2CCMA

X-ray structure of calexcitin from loligo pealeii at 1.8a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
190
structure length
190
Chain Sequence
AAHQLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARATLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGTLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CALEXCITIN
publication title Structure of the Neuronal Protein Calexcitin Suggests a Mode of Interaction in Signalling Pathways of Learning and Memory.
pubmed doi rcsb
source organism Loligo pealeii
total genus 80
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ccmA00
1M46A 4P5OE 2M7LA 1KK7Z 2JNXA 1XFXO 1N0YA 4CFQA 4N1FA 1N2DA 4QJ5B 3PSRA 1CDMA 4GUKA 2M3WA 3BQ3A 5TNCA 1QVIZ 4YGBB 2PASA 5BPJA 1W7JB 2M9GA 1QX5B 2NLNA 3F45A 3SIAA 2JZIA 3DVKA 2FOTA 2H61C 3TZ1A 5CSJA 1WRKA 1A2XA 2BBNA 3DF0A 4GGFC 3FIAA 1J1DA 3SJSA 2KNEA 1MQ1A 4C0LA 2JU0A 4JPZB 2BCAA 1OZOA 3AAJA 3OHMB 4MN0A 1BR4B 3EVRA 3NXAA 3GOFA 2ZNEA 3CGAA 2FJUB 4MRXA 1FI6A 3I5GB 1A29A 2LHLA 1KQMC 1WRZA 2KI4C 1NYAA 1K2HA 1CTRA 1OMDA 1JSAA 3TDIA 4HSZA 3VRPA 2H2KA 3SG3A 2BE4A 3BUXB 3FWBA 1A4PA 3I5HC 1IQ3A 4PHKA 3VRNA 2LE9B 1UUSA 1QTXA 1SL9A 3FS7A 4TNCA 2LANA 2O60A 4PCWA 1KFXS 1M63B 1YVHA 1S6IA 1J55A 3CR4X 3SG6A 1B47A 1A03A 1JFKA 1K9UA 1PSBA 1BF5A 1DF0B 5F6TA 4N1GA 2F8PA 3TUYC 2BL0B 2JNFA 4CPVA 2PALA 1R2UA 2NCPA 1QXPA 4FQOA 4MZKA 3O4YA 2CTNA 4MEWA 1J7QA 1XFYO 3IQOA 1YRUB 2M1UA 3ZNIA 1DMOA 2L5XB 1IRJA 3O2PA 1QASA 1QLKA 5CSFA 1NX1A 1K94A 1B8CA 1XFZO 1F8HA 5HYDA 3KO0A 4JWQA 2JTTA 3SG2A 1DT7B 4OR9B 1SK6D 3JVTC 3WXAA 2OPOA 2LLTA 2CBLA 4C0KA 2KFFA 5AFPA 2K7OA 1SR6C 1UHHA 1JC2A 1AVSA 4MLWA 3C1VA 1KWOC 2WORA 4GGNA 1AHRA 2OS8B 3CR2A 3M0WA 4YGAA 5HKWA 2JTZA 1FBVA 4P2YB 1QLSA 1QJTA 3QRXA 4NDDA 1E8AA 2L4HA 4PE7A 5JOLA 2KDHA 4HRGA 2JT3A 3OP0A 4YI9A 2NXQA 2BCBA 1EH2A 4PDZA 1LXFC 1NCXA 1JF0A 3NSLA 1M45A 2Q4UA 1YRTB 4PHMA 3JTDC 3PM8A 4DUQA 1AJ5A 1K9PA 1PVBA 1YUSA 1IQ5A 1SL8A 2AUCA 1XO5A 3O6BA 1TNQA 3NSOA 2Q91A 1Y1UA 1Y0VH 2PRUA 3A8RA 4OVNF 3VGOA 4WQ3A 1S1EA 1KFUS 2KAYA 5AANA 2AAOA 4ORCB 3CZTX 1SPYA 4ORBB 2IS9A 2DOQA 1HQVA 5B8IB 1DVIA 1NX3A 2ZN8A 4WRIA 2L2EA 1CFDA 1NUBA 3EK4A 2LP2A 1G8IA 1UP5A 2P6BB 3E3RA 3DVEA 5JJGA 1M39A 1LA3A 1CNPA 2MLFC 2F2OA 4DIRA 1K90D 1K9KA 2GGMA 2V53A 1B9AA 2LAPA 2PMYA 5D69A 1BU3A 1S6CA 1ZUZA 4A4CA 3NSIA 1MUXA 5J3XA 3NSKA 5AERA 2LMVA 1CDLA 1KSOA 3I5GC 5I2OA 1J7RA 1WDCB 1C7WA 1SCMB 2D8NA 3EVVA 5KTYA 1B1GA 1IJ5A 3OX6A 4OKHA 4DCKA 1XYDA 3SIBA 1BLQA 1SBJA 1D1OA 1DJYA 2HQ8A 2COLB 4UPGA 1JFJA 3DVJA 3I5FB 3D10A 1Y6WA 2E30A 2TN4A 1CB1A 2K0JA 3BUWB 3SG7A 4BY5A 2F3ZA 1TTXA 2LC5A 1CDNA 5PALA 2LHIA 1S5GZ 2BL0C 2LUXA 3PALA 2CT9A 3KPXA 2K2AA 2G2BA 2KQYA 2ZFDA 4MVFA 2A4JA 5DKRA 1MWNA 1F71A 4QJ4B 4M2QA 2ZRTA 1YX7A 4NDBA 1YURA 1BR1B 1B7TZ 2KAVA 2BECA 4CFRA 1DJIA 1TNWA 3DF0B 3BUOB 3CTNA 1JUOA 2WOSA 4M2PA 3CR5X 1X02A 3LCPC 1G33A 1MR8A 5HLOA 2I18A 1RROA 2BBMA 2WCEA 1XK4C 2LV7A 4Q04A 3PLFB 5G08A 1EJ3A 2OS8C 1MXEA 3BXKA 1V1GA 1ZMZA 3FWCA 5FYXA 3SG5A 3VRRA 2OTGB 4WQ2A 2Y1MA 2JT0A 3EVUA 1KK7Y 3IF7A 4PALA 3RLZA 4CLNA 1OE9B 2JXLA 2NZ0A 4ETOA 2JRFA 1XA5A 3MSEB 1LKJA 2M1KB 2KYFA 2QACA 3TS5B 1H4BA 4GFTA 1F55A 2EC6B 2BKIB 1YX8A 3H4SE 2H61A 3I5IB 1DF0A 2LNKA 2LVIA 3ICBA 4GBAA 2KQ6A 2M97A 3WHUB 1TRFA 3EK7A 1CMGA 4GGFA 2K8MB 2QPTA 3AAKA 1CM4A 1OMRA 1AJ4A 1S26D 1Y1AA 2GV5A 2VRGA 1K96A 5CPVA 1W7IB 1QX7A 1CFPA 1IGVA 1DJGA 3K21A 2L51A 1NWDA 4MRYA 3EKJA 2L98A 2Y5IA 2ISDA 1DJXA 2Y1NA 3KF9A 1TIZA 2HQWA 2ZKMX 3BYAA 2Y4QA 2JXCA 4PHJA 4GAOA 4OV2A 2KBMA 1WY9A 2I7AA 4YBHB 3IQQA 3CS1A 2SCPA 4A4BA 1CLBA 4ZCUA 1OSAA 4N5XA 1L7ZA 1A75A 3VRQA 4F0ZB 5KSZA 3BOWA 1WDCC 1F4QA 2K7CA 1SYMA 1SCMC 5I2LA 2LVJA 1CFCA 2KFHA 3CWGA 1M31A 1BJFA 4MBEA 4I5NB 1NSHA 3I5FC 2LP3A 4MSPA 1AUIB 1JWDA 2E6WA 1RTP1 1XFWO 2K7DA 2BE6A 1QIVA 3AKAA 5DKQA 4L9MA 2LLUA 1CDPA 2LUCA 2KYCA 4JQ0D 4ICBA 3O78A 4HRHA 5D7FA 2M29A 5DKNA 1NCZA 4AQIA 1DTLA 3KEVA 1TN4A 3DVMA 2L50A 2GGZA 4XJKB 3BUMB 4ZCVA 1BMOA 1ZACA 1SL7A 3VROA 1LVCD 1PRWA 2B1UA 4MZLA 4PHNA 1OQPA 1YUUA 3WNXB 2MA2A 2ZRSA 2KBIA 2LMUA 3LK1A 3PN7B 5AEQA 1FW4A 1IKUA 2KHNA 1CM1A 1YUTA 1DGUA 3OB1B 1PALA 1GGZA 3WHTB 1PSRA 2WNDA 2MHHA 1U5IB 1J7PA 1OZSA 3A4UB 1K8UA 1XFVO 2JC2A 3D0YB 2G9BA 1OOJA 4IL1A 1FPWA 2OTGC 1KSMA 4M2OA 1YVLA 4C0JA 3SG4A 1NIWA 1HT9A 2F33A 2L4IA 4YGCB 1ZFSA 4YGEB 2M8UA 5I2QA 1KQVA 1CMFA 3TS5C 4YRUA 1PVAA 2I94A 1S6JA 2EC6C 1FF1A 1ZOTB 3I5IC 2O5GA 1B4CA 2HETA 3AKBA 1Y1XA 1ALWA 1JBAA 1V1FA 1YR5A 2CXJA 1TNXA 4QJ3B 2JQ6A 4AQJA 1N65A 1VRKA 1SY9A 1BT6A 1ALVA 1PK0D 1TNPA 1GQMA 1TCFA 1QV0A 1UHIA 1LINA 4I5LB 2CNPA 4PE1A 1CLMA 1NCYA 1JF2A 2ZNDA 4PE4A 2LM5A 2KAXA 1KK8B 4DS7A 1UWOA 1RWYA 1GJYA 5CSNA 1KFXL 2KOTA 3CLNA 1EL4A 1F54A 1EXRA 2EHBA 2F2PA 4BY4A 3RM1A 1AK8A 3LL8B 4GPLB 4MZJA 5K89A 4NDCA 1SRAA 2KFGA 4R1EA 2JOJA 5GQQC 1ODBA 1K95A 1QX2A 2FCDA 2CCMA 4GNKB 1QV1A 1WRLA 1RECA 3TDZA 1QVIY 1IH0A 1CFFA 2PVBA 1GGWA 2MLEC 2BCXA 4D1EA 1F70A 1DGVA 1S5GY 2PSRA 4CIDA 3GK4X 3HX4A 2KGRA 2JWWA 1FI5A 1DJZA 1CKKA 4I5KA 1QATA 1TOPA 2M0RA 1IWQA 2BKHB 2RGIA 1TCOB 2WC8A 3HCMA 2JULA 4DRWA 2FCEA 1L2OC 3KHEA 3LLEA 3GK1A 4FTGA 1B7TY 2K2FA 1R6PA 3BUNB 1IG5A 2LVKA 1WLZA 2KSPA 3ZWHA 5CSIA 2LLSA 5HKYA 2L0PA 1YTZC 2MAZA 2MBXA 1XK4A 3GK2A 2R2IA 4I5JA 1NX0A 2KI6C 1G4YR 1MF8B 4XYNA 1C07A 2M7NA 2NCOA 1QS7A 1KQMB 2K7BA 3TDUA 5HLVA 2KI4B 4U8DA 1QIWA 1RJVA 1K93D 1S3PA 2SASA 3PN7C 5ER4X 2HF5A 4OCIA 1LA0A 1XVJA 2MRDA 2JPTA 5KU1A 4YI8A 3EK8A 3I5HB 5IBWA 1S36A 2JT8A 4E68A 1KFUL 1IJ6A 4USLA 5I8NA 1CLLA 1A75B 2ZN9A 2HPSA 1AP4A 2I2RE 1WLMA 2LCPA 3BOWB 1NX2A 1PULA 2M49B 3EKHA 3JTDB 1BODA 3TUYB 1C7VA 1L2OB 1UHNA 1RFJA 1KCYA 1DJHA 4PE0A 1RK9A 1SCVA 2F3YA 1UHKA 2LVVA 1OMVA 1UURA 4AOMA 2WCFA 2KGBC 1B8LA 1SNLA 1BOCA 3LK0A 5AXIA 2EGDA 4ORAB 1MXLC 1J7OA 1XFUO 5ER5A 1NP8A 4XJKA 4HREE 1SMGA 2K61A 1UHJA 1Q80A 1NPQA 1J1EA 3OB2B 3JVTB 1EG4A 1MHOA 4YGDB 1SR6B 1KK8C 1KWOB 1SW8A 2MJWB 1BG1A 3DD4A 4NQGA 1EG3A 1F4OA 2KI6D 1B8RA 2AMIA 1U5IA 2WCBA 3PFVA 1H8BA 2LMTA 3D0YA 3OX5A 5HKZA 3PATA 1SKTA 1DJWA
chains in the Genus database with same CATH superfamily
1M46A 4P5OE 2M7LA 1KK7Z 2JNXA 1XFXO 1N0YA 4CFQA 4N1FA 1N2DA 4QJ5B 3BFHA 3B88A 3PSRA 1CDMA 4GUKA 2M3WA 3BQ3A 5TNCA 1QVIZ 3SS5A 4YGBB 2PASA 5BPJA 1W7JB 2M9GA 1QX5B 2NLNA 3F45A 3SIAA 2JZIA 3DVKA 5FI6A 2FOTA 2H61C 3TZ1A 5CSJA 1WRKA 1A2XA 2BBNA 3DF0A 4GGFC 1TUZA 3B6XA 1J1DA 3BFBA 3FE9A 2KNEA 1C3ZA 1MQ1A 3FIAA 3SJSA 3S0BA 4C0LA 2JU0A 4JPZB 2BCAA 1DEKA 1OZOA 3AAJA 3OHMB 3D74A 4MN0A 1BR4B 3EVRA 3NXAA 3GOFA 3D73A 2ZNEA 3CGAA 2FJUB 4MRXA 1FI6A 3I5GB 1A29A 2LHLA 1KQMC 1WRZA 2KI4C 4IJ7A 1NYAA 1K2HA 1CTRA 1OMDA 3CDNA 1JSAA 3TDIA 2KLDA 4HSZA 3VRPA 2H2KA 3SG3A 2BE4A 3BUXB 3FWBA 1A4PA 3I5HC 1TUJA 4PHKA 3VRNA 1IQ3A 2LE9B 1UUSA 1QTXA 1SL9A 3FS7A 2WCMA 4TNCA 2LANA 2O60A 4PCWA 1KFXS 1M63B 1YVHA 1S6IA 3S0AA 1J55A 3CR4X 3SG6A 1B47A 1A03A 1JFKA 1K9UA 1PSBA 1BF5A 1DELA 1DF0B 5F6TA 4N1GA 2F8PA 3TUYC 2BL0B 2JNFA 4CPVA 2PALA 1R2UA 2NCPA 1QXPA 4FQOA 4PT1A 4MZKA 3O4YA 2CTNA 4MEWA 1J7QA 5EL2A 1XFYO 3IQOA 1YRUB 2M1UA 3ZNIA 1DMOA 2L5XB 1IRJA 3O2PA 1QASA 1QLKA 5CSFA 1NX1A 1K94A 1OOFA 4JD9A 3R1VA 1B8CA 1XFZO 1F8HA 5HYDA 2WCHA 3DY9A 3KO0A 4JWQA 2JTTA 3SG2A 1DT7B 4OR9B 1SK6D 3JVTC 3WXAA 2OPOA 2LLTA 2CBLA 4C0KA 2KFFA 5AFPA 2K7OA 1SR6C 1UHHA 1JC2A 1AVSA 4MLWA 3C1VA 1KWOC 2WORA 4GGNA 1AHRA 2OS8B 3CR2A 3M0WA 4YGAA 5HKWA 2JTZA 1FBVA 3Q8IA 4P2YB 1QLSA 1QJTA 3QRXA 4NDDA 1E8AA 2L4HA 4PE7A 5JOLA 2KDHA 4HRGA 2JT3A 3OP0A 4YI9A 2NXQA 2BCBA 3PJIA 4PDZA 4FQTA 1LXFC 1NCXA 1JF0A 3NSLA 1M45A 2Q4UA 2WC6A 1YRTB 4PHMA 3JTDC 3PM8A 4DUQA 3CABA 1AJ5A 1K9PA 1PVBA 1YUSA 1IQ5A 1SL8A 1GM0A 2AUCA 1XO5A 3O6BA 1TNQA 1LS8A 3NSOA 2Q91A 1Y1UA 1Y0VH 2PRUA 3A8RA 4OVNF 3VGOA 1T14A 4WQ3A 1S1EA 1KFUS 2KAYA 5AANA 2AAOA 4ORCB 3CZTX 1SPYA 4ORBB 2IS9A 3R1PA 2DOQA 1EH2A 1HQVA 5B8IB 1DVIA 1NX3A 2ZN8A 4WRIA 2L2EA 1CFDA 1NUBA 3EK4A 2LP2A 1G8IA 1UP5A 2P6BB 3BFAA 3E3RA 3DVEA 3OBVA 1M39A 1LA3A 5JJGA 1CNPA 2MLFC 2F2OA 4DIRA 1K90D 1K9KA 2GGMA 2V53A 1B9AA 2LAPA 3BJHA 2PMYA 1DQEA 5D69A 1BU3A 1S6CA 1ZUZA 4INXA 2QDIA 2ERBA 1XFRA 3NSIA 4A4CA 1MUXA 5J3XA 3NSKA 2WCLA 5AERA 2LMVA 1CDLA 1KSOA 3I5GC 5I2OA 1J7RA 1WDCB 1C7WA 1SCMB 2D8NA 3EVVA 5KTYA 1B1GA 1IJ5A 3OX6A 4OKHA 4DCKA 1XYDA 3SIBA 1BLQA 1SBJA 1D1OA 1DJYA 2HQ8A 2COLB 4UPGA 1JFJA 3DVJA 3QMEA 3I5FB 3D10A 1Y6WA 2E30A 2TN4A 3V2LA 4INWA 1CB1A 2K0JA 3BUWB 3SG7A 4BY5A 2F3ZA 1TTXA 2LC5A 2WC5A 5PALA 1CDNA 2LHIA 1S5GZ 2BL0C 2LUXA 2FJYA 3CYZA 2JPOA 2L2CA 3PALA 2QEVA 2CT9A 3KPXA 2K2AA 2G2BA 2KQYA 2ZFDA 4MVFA 2A4JA 5DKRA 1MWNA 1F71A 4QJ4B 4OZDA 4M2QA 2ZRTA 1YX7A 4NDBA 1YURA 1BR1B 1B7TZ 3D77A 2KAVA 2BECA 4CFRA 1DJIA 2P70A 1TNWA 3DF0B 2GTEA 3BUOB 3CTNA 1JUOA 2WOSA 4M2PA 3CR5X 1X02A 3LCPC 1G33A 1MR8A 3NHTA 5FI2A 5HLOA 2I18A 1RROA 2BBMA 2WCEA 1XK4C 2LV7A 4Q04A 3PLFB 5G08A 1EJ3A 2OS8C 1MXEA 3BXKA 1V1GA 1ZMZA 3FWCA 5FYXA 3SG5A 3VRRA 2OTGB 4WQ2A 2Y1MA 2JT0A 3EVUA 1KK7Y 3IF7A 3L4AA 4PALA 5FI7A 3RLZA 4CLNA 1OE9B 2JXLA 2NZ0A 3OGNA 4ETOA 2JRFA 1XA5A 3MSEB 1LKJA 2M1KB 2KYFA 2QACA 2QEOA 3TS5B 4GFTA 1F55A 2EC6B 1H4BA 2BKIB 1YX8A 3H4SE 3S0EA 2H61A 3I5IB 1DF0A 2LNKA 2LVIA 3ICBA 4GBAA 2KQ6A 2M97A 3WHUB 1TRFA 3EK7A 1CMGA 4GGFA 2K8MB 2QPTA 3AAKA 1CM4A 1OMRA 1AJ4A 1S26D 1Y1AA 2GV5A 1OOGA 3R1OA 2VRGA 2WCKA 2YGUA 1K96A 5CPVA 1W7IB 1QX7A 1CFPA 1IGVA 1DJGA 1DC1A 3K21A 1Z4HA 2H8VA 2L51A 1NWDA 4MRYA 3EKJA 2L98A 2Y5IA 2ISDA 1DJXA 2Y1NA 3KF9A 1TIZA 2HQWA 2ZKMX 3BYAA 5D3OA 2Y4QA 2JXCA 4PHJA 4GAOA 3SS4A 4OV2A 2KBMA 1WY9A 2I7AA 4YBHB 3IQQA 3CS1A 2PQLA 1P28A 2SCPA 4A4BA 1CLBA 4ZCUA 1OSAA 4N5XA 1L7ZA 1A75A 3SS3A 3VRQA 4F0ZB 5KSZA 2P71A 3BOWA 1WDCC 1F4QA 2K7CA 1SYMA 1SCMC 5I2LA 2LVJA 1CFCA 2KFHA 2KPHA 3CWGA 1M31A 1BJFA 4MBEA 4I5NB 1NSHA 3I5FC 4KYNA 2LP3A 4MSPA 3B7AA 1AUIB 4JKTA 1JWDA 2E6WA 1RTP1 1XFWO 3K1EA 3NGVA 2K7DA 2BE6A 1QIVA 3AKAA 5DKQA 1OW4A 4L9MA 2LLUA 1ORGA 3DZTA 1CDPA 3O4XA 2LUCA 1OOHA 2KYCA 4ICBA 3O78A 4JQ0D 4HRHA 5D7FA 2M29A 5DKNA 1NCZA 4AQIA 1DTLA 3RZSA 3KEVA 1TN4A 3DVMA 2L50A 2GGZA 3CZ2A 4XJKB 3S0DA 3BUMB 4ZCVA 1BMOA 1ZACA 1SL7A 3VROA 1LVCD 1PRWA 2B1UA 4MZLA 4PHNA 1OQPA 1YUUA 3WNXB 2MA2A 2ZRSA 2QEBA 2KBIA 2LMUA 3LK1A 3PN7B 5AEQA 1FW4A 1IKUA 2KHNA 1CM1A 1YUTA 1DGUA 3OB1B 1PALA 1GGZA 3WHTB 1PSRA 2WNDA 3FE8A 1C3YA 2MHHA 1U5IB 1J7PA 1OZSA 3A4UB 1K8UA 1XFVO 2JC2A 3D0YB 2G9BA 1OOJA 4IL1A 1FPWA 2OTGC 1KSMA 4M2OA 1YVLA 4C0JA 3SG4A 1NIWA 1HT9A 2F33A 4F7FA 2L4IA 3IVTA 4YGCB 1ZFSA 4YGEB 2M8UA 5I2QA 1KQVA 1CMFA 3TS5C 4YRUA 1PVAA 2I94A 1S6JA 2EC6C 3S0FA 1FF1A 1ZOTB 3DYEA 3DXLA 3I5IC 2O5GA 1B4CA 2HETA 3AKBA 1Y1XA 1ALWA 1JBAA 1OOIX 1TWOA 1V1FA 1YR5A 2CXJA 1TNXA 4QJ3B 2JQ6A 4AQJA 1N65A 1VRKA 1SY9A 1BT6A 2BNXA 1ALVA 1PK0D 1TNPA 1GQMA 1TCFA 3PM2A 2QEHA 1QV0A 5I94A 1UHIA 1LINA 4I5LB 2CNPA 4PE1A 1CLMA 1NCYA 1JF2A 2ZNDA 3EG5B 2LM5A 2KAXA 1KK8B 4PE4A 5DICA 1UWOA 1RWYA 4DS7A 1GJYA 5HL1A 5CSNA 1KFXL 2KOTA 3CLNA 1EL4A 1F54A 1EXRA 2EHBA 2F2PA 4BY4A 3RM1A 1AK8A 3LL8B 4GPLB 3D75A 4MZJA 5K89A 4NDCA 1QWVA 1SRAA 2KFGA 4R1EA 2JOJA 5GQQC 1ODBA 1K95A 1QX2A 2FCDA 2CCMA 4GNKB 3S0GA 1QV1A 1WRLA 1RECA 3TDZA 1QVIY 1IH0A 1CFFA 2PVBA 1GGWA 2MLEC 2BCXA 4D1EA 1W9ZA 1F70A 1DGVA 1S5GY 2PSRA 4CIDA 3GK4X 3HX4A 2KGRA 2JWWA 3UO9A 1DJZA 1FI5A 1CKKA 2WCJA 4I5KA 1QATA 1TOPA 2M0RA 3R72A 1IWQA 2BKHB 2RGIA 1TCOB 2WC8A 3HCMA 2JULA 4DRWA 2FCEA 1L2OC 3KHEA 3LLEA 3GK1A 4FTGA 1B7TY 2K2FA 1R6PA 3BUNB 1IG5A 2LVKA 1WLZA 2KSPA 3ZWHA 5CSIA 2LLSA 5HKYA 2L0PA 1YTZC 2MAZA 2MBXA 1XK4A 3GK2A 2R2IA 3D76A 4I5JA 1NX0A 2KI6C 1G4YR 1MF8B 4XYNA 1C07A 2M7NA 2NCOA 1QS7A 3N7HA 1KQMB 2K7BA 3TDUA 5HLVA 2KI4B 4U8DA 1QIWA 1RJVA 1K93D 1S3PA 2SASA 3PN7C 5ER4X 2HF5A 4OCIA 1LA0A 1XVJA 2MRDA 3CZ0A 2JPTA 5KU1A 4YI8A 3EK8A 3I5HB 3L47A 1S36A 2JT8A 5IBWA 4E68A 1KFUL 1IJ6A 4USLA 5I8NA 1CLLA 1A75B 2ZN9A 2HPSA 1AP4A 2I2RE 3PATA 1WLMA 2LCPA 3BOWB 1NX2A 1PULA 2M49B 3EKHA 3JTDB 1BODA 3TUYB 1C7VA 1L2OB 1UHNA 1RFJA 3VB1A 1KCYA 2PYQA 3D78A 1DJHA 3L4LA 4PE0A 1RK9A 1SCVA 2F3YA 3NHIA 1UHKA 2LVVA 1OMVA 1UURA 4AOMA 2WCFA 3FE6A 2KGBC 1B8LA 1SNLA 1BOCA 1IIOA 3LK0A 5AXIA 2EGDA 2L5YA 4ORAB 1MXLC 1J7OA 1XFUO 5ER5A 1NP8A 4XJKA 1Z2CB 4HREE 1SMGA 1SSEB 2K61A 1UHJA 1Q80A 1NPQA 1J1EA 3B87A 3OB2B 3JVTB 1EG4A 1MHOA 3CZ1A 4YGDB 1SR6B 1KK8C 1KWOB 1SW8A 2K60A 3B86A 2MJWB 1BG1A 3DD4A 4NQGA 1EG3A 1F4OA 2KI6D 1B8RA 2AMIA 1U5IA 2WCBA 3PFVA 1H8BA 2LMTA 2BAPA 3D0YA 3OX5A 5HKZA 2KLEA 1SKTA 3UNWA 1DJWA
chains in the Genus database with same CATH topology
1M46A 4P5OE 2M7LA 1KK7Z 2JNXA 1XFXO 1N0YA 4CFQA 4N1FA 1N2DA 4QJ5B 3PSRA 1CDMA 4GUKA 2M3WA 3BQ3A 5TNCA 1QVIZ 4YGBB 2PASA 5BPJA 1W7JB 2M9GA 1QX5B 2NLNA 3F45A 3SIAA 2JZIA 3DVKA 2FOTA 2H61C 3TZ1A 5CSJA 1WRKA 1A2XA 2BBNA 3DF0A 4GGFC 3FIAA 1J1DA 3SJSA 2KNEA 1MQ1A 4C0LA 2JU0A 4JPZB 2BCAA 1OZOA 3AAJA 3OHMB 4MN0A 1BR4B 3EVRA 3NXAA 3GOFA 2ZNEA 3CGAA 2FJUB 4MRXA 1FI6A 3I5GB 1A29A 2LHLA 1KQMC 1WRZA 2KI4C 1NYAA 1K2HA 1CTRA 1OMDA 1JSAA 3TDIA 4HSZA 3VRPA 2H2KA 3SG3A 2BE4A 3BUXB 3FWBA 1A4PA 3I5HC 1IQ3A 4PHKA 3VRNA 2LE9B 1UUSA 1QTXA 1SL9A 3FS7A 4TNCA 2LANA 2O60A 4PCWA 1KFXS 1M63B 1YVHA 1S6IA 1J55A 3CR4X 3SG6A 1B47A 1A03A 1JFKA 1K9UA 1PSBA 1BF5A 1DF0B 5F6TA 4N1GA 2F8PA 3TUYC 2BL0B 2JNFA 4CPVA 2PALA 1R2UA 2NCPA 1QXPA 4FQOA 4MZKA 3O4YA 2CTNA 4MEWA 1J7QA 1XFYO 3IQOA 1YRUB 2M1UA 3ZNIA 1DMOA 2L5XB 1IRJA 3O2PA 1QASA 1QLKA 5CSFA 1NX1A 1K94A 1B8CA 1XFZO 1F8HA 5HYDA 3KO0A 4JWQA 2JTTA 3SG2A 1DT7B 4OR9B 1SK6D 3JVTC 3WXAA 2OPOA 2LLTA 2CBLA 4C0KA 2KFFA 5AFPA 2K7OA 1SR6C 1UHHA 1JC2A 1AVSA 4MLWA 3C1VA 1KWOC 2WORA 4GGNA 1AHRA 2OS8B 3CR2A 3M0WA 4YGAA 5HKWA 2JTZA 1FBVA 4P2YB 1QLSA 1QJTA 3QRXA 4NDDA 1E8AA 2L4HA 4PE7A 5JOLA 2KDHA 4HRGA 2JT3A 3OP0A 4YI9A 2NXQA 2BCBA 1EH2A 4PDZA 1LXFC 1NCXA 1JF0A 3NSLA 1M45A 2Q4UA 1YRTB 4PHMA 3JTDC 3PM8A 4DUQA 1AJ5A 1K9PA 1PVBA 1YUSA 1IQ5A 1SL8A 2AUCA 1XO5A 3O6BA 1TNQA 3NSOA 2Q91A 1Y1UA 1Y0VH 2PRUA 3A8RA 4OVNF 3VGOA 4WQ3A 1S1EA 1KFUS 2KAYA 5AANA 2AAOA 4ORCB 3CZTX 1SPYA 4ORBB 2IS9A 2DOQA 1HQVA 5B8IB 1DVIA 1NX3A 2ZN8A 4WRIA 2L2EA 1CFDA 1NUBA 3EK4A 2LP2A 1G8IA 1UP5A 2P6BB 3E3RA 3DVEA 5JJGA 1M39A 1LA3A 1CNPA 2MLFC 2F2OA 4DIRA 1K90D 1K9KA 2GGMA 2V53A 1B9AA 2LAPA 2PMYA 5D69A 1BU3A 1S6CA 1ZUZA 4A4CA 3NSIA 1MUXA 5J3XA 3NSKA 5AERA 2LMVA 1CDLA 1KSOA 3I5GC 5I2OA 1J7RA 1WDCB 1C7WA 1SCMB 2D8NA 3EVVA 5KTYA 1B1GA 1IJ5A 3OX6A 4OKHA 4DCKA 1XYDA 3SIBA 1BLQA 1SBJA 1D1OA 1DJYA 2HQ8A 2COLB 4UPGA 1JFJA 3DVJA 3I5FB 3D10A 1Y6WA 2E30A 2TN4A 1CB1A 2K0JA 3BUWB 3SG7A 4BY5A 2F3ZA 1TTXA 2LC5A 1CDNA 5PALA 2LHIA 1S5GZ 2BL0C 2LUXA 3PALA 2CT9A 3KPXA 2K2AA 2G2BA 2KQYA 2ZFDA 4MVFA 2A4JA 5DKRA 1MWNA 1F71A 4QJ4B 4M2QA 2ZRTA 1YX7A 4NDBA 1YURA 1BR1B 1B7TZ 2KAVA 2BECA 4CFRA 1DJIA 1TNWA 3DF0B 3BUOB 3CTNA 1JUOA 2WOSA 4M2PA 3CR5X 1X02A 3LCPC 1G33A 1MR8A 5HLOA 2I18A 1RROA 2BBMA 2WCEA 1XK4C 2LV7A 4Q04A 3PLFB 5G08A 1EJ3A 2OS8C 1MXEA 3BXKA 1V1GA 1ZMZA 3FWCA 5FYXA 3SG5A 3VRRA 2OTGB 4WQ2A 2Y1MA 2JT0A 3EVUA 1KK7Y 3IF7A 4PALA 3RLZA 4CLNA 1OE9B 2JXLA 2NZ0A 4ETOA 2JRFA 1XA5A 3MSEB 1LKJA 2M1KB 2KYFA 2QACA 3TS5B 1H4BA 4GFTA 1F55A 2EC6B 2BKIB 1YX8A 3H4SE 2H61A 3I5IB 1DF0A 2LNKA 2LVIA 3ICBA 4GBAA 2KQ6A 2M97A 3WHUB 1TRFA 3EK7A 1CMGA 4GGFA 2K8MB 2QPTA 3AAKA 1CM4A 1OMRA 1AJ4A 1S26D 1Y1AA 2GV5A 2VRGA 1K96A 5CPVA 1W7IB 1QX7A 1CFPA 1IGVA 1DJGA 3K21A 2L51A 1NWDA 4MRYA 3EKJA 2L98A 2Y5IA 2ISDA 1DJXA 2Y1NA 3KF9A 1TIZA 2HQWA 2ZKMX 3BYAA 2Y4QA 2JXCA 4PHJA 4GAOA 4OV2A 2KBMA 1WY9A 2I7AA 4YBHB 3IQQA 3CS1A 2SCPA 4A4BA 1CLBA 4ZCUA 1OSAA 4N5XA 1L7ZA 1A75A 3VRQA 4F0ZB 5KSZA 3BOWA 1WDCC 1F4QA 2K7CA 1SYMA 1SCMC 5I2LA 2LVJA 1CFCA 2KFHA 3CWGA 1M31A 1BJFA 4MBEA 4I5NB 1NSHA 3I5FC 2LP3A 4MSPA 1AUIB 1JWDA 2E6WA 1RTP1 1XFWO 2K7DA 2BE6A 1QIVA 3AKAA 5DKQA 4L9MA 2LLUA 1CDPA 2LUCA 2KYCA 4JQ0D 4ICBA 3O78A 4HRHA 5D7FA 2M29A 5DKNA 1NCZA 4AQIA 1DTLA 3KEVA 1TN4A 3DVMA 2L50A 2GGZA 4XJKB 3BUMB 4ZCVA 1BMOA 1ZACA 1SL7A 3VROA 1LVCD 1PRWA 2B1UA 4MZLA 4PHNA 1OQPA 1YUUA 3WNXB 2MA2A 2ZRSA 2KBIA 2LMUA 3LK1A 3PN7B 5AEQA 1FW4A 1IKUA 2KHNA 1CM1A 1YUTA 1DGUA 3OB1B 1PALA 1GGZA 3WHTB 1PSRA 2WNDA 2MHHA 1U5IB 1J7PA 1OZSA 3A4UB 1K8UA 1XFVO 2JC2A 3D0YB 2G9BA 1OOJA 4IL1A 1FPWA 2OTGC 1KSMA 4M2OA 1YVLA 4C0JA 3SG4A 1NIWA 1HT9A 2F33A 2L4IA 4YGCB 1ZFSA 4YGEB 2M8UA 5I2QA 1KQVA 1CMFA 3TS5C 4YRUA 1PVAA 2I94A 1S6JA 2EC6C 1FF1A 1ZOTB 3I5IC 2O5GA 1B4CA 2HETA 3AKBA 1Y1XA 1ALWA 1JBAA 1V1FA 1YR5A 2CXJA 1TNXA 4QJ3B 2JQ6A 4AQJA 1N65A 1VRKA 1SY9A 1BT6A 1ALVA 1PK0D 1TNPA 1GQMA 1TCFA 1QV0A 1UHIA 1LINA 4I5LB 2CNPA 4PE1A 1CLMA 1NCYA 1JF2A 2ZNDA 4PE4A 2LM5A 2KAXA 1KK8B 4DS7A 1UWOA 1RWYA 1GJYA 5CSNA 1KFXL 2KOTA 3CLNA 1EL4A 1F54A 1EXRA 2EHBA 2F2PA 4BY4A 3RM1A 1AK8A 3LL8B 4GPLB 4MZJA 5K89A 4NDCA 1SRAA 2KFGA 4R1EA 2JOJA 5GQQC 1ODBA 1K95A 1QX2A 2FCDA 2CCMA 4GNKB 1QV1A 1WRLA 1RECA 3TDZA 1QVIY 1IH0A 1CFFA 2PVBA 1GGWA 2MLEC 2BCXA 4D1EA 1F70A 1DGVA 1S5GY 2PSRA 4CIDA 3GK4X 3HX4A 2KGRA 2JWWA 1FI5A 1DJZA 1CKKA 4I5KA 1QATA 1TOPA 2M0RA 1IWQA 2BKHB 2RGIA 1TCOB 2WC8A 3HCMA 2JULA 4DRWA 2FCEA 1L2OC 3KHEA 3LLEA 3GK1A 4FTGA 1B7TY 2K2FA 1R6PA 3BUNB 1IG5A 2LVKA 1WLZA 2KSPA 3ZWHA 5CSIA 2LLSA 5HKYA 2L0PA 1YTZC 2MAZA 2MBXA 1XK4A 3GK2A 2R2IA 4I5JA 1NX0A 2KI6C 1G4YR 1MF8B 4XYNA 1C07A 2M7NA 2NCOA 1QS7A 1KQMB 2K7BA 3TDUA 5HLVA 2KI4B 4U8DA 1QIWA 1RJVA 1K93D 1S3PA 2SASA 3PN7C 5ER4X 2HF5A 4OCIA 1LA0A 1XVJA 2MRDA 2JPTA 5KU1A 4YI8A 3EK8A 3I5HB 5IBWA 1S36A 2JT8A 4E68A 1KFUL 1IJ6A 4USLA 5I8NA 1CLLA 1A75B 2ZN9A 2HPSA 1AP4A 2I2RE 1WLMA 2LCPA 3BOWB 1NX2A 1PULA 2M49B 3EKHA 3JTDB 1BODA 3TUYB 1C7VA 1L2OB 1UHNA 1RFJA 1KCYA 1DJHA 4PE0A 1RK9A 1SCVA 2F3YA 1UHKA 2LVVA 1OMVA 1UURA 4AOMA 2WCFA 2KGBC 1B8LA 1SNLA 1BOCA 3LK0A 5AXIA 2EGDA 4ORAB 1MXLC 1J7OA 1XFUO 5ER5A 1NP8A 4XJKA 4HREE 1SMGA 2K61A 1UHJA 1Q80A 1NPQA 1J1EA 3OB2B 3JVTB 1EG4A 1MHOA 4YGDB 1SR6B 1KK8C 1KWOB 1SW8A 2MJWB 1BG1A 3DD4A 4NQGA 1EG3A 1F4OA 2KI6D 1B8RA 2AMIA 1U5IA 2WCBA 3PFVA 1H8BA 2LMTA 3D0YA 3OX5A 5HKZA 3PATA 1SKTA 1DJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M46 A;  4P5O E;  2M7L A;  1KK7 Z;  2JNX A;  1XFX O;  1N0Y A;  4CFQ A;  4N1F A;  1N2D A;  4QJ5 B;  3PSR A;  1CDM A;  4GUK A;  2M3W A;  3BQ3 A;  5TNC A;  1QVI Z;  4YGB B;  2PAS A;  5BPJ A;  1W7J B;  2M9G A;  1QX5 B;  2NLN A;  3F45 A;  3SIA A;  2JZI A;  3DVK A;  2FOT A;  2H61 C;  3TZ1 A;  5CSJ A;  1WRK A;  1A2X A;  2BBN A;  3DF0 A;  4GGF C;  3FIA A;  1J1D A;  3SJS A;  2KNE A;  1MQ1 A;  4C0L A;  2JU0 A;  4JPZ B;  2BCA A;  1OZO A;  3AAJ A;  3OHM B;  4MN0 A;  1BR4 B;  3EVR A;  3NXA A;  3GOF A;  2ZNE A;  3CGA A;  2FJU B;  4MRX A;  1FI6 A;  3I5G B;  1A29 A;  2LHL A;  1KQM C;  1WRZ A;  2KI4 C;  1NYA A;  1K2H A;  1CTR A;  1OMD A;  1JSA A;  3TDI A;  4HSZ A;  3VRP A;  2H2K A;  3SG3 A;  2BE4 A;  3BUX B;  3FWB A;  1A4P A;  3I5H C;  1IQ3 A;  4PHK A;  3VRN A;  2LE9 B;  1UUS A;  1QTX A;  1SL9 A;  3FS7 A;  4TNC A;  2LAN A;  2O60 A;  4PCW A;  1KFX S;  1M63 B;  1YVH A;  1S6I A;  1J55 A;  3CR4 X;  3SG6 A;  1B47 A;  1A03 A;  1JFK A;  1K9U A;  1PSB A;  1BF5 A;  1DF0 B;  5F6T A;  4N1G A;  2F8P A;  3TUY C;  2BL0 B;  2JNF A;  4CPV A;  2PAL A;  1R2U A;  2NCP A;  1QXP A;  4FQO A;  4MZK A;  3O4Y A;  2CTN A;  4MEW A;  1J7Q A;  1XFY O;  3IQO A;  1YRU B;  2M1U A;  3ZNI A;  1DMO A;  2L5X B;  1IRJ A;  3O2P A;  1QAS A;  1QLK A;  5CSF A;  1NX1 A;  1K94 A;  1B8C A;  1XFZ O;  1F8H A;  5HYD A;  3KO0 A;  4JWQ A;  2JTT A;  3SG2 A;  1DT7 B;  4OR9 B;  1SK6 D;  3JVT C;  3WXA A;  2OPO A;  2LLT A;  2CBL A;  4C0K A;  2KFF A;  5AFP A;  2K7O A;  1SR6 C;  1UHH A;  1JC2 A;  1AVS A;  4MLW A;  3C1V A;  1KWO C;  2WOR A;  4GGN A;  1AHR A;  2OS8 B;  3CR2 A;  3M0W A;  4YGA A;  5HKW A;  2JTZ A;  1FBV A;  4P2Y B;  1QLS A;  1QJT A;  3QRX A;  4NDD A;  1E8A A;  2L4H A;  4PE7 A;  5JOL A;  2KDH A;  4HRG A;  2JT3 A;  3OP0 A;  4YI9 A;  2NXQ A;  2BCB A;  1EH2 A;  4PDZ A;  1LXF C;  1NCX A;  1JF0 A;  3NSL A;  1M45 A;  2Q4U A;  1YRT B;  4PHM A;  3JTD C;  3PM8 A;  4DUQ A;  1AJ5 A;  1K9P A;  1PVB A;  1YUS A;  1IQ5 A;  1SL8 A;  2AUC A;  1XO5 A;  3O6B A;  1TNQ A;  3NSO A;  2Q91 A;  1Y1U A;  1Y0V H;  2PRU A;  3A8R A;  4OVN F;  3VGO A;  4WQ3 A;  1S1E A;  1KFU S;  2KAY A;  5AAN A;  2AAO A;  4ORC B;  3CZT X;  1SPY A;  4ORB B;  2IS9 A;  2DOQ A;  1HQV A;  5B8I B;  1DVI A;  1NX3 A;  2ZN8 A;  4WRI A;  2L2E A;  1CFD A;  1NUB A;  3EK4 A;  2LP2 A;  1G8I A;  1UP5 A;  2P6B B;  3E3R A;  3DVE A;  5JJG A;  1M39 A;  1LA3 A;  1CNP A;  2MLF C;  2F2O A;  4DIR A;  1K90 D;  1K9K A;  2GGM A;  2V53 A;  1B9A A;  2LAP A;  2PMY A;  5D69 A;  1BU3 A;  1S6C A;  1ZUZ A;  4A4C A;  3NSI A;  1MUX A;  5J3X A;  3NSK A;  5AER A;  2LMV A;  1CDL A;  1KSO A;  3I5G C;  5I2O A;  1J7R A;  1WDC B;  1C7W A;  1SCM B;  2D8N A;  3EVV A;  5KTY A;  1B1G A;  1IJ5 A;  3OX6 A;  4OKH A;  4DCK A;  1XYD A;  3SIB A;  1BLQ A;  1SBJ A;  1D1O A;  1DJY A;  2HQ8 A;  2COL B;  4UPG A;  1JFJ A;  3DVJ A;  3I5F B;  3D10 A;  1Y6W A;  2E30 A;  2TN4 A;  1CB1 A;  2K0J A;  3BUW B;  3SG7 A;  4BY5 A;  2F3Z A;  1TTX A;  2LC5 A;  1CDN A;  5PAL A;  2LHI A;  1S5G Z;  2BL0 C;  2LUX A;  3PAL A;  2CT9 A;  3KPX A;  2K2A A;  2G2B A;  2KQY A;  2ZFD A;  4MVF A;  2A4J A;  5DKR A;  1MWN A;  1F71 A;  4QJ4 B;  4M2Q A;  2ZRT A;  1YX7 A;  4NDB A;  1YUR A;  1BR1 B;  1B7T Z;  2KAV A;  2BEC A;  4CFR A;  1DJI A;  1TNW A;  3DF0 B;  3BUO B;  3CTN A;  1JUO A;  2WOS A;  4M2P A;  3CR5 X;  1X02 A;  3LCP C;  1G33 A;  1MR8 A;  5HLO A;  2I18 A;  1RRO A;  2BBM A;  2WCE A;  1XK4 C;  2LV7 A;  4Q04 A;  3PLF B;  5G08 A;  1EJ3 A;  2OS8 C;  1MXE A;  3BXK A;  1V1G A;  1ZMZ A;  3FWC A;  5FYX A;  3SG5 A;  3VRR A;  2OTG B;  4WQ2 A;  2Y1M A;  2JT0 A;  3EVU A;  1KK7 Y;  3IF7 A;  4PAL A;  3RLZ A;  4CLN A;  1OE9 B;  2JXL A;  2NZ0 A;  4ETO A;  2JRF A;  1XA5 A;  3MSE B;  1LKJ A;  2M1K B;  2KYF A;  2QAC A;  3TS5 B;  1H4B A;  4GFT A;  1F55 A;  2EC6 B;  2BKI B;  1YX8 A;  3H4S E;  2H61 A;  3I5I B;  1DF0 A;  2LNK A;  2LVI A;  3ICB A;  4GBA A;  2KQ6 A;  2M97 A;  3WHU B;  1TRF A;  3EK7 A;  1CMG A;  4GGF A;  2K8M B;  2QPT A;  3AAK A;  1CM4 A;  1OMR A;  1AJ4 A;  1S26 D;  1Y1A A;  2GV5 A;  2VRG A;  1K96 A;  5CPV A;  1W7I B;  1QX7 A;  1CFP A;  1IGV A;  1DJG A;  3K21 A;  2L51 A;  1NWD A;  4MRY A;  3EKJ A;  2L98 A;  2Y5I A;  2ISD A;  1DJX A;  2Y1N A;  3KF9 A;  1TIZ A;  2HQW A;  2ZKM X;  3BYA A;  2Y4Q A;  2JXC A;  4PHJ A;  4GAO A;  4OV2 A;  2KBM A;  1WY9 A;  2I7A A;  4YBH B;  3IQQ A;  3CS1 A;  2SCP A;  4A4B A;  1CLB A;  4ZCU A;  1OSA A;  4N5X A;  1L7Z A;  1A75 A;  3VRQ A;  4F0Z B;  5KSZ A;  3BOW A;  1WDC C;  1F4Q A;  2K7C A;  1SYM A;  1SCM C;  5I2L A;  2LVJ A;  1CFC A;  2KFH A;  3CWG A;  1M31 A;  1BJF A;  4MBE A;  4I5N B;  1NSH A;  3I5F C;  2LP3 A;  4MSP A;  1AUI B;  1JWD A;  2E6W A;  1RTP 1;  1XFW O;  2K7D A;  2BE6 A;  1QIV A;  3AKA A;  5DKQ A;  4L9M A;  2LLU A;  1CDP A;  2LUC A;  2KYC A;  4JQ0 D;  4ICB A;  3O78 A;  4HRH A;  5D7F A;  2M29 A;  5DKN A;  1NCZ A;  4AQI A;  1DTL A;  3KEV A;  1TN4 A;  3DVM A;  2L50 A;  2GGZ A;  4XJK B;  3BUM B;  4ZCV A;  1BMO A;  1ZAC A;  1SL7 A;  3VRO A;  1LVC D;  1PRW A;  2B1U A;  4MZL A;  4PHN A;  1OQP A;  1YUU A;  3WNX B;  2MA2 A;  2ZRS A;  2KBI A;  2LMU A;  3LK1 A;  3PN7 B;  5AEQ A;  1FW4 A;  1IKU A;  2KHN A;  1CM1 A;  1YUT A;  1DGU A;  3OB1 B;  1PAL A;  1GGZ A;  3WHT B;  1PSR A;  2WND A;  2MHH A;  1U5I B;  1J7P A;  1OZS A;  3A4U B;  1K8U A;  1XFV O;  2JC2 A;  3D0Y B;  2G9B A;  1OOJ A;  4IL1 A;  1FPW A;  2OTG C;  1KSM A;  4M2O A;  1YVL A;  4C0J A;  3SG4 A;  1NIW A;  1HT9 A;  2F33 A;  2L4I A;  4YGC B;  1ZFS A;  4YGE B;  2M8U A;  5I2Q A;  1KQV A;  1CMF A;  3TS5 C;  4YRU A;  1PVA A;  2I94 A;  1S6J A;  2EC6 C;  1FF1 A;  1ZOT B;  3I5I C;  2O5G A;  1B4C A;  2HET A;  3AKB A;  1Y1X A;  1ALW A;  1JBA A;  1V1F A;  1YR5 A;  2CXJ A;  1TNX A;  4QJ3 B;  2JQ6 A;  4AQJ A;  1N65 A;  1VRK A;  1SY9 A;  1BT6 A;  1ALV A;  1PK0 D;  1TNP A;  1GQM A;  1TCF A;  1QV0 A;  1UHI A;  1LIN A;  4I5L B;  2CNP A;  4PE1 A;  1CLM A;  1NCY A;  1JF2 A;  2ZND A;  4PE4 A;  2LM5 A;  2KAX A;  1KK8 B;  4DS7 A;  1UWO A;  1RWY A;  1GJY A;  5CSN A;  1KFX L;  2KOT A;  3CLN A;  1EL4 A;  1F54 A;  1EXR A;  2EHB A;  2F2P A;  4BY4 A;  3RM1 A;  1AK8 A;  3LL8 B;  4GPL B;  4MZJ A;  5K89 A;  4NDC A;  1SRA A;  2KFG A;  4R1E A;  2JOJ A;  5GQQ C;  1ODB A;  1K95 A;  1QX2 A;  2FCD A;  2CCM A;  4GNK B;  1QV1 A;  1WRL A;  1REC A;  3TDZ A;  1QVI Y;  1IH0 A;  1CFF A;  2PVB A;  1GGW A;  2MLE C;  2BCX A;  4D1E A;  1F70 A;  1DGV A;  1S5G Y;  2PSR A;  4CID A;  3GK4 X;  3HX4 A;  2KGR A;  2JWW A;  1FI5 A;  1DJZ A;  1CKK A;  4I5K A;  1QAT A;  1TOP A;  2M0R A;  1IWQ A;  2BKH B;  2RGI A;  1TCO B;  2WC8 A;  3HCM A;  2JUL A;  4DRW A;  2FCE A;  1L2O C;  3KHE A;  3LLE A;  3GK1 A;  4FTG A;  1B7T Y;  2K2F A;  1R6P A;  3BUN B;  1IG5 A;  2LVK A;  1WLZ A;  2KSP A;  3ZWH A;  5CSI A;  2LLS A;  5HKY A;  2L0P A;  1YTZ C;  2MAZ A;  2MBX A;  1XK4 A;  3GK2 A;  2R2I A;  4I5J A;  1NX0 A;  2KI6 C;  1G4Y R;  1MF8 B;  4XYN A;  1C07 A;  2M7N A;  2NCO A;  1QS7 A;  1KQM B;  2K7B A;  3TDU A;  5HLV A;  2KI4 B;  4U8D A;  1QIW A;  1RJV A;  1K93 D;  1S3P A;  2SAS A;  3PN7 C;  5ER4 X;  2HF5 A;  4OCI A;  1LA0 A;  1XVJ A;  2MRD A;  2JPT A;  5KU1 A;  4YI8 A;  3EK8 A;  3I5H B;  5IBW A;  1S36 A;  2JT8 A;  4E68 A;  1KFU L;  1IJ6 A;  4USL A;  5I8N A;  1CLL A;  1A75 B;  2ZN9 A;  2HPS A;  1AP4 A;  2I2R E;  1WLM A;  2LCP A;  3BOW B;  1NX2 A;  1PUL A;  2M49 B;  3EKH A;  3JTD B;  1BOD A;  3TUY B;  1C7V A;  1L2O B;  1UHN A;  1RFJ A;  1KCY A;  1DJH A;  4PE0 A;  1RK9 A;  1SCV A;  2F3Y A;  1UHK A;  2LVV A;  1OMV A;  1UUR A;  4AOM A;  2WCF A;  2KGB C;  1B8L A;  1SNL A;  1BOC A;  3LK0 A;  5AXI A;  2EGD A;  4ORA B;  1MXL C;  1J7O A;  1XFU O;  5ER5 A;  1NP8 A;  4XJK A;  4HRE E;  1SMG A;  2K61 A;  1UHJ A;  1Q80 A;  1NPQ A;  1J1E A;  3OB2 B;  3JVT B;  1EG4 A;  1MHO A;  4YGD B;  1SR6 B;  1KK8 C;  1KWO B;  1SW8 A;  2MJW B;  1BG1 A;  3DD4 A;  4NQG A;  1EG3 A;  1F4O A;  2KI6 D;  1B8R A;  2AMI A;  1U5I A;  2WCB A;  3PFV A;  1H8B A;  2LMT A;  3D0Y A;  3OX5 A;  5HKZ A;  3PAT A;  1SKT A;  1DJW A; 
#chains in the Genus database with same CATH topology
 1M46 A;  4P5O E;  2M7L A;  1KK7 Z;  2JNX A;  1XFX O;  1N0Y A;  4CFQ A;  4N1F A;  1N2D A;  4QJ5 B;  3BFH A;  3B88 A;  3PSR A;  1CDM A;  4GUK A;  2M3W A;  3BQ3 A;  5TNC A;  1QVI Z;  3SS5 A;  4YGB B;  2PAS A;  5BPJ A;  1W7J B;  2M9G A;  1QX5 B;  2NLN A;  3F45 A;  3SIA A;  2JZI A;  3DVK A;  5FI6 A;  2FOT A;  2H61 C;  3TZ1 A;  5CSJ A;  1WRK A;  1A2X A;  2BBN A;  3DF0 A;  4GGF C;  1TUZ A;  3B6X A;  1J1D A;  3BFB A;  3FE9 A;  2KNE A;  1C3Z A;  1MQ1 A;  3FIA A;  3SJS A;  3S0B A;  4C0L A;  2JU0 A;  4JPZ B;  2BCA A;  1DEK A;  1OZO A;  3AAJ A;  3OHM B;  3D74 A;  4MN0 A;  1BR4 B;  3EVR A;  3NXA A;  3GOF A;  3D73 A;  2ZNE A;  3CGA A;  2FJU B;  4MRX A;  1FI6 A;  3I5G B;  1A29 A;  2LHL A;  1KQM C;  1WRZ A;  2KI4 C;  4IJ7 A;  1NYA A;  1K2H A;  1CTR A;  1OMD A;  3CDN A;  1JSA A;  3TDI A;  2KLD A;  4HSZ A;  3VRP A;  2H2K A;  3SG3 A;  2BE4 A;  3BUX B;  3FWB A;  1A4P A;  3I5H C;  1TUJ A;  4PHK A;  3VRN A;  1IQ3 A;  2LE9 B;  1UUS A;  1QTX A;  1SL9 A;  3FS7 A;  2WCM A;  4TNC A;  2LAN A;  2O60 A;  4PCW A;  1KFX S;  1M63 B;  1YVH A;  1S6I A;  3S0A A;  1J55 A;  3CR4 X;  3SG6 A;  1B47 A;  1A03 A;  1JFK A;  1K9U A;  1PSB A;  1BF5 A;  1DEL A;  1DF0 B;  5F6T A;  4N1G A;  2F8P A;  3TUY C;  2BL0 B;  2JNF A;  4CPV A;  2PAL A;  1R2U A;  2NCP A;  1QXP A;  4FQO A;  4PT1 A;  4MZK A;  3O4Y A;  2CTN A;  4MEW A;  1J7Q A;  5EL2 A;  1XFY O;  3IQO A;  1YRU B;  2M1U A;  3ZNI A;  1DMO A;  2L5X B;  1IRJ A;  3O2P A;  1QAS A;  1QLK A;  5CSF A;  1NX1 A;  1K94 A;  1OOF A;  4JD9 A;  3R1V A;  1B8C A;  1XFZ O;  1F8H A;  5HYD A;  2WCH A;  3DY9 A;  3KO0 A;  4JWQ A;  2JTT A;  3SG2 A;  1DT7 B;  4OR9 B;  1SK6 D;  3JVT C;  3WXA A;  2OPO A;  2LLT A;  2CBL A;  4C0K A;  2KFF A;  5AFP A;  2K7O A;  1SR6 C;  1UHH A;  1JC2 A;  1AVS A;  4MLW A;  3C1V A;  1KWO C;  2WOR A;  4GGN A;  1AHR A;  2OS8 B;  3CR2 A;  3M0W A;  4YGA A;  5HKW A;  2JTZ A;  1FBV A;  3Q8I A;  4P2Y B;  1QLS A;  1QJT A;  3QRX A;  4NDD A;  1E8A A;  2L4H A;  4PE7 A;  5JOL A;  2KDH A;  4HRG A;  2JT3 A;  3OP0 A;  4YI9 A;  2NXQ A;  2BCB A;  3PJI A;  4PDZ A;  4FQT A;  1LXF C;  1NCX A;  1JF0 A;  3NSL A;  1M45 A;  2Q4U A;  2WC6 A;  1YRT B;  4PHM A;  3JTD C;  3PM8 A;  4DUQ A;  3CAB A;  1AJ5 A;  1K9P A;  1PVB A;  1YUS A;  1IQ5 A;  1SL8 A;  1GM0 A;  2AUC A;  1XO5 A;  3O6B A;  1TNQ A;  1LS8 A;  3NSO A;  2Q91 A;  1Y1U A;  1Y0V H;  2PRU A;  3A8R A;  4OVN F;  3VGO A;  1T14 A;  4WQ3 A;  1S1E A;  1KFU S;  2KAY A;  5AAN A;  2AAO A;  4ORC B;  3CZT X;  1SPY A;  4ORB B;  2IS9 A;  3R1P A;  2DOQ A;  1EH2 A;  1HQV A;  5B8I B;  1DVI A;  1NX3 A;  2ZN8 A;  4WRI A;  2L2E A;  1CFD A;  1NUB A;  3EK4 A;  2LP2 A;  1G8I A;  1UP5 A;  2P6B B;  3BFA A;  3E3R A;  3DVE A;  3OBV A;  1M39 A;  1LA3 A;  5JJG A;  1CNP A;  2MLF C;  2F2O A;  4DIR A;  1K90 D;  1K9K A;  2GGM A;  2V53 A;  1B9A A;  2LAP A;  3BJH A;  2PMY A;  1DQE A;  5D69 A;  1BU3 A;  1S6C A;  1ZUZ A;  4INX A;  2QDI A;  2ERB A;  1XFR A;  3NSI A;  4A4C A;  1MUX A;  5J3X A;  3NSK A;  2WCL A;  5AER A;  2LMV A;  1CDL A;  1KSO A;  3I5G C;  5I2O A;  1J7R A;  1WDC B;  1C7W A;  1SCM B;  2D8N A;  3EVV A;  5KTY A;  1B1G A;  1IJ5 A;  3OX6 A;  4OKH A;  4DCK A;  1XYD A;  3SIB A;  1BLQ A;  1SBJ A;  1D1O A;  1DJY A;  2HQ8 A;  2COL B;  4UPG A;  1JFJ A;  3DVJ A;  3QME A;  3I5F B;  3D10 A;  1Y6W A;  2E30 A;  2TN4 A;  3V2L A;  4INW A;  1CB1 A;  2K0J A;  3BUW B;  3SG7 A;  4BY5 A;  2F3Z A;  1TTX A;  2LC5 A;  2WC5 A;  5PAL A;  1CDN A;  2LHI A;  1S5G Z;  2BL0 C;  2LUX A;  2FJY A;  3CYZ A;  2JPO A;  2L2C A;  3PAL A;  2QEV A;  2CT9 A;  3KPX A;  2K2A A;  2G2B A;  2KQY A;  2ZFD A;  4MVF A;  2A4J A;  5DKR A;  1MWN A;  1F71 A;  4QJ4 B;  4OZD A;  4M2Q A;  2ZRT A;  1YX7 A;  4NDB A;  1YUR A;  1BR1 B;  1B7T Z;  3D77 A;  2KAV A;  2BEC A;  4CFR A;  1DJI A;  2P70 A;  1TNW A;  3DF0 B;  2GTE A;  3BUO B;  3CTN A;  1JUO A;  2WOS A;  4M2P A;  3CR5 X;  1X02 A;  3LCP C;  1G33 A;  1MR8 A;  3NHT A;  5FI2 A;  5HLO A;  2I18 A;  1RRO A;  2BBM A;  2WCE A;  1XK4 C;  2LV7 A;  4Q04 A;  3PLF B;  5G08 A;  1EJ3 A;  2OS8 C;  1MXE A;  3BXK A;  1V1G A;  1ZMZ A;  3FWC A;  5FYX A;  3SG5 A;  3VRR A;  2OTG B;  4WQ2 A;  2Y1M A;  2JT0 A;  3EVU A;  1KK7 Y;  3IF7 A;  3L4A A;  4PAL A;  5FI7 A;  3RLZ A;  4CLN A;  1OE9 B;  2JXL A;  2NZ0 A;  3OGN A;  4ETO A;  2JRF A;  1XA5 A;  3MSE B;  1LKJ A;  2M1K B;  2KYF A;  2QAC A;  2QEO A;  3TS5 B;  4GFT A;  1F55 A;  2EC6 B;  1H4B A;  2BKI B;  1YX8 A;  3H4S E;  3S0E A;  2H61 A;  3I5I B;  1DF0 A;  2LNK A;  2LVI A;  3ICB A;  4GBA A;  2KQ6 A;  2M97 A;  3WHU B;  1TRF A;  3EK7 A;  1CMG A;  4GGF A;  2K8M B;  2QPT A;  3AAK A;  1CM4 A;  1OMR A;  1AJ4 A;  1S26 D;  1Y1A A;  2GV5 A;  1OOG A;  3R1O A;  2VRG A;  2WCK A;  2YGU A;  1K96 A;  5CPV A;  1W7I B;  1QX7 A;  1CFP A;  1IGV A;  1DJG A;  1DC1 A;  3K21 A;  1Z4H A;  2H8V A;  2L51 A;  1NWD A;  4MRY A;  3EKJ A;  2L98 A;  2Y5I A;  2ISD A;  1DJX A;  2Y1N A;  3KF9 A;  1TIZ A;  2HQW A;  2ZKM X;  3BYA A;  5D3O A;  2Y4Q A;  2JXC A;  4PHJ A;  4GAO A;  3SS4 A;  4OV2 A;  2KBM A;  1WY9 A;  2I7A A;  4YBH B;  3IQQ A;  3CS1 A;  2PQL A;  1P28 A;  2SCP A;  4A4B A;  1CLB A;  4ZCU A;  1OSA A;  4N5X A;  1L7Z A;  1A75 A;  3SS3 A;  3VRQ A;  4F0Z B;  5KSZ A;  2P71 A;  3BOW A;  1WDC C;  1F4Q A;  2K7C A;  1SYM A;  1SCM C;  5I2L A;  2LVJ A;  1CFC A;  2KFH A;  2KPH A;  3CWG A;  1M31 A;  1BJF A;  4MBE A;  4I5N B;  1NSH A;  3I5F C;  4KYN A;  2LP3 A;  4MSP A;  3B7A A;  1AUI B;  4JKT A;  1JWD A;  2E6W A;  1RTP 1;  1XFW O;  3K1E A;  3NGV A;  2K7D A;  2BE6 A;  1QIV A;  3AKA A;  5DKQ A;  1OW4 A;  4L9M A;  2LLU A;  1ORG A;  3DZT A;  1CDP A;  3O4X A;  2LUC A;  1OOH A;  2KYC A;  4ICB A;  3O78 A;  4JQ0 D;  4HRH A;  5D7F A;  2M29 A;  5DKN A;  1NCZ A;  4AQI A;  1DTL A;  3RZS A;  3KEV A;  1TN4 A;  3DVM A;  2L50 A;  2GGZ A;  3CZ2 A;  4XJK B;  3S0D A;  3BUM B;  4ZCV A;  1BMO A;  1ZAC A;  1SL7 A;  3VRO A;  1LVC D;  1PRW A;  2B1U A;  4MZL A;  4PHN A;  1OQP A;  1YUU A;  3WNX B;  2MA2 A;  2ZRS A;  2QEB A;  2KBI A;  2LMU A;  3LK1 A;  3PN7 B;  5AEQ A;  1FW4 A;  1IKU A;  2KHN A;  1CM1 A;  1YUT A;  1DGU A;  3OB1 B;  1PAL A;  1GGZ A;  3WHT B;  1PSR A;  2WND A;  3FE8 A;  1C3Y A;  2MHH A;  1U5I B;  1J7P A;  1OZS A;  3A4U B;  1K8U A;  1XFV O;  2JC2 A;  3D0Y B;  2G9B A;  1OOJ A;  4IL1 A;  1FPW A;  2OTG C;  1KSM A;  4M2O A;  1YVL A;  4C0J A;  3SG4 A;  1NIW A;  1HT9 A;  2F33 A;  4F7F A;  2L4I A;  3IVT A;  4YGC B;  1ZFS A;  4YGE B;  2M8U A;  5I2Q A;  1KQV A;  1CMF A;  3TS5 C;  4YRU A;  1PVA A;  2I94 A;  1S6J A;  2EC6 C;  3S0F A;  1FF1 A;  1ZOT B;  3DYE A;  3DXL A;  3I5I C;  2O5G A;  1B4C A;  2HET A;  3AKB A;  1Y1X A;  1ALW A;  1JBA A;  1OOI X;  1TWO A;  1V1F A;  1YR5 A;  2CXJ A;  1TNX A;  4QJ3 B;  2JQ6 A;  4AQJ A;  1N65 A;  1VRK A;  1SY9 A;  1BT6 A;  2BNX A;  1ALV A;  1PK0 D;  1TNP A;  1GQM A;  1TCF A;  3PM2 A;  2QEH A;  1QV0 A;  5I94 A;  1UHI A;  1LIN A;  4I5L B;  2CNP A;  4PE1 A;  1CLM A;  1NCY A;  1JF2 A;  2ZND A;  3EG5 B;  2LM5 A;  2KAX A;  1KK8 B;  4PE4 A;  5DIC A;  1UWO A;  1RWY A;  4DS7 A;  1GJY A;  5HL1 A;  5CSN A;  1KFX L;  2KOT A;  3CLN A;  1EL4 A;  1F54 A;  1EXR A;  2EHB A;  2F2P A;  4BY4 A;  3RM1 A;  1AK8 A;  3LL8 B;  4GPL B;  3D75 A;  4MZJ A;  5K89 A;  4NDC A;  1QWV A;  1SRA A;  2KFG A;  4R1E A;  2JOJ A;  5GQQ C;  1ODB A;  1K95 A;  1QX2 A;  2FCD A;  2CCM A;  4GNK B;  3S0G A;  1QV1 A;  1WRL A;  1REC A;  3TDZ A;  1QVI Y;  1IH0 A;  1CFF A;  2PVB A;  1GGW A;  2MLE C;  2BCX A;  4D1E A;  1W9Z A;  1F70 A;  1DGV A;  1S5G Y;  2PSR A;  4CID A;  3GK4 X;  3HX4 A;  2KGR A;  2JWW A;  3UO9 A;  1DJZ A;  1FI5 A;  1CKK A;  2WCJ A;  4I5K A;  1QAT A;  1TOP A;  2M0R A;  3R72 A;  1IWQ A;  2BKH B;  2RGI A;  1TCO B;  2WC8 A;  3HCM A;  2JUL A;  4DRW A;  2FCE A;  1L2O C;  3KHE A;  3LLE A;  3GK1 A;  4FTG A;  1B7T Y;  2K2F A;  1R6P A;  3BUN B;  1IG5 A;  2LVK A;  1WLZ A;  2KSP A;  3ZWH A;  5CSI A;  2LLS A;  5HKY A;  2L0P A;  1YTZ C;  2MAZ A;  2MBX A;  1XK4 A;  3GK2 A;  2R2I A;  3D76 A;  4I5J A;  1NX0 A;  2KI6 C;  1G4Y R;  1MF8 B;  4XYN A;  1C07 A;  2M7N A;  2NCO A;  1QS7 A;  3N7H A;  1KQM B;  2K7B A;  3TDU A;  5HLV A;  2KI4 B;  4U8D A;  1QIW A;  1RJV A;  1K93 D;  1S3P A;  2SAS A;  3PN7 C;  5ER4 X;  2HF5 A;  4OCI A;  1LA0 A;  1XVJ A;  2MRD A;  3CZ0 A;  2JPT A;  5KU1 A;  4YI8 A;  3EK8 A;  3I5H B;  3L47 A;  1S36 A;  2JT8 A;  5IBW A;  4E68 A;  1KFU L;  1IJ6 A;  4USL A;  5I8N A;  1CLL A;  1A75 B;  2ZN9 A;  2HPS A;  1AP4 A;  2I2R E;  3PAT A;  1WLM A;  2LCP A;  3BOW B;  1NX2 A;  1PUL A;  2M49 B;  3EKH A;  3JTD B;  1BOD A;  3TUY B;  1C7V A;  1L2O B;  1UHN A;  1RFJ A;  3VB1 A;  1KCY A;  2PYQ A;  3D78 A;  1DJH A;  3L4L A;  4PE0 A;  1RK9 A;  1SCV A;  2F3Y A;  3NHI A;  1UHK A;  2LVV A;  1OMV A;  1UUR A;  4AOM A;  2WCF A;  3FE6 A;  2KGB C;  1B8L A;  1SNL A;  1BOC A;  1IIO A;  3LK0 A;  5AXI A;  2EGD A;  2L5Y A;  4ORA B;  1MXL C;  1J7O A;  1XFU O;  5ER5 A;  1NP8 A;  4XJK A;  1Z2C B;  4HRE E;  1SMG A;  1SSE B;  2K61 A;  1UHJ A;  1Q80 A;  1NPQ A;  1J1E A;  3B87 A;  3OB2 B;  3JVT B;  1EG4 A;  1MHO A;  3CZ1 A;  4YGD B;  1SR6 B;  1KK8 C;  1KWO B;  1SW8 A;  2K60 A;  3B86 A;  2MJW B;  1BG1 A;  3DD4 A;  4NQG A;  1EG3 A;  1F4O A;  2KI6 D;  1B8R A;  2AMI A;  1U5I A;  2WCB A;  3PFV A;  1H8B A;  2LMT A;  2BAP A;  3D0Y A;  3OX5 A;  5HKZ A;  2KLE A;  1SKT A;  3UNW A;  1DJW A; 
#chains in the Genus database with same CATH homology
 1M46 A;  4P5O E;  2M7L A;  1KK7 Z;  2JNX A;  1XFX O;  1N0Y A;  4CFQ A;  4N1F A;  1N2D A;  4QJ5 B;  3PSR A;  1CDM A;  4GUK A;  2M3W A;  3BQ3 A;  5TNC A;  1QVI Z;  4YGB B;  2PAS A;  5BPJ A;  1W7J B;  2M9G A;  1QX5 B;  2NLN A;  3F45 A;  3SIA A;  2JZI A;  3DVK A;  2FOT A;  2H61 C;  3TZ1 A;  5CSJ A;  1WRK A;  1A2X A;  2BBN A;  3DF0 A;  4GGF C;  3FIA A;  1J1D A;  3SJS A;  2KNE A;  1MQ1 A;  4C0L A;  2JU0 A;  4JPZ B;  2BCA A;  1OZO A;  3AAJ A;  3OHM B;  4MN0 A;  1BR4 B;  3EVR A;  3NXA A;  3GOF A;  2ZNE A;  3CGA A;  2FJU B;  4MRX A;  1FI6 A;  3I5G B;  1A29 A;  2LHL A;  1KQM C;  1WRZ A;  2KI4 C;  1NYA A;  1K2H A;  1CTR A;  1OMD A;  1JSA A;  3TDI A;  4HSZ A;  3VRP A;  2H2K A;  3SG3 A;  2BE4 A;  3BUX B;  3FWB A;  1A4P A;  3I5H C;  1IQ3 A;  4PHK A;  3VRN A;  2LE9 B;  1UUS A;  1QTX A;  1SL9 A;  3FS7 A;  4TNC A;  2LAN A;  2O60 A;  4PCW A;  1KFX S;  1M63 B;  1YVH A;  1S6I A;  1J55 A;  3CR4 X;  3SG6 A;  1B47 A;  1A03 A;  1JFK A;  1K9U A;  1PSB A;  1BF5 A;  1DF0 B;  5F6T A;  4N1G A;  2F8P A;  3TUY C;  2BL0 B;  2JNF A;  4CPV A;  2PAL A;  1R2U A;  2NCP A;  1QXP A;  4FQO A;  4MZK A;  3O4Y A;  2CTN A;  4MEW A;  1J7Q A;  1XFY O;  3IQO A;  1YRU B;  2M1U A;  3ZNI A;  1DMO A;  2L5X B;  1IRJ A;  3O2P A;  1QAS A;  1QLK A;  5CSF A;  1NX1 A;  1K94 A;  1B8C A;  1XFZ O;  1F8H A;  5HYD A;  3KO0 A;  4JWQ A;  2JTT A;  3SG2 A;  1DT7 B;  4OR9 B;  1SK6 D;  3JVT C;  3WXA A;  2OPO A;  2LLT A;  2CBL A;  4C0K A;  2KFF A;  5AFP A;  2K7O A;  1SR6 C;  1UHH A;  1JC2 A;  1AVS A;  4MLW A;  3C1V A;  1KWO C;  2WOR A;  4GGN A;  1AHR A;  2OS8 B;  3CR2 A;  3M0W A;  4YGA A;  5HKW A;  2JTZ A;  1FBV A;  4P2Y B;  1QLS A;  1QJT A;  3QRX A;  4NDD A;  1E8A A;  2L4H A;  4PE7 A;  5JOL A;  2KDH A;  4HRG A;  2JT3 A;  3OP0 A;  4YI9 A;  2NXQ A;  2BCB A;  1EH2 A;  4PDZ A;  1LXF C;  1NCX A;  1JF0 A;  3NSL A;  1M45 A;  2Q4U A;  1YRT B;  4PHM A;  3JTD C;  3PM8 A;  4DUQ A;  1AJ5 A;  1K9P A;  1PVB A;  1YUS A;  1IQ5 A;  1SL8 A;  2AUC A;  1XO5 A;  3O6B A;  1TNQ A;  3NSO A;  2Q91 A;  1Y1U A;  1Y0V H;  2PRU A;  3A8R A;  4OVN F;  3VGO A;  4WQ3 A;  1S1E A;  1KFU S;  2KAY A;  5AAN A;  2AAO A;  4ORC B;  3CZT X;  1SPY A;  4ORB B;  2IS9 A;  2DOQ A;  1HQV A;  5B8I B;  1DVI A;  1NX3 A;  2ZN8 A;  4WRI A;  2L2E A;  1CFD A;  1NUB A;  3EK4 A;  2LP2 A;  1G8I A;  1UP5 A;  2P6B B;  3E3R A;  3DVE A;  5JJG A;  1M39 A;  1LA3 A;  1CNP A;  2MLF C;  2F2O A;  4DIR A;  1K90 D;  1K9K A;  2GGM A;  2V53 A;  1B9A A;  2LAP A;  2PMY A;  5D69 A;  1BU3 A;  1S6C A;  1ZUZ A;  4A4C A;  3NSI A;  1MUX A;  5J3X A;  3NSK A;  5AER A;  2LMV A;  1CDL A;  1KSO A;  3I5G C;  5I2O A;  1J7R A;  1WDC B;  1C7W A;  1SCM B;  2D8N A;  3EVV A;  5KTY A;  1B1G A;  1IJ5 A;  3OX6 A;  4OKH A;  4DCK A;  1XYD A;  3SIB A;  1BLQ A;  1SBJ A;  1D1O A;  1DJY A;  2HQ8 A;  2COL B;  4UPG A;  1JFJ A;  3DVJ A;  3I5F B;  3D10 A;  1Y6W A;  2E30 A;  2TN4 A;  1CB1 A;  2K0J A;  3BUW B;  3SG7 A;  4BY5 A;  2F3Z A;  1TTX A;  2LC5 A;  1CDN A;  5PAL A;  2LHI A;  1S5G Z;  2BL0 C;  2LUX A;  3PAL A;  2CT9 A;  3KPX A;  2K2A A;  2G2B A;  2KQY A;  2ZFD A;  4MVF A;  2A4J A;  5DKR A;  1MWN A;  1F71 A;  4QJ4 B;  4M2Q A;  2ZRT A;  1YX7 A;  4NDB A;  1YUR A;  1BR1 B;  1B7T Z;  2KAV A;  2BEC A;  4CFR A;  1DJI A;  1TNW A;  3DF0 B;  3BUO B;  3CTN A;  1JUO A;  2WOS A;  4M2P A;  3CR5 X;  1X02 A;  3LCP C;  1G33 A;  1MR8 A;  5HLO A;  2I18 A;  1RRO A;  2BBM A;  2WCE A;  1XK4 C;  2LV7 A;  4Q04 A;  3PLF B;  5G08 A;  1EJ3 A;  2OS8 C;  1MXE A;  3BXK A;  1V1G A;  1ZMZ A;  3FWC A;  5FYX A;  3SG5 A;  3VRR A;  2OTG B;  4WQ2 A;  2Y1M A;  2JT0 A;  3EVU A;  1KK7 Y;  3IF7 A;  4PAL A;  3RLZ A;  4CLN A;  1OE9 B;  2JXL A;  2NZ0 A;  4ETO A;  2JRF A;  1XA5 A;  3MSE B;  1LKJ A;  2M1K B;  2KYF A;  2QAC A;  3TS5 B;  1H4B A;  4GFT A;  1F55 A;  2EC6 B;  2BKI B;  1YX8 A;  3H4S E;  2H61 A;  3I5I B;  1DF0 A;  2LNK A;  2LVI A;  3ICB A;  4GBA A;  2KQ6 A;  2M97 A;  3WHU B;  1TRF A;  3EK7 A;  1CMG A;  4GGF A;  2K8M B;  2QPT A;  3AAK A;  1CM4 A;  1OMR A;  1AJ4 A;  1S26 D;  1Y1A A;  2GV5 A;  2VRG A;  1K96 A;  5CPV A;  1W7I B;  1QX7 A;  1CFP A;  1IGV A;  1DJG A;  3K21 A;  2L51 A;  1NWD A;  4MRY A;  3EKJ A;  2L98 A;  2Y5I A;  2ISD A;  1DJX A;  2Y1N A;  3KF9 A;  1TIZ A;  2HQW A;  2ZKM X;  3BYA A;  2Y4Q A;  2JXC A;  4PHJ A;  4GAO A;  4OV2 A;  2KBM A;  1WY9 A;  2I7A A;  4YBH B;  3IQQ A;  3CS1 A;  2SCP A;  4A4B A;  1CLB A;  4ZCU A;  1OSA A;  4N5X A;  1L7Z A;  1A75 A;  3VRQ A;  4F0Z B;  5KSZ A;  3BOW A;  1WDC C;  1F4Q A;  2K7C A;  1SYM A;  1SCM C;  5I2L A;  2LVJ A;  1CFC A;  2KFH A;  3CWG A;  1M31 A;  1BJF A;  4MBE A;  4I5N B;  1NSH A;  3I5F C;  2LP3 A;  4MSP A;  1AUI B;  1JWD A;  2E6W A;  1RTP 1;  1XFW O;  2K7D A;  2BE6 A;  1QIV A;  3AKA A;  5DKQ A;  4L9M A;  2LLU A;  1CDP A;  2LUC A;  2KYC A;  4JQ0 D;  4ICB A;  3O78 A;  4HRH A;  5D7F A;  2M29 A;  5DKN A;  1NCZ A;  4AQI A;  1DTL A;  3KEV A;  1TN4 A;  3DVM A;  2L50 A;  2GGZ A;  4XJK B;  3BUM B;  4ZCV A;  1BMO A;  1ZAC A;  1SL7 A;  3VRO A;  1LVC D;  1PRW A;  2B1U A;  4MZL A;  4PHN A;  1OQP A;  1YUU A;  3WNX B;  2MA2 A;  2ZRS A;  2KBI A;  2LMU A;  3LK1 A;  3PN7 B;  5AEQ A;  1FW4 A;  1IKU A;  2KHN A;  1CM1 A;  1YUT A;  1DGU A;  3OB1 B;  1PAL A;  1GGZ A;  3WHT B;  1PSR A;  2WND A;  2MHH A;  1U5I B;  1J7P A;  1OZS A;  3A4U B;  1K8U A;  1XFV O;  2JC2 A;  3D0Y B;  2G9B A;  1OOJ A;  4IL1 A;  1FPW A;  2OTG C;  1KSM A;  4M2O A;  1YVL A;  4C0J A;  3SG4 A;  1NIW A;  1HT9 A;  2F33 A;  2L4I A;  4YGC B;  1ZFS A;  4YGE B;  2M8U A;  5I2Q A;  1KQV A;  1CMF A;  3TS5 C;  4YRU A;  1PVA A;  2I94 A;  1S6J A;  2EC6 C;  1FF1 A;  1ZOT B;  3I5I C;  2O5G A;  1B4C A;  2HET A;  3AKB A;  1Y1X A;  1ALW A;  1JBA A;  1V1F A;  1YR5 A;  2CXJ A;  1TNX A;  4QJ3 B;  2JQ6 A;  4AQJ A;  1N65 A;  1VRK A;  1SY9 A;  1BT6 A;  1ALV A;  1PK0 D;  1TNP A;  1GQM A;  1TCF A;  1QV0 A;  1UHI A;  1LIN A;  4I5L B;  2CNP A;  4PE1 A;  1CLM A;  1NCY A;  1JF2 A;  2ZND A;  4PE4 A;  2LM5 A;  2KAX A;  1KK8 B;  4DS7 A;  1UWO A;  1RWY A;  1GJY A;  5CSN A;  1KFX L;  2KOT A;  3CLN A;  1EL4 A;  1F54 A;  1EXR A;  2EHB A;  2F2P A;  4BY4 A;  3RM1 A;  1AK8 A;  3LL8 B;  4GPL B;  4MZJ A;  5K89 A;  4NDC A;  1SRA A;  2KFG A;  4R1E A;  2JOJ A;  5GQQ C;  1ODB A;  1K95 A;  1QX2 A;  2FCD A;  2CCM A;  4GNK B;  1QV1 A;  1WRL A;  1REC A;  3TDZ A;  1QVI Y;  1IH0 A;  1CFF A;  2PVB A;  1GGW A;  2MLE C;  2BCX A;  4D1E A;  1F70 A;  1DGV A;  1S5G Y;  2PSR A;  4CID A;  3GK4 X;  3HX4 A;  2KGR A;  2JWW A;  1FI5 A;  1DJZ A;  1CKK A;  4I5K A;  1QAT A;  1TOP A;  2M0R A;  1IWQ A;  2BKH B;  2RGI A;  1TCO B;  2WC8 A;  3HCM A;  2JUL A;  4DRW A;  2FCE A;  1L2O C;  3KHE A;  3LLE A;  3GK1 A;  4FTG A;  1B7T Y;  2K2F A;  1R6P A;  3BUN B;  1IG5 A;  2LVK A;  1WLZ A;  2KSP A;  3ZWH A;  5CSI A;  2LLS A;  5HKY A;  2L0P A;  1YTZ C;  2MAZ A;  2MBX A;  1XK4 A;  3GK2 A;  2R2I A;  4I5J A;  1NX0 A;  2KI6 C;  1G4Y R;  1MF8 B;  4XYN A;  1C07 A;  2M7N A;  2NCO A;  1QS7 A;  1KQM B;  2K7B A;  3TDU A;  5HLV A;  2KI4 B;  4U8D A;  1QIW A;  1RJV A;  1K93 D;  1S3P A;  2SAS A;  3PN7 C;  5ER4 X;  2HF5 A;  4OCI A;  1LA0 A;  1XVJ A;  2MRD A;  2JPT A;  5KU1 A;  4YI8 A;  3EK8 A;  3I5H B;  5IBW A;  1S36 A;  2JT8 A;  4E68 A;  1KFU L;  1IJ6 A;  4USL A;  5I8N A;  1CLL A;  1A75 B;  2ZN9 A;  2HPS A;  1AP4 A;  2I2R E;  1WLM A;  2LCP A;  3BOW B;  1NX2 A;  1PUL A;  2M49 B;  3EKH A;  3JTD B;  1BOD A;  3TUY B;  1C7V A;  1L2O B;  1UHN A;  1RFJ A;  1KCY A;  1DJH A;  4PE0 A;  1RK9 A;  1SCV A;  2F3Y A;  1UHK A;  2LVV A;  1OMV A;  1UUR A;  4AOM A;  2WCF A;  2KGB C;  1B8L A;  1SNL A;  1BOC A;  3LK0 A;  5AXI A;  2EGD A;  4ORA B;  1MXL C;  1J7O A;  1XFU O;  5ER5 A;  1NP8 A;  4XJK A;  4HRE E;  1SMG A;  2K61 A;  1UHJ A;  1Q80 A;  1NPQ A;  1J1E A;  3OB2 B;  3JVT B;  1EG4 A;  1MHO A;  4YGD B;  1SR6 B;  1KK8 C;  1KWO B;  1SW8 A;  2MJW B;  1BG1 A;  3DD4 A;  4NQG A;  1EG3 A;  1F4O A;  2KI6 D;  1B8R A;  2AMI A;  1U5I A;  2WCB A;  3PFV A;  1H8B A;  2LMT A;  3D0Y A;  3OX5 A;  5HKZ A;  3PAT A;  1SKT A;  1DJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...