA 1AP4A 4DS7A 1PVAA 1RJVA 2LVKA 2QEVA 3D73A 3WNXB 3V2LA 2YGUA 1KFUL 4F7FA 3B87A 3I5IC 3GK2A 2L2EA 2LLUA 2JXCA 3D74A 1RK9A 2BCBA 5HKZA 4PCWA 5D3OA 4JPZB 3OX5A 2JT8A 1XK4A 2L5YA 2PMYA 2JPOA 3BJHA 2M7NA 2NZ0A 1JSAA 2SASA 2ZRSA 1C7WA 5FI6A 2OTGC 4ZCUA 4UPGA 1JC2A 2KGBC 2KFHA 1JBAA 2KFFA 2L98A 5TNCA 1JUOA 4CFRA 1OOGA 1K96A 4MSPA 2LC5A 2L4HA 3WXAA 2L5XB 3D75A 2KI6C 3IF7A 3EVRA 3TS5C 5DICA 2LE9B 1NCXA 1QV1A 1LS8A 2EC6B 2LMVA 1AJ5A 3CR5X 4NDCA 4YGEB 2F2OA 2WC8A 3EK8A 5FI7A 3D76A 1UHKA 1ZOTB 4PALA 4CFQA 1FF1A 1KFUS 2KAVA 4WQ3A 3DVMA 1S36A 3RM1A 1BR1B 2K2AA 4HRHA 1CFDA 1QIVA 1QLSA 1SL8A 2MLFC 3FIAA 2JXLA 2QEHA 1FI5A 1PULA 3B7AA 4OCIA 1PALA 3L47A 1ZMZA 4PHKA 2JNXA 1DJGA 1QVIY 1UP5A 4BY4A 2JRFA 3OB1B 2WORA 3JTDC 1DJIA 2NCOA 1F8HA 1EXRA 1P28A 1A75B 3D78A 4YBHB 4ZCVA 2PRUA 3TDIA 4FTGA 1YVHA 3CLNA 4PT1A 3SS5A 2LCPA 1KQMC 1S5GZ 2WCKA 3DXLA 5CSJA 3C1VA 1GJYA 1L7ZA 1XA5A 1M31A 2LVVA 3DVEA 1AJ4A 3NSLA 4NDBA 1HT9A 4JKTA 3EK4A 3VRPA 2JU0A 1KK8C 4Q04A 3SG4A 2BAPA 4PE4A 3CZ0A 1RFJA 3HX4A 3NSKA 3CZ2A 4P2YB 1XFZO 2BKIB 4PE7A 2KI6D 2H61C 4D1EA 2ZKMX 1SK6D 3BUNB 3F45A 1QX5B 1MF8B 1FW4A 4GGFC 1AHRA 4MZKA 1TRFA 3FWCA 1PSBA 5HLOA 1EL4A 1GGZA 2P71A 1J7QA 1YUTA 1IWQA 1KQVA 3BFHA 1CB1A 3D0YB 4INXA 3CR2A 1LINA 1CTRA 2JT3A 2JULA 1T14A 2Q4UA 2M1UA 4N1GA 3CZ1A 1XFWO 3PN7C 2EGDA 1V1FA 1CFFA 3PJIA 1DF0A 5CSNA 5ER5A 4A4BA 1SNLA 1TTXA 4HREE 1JFJA 1IQ3A 3DYEA 1ALVA 1Z2CB 1NYAA 3R72A 2F3ZA 1DTLA 5PALA 1NCYA 1UHHA 1K8UA 1TNXA 3EKHA 1CM1A 1F55A 2FCDA 1SPYA 1MQ1A 5IBWA 1U5IA 2ZFDA 2ZN8A 5DKRA 2BNXA 2LLSA 1XYDA 2BBMA 3I5HC 2PALA 3EKJA 3ZWHA 3QMEA 3EVUA 3SG6A 1SR6C 3OB2B 3LCPC 2I2RE 2KLDA 3DVKA 3IQQA 3D77A 3LK1A 5HL1A 1QVIZ 1CLBA 4NDDA 2K8MB 1E8AA 2HF5A 4XJKA 1NSHA 2PYQA 1F70A 1EJ3A 1K94A 1SRAA 1F4OA 1KWOB 2HETA 2WCBA 4MLWA 3RLZA 1L2OB 2DOQA 3BOWA 5D7FA 1BF5A 1BODA 2BCAA 1NX3A 2K7DA 2BE6A 2MRDA 2QACA 1N0YA 4GBAA 4IJ7A 1NPQA 3OBVA 2CTNA 2JNFA 2NCPA 4JWQA 1L2OC 1DMOA 2KFGA 4MRYA 3CR4X 2WOSA 1UURA 1TN4A 2KDHA 5AANA 5HKYA 5CSIA 3SIAA 3R1PA 1QX7A 1W7IB 2JT0A 1H8BA 2COLB 2FJUB 1C3ZA 3S0FA 2JC2A 1KCYA 1NUBA 3JVTB 5G08A 1W9ZA 1QJTA 1CNPA 3SG7A 1S3PA 1ALWA 3LLEA 2I94A 1Y1XA 5I94A 1EH2A 1KFXL 1YRTB 2EHBA 1TOPA 2F2PA 2KAYA 2LMUA 4FQOA 5AEQA 1CDNA 1B8RA 2M8UA 1LXFC 1R2UA 1MUXA 3TDZA 3L4AA 1Y1UA 1TIZA 5FYXA 4HRGA 2AUCA 1CM4A 1DJXA 1OSAA 2LVIA 1TUJA 4CIDA 3D10A 3BYAA 4ORAB 5I8NA 1S6IA 2Q91A 1CFCA 5B8IB 3DVJA 3H4SE 3S0DA 1DEKA 1YVLA 3NHTA 1WY9A 2EC6C 1MWNA 1MR8A 3BUMB 1DT7B 2GV5A 3SJSA 1CDPA 5D69A 1J7OA 2LM5A 1DGUA 4YI8A 3KF9A 4OVNF 2CBLA 3AKAA 1LA3A 1JWDA 2BKHB 1A29A 5CSFA 1NX0A 1AUIB 2Y4QA 1YX7A 2G2BA 1KFXS 3UO9A 1RWYA 3SS3A 1WRLA 1WRKA 3IQOA 3SG5A 1IJ5A 1FBVA 2BBNA 1G4YR 1CLMA 1XFXO 2MHHA 2PQLA 2LUXA 3LK0A 1DELA 2MA2A 1GGWA 4PHNA 2LLTA 1B8CA 2ZRTA 4XYNA 3TZ1A 1SCVA 3BFAA 4YI9A 1ZFSA 2KHNA 2H2KA 3Q8IA 2BECA 2CT9A 2PSRA 4MBEA 1NX1A 1ZUZA 1WLMA 1SSEB 4XJKB 1UHNA 4M2OA 1K90D 3VROA 2NLNA 5JJGA 1X02A 1CMGA 3M0WA 1QIWA 1C7VA 1RECA 3BOWB 4C0JA 2LUCA 2E6WA 1JF2A 1SYMA 2LAPA 2F8PA 4OR9B 1OE9B 1S1EA 4I5JA 3R1VA 2GGZA 4PE1A 1A03A 1M45A 1QX2A 1K9KA 2L50A 4ORBB 1IKUA 4YGBB 1CDMA 2KBIA 1QXPA 3SS4A 2MLEC 3S0GA 4JD9A 2WC5A 3NGVA 4AOMA 1G8IA 3L4LA 4PHMA 1IGVA 1B8LA 1DJYA 1IRJA 2D8NA 2F33A 3I5FB 3O78A 4R1EA 2K7OA 1CKKA 2P70A 1CFPA 2QDIA 2WCHA 1XFYO 1DC1A 4MVFA 2PVBA 1XK4C 1Y6WA 1SKTA 4YGCB 3DY9A 1Q80A 1BG1A 3PM2A 1YR5A 1XO5A 1F4QA 1UUSA 3CYZA 1PK0D 2R2IA 1OQPA 3UNWA 2I18A 2ZN9A 4F0ZB 1JFKA 2A4JA 5FI2A 1A2XA 3CDNA 1XVJA 3IVTA 5KTYA 2JWWA 5J3XA 1DVIA 4CPVA 2K60A 3CWGA 3DD4A 3S0AA 2PASA 1SL9A 3O2PA 3B88A 1B4CA 1B47A 1NIWA 3EK7A 4AQJA 4I5KA 2K7BA 4P5OE 1Z4HA 3VRRA 1NP8A 1UHIA 1K93D 1BMOA 2FOTA 4DRWA 2JTTA 1J55A 4YRUA 3S0EA 1DJZA 1EG4A 2BCXA 1M39A 2LMTA 2KOTA 3K1EA 1WDCB 1S6JA 5AERA 1FPWA 1CLLA 2KLEA 1QWVA 2WNDA 1EG3A 4NQGA 1TNQA 4OZDA 2M3WA 3BUOB 1YX8A 1LVCD 1KSMA 3BUWB 1J1EA 1KWOC 3KEVA 2AMIA 1CMFA 1OZSA 4DIRA 2BL0B 2K2FA 2KPHA 1A4PA 2M7LA 1KSOA 1H4BA 3CTNA 2WCLA 2L4IA 3K21A 2BL0C 3WHTB 4E68A 2H61A 2LNKA 1OOHA 2LV7A 3B86A 4C0LA 4L9MA 2WC6A 1QTXA 1BR4B 2QEOA 3PM8A 1J7RA 2M97A 3KPXA 4GGFA 4MEWA 5I2LA 1DQEA 1BJFA 1BT6A 2QEBA 2FJYA 3GOFA 4PHJA 3NSIA 1Y0VH 1GM0A 3AAJA 5HKWA 2KQYA 2L51A 2HQWA 3JVTC 3GK1A 4GNKB 2SCPA 4ICBA 1TCOB 5BPJA 1LA0A 4OKHA 3E3RA 4BY5A 2ZNEA 3CGAA 1B7TZ 1J1DA 2KAXA 4INWA 1QATA 2GGMA 1AVSA 3HCMA 5AXIA 3DF0A 3O4YA 1YUUA 4HSZA 1QV0A 3PLFB 2WCEA 3FWBA 1WRZA 1XFUO 2OPOA 3AAKA 3EG5B 4QJ4B 2OTGB 1ZACA 2JPTA 2MJWB 3VB1A 1SBJA 1K2HA 1V1GA 3WHUB 3FE6A 4CLNA 2HQ8A 3I5GB 5JOLA 1LKJA 1M63B 2CXJA 1TCFA 4GAOA 4GFTA 3O6BA 5DKQA 1DF0B 4KYNA 3I5GC 4FQTA 1IQ5A 1OOFA 1UHJA 2KI4B 3NHIA 3TS5B 1NX2A 2JQ6A 3OP0A 1MXEA 4WQ2A 4A4CA 1K9UA 2LHIA 2KI4C 3OGNA 3SG2A 2L0PA 2GTEA 1KK7Y 1MHOA 1TNWA 3OX6A 5CPVA 4YGDB 4MZLA 5KU1A 2KNEA 1SCMB 3SG3A 1U5IB 3GK4X 1IH0A 1BU3A 1Y1AA 4QJ3B 2MBXA 1YTZC 3DZTA 1SCMC 1B9AA 3NXAA 1C07A 1IG5A 2ISDA 2E30A 2WCFA 2G9BA 2M29A 4ORCB 1VRKA 1OMDA 4MZJA 5HLVA 5K89A 5DKNA 3BFBA 3JTDB 3PFVA 1PSRA 1OMVA 1W7JB 1ORGA 4ETOA 2KYCA 1D1OA 3PATA 2LP2A 2M0RA 2Y1MA 4IL1A 5I2QA 2O60A 3MSEB 1OZOA 1K95A 1KQMB 2WCJA 3QRXA 3VGOA 4WRIA 1DJHA 5HYDA 1AK8A 2ZNDA 3TUYB 4PDZA 3CZTX 1IJ6A 2TN4A 3BUXB 2M49B 1C3YA 4QJ5B 2M1KB 4OV2A 1YRUB 3TUYC 4N5XA 1WLZA 2Y1NA 1B7TY 4USLA 5ER4X 1F71A 3B6XA 1KK8B 4N1FA 4I5LB 2JTZA 1TWOA 1OMRA 1HQVA 2OS8B 3A4UB 2H8VA 4YGAA 1TUZA 1YURA 2BE4A 2QPTA 4JQ0D 5GQQC 2MAZA 2CCMA 3O4XA 1DGVA 2OS8C 2Y5IA 2B1UA 3PSRA 3KO0A 1BLQA 4TNCA 1OOIX 4PE0A 2KYFA 2AAOA 2LANA 4AQIA 3OHMB 5F6TA 5EL2A 2L2CA 1QLKA 3I5FC 3R1OA 2O5GA 4MRXA 2IS9A 1S6CA 3VRNA 1M46A 3RZSA 2HPSA 1JF0A 3NSOA 1N65A 3PN7B 1CDLA 2RGIA 4M2QA 2K0JA 1NCZA 1QS7A 1TNPA 2ERBA 3DF0B 2I7AA 4DCKA 2K61A 1DJWA 1SL7A 2K7CA 3S0BA 5AFPA 1BOCA 4GPLB 2JOJA 1XFVO 1RTP1 2WCMA 2LVJA 2NXQA 3A8RA 1F54A 3KHEA 1RROA 3CS1A 3AKBA 2P6BB 1QASA 3ICBA 1J7PA 1R6PA 3EVVA 1KK7Z 2JZIA 3FS7A 2CNPA 2V53A 1A75A 1OW4A 1XFRA 3FE9A 3FE8A 1PRWA 5KSZA 2M9GA 3I5HB 1WDCC 1MXLC 3VRQA 1SMGA 1SR6B 1ODBA 3LL8B 2LP3A 1PVBA 4GUKA 2LHLA 1UWOA 2FCEA
chains in the Genus database with same CATH topology
1GQMA 1S5GY 4U8DA 4GGNA 1N2DA 4MN0A 3TDUA 1SY9A 2KBMA 3BQ3A 1B1GA 1K9PA 4M2PA 1FI6A 1NWDA 2KGRA 4I5NB 3SIBA 3BXKA 4DUQA 1S26D 5I2OA 2KSPA 2F3YA 1G33A 2VRGA 2KQ6A 1OOJA 4C0KA 1YUSA 3ZNIA 3D0YA 1SW8A 3I5IB 3PALA 1AP4A 4DS7A 1PVAA 1RJVA 2LVKA 3WNXB 1KFUL 3I5IC 3GK2A 2L2EA 2LLUA 2JXCA 1RK9A 2BCBA 5HKZA 4PCWA 4JPZB 3OX5A 2JT8A 1XK4A 2PMYA 2M7NA 2NZ0A 1JSAA 2SASA 2ZRSA 1C7WA 2OTGC 4ZCUA 4UPGA 1JC2A 2KGBC 2KFHA 1JBAA 2KFFA 2L98A 5TNCA 1JUOA 4CFRA 1K96A 4MSPA 2LC5A 2L4HA 3WXAA 2L5XB 3IF7A 2KI6C 3EVRA 3TS5C 2LE9B 1NCXA 1QV1A 2EC6B 2LMVA 1AJ5A 3CR5X 4NDCA 4YGEB 2F2OA 2WC8A 3EK8A 1UHKA 1ZOTB 4PALA 4CFQA 1FF1A 1KFUS 2KAVA 4WQ3A 3DVMA 1S36A 3RM1A 1BR1B 2K2AA 4HRHA 1CFDA 1QIVA 1QLSA 1SL8A 2MLFC 3FIAA 2JXLA 1FI5A 1PULA 4OCIA 1PALA 1ZMZA 4PHKA 2JNXA 1DJGA 1QVIY 1UP5A 4BY4A 2JRFA 3OB1B 2WORA 3JTDC 1DJIA 2NCOA 1F8HA 1EXRA 1A75B 4YBHB 4ZCVA 2PRUA 3TDIA 4FTGA 1YVHA 3CLNA 2LCPA 1KQMC 1S5GZ 5CSJA 3C1VA 1GJYA 1L7ZA 1XA5A 1M31A 2LVVA 3DVEA 1AJ4A 3NSLA 4NDBA 1HT9A 3EK4A 3VRPA 2JU0A 1KK8C 4Q04A 3SG4A 4PE4A 4PE7A 1RFJA 3HX4A 3NSKA 4P2YB 1XFZO 2BKIB 2KI6D 2H61C 4D1EA 2ZKMX 1SK6D 3BUNB 3F45A 1QX5B 1MF8B 1FW4A 4GGFC 1AHRA 4MZKA 1TRFA 3FWCA 1PSBA 5HLOA 1EL4A 1GGZA 1J7QA 1YUTA 1IWQA 1KQVA 1CB1A 3D0YB 3CR2A 1LINA 1CTRA 2JT3A 2JULA 2Q4UA 2M1UA 4N1GA 1XFWO 3PN7C 2EGDA 1V1FA 1CFFA 1DF0A 5CSNA 5ER5A 4A4BA 1SNLA 1TTXA 4HREE 1JFJA 1IQ3A 1ALVA 1NYAA 2F3ZA 1DTLA 5PALA 1NCYA 1UHHA 1K8UA 1TNXA 3EKHA 1CM1A 1F55A 2FCDA 1SPYA 1MQ1A 5IBWA 1U5IA 2ZFDA 2ZN8A 5DKRA 2LLSA 1XYDA 2BBMA 3I5HC 2PALA 3EKJA 3ZWHA 3EVUA 3SG6A 1SR6C 3OB2B 3LCPC 2I2RE 3DVKA 3IQQA 3LK1A 1QVIZ 1CLBA 4NDDA 2K8MB 1E8AA 2HF5A 4XJKA 1NSHA 1F70A 1EJ3A 1K94A 1SRAA 1F4OA 1KWOB 2HETA 2WCBA 4MLWA 3RLZA 1L2OB 2DOQA 3BOWA 5D7FA 1BF5A 1BODA 2BCAA 1NX3A 2K7DA 2BE6A 2MRDA 2QACA 1N0YA 4GBAA 4DCKA 1NPQA 1DMOA 2CTNA 2JNFA 2NCPA 4JWQA 1L2OC 2KFGA 4MRYA 3CR4X 2WOSA 1UURA 1TN4A 2KDHA 5AANA 5HKYA 5CSIA 3SIAA 1QX7A 1W7IB 2JT0A 1H8BA 2COLB 2FJUB 1KCYA 2JC2A 1NUBA 3JVTB 5G08A 1QJTA 1CNPA 3SG7A 1S3PA 1ALWA 3LLEA 2I94A 1Y1XA 1EH2A 1KFXL 1YRTB 2EHBA 1TOPA 2F2PA 2KAYA 2LMUA 4FQOA 5AEQA 1CDNA 1B8RA 2M8UA 1LXFC 1R2UA 1MUXA 3TDZA 1Y1UA 1TIZA 5FYXA 4HRGA 2AUCA 1CM4A 1DJXA 1OSAA 2LVIA 4CIDA 3D10A 3BYAA 4ORAB 5I8NA 1S6IA 2Q91A 1CFCA 5B8IB 3DVJA 3H4SE 1YVLA 1WY9A 2EC6C 1MWNA 1MR8A 3BUMB 1DT7B 2GV5A 3SJSA 1CDPA 5D69A 1J7OA 2LM5A 1DGUA 4YI8A 3KF9A 4OVNF 2CBLA 3AKAA 1LA3A 1JWDA 2BKHB 1A29A 5CSFA 1NX0A 1AUIB 2Y4QA 1YX7A 2G2BA 1KFXS 1RWYA 1WRLA 1WRKA 3IQOA 3SG5A 1IJ5A 1FBVA 2BBNA 1G4YR 1CLMA 1XFXO 2MHHA 2LUXA 3LK0A 2MA2A 1GGWA 4PHNA 2LLTA 1B8CA 2ZRTA 4XYNA 3TZ1A 1SCVA 4YI9A 1ZFSA 2KHNA 2H2KA 2CT9A 2PSRA 4MBEA 1NX1A 1ZUZA 1WLMA 4XJKB 5JJGA 1UHNA 4M2OA 1K90D 3VROA 2NLNA 1X02A 1CMGA 3M0WA 1QIWA 1C7VA 1RECA 3BOWB 4C0JA 2LUCA 2E6WA 1JF2A 1SYMA 2LAPA 2F8PA 4OR9B 1OE9B 1S1EA 4I5JA 2GGZA 4PE1A 1A03A 1M45A 1QX2A 1K9KA 2L50A 4ORBB 1IKUA 4YGBB 1CDMA 2KBIA 1QXPA 2MLEC 4AOMA 1G8IA 4PHMA 1IGVA 1B8LA 1DJYA 1IRJA 2D8NA 2F33A 3I5FB 3O78A 4R1EA 2K7OA 1CKKA 1CFPA 1XFYO 4MVFA 2PVBA 1XK4C 1Y6WA 1SKTA 4YGCB 1Q80A 1BG1A 1YR5A 1XO5A 1F4QA 1UUSA 1PK0D 2R2IA 1OQPA 1UWOA 2I18A 2ZN9A 4F0ZB 1JFKA 2A4JA 1A2XA 1XVJA 5KTYA 2JWWA 5J3XA 1DVIA 4CPVA 3CWGA 3DD4A 2PASA 1SL9A 3O2PA 1B4CA 1B47A 1NIWA 3EK7A 4AQJA 4I5KA 2K7BA 4P5OE 3VRRA 1NP8A 1UHIA 1K93D 1BMOA 2FOTA 4DRWA 2JTTA 1J55A 4YRUA 1DJZA 1EG4A 2BCXA 1M39A 2LMTA 2KOTA 1WDCB 1S6JA 5AERA 1FPWA 1CLLA 2WNDA 1EG3A 4NQGA 1TNQA 2M3WA 3BUOB 1YX8A 1LVCD 1KSMA 3BUWB 1J1EA 1KWOC 3KEVA 2AMIA 1CMFA 1OZSA 4DIRA 2BL0B 2K2FA 1A4PA 2M7LA 1KSOA 1H4BA 3CTNA 2L4IA 3K21A 2BL0C 3WHTB 4E68A 2H61A 2LNKA 2LV7A 4C0LA 4L9MA 1QTXA 1BR4B 3PM8A 5I2LA 1J7RA 2M97A 3KPXA 4GGFA 4MEWA 1BJFA 1BT6A 3GOFA 4PHJA 3NSIA 1Y0VH 3AAJA 5HKWA 2KQYA 2L51A 2HQWA 3JVTC 3GK1A 4GNKB 2SCPA 4ICBA 1TCOB 5BPJA 1LA0A 4OKHA 3E3RA 4BY5A 2ZNEA 3CGAA 1B7TZ 1J1DA 2KAXA 1QATA 2GGMA 1AVSA 3HCMA 5AXIA 3DF0A 3O4YA 1YUUA 4HSZA 1QV0A 3PLFB 2WCEA 3FWBA 1WRZA 1XFUO 2OPOA 3AAKA 4QJ4B 2OTGB 1ZACA 2JPTA 2MJWB 1K2HA 1SBJA 1V1GA 3WHUB 4CLNA 2HQ8A 3I5GB 5JOLA 1LKJA 1M63B 2CXJA 1TCFA 4GAOA 4GFTA 3O6BA 5DKQA 1DF0B 3I5GC 1IQ5A 2KI4B 1UHJA 3TS5B 1NX2A 2JQ6A 3OP0A 1MXEA 4WQ2A 4A4CA 1K9UA 2LHIA 2KI4C 3SG2A 2L0PA 1KK7Y 1MHOA 1TNWA 3OX6A 5CPVA 4YGDB 4MZLA 5KU1A 2KNEA 1SCMB 3SG3A 1U5IB 3GK4X 1IH0A 1BU3A 1Y1AA 4QJ3B 2MBXA 1YTZC 1SCMC 1B9AA 3NXAA 1C07A 1IG5A 2ISDA 2E30A 2WCFA 2G9BA 2M29A 4ORCB 1VRKA 1OMDA 4MZJA 5HLVA 5K89A 5DKNA 3JTDB 3PFVA 1PSRA 1OMVA 1W7JB 4ETOA 2KYCA 1D1OA 3PATA 2LP2A 2M0RA 2Y1MA 4IL1A 5I2QA 2O60A 3MSEB 1OZOA 1K95A 1KQMB 3QRXA 3VGOA 1AK8A 4WRIA 1DJHA 5HYDA 2ZNDA 3TUYB 4PDZA 3CZTX 1IJ6A 2TN4A 3BUXB 2M49B 4QJ5B 2M1KB 4OV2A 1YRUB 3TUYC 4N5XA 1WLZA 2Y1NA 1B7TY 4USLA 5ER4X 1F71A 1KK8B 4N1FA 4I5LB 2JTZA 3A4UB 1OMRA 1HQVA 2OS8B 4YGAA 1YURA 2BE4A 2QPTA 4JQ0D 5GQQC 2MAZA 2CCMA 1DGVA 2OS8C 2Y5IA 2B1UA 3PSRA 3KO0A 1BLQA 4TNCA 4PE0A 2KYFA 2AAOA 2LANA 4AQIA 3OHMB 5F6TA 1QLKA 3I5FC 2O5GA 4MRXA 2IS9A 1S6CA 3VRNA 1M46A 2HPSA 1JF0A 3NSOA 1N65A 3PN7B 1CDLA 2RGIA 4M2QA 2K0JA 1NCZA 1QS7A 1TNPA 3DF0B 2I7AA 2K61A 1DJWA 1SL7A 2K7CA 5AFPA 1BOCA 4GPLB 2JOJA 1XFVO 1RTP1 2LVJA 2NXQA 3A8RA 1F54A 3KHEA 1RROA 3CS1A 3AKBA 2P6BB 1QASA 3ICBA 1J7PA 1R6PA 3EVVA 1KK7Z 2JZIA 3FS7A 2CNPA 2V53A 1A75A 1PRWA 5KSZA 2M9GA 3I5HB 1WDCC 1MXLC 3VRQA 1SMGA 1SR6B 1ODBA 3LL8B 2LP3A 1PVBA 4GUKA 2LHLA 2BECA 2FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQM A;  1S5G Y;  4U8D A;  4GGN A;  1N2D A;  4MN0 A;  3TDU A;  1SY9 A;  2KBM A;  3BQ3 A;  1B1G A;  1K9P A;  4M2P A;  1FI6 A;  1NWD A;  2KGR A;  4I5N B;  3SIB A;  3BXK A;  4DUQ A;  1S26 D;  5I2O A;  2KSP A;  2F3Y A;  1G33 A;  2VRG A;  2KQ6 A;  1OOJ A;  4C0K A;  1YUS A;  3ZNI A;  3D0Y A;  1SW8 A;  3I5I B;  3PAL A;  1AP4 A;  4DS7 A;  1PVA A;  1RJV A;  2LVK A;  3WNX B;  1KFU L;  3I5I C;  3GK2 A;  2L2E A;  2LLU A;  2JXC A;  1RK9 A;  2BCB A;  5HKZ A;  4PCW A;  4JPZ B;  3OX5 A;  2JT8 A;  1XK4 A;  2PMY A;  2M7N A;  2NZ0 A;  1JSA A;  2SAS A;  2ZRS A;  1C7W A;  2OTG C;  4ZCU A;  4UPG A;  1JC2 A;  2KGB C;  2KFH A;  1JBA A;  2KFF A;  2L98 A;  5TNC A;  1JUO A;  4CFR A;  1K96 A;  4MSP A;  2LC5 A;  2L4H A;  3WXA A;  2L5X B;  3IF7 A;  2KI6 C;  3EVR A;  3TS5 C;  2LE9 B;  1NCX A;  1QV1 A;  2EC6 B;  2LMV A;  1AJ5 A;  3CR5 X;  4NDC A;  4YGE B;  2F2O A;  2WC8 A;  3EK8 A;  1UHK A;  1ZOT B;  4PAL A;  4CFQ A;  1FF1 A;  1KFU S;  2KAV A;  4WQ3 A;  3DVM A;  1S36 A;  3RM1 A;  1BR1 B;  2K2A A;  4HRH A;  1CFD A;  1QIV A;  1QLS A;  1SL8 A;  2MLF C;  3FIA A;  2JXL A;  1FI5 A;  1PUL A;  4OCI A;  1PAL A;  1ZMZ A;  4PHK A;  2JNX A;  1DJG A;  1QVI Y;  1UP5 A;  4BY4 A;  2JRF A;  3OB1 B;  2WOR A;  3JTD C;  1DJI A;  2NCO A;  1F8H A;  1EXR A;  1A75 B;  4YBH B;  4ZCV A;  2PRU A;  3TDI A;  4FTG A;  1YVH A;  3CLN A;  2LCP A;  1KQM C;  1S5G Z;  5CSJ A;  3C1V A;  1GJY A;  1L7Z A;  1XA5 A;  1M31 A;  2LVV A;  3DVE A;  1AJ4 A;  3NSL A;  4NDB A;  1HT9 A;  3EK4 A;  3VRP A;  2JU0 A;  1KK8 C;  4Q04 A;  3SG4 A;  4PE4 A;  4PE7 A;  1RFJ A;  3HX4 A;  3NSK A;  4P2Y B;  1XFZ O;  2BKI B;  2KI6 D;  2H61 C;  4D1E A;  2ZKM X;  1SK6 D;  3BUN B;  3F45 A;  1QX5 B;  1MF8 B;  1FW4 A;  4GGF C;  1AHR A;  4MZK A;  1TRF A;  3FWC A;  1PSB A;  5HLO A;  1EL4 A;  1GGZ A;  1J7Q A;  1YUT A;  1IWQ A;  1KQV A;  1CB1 A;  3D0Y B;  3CR2 A;  1LIN A;  1CTR A;  2JT3 A;  2JUL A;  2Q4U A;  2M1U A;  4N1G A;  1XFW O;  3PN7 C;  2EGD A;  1V1F A;  1CFF A;  1DF0 A;  5CSN A;  5ER5 A;  4A4B A;  1SNL A;  1TTX A;  4HRE E;  1JFJ A;  1IQ3 A;  1ALV A;  1NYA A;  2F3Z A;  1DTL A;  5PAL A;  1NCY A;  1UHH A;  1K8U A;  1TNX A;  3EKH A;  1CM1 A;  1F55 A;  2FCD A;  1SPY A;  1MQ1 A;  5IBW A;  1U5I A;  2ZFD A;  2ZN8 A;  5DKR A;  2LLS A;  1XYD A;  2BBM A;  3I5H C;  2PAL A;  3EKJ A;  3ZWH A;  3EVU A;  3SG6 A;  1SR6 C;  3OB2 B;  3LCP C;  2I2R E;  3DVK A;  3IQQ A;  3LK1 A;  1QVI Z;  1CLB A;  4NDD A;  2K8M B;  1E8A A;  2HF5 A;  4XJK A;  1NSH A;  1F70 A;  1EJ3 A;  1K94 A;  1SRA A;  1F4O A;  1KWO B;  2HET A;  2WCB A;  4MLW A;  3RLZ A;  1L2O B;  2DOQ A;  3BOW A;  5D7F A;  1BF5 A;  1BOD A;  2BCA A;  1NX3 A;  2K7D A;  2BE6 A;  2MRD A;  2QAC A;  1N0Y A;  4GBA A;  4DCK A;  1NPQ A;  1DMO A;  2CTN A;  2JNF A;  2NCP A;  4JWQ A;  1L2O C;  2KFG A;  4MRY A;  3CR4 X;  2WOS A;  1UUR A;  1TN4 A;  2KDH A;  5AAN A;  5HKY A;  5CSI A;  3SIA A;  1QX7 A;  1W7I B;  2JT0 A;  1H8B A;  2COL B;  2FJU B;  1KCY A;  2JC2 A;  1NUB A;  3JVT B;  5G08 A;  1QJT A;  1CNP A;  3SG7 A;  1S3P A;  1ALW A;  3LLE A;  2I94 A;  1Y1X A;  1EH2 A;  1KFX L;  1YRT B;  2EHB A;  1TOP A;  2F2P A;  2KAY A;  2LMU A;  4FQO A;  5AEQ A;  1CDN A;  1B8R A;  2M8U A;  1LXF C;  1R2U A;  1MUX A;  3TDZ A;  1Y1U A;  1TIZ A;  5FYX A;  4HRG A;  2AUC A;  1CM4 A;  1DJX A;  1OSA A;  2LVI A;  4CID A;  3D10 A;  3BYA A;  4ORA B;  5I8N A;  1S6I A;  2Q91 A;  1CFC A;  5B8I B;  3DVJ A;  3H4S E;  1YVL A;  1WY9 A;  2EC6 C;  1MWN A;  1MR8 A;  3BUM B;  1DT7 B;  2GV5 A;  3SJS A;  1CDP A;  5D69 A;  1J7O A;  2LM5 A;  1DGU A;  4YI8 A;  3KF9 A;  4OVN F;  2CBL A;  3AKA A;  1LA3 A;  1JWD A;  2BKH B;  1A29 A;  5CSF A;  1NX0 A;  1AUI B;  2Y4Q A;  1YX7 A;  2G2B A;  1KFX S;  1RWY A;  1WRL A;  1WRK A;  3IQO A;  3SG5 A;  1IJ5 A;  1FBV A;  2BBN A;  1G4Y R;  1CLM A;  1XFX O;  2MHH A;  2LUX A;  3LK0 A;  2MA2 A;  1GGW A;  4PHN A;  2LLT A;  1B8C A;  2ZRT A;  4XYN A;  3TZ1 A;  1SCV A;  4YI9 A;  1ZFS A;  2KHN A;  2H2K A;  2CT9 A;  2PSR A;  4MBE A;  1NX1 A;  1ZUZ A;  1WLM A;  4XJK B;  5JJG A;  1UHN A;  4M2O A;  1K90 D;  3VRO A;  2NLN A;  1X02 A;  1CMG A;  3M0W A;  1QIW A;  1C7V A;  1REC A;  3BOW B;  4C0J A;  2LUC A;  2E6W A;  1JF2 A;  1SYM A;  2LAP A;  2F8P A;  4OR9 B;  1OE9 B;  1S1E A;  4I5J A;  2GGZ A;  4PE1 A;  1A03 A;  1M45 A;  1QX2 A;  1K9K A;  2L50 A;  4ORB B;  1IKU A;  4YGB B;  1CDM A;  2KBI A;  1QXP A;  2MLE C;  4AOM A;  1G8I A;  4PHM A;  1IGV A;  1B8L A;  1DJY A;  1IRJ A;  2D8N A;  2F33 A;  3I5F B;  3O78 A;  4R1E A;  2K7O A;  1CKK A;  1CFP A;  1XFY O;  4MVF A;  2PVB A;  1XK4 C;  1Y6W A;  1SKT A;  4YGC B;  1Q80 A;  1BG1 A;  1YR5 A;  1XO5 A;  1F4Q A;  1UUS A;  1PK0 D;  2R2I A;  1OQP A;  1UWO A;  2I18 A;  2ZN9 A;  4F0Z B;  1JFK A;  2A4J A;  1A2X A;  1XVJ A;  5KTY A;  2JWW A;  5J3X A;  1DVI A;  4CPV A;  3CWG A;  3DD4 A;  2PAS A;  1SL9 A;  3O2P A;  1B4C A;  1B47 A;  1NIW A;  3EK7 A;  4AQJ A;  4I5K A;  2K7B A;  4P5O E;  3VRR A;  1NP8 A;  1UHI A;  1K93 D;  1BMO A;  2FOT A;  4DRW A;  2JTT A;  1J55 A;  4YRU A;  1DJZ A;  1EG4 A;  2BCX A;  1M39 A;  2LMT A;  2KOT A;  1WDC B;  1S6J A;  5AER A;  1FPW A;  1CLL A;  2WND A;  1EG3 A;  4NQG A;  1TNQ A;  2M3W A;  3BUO B;  1YX8 A;  1LVC D;  1KSM A;  3BUW B;  1J1E A;  1KWO C;  3KEV A;  2AMI A;  1CMF A;  1OZS A;  4DIR A;  2BL0 B;  2K2F A;  1A4P A;  2M7L A;  1KSO A;  1H4B A;  3CTN A;  2L4I A;  3K21 A;  2BL0 C;  3WHT B;  4E68 A;  2H61 A;  2LNK A;  2LV7 A;  4C0L A;  4L9M A;  1QTX A;  1BR4 B;  3PM8 A;  5I2L A;  1J7R A;  2M97 A;  3KPX A;  4GGF A;  4MEW A;  1BJF A;  1BT6 A;  3GOF A;  4PHJ A;  3NSI A;  1Y0V H;  3AAJ A;  5HKW A;  2KQY A;  2L51 A;  2HQW A;  3JVT C;  3GK1 A;  4GNK B;  2SCP A;  4ICB A;  1TCO B;  5BPJ A;  1LA0 A;  4OKH A;  3E3R A;  4BY5 A;  2ZNE A;  3CGA A;  1B7T Z;  1J1D A;  2KAX A;  1QAT A;  2GGM A;  1AVS A;  3HCM A;  5AXI A;  3DF0 A;  3O4Y A;  1YUU A;  4HSZ A;  1QV0 A;  3PLF B;  2WCE A;  3FWB A;  1WRZ A;  1XFU O;  2OPO A;  3AAK A;  4QJ4 B;  2OTG B;  1ZAC A;  2JPT A;  2MJW B;  1K2H A;  1SBJ A;  1V1G A;  3WHU B;  4CLN A;  2HQ8 A;  3I5G B;  5JOL A;  1LKJ A;  1M63 B;  2CXJ A;  1TCF A;  4GAO A;  4GFT A;  3O6B A;  5DKQ A;  1DF0 B;  3I5G C;  1IQ5 A;  2KI4 B;  1UHJ A;  3TS5 B;  1NX2 A;  2JQ6 A;  3OP0 A;  1MXE A;  4WQ2 A;  4A4C A;  1K9U A;  2LHI A;  2KI4 C;  3SG2 A;  2L0P A;  1KK7 Y;  1MHO A;  1TNW A;  3OX6 A;  5CPV A;  4YGD B;  4MZL A;  5KU1 A;  2KNE A;  1SCM B;  3SG3 A;  1U5I B;  3GK4 X;  1IH0 A;  1BU3 A;  1Y1A A;  4QJ3 B;  2MBX A;  1YTZ C;  1SCM C;  1B9A A;  3NXA A;  1C07 A;  1IG5 A;  2ISD A;  2E30 A;  2WCF A;  2G9B A;  2M29 A;  4ORC B;  1VRK A;  1OMD A;  4MZJ A;  5HLV A;  5K89 A;  5DKN A;  3JTD B;  3PFV A;  1PSR A;  1OMV A;  1W7J B;  4ETO A;  2KYC A;  1D1O A;  3PAT A;  2LP2 A;  2M0R A;  2Y1M A;  4IL1 A;  5I2Q A;  2O60 A;  3MSE B;  1OZO A;  1K95 A;  1KQM B;  3QRX A;  3VGO A;  1AK8 A;  4WRI A;  1DJH A;  5HYD A;  2ZND A;  3TUY B;  4PDZ A;  3CZT X;  1IJ6 A;  2TN4 A;  3BUX B;  2M49 B;  4QJ5 B;  2M1K B;  4OV2 A;  1YRU B;  3TUY C;  4N5X A;  1WLZ A;  2Y1N A;  1B7T Y;  4USL A;  5ER4 X;  1F71 A;  1KK8 B;  4N1F A;  4I5L B;  2JTZ A;  3A4U B;  1OMR A;  1HQV A;  2OS8 B;  4YGA A;  1YUR A;  2BE4 A;  2QPT A;  4JQ0 D;  5GQQ C;  2MAZ A;  2CCM A;  1DGV A;  2OS8 C;  2Y5I A;  2B1U A;  3PSR A;  3KO0 A;  1BLQ A;  4TNC A;  4PE0 A;  2KYF A;  2AAO A;  2LAN A;  4AQI A;  3OHM B;  5F6T A;  1QLK A;  3I5F C;  2O5G A;  4MRX A;  2IS9 A;  1S6C A;  3VRN A;  1M46 A;  2HPS A;  1JF0 A;  3NSO A;  1N65 A;  3PN7 B;  1CDL A;  2RGI A;  4M2Q A;  2K0J A;  1NCZ A;  1QS7 A;  1TNP A;  3DF0 B;  2I7A A;  2K61 A;  1DJW A;  1SL7 A;  2K7C A;  5AFP A;  1BOC A;  4GPL B;  2JOJ A;  1XFV O;  1RTP 1;  2LVJ A;  2NXQ A;  3A8R A;  1F54 A;  3KHE A;  1RRO A;  3CS1 A;  3AKB A;  2P6B B;  1QAS A;  3ICB A;  1J7P A;  1R6P A;  3EVV A;  1KK7 Z;  2JZI A;  3FS7 A;  2CNP A;  2V53 A;  1A75 A;  1PRW A;  5KSZ A;  2M9G A;  3I5H B;  1WDC C;  1MXL C;  3VRQ A;  1SMG A;  1SR6 B;  1ODB A;  3LL8 B;  2LP3 A;  1PVB A;  4GUK A;  2LHL A;  2BEC A;  2FCE A; 
#chains in the Genus database with same CATH topology
 1GQM A;  1S5G Y;  4U8D A;  4GGN A;  1N2D A;  4MN0 A;  3TDU A;  1SY9 A;  2KBM A;  3BQ3 A;  1B1G A;  1K9P A;  3CAB A;  4M2P A;  1FI6 A;  1NWD A;  2KGR A;  4I5N B;  3SIB A;  3BXK A;  4DUQ A;  3N7H A;  1S26 D;  5I2O A;  2KSP A;  2F3Y A;  1G33 A;  2VRG A;  2KQ6 A;  1OOJ A;  4C0K A;  1IIO A;  1YUS A;  3ZNI A;  3D0Y A;  1SW8 A;  3I5I B;  3PAL A;  1AP4 A;  4DS7 A;  1PVA A;  1RJV A;  2LVK A;  2QEV A;  3D73 A;  3WNX B;  3V2L A;  2YGU A;  1KFU L;  4F7F A;  3B87 A;  3I5I C;  3GK2 A;  2L2E A;  2LLU A;  2JXC A;  3D74 A;  1RK9 A;  2BCB A;  5HKZ A;  4PCW A;  5D3O A;  4JPZ B;  3OX5 A;  2JT8 A;  1XK4 A;  2L5Y A;  2PMY A;  2JPO A;  3BJH A;  2M7N A;  2NZ0 A;  1JSA A;  2SAS A;  2ZRS A;  1C7W A;  5FI6 A;  2OTG C;  4ZCU A;  4UPG A;  1JC2 A;  2KGB C;  2KFH A;  1JBA A;  2KFF A;  2L98 A;  5TNC A;  1JUO A;  4CFR A;  1OOG A;  1K96 A;  4MSP A;  2LC5 A;  2L4H A;  3WXA A;  2L5X B;  3D75 A;  2KI6 C;  3IF7 A;  3EVR A;  3TS5 C;  5DIC A;  2LE9 B;  1NCX A;  1QV1 A;  1LS8 A;  2EC6 B;  2LMV A;  1AJ5 A;  3CR5 X;  4NDC A;  4YGE B;  2F2O A;  2WC8 A;  3EK8 A;  5FI7 A;  3D76 A;  1UHK A;  1ZOT B;  4PAL A;  4CFQ A;  1FF1 A;  1KFU S;  2KAV A;  4WQ3 A;  3DVM A;  1S36 A;  3RM1 A;  1BR1 B;  2K2A A;  4HRH A;  1CFD A;  1QIV A;  1QLS A;  1SL8 A;  2MLF C;  3FIA A;  2JXL A;  2QEH A;  1FI5 A;  1PUL A;  3B7A A;  4OCI A;  1PAL A;  3L47 A;  1ZMZ A;  4PHK A;  2JNX A;  1DJG A;  1QVI Y;  1UP5 A;  4BY4 A;  2JRF A;  3OB1 B;  2WOR A;  3JTD C;  1DJI A;  2NCO A;  1F8H A;  1EXR A;  1P28 A;  1A75 B;  3D78 A;  4YBH B;  4ZCV A;  2PRU A;  3TDI A;  4FTG A;  1YVH A;  3CLN A;  4PT1 A;  3SS5 A;  2LCP A;  1KQM C;  1S5G Z;  2WCK A;  3DXL A;  5CSJ A;  3C1V A;  1GJY A;  1L7Z A;  1XA5 A;  1M31 A;  2LVV A;  3DVE A;  1AJ4 A;  3NSL A;  4NDB A;  1HT9 A;  4JKT A;  3EK4 A;  3VRP A;  2JU0 A;  1KK8 C;  4Q04 A;  3SG4 A;  2BAP A;  4PE4 A;  3CZ0 A;  1RFJ A;  3HX4 A;  3NSK A;  3CZ2 A;  4P2Y B;  1XFZ O;  2BKI B;  4PE7 A;  2KI6 D;  2H61 C;  4D1E A;  2ZKM X;  1SK6 D;  3BUN B;  3F45 A;  1QX5 B;  1MF8 B;  1FW4 A;  4GGF C;  1AHR A;  4MZK A;  1TRF A;  3FWC A;  1PSB A;  5HLO A;  1EL4 A;  1GGZ A;  2P71 A;  1J7Q A;  1YUT A;  1IWQ A;  1KQV A;  3BFH A;  1CB1 A;  3D0Y B;  4INX A;  3CR2 A;  1LIN A;  1CTR A;  2JT3 A;  2JUL A;  1T14 A;  2Q4U A;  2M1U A;  4N1G A;  3CZ1 A;  1XFW O;  3PN7 C;  2EGD A;  1V1F A;  1CFF A;  3PJI A;  1DF0 A;  5CSN A;  5ER5 A;  4A4B A;  1SNL A;  1TTX A;  4HRE E;  1JFJ A;  1IQ3 A;  3DYE A;  1ALV A;  1Z2C B;  1NYA A;  3R72 A;  2F3Z A;  1DTL A;  5PAL A;  1NCY A;  1UHH A;  1K8U A;  1TNX A;  3EKH A;  1CM1 A;  1F55 A;  2FCD A;  1SPY A;  1MQ1 A;  5IBW A;  1U5I A;  2ZFD A;  2ZN8 A;  5DKR A;  2BNX A;  2LLS A;  1XYD A;  2BBM A;  3I5H C;  2PAL A;  3EKJ A;  3ZWH A;  3QME A;  3EVU A;  3SG6 A;  1SR6 C;  3OB2 B;  3LCP C;  2I2R E;  2KLD A;  3DVK A;  3IQQ A;  3D77 A;  3LK1 A;  5HL1 A;  1QVI Z;  1CLB A;  4NDD A;  2K8M B;  1E8A A;  2HF5 A;  4XJK A;  1NSH A;  2PYQ A;  1F70 A;  1EJ3 A;  1K94 A;  1SRA A;  1F4O A;  1KWO B;  2HET A;  2WCB A;  4MLW A;  3RLZ A;  1L2O B;  2DOQ A;  3BOW A;  5D7F A;  1BF5 A;  1BOD A;  2BCA A;  1NX3 A;  2K7D A;  2BE6 A;  2MRD A;  2QAC A;  1N0Y A;  4GBA A;  4IJ7 A;  1NPQ A;  3OBV A;  2CTN A;  2JNF A;  2NCP A;  4JWQ A;  1L2O C;  1DMO A;  2KFG A;  4MRY A;  3CR4 X;  2WOS A;  1UUR A;  1TN4 A;  2KDH A;  5AAN A;  5HKY A;  5CSI A;  3SIA A;  3R1P A;  1QX7 A;  1W7I B;  2JT0 A;  1H8B A;  2COL B;  2FJU B;  1C3Z A;  3S0F A;  2JC2 A;  1KCY A;  1NUB A;  3JVT B;  5G08 A;  1W9Z A;  1QJT A;  1CNP A;  3SG7 A;  1S3P A;  1ALW A;  3LLE A;  2I94 A;  1Y1X A;  5I94 A;  1EH2 A;  1KFX L;  1YRT B;  2EHB A;  1TOP A;  2F2P A;  2KAY A;  2LMU A;  4FQO A;  5AEQ A;  1CDN A;  1B8R A;  2M8U A;  1LXF C;  1R2U A;  1MUX A;  3TDZ A;  3L4A A;  1Y1U A;  1TIZ A;  5FYX A;  4HRG A;  2AUC A;  1CM4 A;  1DJX A;  1OSA A;  2LVI A;  1TUJ A;  4CID A;  3D10 A;  3BYA A;  4ORA B;  5I8N A;  1S6I A;  2Q91 A;  1CFC A;  5B8I B;  3DVJ A;  3H4S E;  3S0D A;  1DEK A;  1YVL A;  3NHT A;  1WY9 A;  2EC6 C;  1MWN A;  1MR8 A;  3BUM B;  1DT7 B;  2GV5 A;  3SJS A;  1CDP A;  5D69 A;  1J7O A;  2LM5 A;  1DGU A;  4YI8 A;  3KF9 A;  4OVN F;  2CBL A;  3AKA A;  1LA3 A;  1JWD A;  2BKH B;  1A29 A;  5CSF A;  1NX0 A;  1AUI B;  2Y4Q A;  1YX7 A;  2G2B A;  1KFX S;  3UO9 A;  1RWY A;  3SS3 A;  1WRL A;  1WRK A;  3IQO A;  3SG5 A;  1IJ5 A;  1FBV A;  2BBN A;  1G4Y R;  1CLM A;  1XFX O;  2MHH A;  2PQL A;  2LUX A;  3LK0 A;  1DEL A;  2MA2 A;  1GGW A;  4PHN A;  2LLT A;  1B8C A;  2ZRT A;  4XYN A;  3TZ1 A;  1SCV A;  3BFA A;  4YI9 A;  1ZFS A;  2KHN A;  2H2K A;  3Q8I A;  2BEC A;  2CT9 A;  2PSR A;  4MBE A;  1NX1 A;  1ZUZ A;  1WLM A;  1SSE B;  4XJK B;  1UHN A;  4M2O A;  1K90 D;  3VRO A;  2NLN A;  5JJG A;  1X02 A;  1CMG A;  3M0W A;  1QIW A;  1C7V A;  1REC A;  3BOW B;  4C0J A;  2LUC A;  2E6W A;  1JF2 A;  1SYM A;  2LAP A;  2F8P A;  4OR9 B;  1OE9 B;  1S1E A;  4I5J A;  3R1V A;  2GGZ A;  4PE1 A;  1A03 A;  1M45 A;  1QX2 A;  1K9K A;  2L50 A;  4ORB B;  1IKU A;  4YGB B;  1CDM A;  2KBI A;  1QXP A;  3SS4 A;  2MLE C;  3S0G A;  4JD9 A;  2WC5 A;  3NGV A;  4AOM A;  1G8I A;  3L4L A;  4PHM A;  1IGV A;  1B8L A;  1DJY A;  1IRJ A;  2D8N A;  2F33 A;  3I5F B;  3O78 A;  4R1E A;  2K7O A;  1CKK A;  2P70 A;  1CFP A;  2QDI A;  2WCH A;  1XFY O;  1DC1 A;  4MVF A;  2PVB A;  1XK4 C;  1Y6W A;  1SKT A;  4YGC B;  3DY9 A;  1Q80 A;  1BG1 A;  3PM2 A;  1YR5 A;  1XO5 A;  1F4Q A;  1UUS A;  3CYZ A;  1PK0 D;  2R2I A;  1OQP A;  3UNW A;  2I18 A;  2ZN9 A;  4F0Z B;  1JFK A;  2A4J A;  5FI2 A;  1A2X A;  3CDN A;  1XVJ A;  3IVT A;  5KTY A;  2JWW A;  5J3X A;  1DVI A;  4CPV A;  2K60 A;  3CWG A;  3DD4 A;  3S0A A;  2PAS A;  1SL9 A;  3O2P A;  3B88 A;  1B4C A;  1B47 A;  1NIW A;  3EK7 A;  4AQJ A;  4I5K A;  2K7B A;  4P5O E;  1Z4H A;  3VRR A;  1NP8 A;  1UHI A;  1K93 D;  1BMO A;  2FOT A;  4DRW A;  2JTT A;  1J55 A;  4YRU A;  3S0E A;  1DJZ A;  1EG4 A;  2BCX A;  1M39 A;  2LMT A;  2KOT A;  3K1E A;  1WDC B;  1S6J A;  5AER A;  1FPW A;  1CLL A;  2KLE A;  1QWV A;  2WND A;  1EG3 A;  4NQG A;  1TNQ A;  4OZD A;  2M3W A;  3BUO B;  1YX8 A;  1LVC D;  1KSM A;  3BUW B;  1J1E A;  1KWO C;  3KEV A;  2AMI A;  1CMF A;  1OZS A;  4DIR A;  2BL0 B;  2K2F A;  2KPH A;  1A4P A;  2M7L A;  1KSO A;  1H4B A;  3CTN A;  2WCL A;  2L4I A;  3K21 A;  2BL0 C;  3WHT B;  4E68 A;  2H61 A;  2LNK A;  1OOH A;  2LV7 A;  3B86 A;  4C0L A;  4L9M A;  2WC6 A;  1QTX A;  1BR4 B;  2QEO A;  3PM8 A;  1J7R A;  2M97 A;  3KPX A;  4GGF A;  4MEW A;  5I2L A;  1DQE A;  1BJF A;  1BT6 A;  2QEB A;  2FJY A;  3GOF A;  4PHJ A;  3NSI A;  1Y0V H;  1GM0 A;  3AAJ A;  5HKW A;  2KQY A;  2L51 A;  2HQW A;  3JVT C;  3GK1 A;  4GNK B;  2SCP A;  4ICB A;  1TCO B;  5BPJ A;  1LA0 A;  4OKH A;  3E3R A;  4BY5 A;  2ZNE A;  3CGA A;  1B7T Z;  1J1D A;  2KAX A;  4INW A;  1QAT A;  2GGM A;  1AVS A;  3HCM A;  5AXI A;  3DF0 A;  3O4Y A;  1YUU A;  4HSZ A;  1QV0 A;  3PLF B;  2WCE A;  3FWB A;  1WRZ A;  1XFU O;  2OPO A;  3AAK A;  3EG5 B;  4QJ4 B;  2OTG B;  1ZAC A;  2JPT A;  2MJW B;  3VB1 A;  1SBJ A;  1K2H A;  1V1G A;  3WHU B;  3FE6 A;  4CLN A;  2HQ8 A;  3I5G B;  5JOL A;  1LKJ A;  1M63 B;  2CXJ A;  1TCF A;  4GAO A;  4GFT A;  3O6B A;  5DKQ A;  1DF0 B;  4KYN A;  3I5G C;  4FQT A;  1IQ5 A;  1OOF A;  1UHJ A;  2KI4 B;  3NHI A;  3TS5 B;  1NX2 A;  2JQ6 A;  3OP0 A;  1MXE A;  4WQ2 A;  4A4C A;  1K9U A;  2LHI A;  2KI4 C;  3OGN A;  3SG2 A;  2L0P A;  2GTE A;  1KK7 Y;  1MHO A;  1TNW A;  3OX6 A;  5CPV A;  4YGD B;  4MZL A;  5KU1 A;  2KNE A;  1SCM B;  3SG3 A;  1U5I B;  3GK4 X;  1IH0 A;  1BU3 A;  1Y1A A;  4QJ3 B;  2MBX A;  1YTZ C;  3DZT A;  1SCM C;  1B9A A;  3NXA A;  1C07 A;  1IG5 A;  2ISD A;  2E30 A;  2WCF A;  2G9B A;  2M29 A;  4ORC B;  1VRK A;  1OMD A;  4MZJ A;  5HLV A;  5K89 A;  5DKN A;  3BFB A;  3JTD B;  3PFV A;  1PSR A;  1OMV A;  1W7J B;  1ORG A;  4ETO A;  2KYC A;  1D1O A;  3PAT A;  2LP2 A;  2M0R A;  2Y1M A;  4IL1 A;  5I2Q A;  2O60 A;  3MSE B;  1OZO A;  1K95 A;  1KQM B;  2WCJ A;  3QRX A;  3VGO A;  4WRI A;  1DJH A;  5HYD A;  1AK8 A;  2ZND A;  3TUY B;  4PDZ A;  3CZT X;  1IJ6 A;  2TN4 A;  3BUX B;  2M49 B;  1C3Y A;  4QJ5 B;  2M1K B;  4OV2 A;  1YRU B;  3TUY C;  4N5X A;  1WLZ A;  2Y1N A;  1B7T Y;  4USL A;  5ER4 X;  1F71 A;  3B6X A;  1KK8 B;  4N1F A;  4I5L B;  2JTZ A;  1TWO A;  1OMR A;  1HQV A;  2OS8 B;  3A4U B;  2H8V A;  4YGA A;  1TUZ A;  1YUR A;  2BE4 A;  2QPT A;  4JQ0 D;  5GQQ C;  2MAZ A;  2CCM A;  3O4X A;  1DGV A;  2OS8 C;  2Y5I A;  2B1U A;  3PSR A;  3KO0 A;  1BLQ A;  4TNC A;  1OOI X;  4PE0 A;  2KYF A;  2AAO A;  2LAN A;  4AQI A;  3OHM B;  5F6T A;  5EL2 A;  2L2C A;  1QLK A;  3I5F C;  3R1O A;  2O5G A;  4MRX A;  2IS9 A;  1S6C A;  3VRN A;  1M46 A;  3RZS A;  2HPS A;  1JF0 A;  3NSO A;  1N65 A;  3PN7 B;  1CDL A;  2RGI A;  4M2Q A;  2K0J A;  1NCZ A;  1QS7 A;  1TNP A;  2ERB A;  3DF0 B;  2I7A A;  4DCK A;  2K61 A;  1DJW A;  1SL7 A;  2K7C A;  3S0B A;  5AFP A;  1BOC A;  4GPL B;  2JOJ A;  1XFV O;  1RTP 1;  2WCM A;  2LVJ A;  2NXQ A;  3A8R A;  1F54 A;  3KHE A;  1RRO A;  3CS1 A;  3AKB A;  2P6B B;  1QAS A;  3ICB A;  1J7P A;  1R6P A;  3EVV A;  1KK7 Z;  2JZI A;  3FS7 A;  2CNP A;  2V53 A;  1A75 A;  1OW4 A;  1XFR A;  3FE9 A;  3FE8 A;  1PRW A;  5KSZ A;  2M9G A;  3I5H B;  1WDC C;  1MXL C;  3VRQ A;  1SMG A;  1SR6 B;  1ODB A;  3LL8 B;  2LP3 A;  1PVB A;  4GUK A;  2LHL A;  1UWO A;  2FCE A; 
#chains in the Genus database with same CATH homology
 1GQM A;  1S5G Y;  4U8D A;  4GGN A;  1N2D A;  4MN0 A;  3TDU A;  1SY9 A;  2KBM A;  3BQ3 A;  1B1G A;  1K9P A;  4M2P A;  1FI6 A;  1NWD A;  2KGR A;  4I5N B;  3SIB A;  3BXK A;  4DUQ A;  1S26 D;  5I2O A;  2KSP A;  2F3Y A;  1G33 A;  2VRG A;  2KQ6 A;  1OOJ A;  4C0K A;  1YUS A;  3ZNI A;  3D0Y A;  1SW8 A;  3I5I B;  3PAL A;  1AP4 A;  4DS7 A;  1PVA A;  1RJV A;  2LVK A;  3WNX B;  1KFU L;  3I5I C;  3GK2 A;  2L2E A;  2LLU A;  2JXC A;  1RK9 A;  2BCB A;  5HKZ A;  4PCW A;  4JPZ B;  3OX5 A;  2JT8 A;  1XK4 A;  2PMY A;  2M7N A;  2NZ0 A;  1JSA A;  2SAS A;  2ZRS A;  1C7W A;  2OTG C;  4ZCU A;  4UPG A;  1JC2 A;  2KGB C;  2KFH A;  1JBA A;  2KFF A;  2L98 A;  5TNC A;  1JUO A;  4CFR A;  1K96 A;  4MSP A;  2LC5 A;  2L4H A;  3WXA A;  2L5X B;  3IF7 A;  2KI6 C;  3EVR A;  3TS5 C;  2LE9 B;  1NCX A;  1QV1 A;  2EC6 B;  2LMV A;  1AJ5 A;  3CR5 X;  4NDC A;  4YGE B;  2F2O A;  2WC8 A;  3EK8 A;  1UHK A;  1ZOT B;  4PAL A;  4CFQ A;  1FF1 A;  1KFU S;  2KAV A;  4WQ3 A;  3DVM A;  1S36 A;  3RM1 A;  1BR1 B;  2K2A A;  4HRH A;  1CFD A;  1QIV A;  1QLS A;  1SL8 A;  2MLF C;  3FIA A;  2JXL A;  1FI5 A;  1PUL A;  4OCI A;  1PAL A;  1ZMZ A;  4PHK A;  2JNX A;  1DJG A;  1QVI Y;  1UP5 A;  4BY4 A;  2JRF A;  3OB1 B;  2WOR A;  3JTD C;  1DJI A;  2NCO A;  1F8H A;  1EXR A;  1A75 B;  4YBH B;  4ZCV A;  2PRU A;  3TDI A;  4FTG A;  1YVH A;  3CLN A;  2LCP A;  1KQM C;  1S5G Z;  5CSJ A;  3C1V A;  1GJY A;  1L7Z A;  1XA5 A;  1M31 A;  2LVV A;  3DVE A;  1AJ4 A;  3NSL A;  4NDB A;  1HT9 A;  3EK4 A;  3VRP A;  2JU0 A;  1KK8 C;  4Q04 A;  3SG4 A;  4PE4 A;  4PE7 A;  1RFJ A;  3HX4 A;  3NSK A;  4P2Y B;  1XFZ O;  2BKI B;  2KI6 D;  2H61 C;  4D1E A;  2ZKM X;  1SK6 D;  3BUN B;  3F45 A;  1QX5 B;  1MF8 B;  1FW4 A;  4GGF C;  1AHR A;  4MZK A;  1TRF A;  3FWC A;  1PSB A;  5HLO A;  1EL4 A;  1GGZ A;  1J7Q A;  1YUT A;  1IWQ A;  1KQV A;  1CB1 A;  3D0Y B;  3CR2 A;  1LIN A;  1CTR A;  2JT3 A;  2JUL A;  2Q4U A;  2M1U A;  4N1G A;  1XFW O;  3PN7 C;  2EGD A;  1V1F A;  1CFF A;  1DF0 A;  5CSN A;  5ER5 A;  4A4B A;  1SNL A;  1TTX A;  4HRE E;  1JFJ A;  1IQ3 A;  1ALV A;  1NYA A;  2F3Z A;  1DTL A;  5PAL A;  1NCY A;  1UHH A;  1K8U A;  1TNX A;  3EKH A;  1CM1 A;  1F55 A;  2FCD A;  1SPY A;  1MQ1 A;  5IBW A;  1U5I A;  2ZFD A;  2ZN8 A;  5DKR A;  2LLS A;  1XYD A;  2BBM A;  3I5H C;  2PAL A;  3EKJ A;  3ZWH A;  3EVU A;  3SG6 A;  1SR6 C;  3OB2 B;  3LCP C;  2I2R E;  3DVK A;  3IQQ A;  3LK1 A;  1QVI Z;  1CLB A;  4NDD A;  2K8M B;  1E8A A;  2HF5 A;  4XJK A;  1NSH A;  1F70 A;  1EJ3 A;  1K94 A;  1SRA A;  1F4O A;  1KWO B;  2HET A;  2WCB A;  4MLW A;  3RLZ A;  1L2O B;  2DOQ A;  3BOW A;  5D7F A;  1BF5 A;  1BOD A;  2BCA A;  1NX3 A;  2K7D A;  2BE6 A;  2MRD A;  2QAC A;  1N0Y A;  4GBA A;  4DCK A;  1NPQ A;  1DMO A;  2CTN A;  2JNF A;  2NCP A;  4JWQ A;  1L2O C;  2KFG A;  4MRY A;  3CR4 X;  2WOS A;  1UUR A;  1TN4 A;  2KDH A;  5AAN A;  5HKY A;  5CSI A;  3SIA A;  1QX7 A;  1W7I B;  2JT0 A;  1H8B A;  2COL B;  2FJU B;  1KCY A;  2JC2 A;  1NUB A;  3JVT B;  5G08 A;  1QJT A;  1CNP A;  3SG7 A;  1S3P A;  1ALW A;  3LLE A;  2I94 A;  1Y1X A;  1EH2 A;  1KFX L;  1YRT B;  2EHB A;  1TOP A;  2F2P A;  2KAY A;  2LMU A;  4FQO A;  5AEQ A;  1CDN A;  1B8R A;  2M8U A;  1LXF C;  1R2U A;  1MUX A;  3TDZ A;  1Y1U A;  1TIZ A;  5FYX A;  4HRG A;  2AUC A;  1CM4 A;  1DJX A;  1OSA A;  2LVI A;  4CID A;  3D10 A;  3BYA A;  4ORA B;  5I8N A;  1S6I A;  2Q91 A;  1CFC A;  5B8I B;  3DVJ A;  3H4S E;  1YVL A;  1WY9 A;  2EC6 C;  1MWN A;  1MR8 A;  3BUM B;  1DT7 B;  2GV5 A;  3SJS A;  1CDP A;  5D69 A;  1J7O A;  2LM5 A;  1DGU A;  4YI8 A;  3KF9 A;  4OVN F;  2CBL A;  3AKA A;  1LA3 A;  1JWD A;  2BKH B;  1A29 A;  5CSF A;  1NX0 A;  1AUI B;  2Y4Q A;  1YX7 A;  2G2B A;  1KFX S;  1RWY A;  1WRL A;  1WRK A;  3IQO A;  3SG5 A;  1IJ5 A;  1FBV A;  2BBN A;  1G4Y R;  1CLM A;  1XFX O;  2MHH A;  2LUX A;  3LK0 A;  2MA2 A;  1GGW A;  4PHN A;  2LLT A;  1B8C A;  2ZRT A;  4XYN A;  3TZ1 A;  1SCV A;  4YI9 A;  1ZFS A;  2KHN A;  2H2K A;  2CT9 A;  2PSR A;  4MBE A;  1NX1 A;  1ZUZ A;  1WLM A;  4XJK B;  5JJG A;  1UHN A;  4M2O A;  1K90 D;  3VRO A;  2NLN A;  1X02 A;  1CMG A;  3M0W A;  1QIW A;  1C7V A;  1REC A;  3BOW B;  4C0J A;  2LUC A;  2E6W A;  1JF2 A;  1SYM A;  2LAP A;  2F8P A;  4OR9 B;  1OE9 B;  1S1E A;  4I5J A;  2GGZ A;  4PE1 A;  1A03 A;  1M45 A;  1QX2 A;  1K9K A;  2L50 A;  4ORB B;  1IKU A;  4YGB B;  1CDM A;  2KBI A;  1QXP A;  2MLE C;  4AOM A;  1G8I A;  4PHM A;  1IGV A;  1B8L A;  1DJY A;  1IRJ A;  2D8N A;  2F33 A;  3I5F B;  3O78 A;  4R1E A;  2K7O A;  1CKK A;  1CFP A;  1XFY O;  4MVF A;  2PVB A;  1XK4 C;  1Y6W A;  1SKT A;  4YGC B;  1Q80 A;  1BG1 A;  1YR5 A;  1XO5 A;  1F4Q A;  1UUS A;  1PK0 D;  2R2I A;  1OQP A;  1UWO A;  2I18 A;  2ZN9 A;  4F0Z B;  1JFK A;  2A4J A;  1A2X A;  1XVJ A;  5KTY A;  2JWW A;  5J3X A;  1DVI A;  4CPV A;  3CWG A;  3DD4 A;  2PAS A;  1SL9 A;  3O2P A;  1B4C A;  1B47 A;  1NIW A;  3EK7 A;  4AQJ A;  4I5K A;  2K7B A;  4P5O E;  3VRR A;  1NP8 A;  1UHI A;  1K93 D;  1BMO A;  2FOT A;  4DRW A;  2JTT A;  1J55 A;  4YRU A;  1DJZ A;  1EG4 A;  2BCX A;  1M39 A;  2LMT A;  2KOT A;  1WDC B;  1S6J A;  5AER A;  1FPW A;  1CLL A;  2WND A;  1EG3 A;  4NQG A;  1TNQ A;  2M3W A;  3BUO B;  1YX8 A;  1LVC D;  1KSM A;  3BUW B;  1J1E A;  1KWO C;  3KEV A;  2AMI A;  1CMF A;  1OZS A;  4DIR A;  2BL0 B;  2K2F A;  1A4P A;  2M7L A;  1KSO A;  1H4B A;  3CTN A;  2L4I A;  3K21 A;  2BL0 C;  3WHT B;  4E68 A;  2H61 A;  2LNK A;  2LV7 A;  4C0L A;  4L9M A;  1QTX A;  1BR4 B;  3PM8 A;  5I2L A;  1J7R A;  2M97 A;  3KPX A;  4GGF A;  4MEW A;  1BJF A;  1BT6 A;  3GOF A;  4PHJ A;  3NSI A;  1Y0V H;  3AAJ A;  5HKW A;  2KQY A;  2L51 A;  2HQW A;  3JVT C;  3GK1 A;  4GNK B;  2SCP A;  4ICB A;  1TCO B;  5BPJ A;  1LA0 A;  4OKH A;  3E3R A;  4BY5 A;  2ZNE A;  3CGA A;  1B7T Z;  1J1D A;  2KAX A;  1QAT A;  2GGM A;  1AVS A;  3HCM A;  5AXI A;  3DF0 A;  3O4Y A;  1YUU A;  4HSZ A;  1QV0 A;  3PLF B;  2WCE A;  3FWB A;  1WRZ A;  1XFU O;  2OPO A;  3AAK A;  4QJ4 B;  2OTG B;  1ZAC A;  2JPT A;  2MJW B;  1K2H A;  1SBJ A;  1V1G A;  3WHU B;  4CLN A;  2HQ8 A;  3I5G B;  5JOL A;  1LKJ A;  1M63 B;  2CXJ A;  1TCF A;  4GAO A;  4GFT A;  3O6B A;  5DKQ A;  1DF0 B;  3I5G C;  1IQ5 A;  2KI4 B;  1UHJ A;  3TS5 B;  1NX2 A;  2JQ6 A;  3OP0 A;  1MXE A;  4WQ2 A;  4A4C A;  1K9U A;  2LHI A;  2KI4 C;  3SG2 A;  2L0P A;  1KK7 Y;  1MHO A;  1TNW A;  3OX6 A;  5CPV A;  4YGD B;  4MZL A;  5KU1 A;  2KNE A;  1SCM B;  3SG3 A;  1U5I B;  3GK4 X;  1IH0 A;  1BU3 A;  1Y1A A;  4QJ3 B;  2MBX A;  1YTZ C;  1SCM C;  1B9A A;  3NXA A;  1C07 A;  1IG5 A;  2ISD A;  2E30 A;  2WCF A;  2G9B A;  2M29 A;  4ORC B;  1VRK A;  1OMD A;  4MZJ A;  5HLV A;  5K89 A;  5DKN A;  3JTD B;  3PFV A;  1PSR A;  1OMV A;  1W7J B;  4ETO A;  2KYC A;  1D1O A;  3PAT A;  2LP2 A;  2M0R A;  2Y1M A;  4IL1 A;  5I2Q A;  2O60 A;  3MSE B;  1OZO A;  1K95 A;  1KQM B;  3QRX A;  3VGO A;  1AK8 A;  4WRI A;  1DJH A;  5HYD A;  2ZND A;  3TUY B;  4PDZ A;  3CZT X;  1IJ6 A;  2TN4 A;  3BUX B;  2M49 B;  4QJ5 B;  2M1K B;  4OV2 A;  1YRU B;  3TUY C;  4N5X A;  1WLZ A;  2Y1N A;  1B7T Y;  4USL A;  5ER4 X;  1F71 A;  1KK8 B;  4N1F A;  4I5L B;  2JTZ A;  3A4U B;  1OMR A;  1HQV A;  2OS8 B;  4YGA A;  1YUR A;  2BE4 A;  2QPT A;  4JQ0 D;  5GQQ C;  2MAZ A;  2CCM A;  1DGV A;  2OS8 C;  2Y5I A;  2B1U A;  3PSR A;  3KO0 A;  1BLQ A;  4TNC A;  4PE0 A;  2KYF A;  2AAO A;  2LAN A;  4AQI A;  3OHM B;  5F6T A;  1QLK A;  3I5F C;  2O5G A;  4MRX A;  2IS9 A;  1S6C A;  3VRN A;  1M46 A;  2HPS A;  1JF0 A;  3NSO A;  1N65 A;  3PN7 B;  1CDL A;  2RGI A;  4M2Q A;  2K0J A;  1NCZ A;  1QS7 A;  1TNP A;  3DF0 B;  2I7A A;  2K61 A;  1DJW A;  1SL7 A;  2K7C A;  5AFP A;  1BOC A;  4GPL B;  2JOJ A;  1XFV O;  1RTP 1;  2LVJ A;  2NXQ A;  3A8R A;  1F54 A;  3KHE A;  1RRO A;  3CS1 A;  3AKB A;  2P6B B;  1QAS A;  3ICB A;  1J7P A;  1R6P A;  3EVV A;  1KK7 Z;  2JZI A;  3FS7 A;  2CNP A;  2V53 A;  1A75 A;  1PRW A;  5KSZ A;  2M9G A;  3I5H B;  1WDC C;  1MXL C;  3VRQ A;  1SMG A;  1SR6 B;  1ODB A;  3LL8 B;  2LP3 A;  1PVB A;  4GUK A;  2LHL A;  2BEC A;  2FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...