2CCMA

X-ray structure of calexcitin from loligo pealeii at 1.8a
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
190
structure length
190
Chain Sequence
AAHQLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARATLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGTLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALEXCITIN
publication title Structure of the Neuronal Protein Calexcitin Suggests a Mode of Interaction in Signalling Pathways of Learning and Memory.
pubmed doi rcsb
source organism Loligo pealeii
molecule tags Signaling protein
total genus 80
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2ccmA00
1GQMA 1A75A 1B7TY 2OS8C 1SR6C 1BG1A 5ER4X 2WNDA 1JF2A 5D69A 1AK8A 1DVIA 3H4SE 4M2PA 3WHTB 4JQ0D 3BXKA 1OE9B 1N0YA 2LV7A 1XFUO 2KGRA 2G9BA 4GGNA 2MJWB 1GJYA 2HF5A 1KSOA 1XO5A 1NPQA 5GQQC 1FPWA 3VRRA 3LL8B 1MUXA 4HSZA 2O60A 1PSBA 2H61A 4PHMA 2JPTA 1RECA 1K9PA 1KK8C 1DMOA 3EK8A 2H2KA 2LLTA 2PMYA 4E68A 4ETOA 1D1OA 5I2LA 2KHNA 1BODA 2QACA 4FTGA 3LK0A 1J55A 1BJFA 1EJ3A 1SCMC 3OHMB 3KEVA 1S5GZ 2BE4A 1YURA 4NDDA 5AERA 2BKIB 1RK9A 1WY9A 1S6IA 3CLNA 2JT3A 5CSFA 1BLQA 3AKBA 2LHIA 1FI6A 1J1DA 2D8NA 3PALA 1OMDA 3I5HC 4C0KA 3PSRA 4GGFC 3BUXB 1QATA 1RFJA 3BUWB 1TN4A 4CIDA 1H4BA 2M8UA 2F2PA 2KAYA 4D1EA 1DJXA 2M97A 3DVEA 1WDCC 3PM8A 4MBEA 1AVSA 1OZSA 1S36A 4OKHA 1CMFA 3CR4X 1B8LA 2ZRSA 1JFKA 4P2YB 2PALA 2M7LA 1IJ6A 2CTNA 4I5NB 3GK4X 3JTDC 1TNPA 2HPSA 4XJKB 1RROA 2M29A 1QX2A 3PN7B 1CTRA 2ZN8A 2K61A 4JPZB 4MLWA 3SG5A 3DVKA 3TDZA 2E6WA 5JJGA 1E8AA 1NP8A 2COLB 1B8RA 2WC8A 1YRUB 1OQPA 1YTZC 1QXPA 5HKZA 1ZUZA 2L50A 2LUXA 3AAKA 4N1FA 3EKJA 3PLFB 1UP5A 1YR5A 1ZFSA 1JFJA 1W7IB 3BOWB 1EL4A 2KAVA 2JXCA 2M9GA 2PRUA 3SG6A 4ICBA 1SPYA 3FWBA 1SL8A 2JTTA 4HREE 1UHNA 1PRWA 5HKYA 1K94A 5K89A 5DKRA 1CKKA 2KQ6A 2BCBA 1KK7Z 1B8CA 3OX5A 5IBWA 4MVFA 5HYDA 1WRKA 2M3WA 3NSLA 2JRFA 1TNQA 2M49B 2WCFA 4PHNA 1M31A 2F8PA 1CMGA 2MLFC 1FW4A 2LP3A 1HQVA 1NX3A 1KFXS 1NCZA 1K93D 2PASA 1QIVA 2BE6A 3DVMA 4Q04A 2KAXA 1DJIA 4TNCA 1CB1A 4MZLA 2OTGC 1K8UA 1SR6B 5DKQA 5I8NA 1QIWA 2JNFA 3OP0A 2HQWA 2Q91A 1NX0A 4MZJA 3I5IB 4NDCA 1F4QA 1LA3A 2KI4C 1S3PA 1L2OC 4XJKA 2I94A 4HRHA 3RLZA 1J7PA 2NLNA 3JVTB 1R6PA 1GGZA 3DF0A 2LCPA 1X02A 1A2XA 1QVIZ 2L51A 3O2PA 4NDBA 2LC5A 1SBJA 1OZOA 2MRDA 3EVVA 2KOTA 4GFTA 1K90D 4U8DA 3TDIA 4QJ4B 1UUSA 3QRXA 2GGMA 3BUNB 1OOJA 5KSZA 1SK6D 4DCKA 1B4CA 5CPVA 5KU1A 3EK7A 3I5GC 2I18A 4WQ3A 3DVJA 3CWGA 2WOSA 1JBAA 1QLSA 3BUMB 1F70A 5AXIA 2LHLA 2HETA 4ZCVA 1KK7Y 2WORA 2ZRTA 1NCYA 3AAJA 4XYNA 4PHJA 1K96A 4FQOA 1S6JA 5I2OA 1XK4A 1B9AA 3FIAA 2ZN9A 4P5OE 3EVUA 1KFXL 2Q4UA 2ZNEA 2G2BA 1G8IA 4BY5A 2H61C 3NSKA 1DGUA 2K2AA 1QTXA 1CM4A 3O4YA 1IQ5A 3TS5C 1DJGA 1YUTA 3VRNA 1ZACA 2F3YA 2AMIA 4F0ZB 2MBXA 4UPGA 5J3XA 4WQ2A 3D10A 1CLLA 1G33A 1KQMC 1PK0D 2AAOA 2SASA 1F8HA 1IQ3A 3TUYC 1J1EA 2M7NA 1S26D 1SYMA 1IJ5A 2LANA 3BQ3A 5B8IB 1OSAA 1QVIY 3GOFA 1ALVA 1QV1A 3HCMA 1TIZA 2K8MB 1SL7A 5CSJA 1JC2A 1F54A 1R2UA 2K7DA 3KPXA 5I2QA 4IL1A 2LAPA 3SG7A 3MSEB 3CZTX 3TDUA 4AQIA 2GV5A 1MHOA 3EK4A 3WNXB 1F4OA 3ZWHA 1BF5A 1WLZA 5JOLA 3I5FC 2NCPA 3EKHA 4PDZA 1PVAA 3OB1B 1DF0B 3FWCA 2LM5A 1QX5B 1CDMA 1EG4A 1AHRA 1NIWA 1XFWO 4ORAB 3VROA 1SMGA 1IH0A 3KHEA 2CNPA 3NSIA 4PE7A 4PALA 1JSAA 1PVBA 1AP4A 2BL0C 2L0PA 2O5GA 5HLOA 1U5IB 3A4UB 2EC6C 4YBHB 2M1UA 3PFVA 2KDHA 1RWYA 2KI6C 1CFCA 1NSHA 1CDLA 1MXLC 2L5XB 4MSPA 1DJWA 2OTGB 4YGBB 1CDNA 1TCOB 3IQQA 2MAZA 3BUOB 2MLEC 1S5GY 1MWNA 3KO0A 3VGOA 1Y0VH 2KYFA 1CFPA 5CSNA 3D0YB 2KI4B 1L2OB 1IKUA 1TRFA 2BCAA 5G08A 2JNXA 2MA2A 4ZCUA 1AJ4A 4BY4A 1DTLA 2JT0A 4YGDB 1JUOA 4DIRA 3SJSA 5ER5A 1KFUL 1TCFA 2EGDA 4HRGA 3CR2A 3OX6A 3VRQA 4NQGA 2KGBC 3I5GB 3BYAA 1A75B 1K95A 3GK1A 4R1EA 4ORBB 3DD4A 4MN0A 1DJHA 2JU0A 2SCPA 2OS8B 1M46A 1YUUA 2KNEA 4MRXA 1SRAA 1TTXA 2LMTA 2K2FA 1A4PA 2Y1NA 4C0JA 1HT9A 4PE1A 1LVCD 4QJ3B 2QPTA 4PE4A 2BECA 1XFXO 1BT6A 2A4JA 2AUCA 2Y4QA 2ZFDA 1KWOC 1H8BA 1CDPA 2L4HA 3TZ1A 1B47A 1Y6WA 4N1GA 1SY9A 5KTYA 1KK8B 3KF9A 4YGEB 5PALA 2OPOA 1NCXA 1W7JB 5D7FA 1FF1A 1DJZA 1YUSA 2K7BA 3BOWA 2BCXA 1BR4B 3CS1A 3LLEA 3TUYB 1ZOTB 1SCMB 1ZMZA 3WXAA 3HX4A 4CFRA 2L4IA 1EXRA 1XK4C 1LKJA 2E30A 1C07A 1QX7A 1V1GA 1DJYA 1Y1AA 1YRTB 1F71A 3RM1A 3NSOA 4I5JA 1JWDA 3I5HB 2LE9B 3WHUB 2JQ6A 1K2HA 1SNLA 4DRWA 2I2RE 1SCVA 3O6BA 4MZKA 1ODBA 4GAOA 2LMVA 1XFZO 2KI6D 2CBLA 2M0RA 1CNPA 3I5FB 1MQ1A 2JULA 2HQ8A 2PSRA 4OR9B 1J7QA 2NXQA 1Y1XA 4I5KA 2L2EA 1QV0A 1WDCB 4DS7A 1XYDA 1C7VA 2JZIA 3ICBA 1VRKA 4L9MA 2JT8A 4USLA 3CGAA 1AJ5A 1BU3A 1YVHA 3I5IC 2F33A 2KFGA 2PVBA 5HKWA 4N5XA 1FI5A 1NUBA 3F45A 4QJ5B 3JTDB 2JTZA 1BOCA 1XFVO 2BL0B 1CFDA 2JWWA 3JVTC 2EC6B 4M2QA 1F55A 1NWDA 1UHHA 1LINA 1XA5A 2K7OA 4GPLB 1NX1A 1KSMA 1UHJA 1N65A 1BR1B 1RTP1 2ISDA 3AKAA 4M2OA 2BBMA 2L98A 1IGVA 1WLMA 1MR8A 3IF7A 1A29A 1PULA 1TNWA 3OB2B 1A03A 1BMOA 1J7RA 1FBVA 1KFUS 5FYXA 2RGIA 1KCYA 4CFQA 1S1EA 1YVLA 2CXJA 2K0JA 1UWOA 2FOTA 2LNKA 2F2OA 2FCDA 1DT7B 2Y5IA 3SIAA 3A8RA 3SIBA 1PALA 1CLBA 2WCEA 1UURA 2CT9A 2KFFA 3E3RA 4GUKA 4CPVA 1SW8A 1QLKA 1CM1A 2P6BB 3IQOA 1WRLA 5HLVA 4GGFA 3SG3A 1B1GA 4OVNF 1J7OA 1MXEA 3EVRA 1QASA 4GBAA 1NYAA 2KYCA 4YGAA 2BKHB 1C7WA 1IG5A 2KBIA 2I7AA 4YRUA 3K21A 1IRJA 1K9UA 1CFFA 2R2IA 1NX2A 1G4YR 4GNKB 4MEWA 1UHKA 2KFHA 2LLSA 2DOQA 1EG3A 2KBMA 4YGCB 4PCWA 3C1VA 4PHKA 2LUCA 3DF0B 4I5LB 2NCOA 1QS7A 4MRYA 1KWOB 1DGVA 3SG4A 1S6CA 1UHIA 2TN4A 1PSRA 2KSPA 5AANA 2JOJA 3FS7A 3PATA 5TNCA 2Y1MA 1V1FA 1XVJA 4OV2A 3SG2A 3GK2A 1K9KA 2WCBA 4AOMA 4WRIA 1JF0A 4A4BA 1KQVA 2GGZA 2VRGA 4ORCB 1ALWA 3VRPA 1B7TZ 2NZ0A 4A4CA 4OCIA 1DF0A 1M63B 1OMVA 2B1UA 3CR5X 3LCPC 4C0LA 1EH2A 5AEQA 1M39A 4DUQA 2JC2A 2V53A 4CLNA 2MHHA 1YX7A 1RJVA 2IS9A 1L7ZA 1YX8A 3PN7C 4YI8A 1TNXA 2LMUA 1U5IA 1IWQA 1LA0A 2JXLA 1TOPA 5CSIA 1QJTA 2M1KB 1MF8B 4JWQA 2KQYA 1Q80A 4YI9A 2BBNA 1WRZA 5F6TA 3TS5B 2FJUB 2LVKA 4AQJA 2ZNDA 2LLUA 2EHBA 1KQMB 2LP2A 2ZKMX 1Y1UA 5DKNA 3NXAA 2K7CA 3D0YA 2LVJA 3LK1A 3O78A 1SKTA 1M45A 5BPJA 2LVIA 1AUIB 2LVVA 2FCEA 1OMRA 3CTNA 3M0WA 1XFYO 1LXFC 2CCMA 4PE0A 1GGWA 5AFPA 1CLMA 1N2DA 2F3ZA 3ZNIA 1SL9A
chains in the Genus database with same CATH superfamily
3FE9A 3QMEA 1GQMA 1A75A 1B7TY 2OS8C 1OOFA 1SR6C 1BG1A 5ER4X 2WNDA 1JF2A 3BJHA 2L2CA 5D69A 1AK8A 1DVIA 3DYEA 3H4SE 4M2PA 3WHTB 4JQ0D 3BXKA 1OE9B 1N0YA 2LV7A 1XFUO 2KGRA 2G9BA 3B7AA 4GGNA 2MJWB 1GJYA 3OBVA 1T14A 4IJ7A 2HF5A 1KSOA 1XO5A 1NPQA 5GQQC 1FPWA 3VRRA 2QDIA 3UNWA 3LL8B 1MUXA 4HSZA 2O60A 1PSBA 2H61A 4PHMA 2JPTA 1RECA 1K9PA 1KK8C 1DMOA 3EK8A 2H2KA 2LLTA 2PMYA 3D74A 1XFRA 4ETOA 5I2LA 4JD9A 4E68A 1D1OA 2KHNA 1BODA 2QACA 4FTGA 3LK0A 1J55A 1BJFA 1EJ3A 1SCMC 3OHMB 3KEVA 1S5GZ 2BE4A 1YURA 4NDDA 3SS3A 5AERA 2BKIB 1RK9A 1WY9A 1S6IA 3CLNA 2JT3A 5CSFA 1BLQA 3AKBA 2LHIA 5FI7A 1FI6A 1J1DA 2D8NA 3PALA 1OMDA 3I5HC 4C0KA 1OOHA 3PSRA 3BUXB 4GGFC 1QATA 1RFJA 3BUWB 1TN4A 4CIDA 1H4BA 2M8UA 2F2PA 2KAYA 3D78A 4D1EA 1DJXA 2M97A 2GTEA 3DVEA 3RZSA 3BFBA 1WDCC 3PM8A 4MBEA 1AVSA 3SS5A 1OZSA 1S36A 4OKHA 1CMFA 3CR4X 1B8LA 2ZRSA 1JFKA 4P2YB 2PALA 2M7LA 1IJ6A 2CTNA 4I5NB 3GK4X 3JTDC 1TNPA 2HPSA 4XJKB 1RROA 2M29A 1QX2A 4PT1A 3PN7B 1CTRA 2ZN8A 2K61A 4JPZB 4MLWA 3SG5A 3DVKA 2WCJA 3TDZA 2E6WA 2QEOA 5JJGA 1E8AA 1NP8A 2COLB 1B8RA 2WC8A 1W9ZA 1YRUB 1OQPA 1YTZC 1QXPA 5HKZA 1ZUZA 2L50A 2LUXA 3AAKA 4N1FA 3EKJA 3PLFB 1UP5A 4INWA 1YR5A 2JPOA 1ZFSA 1JFJA 1W7IB 3BOWB 1EL4A 3L47A 2KAVA 2JXCA 2M9GA 2PRUA 3SG6A 4ICBA 1SPYA 3FWBA 1SL8A 2JTTA 4HREE 1UHNA 1PRWA 2WC5A 1K94A 5HKYA 5K89A 5DKRA 1CKKA 2KQ6A 2BCBA 1KK7Z 1B8CA 3OX5A 5IBWA 4MVFA 5HYDA 1WRKA 2M3WA 3NSLA 2JRFA 2WCMA 3S0EA 1TNQA 2M49B 2WCFA 4PHNA 1DC1A 1M31A 2F8PA 1CMGA 2MLFC 1FW4A 2LP3A 3B86A 3PM2A 1HQVA 1NX3A 1KFXS 1NCZA 1K93D 2PASA 1OOGA 1QIVA 2BE6A 3DVMA 4Q04A 2KAXA 1DJIA 4TNCA 1CB1A 4MZLA 2OTGC 1K8UA 1SR6B 5DKQA 5I8NA 1QIWA 2JNFA 3OP0A 2HQWA 2Q91A 1NX0A 3PJIA 4MZJA 3I5IB 3CZ1A 4NDCA 1F4QA 1LA3A 2KI4C 1S3PA 1L2OC 4XJKA 1TUZA 2I94A 4HRHA 3RLZA 1J7PA 2NLNA 3JVTB 1R6PA 1GGZA 3DF0A 2LCPA 1X02A 1A2XA 1QVIZ 2L51A 3O2PA 4NDBA 2LC5A 1SBJA 1OZOA 2MRDA 3EVVA 2KOTA 4GFTA 1K90D 4U8DA 3TDIA 4QJ4B 1UUSA 3QRXA 2GGMA 3BUNB 1OOJA 5KSZA 1SK6D 4DCKA 1B4CA 5CPVA 2WCKA 3IVTA 5KU1A 3EK7A 3DY9A 3I5GC 2I18A 4WQ3A 3DVJA 3CWGA 2WOSA 1JBAA 1QLSA 3BUMB 1F70A 5AXIA 2LHLA 2HETA 4ZCVA 1KK7Y 2WORA 3NGVA 2ZRTA 1NCYA 3AAJA 4XYNA 4PHJA 1K96A 4FQOA 1S6JA 5I2OA 1XK4A 1B9AA 1LS8A 3BFAA 3FE6A 2ZN9A 3FIAA 4P5OE 3EVUA 1KFXL 1OW4A 2Q4UA 2ZNEA 2G2BA 1G8IA 4BY5A 2H61C 3NSKA 1DGUA 4OZDA 2K2AA 1QTXA 1CM4A 3O4YA 1IQ5A 3TS5C 1DJGA 1YUTA 3V2LA 3VRNA 1ZACA 2F3YA 2AMIA 4F0ZB 2MBXA 5DICA 4UPGA 5J3XA 4WQ2A 3D10A 1CLLA 1DEKA 1DQEA 1G33A 1KQMC 1PK0D 2AAOA 2SASA 1F8HA 1IQ3A 3TUYC 1J1EA 2M7NA 1S26D 1SYMA 1IJ5A 2LANA 3BQ3A 3O4XA 5B8IB 1OSAA 1QVIY 3GOFA 1ALVA 1QV1A 2PYQA 3HCMA 1TIZA 2K8MB 1SL7A 5CSJA 1JC2A 1F54A 1R2UA 2K7DA 3KPXA 3FE8A 3K1EA 5I2QA 3CYZA 4IL1A 2LAPA 3SG7A 3MSEB 3CZTX 3TDUA 4AQIA 2GV5A 2BAPA 1MHOA 3EK4A 3WNXB 1F4OA 3S0FA 3ZWHA 1BF5A 1WLZA 5JOLA 3I5FC 2NCPA 3EKHA 5I94A 4PDZA 2H8VA 1PVAA 3OB1B 1DF0B 3FWCA 2LM5A 1QX5B 1P28A 1CDMA 1EG4A 1AHRA 1NIWA 1XFWO 4ORAB 3VROA 1SMGA 1IH0A 2FJYA 3KHEA 2CNPA 3NSIA 4PE7A 4PALA 1JSAA 1PVBA 2P71A 1AP4A 2BL0C 2L0PA 2O5GA 5HLOA 1SSEB 1U5IB 3A4UB 3B88A 2EC6C 3CZ2A 4YBHB 2M1UA 2PQLA 2QEBA 3PFVA 3UO9A 2KDHA 3D76A 1RWYA 2YGUA 2KI6C 1CFCA 1NSHA 1CDLA 1MXLC 2L5XB 4MSPA 1DJWA 2OTGB 4YGBB 3S0BA 1CDNA 1TCOB 3IQQA 2MAZA 3BUOB 2MLEC 1S5GY 1MWNA 3KO0A 3VGOA 1Y0VH 2KYFA 3D73A 5CSNA 3D0YB 1CFPA 2KI4B 1L2OB 1IKUA 1TRFA 2BCAA 5G08A 2JNXA 2MA2A 4ZCUA 1AJ4A 4BY4A 1ORGA 1DTLA 2JT0A 4YGDB 1JUOA 4DIRA 3CZ0A 5ER5A 3SJSA 1KFUL 1TCFA 3B6XA 2EGDA 4HRGA 3CR2A 3OX6A 3VRQA 4NQGA 2KGBC 3I5GB 3BYAA 1A75B 1K95A 3GK1A 4R1EA 4ORBB 3DD4A 4MN0A 2ERBA 3S0AA 1DJHA 2JU0A 2WCHA 2SCPA 2OS8B 1M46A 1YUUA 2KNEA 4MRXA 1SRAA 3R1VA 1TTXA 2LMTA 2K2FA 1A4PA 2Y1NA 4C0JA 2WCLA 1HT9A 4PE1A 1LVCD 4QJ3B 4KYNA 2QPTA 4PE4A 3OGNA 2BECA 1XFXO 2KPHA 5HL1A 1BT6A 2A4JA 2AUCA 2Y4QA 2ZFDA 1KWOC 1H8BA 1CDPA 3DZTA 2L4HA 4JKTA 3TZ1A 1Z2CB 1B47A 1Y6WA 1C3YA 4N1GA 1SY9A 5KTYA 1KK8B 3KF9A 4YGEB 5PALA 2OPOA 1NCXA 1W7JB 5D7FA 1FF1A 1DJZA 1YUSA 2K7BA 3BOWA 2BCXA 1BR4B 3CS1A 3LLEA 3L4LA 3TUYB 1ZOTB 1SCMB 1ZMZA 3WXAA 3HX4A 4CFRA 2L4IA 1EXRA 1XK4C 1LKJA 2E30A 1C07A 1QX7A 3S0GA 5D3OA 3R72A 1V1GA 1DJYA 1Y1AA 1YRTB 1F71A 2K60A 3NSOA 4I5JA 3RM1A 2WC6A 3I5HB 1JWDA 2LE9B 3WHUB 2JQ6A 1K2HA 1SNLA 4DRWA 2I2RE 1OOIX 1SCVA 3O6BA 3CABA 3CDNA 4MZKA 1ODBA 4GAOA 2LMVA 1XFZO 2KI6D 2CBLA 2M0RA 1CNPA 3I5FB 1MQ1A 2JULA 2HQ8A 2PSRA 4OR9B 1J7QA 2NXQA 5FI2A 1Y1XA 3R1PA 4I5KA 1Z4HA 2L2EA 1QV0A 2QEVA 1WDCB 4DS7A 1XYDA 1C7VA 2JZIA 2KLDA 1DELA 1VRKA 3ICBA 4L9MA 2JT8A 4USLA 3CGAA 1AJ5A 1BU3A 1YVHA 3I5IC 2F33A 2KFGA 2PVBA 3NHTA 3R1OA 4N5XA 5HKWA 1FI5A 1NUBA 3F45A 4QJ5B 3JTDB 2JTZA 1BOCA 1XFVO 2BL0B 1CFDA 2JWWA 3JVTC 3L4AA 2EC6B 4M2QA 1F55A 1NWDA 1UHHA 1LINA 1XA5A 2K7OA 4GPLB 1NX1A 5EL2A 1KSMA 1UHJA 1N65A 1BR1B 1RTP1 2L5YA 2ISDA 4F7FA 3AKAA 4M2OA 2BBMA 2L98A 1IGVA 1WLMA 1MR8A 3IF7A 1A29A 3B87A 1PULA 1TNWA 3OB2B 1A03A 1BMOA 1J7RA 1FBVA 1KFUS 5FYXA 2RGIA 1KCYA 4CFQA 1S1EA 1YVLA 2CXJA 2K0JA 1UWOA 2FOTA 2LNKA 3Q8IA 2F2OA 2FCDA 1DT7B 2Y5IA 3SIAA 3A8RA 3D77A 3SIBA 1C3ZA 1PALA 2WCEA 1CLBA 1UURA 2CT9A 2KFFA 3E3RA 4GUKA 4CPVA 1SW8A 1QLKA 1TUJA 3S0DA 1CM1A 2P6BB 3IQOA 3VB1A 1WRLA 5HLVA 4GGFA 3SG3A 1B1GA 4OVNF 1J7OA 1MXEA 3EVRA 1QASA 1TWOA 4GBAA 1NYAA 2KYCA 2P70A 4YGAA 2BKHB 1C7WA 1IG5A 2KBIA 2I7AA 4YRUA 3K21A 1IRJA 1K9UA 1CFFA 2R2IA 1NX2A 1G4YR 4GNKB 4MEWA 1UHKA 2KFHA 2LLSA 2DOQA 1EG3A 2KBMA 4YGCB 4PCWA 3C1VA 4PHKA 2LUCA 3DF0B 4I5LB 2NCOA 1QS7A 4MRYA 1KWOB 1DGVA 3SG4A 1S6CA 1UHIA 2TN4A 1PSRA 2KSPA 5AANA 2JOJA 3FS7A 3PATA 1IIOA 5TNCA 2Y1MA 1V1FA 1XVJA 2BNXA 4OV2A 3SG2A 3GK2A 1K9KA 2WCBA 4AOMA 4WRIA 1JF0A 4A4BA 1KQVA 2GGZA 2VRGA 4ORCB 1ALWA 3VRPA 1B7TZ 2NZ0A 4A4CA 1GM0A 3N7HA 4OCIA 1DF0A 1M63B 1OMVA 2B1UA 3CR5X 3LCPC 4C0LA 1EH2A 2QEHA 5AEQA 1M39A 4DUQA 2JC2A 2V53A 4CLNA 2MHHA 1YX7A 1RJVA 2IS9A 1L7ZA 1YX8A 3PN7C 4YI8A 1TNXA 2LMUA 1U5IA 1IWQA 1LA0A 2JXLA 1TOPA 5CSIA 1QJTA 2M1KB 1MF8B 3SS4A 4JWQA 3NHIA 5FI6A 2KQYA 1Q80A 4YI9A 2BBNA 1WRZA 5F6TA 3TS5B 2KLEA 2FJUB 2LVKA 3BFHA 4AQJA 2ZNDA 1QWVA 2LLUA 2EHBA 1KQMB 2LP2A 2ZKMX 1Y1UA 5DKNA 3NXAA 2K7CA 3D0YA 2LVJA 3LK1A 3O78A 4FQTA 3DXLA 1SKTA 1M45A 5BPJA 2LVIA 1AUIB 2LVVA 3EG5B 2FCEA 1OMRA 3CTNA 3M0WA 1XFYO 1LXFC 2CCMA 3D75A 4PE0A 1GGWA 5AFPA 1CLMA 1N2DA 2F3ZA 3ZNIA 1SL9A 4INXA
chains in the Genus database with same CATH topology
1GQMA 1A75A 1B7TY 2OS8C 1SR6C 1BG1A 5ER4X 2WNDA 1JF2A 5D69A 1AK8A 1DVIA 3H4SE 4M2PA 3WHTB 4JQ0D 3BXKA 1OE9B 1N0YA 2LV7A 1XFUO 2KGRA 2G9BA 4GGNA 2MJWB 1GJYA 2HF5A 1KSOA 1XO5A 1NPQA 5GQQC 1FPWA 3VRRA 3LL8B 1MUXA 4HSZA 2O60A 1PSBA 2H61A 4PHMA 2JPTA 1RECA 1K9PA 1KK8C 1DMOA 3EK8A 2H2KA 2LLTA 2PMYA 4E68A 4ETOA 1D1OA 5I2LA 2KHNA 1BODA 2QACA 4FTGA 3LK0A 1J55A 1BJFA 1EJ3A 1SCMC 3OHMB 3KEVA 1S5GZ 2BE4A 1YURA 4NDDA 5AERA 2BKIB 1RK9A 1WY9A 1S6IA 3CLNA 2JT3A 5CSFA 1BLQA 3AKBA 2LHIA 1FI6A 1J1DA 2D8NA 3PALA 1OMDA 3I5HC 4C0KA 3PSRA 4GGFC 3BUXB 1QATA 1RFJA 3BUWB 1TN4A 4CIDA 1H4BA 2M8UA 2F2PA 2KAYA 4D1EA 1DJXA 2M97A 3DVEA 1WDCC 3PM8A 4MBEA 1AVSA 1OZSA 1S36A 4OKHA 1CMFA 3CR4X 1B8LA 2ZRSA 1JFKA 4P2YB 2PALA 2M7LA 1IJ6A 2CTNA 4I5NB 3GK4X 3JTDC 1TNPA 2HPSA 4XJKB 1RROA 2M29A 1QX2A 3PN7B 1CTRA 2ZN8A 2K61A 4JPZB 4MLWA 3SG5A 3DVKA 3TDZA 2E6WA 5JJGA 1E8AA 1NP8A 2COLB 1B8RA 2WC8A 1YRUB 1OQPA 1YTZC 1QXPA 5HKZA 1ZUZA 2L50A 2LUXA 3AAKA 4N1FA 3EKJA 3PLFB 1UP5A 1YR5A 1ZFSA 1JFJA 1W7IB 3BOWB 1EL4A 2KAVA 2JXCA 2M9GA 2PRUA 3SG6A 4ICBA 1SPYA 3FWBA 1SL8A 2JTTA 4HREE 1UHNA 1PRWA 5HKYA 1K94A 5K89A 5DKRA 1CKKA 2KQ6A 2BCBA 1KK7Z 1B8CA 3OX5A 5IBWA 4MVFA 5HYDA 1WRKA 2M3WA 3NSLA 2JRFA 1TNQA 2M49B 2WCFA 4PHNA 1M31A 2F8PA 1CMGA 2MLFC 1FW4A 2LP3A 1HQVA 1NX3A 1KFXS 1NCZA 1K93D 2PASA 1QIVA 2BE6A 3DVMA 4Q04A 2KAXA 1DJIA 4TNCA 1CB1A 4MZLA 2OTGC 1K8UA 1SR6B 5DKQA 5I8NA 1QIWA 2JNFA 3OP0A 2HQWA 2Q91A 1NX0A 4MZJA 3I5IB 4NDCA 1F4QA 1LA3A 2KI4C 1S3PA 1L2OC 4XJKA 2I94A 4HRHA 3RLZA 1J7PA 2NLNA 3JVTB 1R6PA 1GGZA 3DF0A 2LCPA 1X02A 1A2XA 1QVIZ 2L51A 3O2PA 4NDBA 2LC5A 1SBJA 1OZOA 2MRDA 3EVVA 2KOTA 4GFTA 1K90D 4U8DA 3TDIA 4QJ4B 1UUSA 3QRXA 2GGMA 3BUNB 1OOJA 5KSZA 1SK6D 4DCKA 1B4CA 5CPVA 5KU1A 3EK7A 3I5GC 2I18A 4WQ3A 3DVJA 3CWGA 2WOSA 1JBAA 1QLSA 3BUMB 1F70A 5AXIA 2LHLA 2HETA 4ZCVA 1KK7Y 2WORA 2ZRTA 1NCYA 3AAJA 4XYNA 4PHJA 1K96A 4FQOA 1S6JA 5I2OA 1XK4A 1B9AA 3FIAA 2ZN9A 4P5OE 3EVUA 1KFXL 2Q4UA 2ZNEA 2G2BA 1G8IA 4BY5A 2H61C 3NSKA 1DGUA 2K2AA 1QTXA 1CM4A 3O4YA 1IQ5A 3TS5C 1DJGA 1YUTA 3VRNA 1ZACA 2F3YA 2AMIA 4F0ZB 2MBXA 4UPGA 5J3XA 4WQ2A 3D10A 1CLLA 1G33A 1KQMC 1PK0D 2AAOA 2SASA 1F8HA 1IQ3A 3TUYC 1J1EA 2M7NA 1S26D 1SYMA 1IJ5A 2LANA 3BQ3A 5B8IB 1OSAA 1QVIY 3GOFA 1ALVA 1QV1A 3HCMA 1TIZA 2K8MB 1SL7A 5CSJA 1JC2A 1F54A 1R2UA 2K7DA 3KPXA 5I2QA 4IL1A 2LAPA 3SG7A 3MSEB 3CZTX 3TDUA 4AQIA 2GV5A 1MHOA 3EK4A 3WNXB 1F4OA 3ZWHA 1BF5A 1WLZA 5JOLA 3I5FC 2NCPA 3EKHA 4PDZA 1PVAA 3OB1B 1DF0B 3FWCA 2LM5A 1QX5B 1CDMA 1EG4A 1AHRA 1NIWA 1XFWO 4ORAB 3VROA 1SMGA 1IH0A 3KHEA 2CNPA 3NSIA 4PE7A 4PALA 1JSAA 1PVBA 1AP4A 2BL0C 2L0PA 2O5GA 5HLOA 1U5IB 3A4UB 2EC6C 4YBHB 2M1UA 3PFVA 2KDHA 1RWYA 2KI6C 1CFCA 1NSHA 1CDLA 1MXLC 2L5XB 4MSPA 1DJWA 2OTGB 4YGBB 1CDNA 1TCOB 3IQQA 2MAZA 3BUOB 2MLEC 1S5GY 1MWNA 3KO0A 3VGOA 1Y0VH 2KYFA 1CFPA 5CSNA 3D0YB 2KI4B 1L2OB 1IKUA 1TRFA 2BCAA 5G08A 2JNXA 2MA2A 4ZCUA 1AJ4A 4BY4A 1DTLA 2JT0A 4YGDB 1JUOA 4DIRA 3SJSA 5ER5A 1KFUL 1TCFA 2EGDA 4HRGA 3CR2A 3OX6A 3VRQA 4NQGA 2KGBC 3I5GB 3BYAA 1A75B 1K95A 3GK1A 4R1EA 4ORBB 3DD4A 4MN0A 1DJHA 2JU0A 2SCPA 2OS8B 1M46A 1YUUA 2KNEA 4MRXA 1SRAA 1TTXA 2LMTA 2K2FA 1A4PA 2Y1NA 4C0JA 1HT9A 4PE1A 1LVCD 4QJ3B 2QPTA 4PE4A 2BECA 1XFXO 1BT6A 2A4JA 2AUCA 2Y4QA 2ZFDA 1KWOC 1H8BA 1CDPA 2L4HA 3TZ1A 1B47A 1Y6WA 4N1GA 1SY9A 5KTYA 1KK8B 3KF9A 4YGEB 5PALA 2OPOA 1NCXA 1W7JB 5D7FA 1FF1A 1DJZA 1YUSA 2K7BA 3BOWA 2BCXA 1BR4B 3CS1A 3LLEA 3TUYB 1ZOTB 1SCMB 1ZMZA 3WXAA 3HX4A 4CFRA 2L4IA 1EXRA 1XK4C 1LKJA 2E30A 1C07A 1QX7A 1V1GA 1DJYA 1Y1AA 1YRTB 1F71A 3RM1A 3NSOA 4I5JA 1JWDA 3I5HB 2LE9B 3WHUB 2JQ6A 1K2HA 1SNLA 4DRWA 2I2RE 1SCVA 3O6BA 4MZKA 1ODBA 4GAOA 2LMVA 1XFZO 2KI6D 2CBLA 2M0RA 1CNPA 3I5FB 1MQ1A 2JULA 2HQ8A 2PSRA 4OR9B 1J7QA 2NXQA 1Y1XA 4I5KA 2L2EA 1QV0A 1WDCB 4DS7A 1XYDA 1C7VA 2JZIA 3ICBA 1VRKA 4L9MA 2JT8A 4USLA 3CGAA 1AJ5A 1BU3A 1YVHA 3I5IC 2F33A 2KFGA 2PVBA 5HKWA 4N5XA 1FI5A 1NUBA 3F45A 4QJ5B 3JTDB 2JTZA 1BOCA 1XFVO 2BL0B 1CFDA 2JWWA 3JVTC 2EC6B 4M2QA 1F55A 1NWDA 1UHHA 1LINA 1XA5A 2K7OA 4GPLB 1NX1A 1KSMA 1UHJA 1N65A 1BR1B 1RTP1 2ISDA 3AKAA 4M2OA 2BBMA 2L98A 1IGVA 1WLMA 1MR8A 3IF7A 1A29A 1PULA 1TNWA 3OB2B 1A03A 1BMOA 1J7RA 1FBVA 1KFUS 5FYXA 2RGIA 1KCYA 4CFQA 1S1EA 1YVLA 2CXJA 2K0JA 1UWOA 2FOTA 2LNKA 2F2OA 2FCDA 1DT7B 2Y5IA 3SIAA 3A8RA 3SIBA 1PALA 1CLBA 2WCEA 1UURA 2CT9A 2KFFA 3E3RA 4GUKA 4CPVA 1SW8A 1QLKA 1CM1A 2P6BB 3IQOA 1WRLA 5HLVA 4GGFA 3SG3A 1B1GA 4OVNF 1J7OA 1MXEA 3EVRA 1QASA 4GBAA 1NYAA 2KYCA 4YGAA 2BKHB 1C7WA 1IG5A 2KBIA 2I7AA 4YRUA 3K21A 1IRJA 1K9UA 1CFFA 2R2IA 1NX2A 1G4YR 4GNKB 4MEWA 1UHKA 2KFHA 2LLSA 2DOQA 1EG3A 2KBMA 4YGCB 4PCWA 3C1VA 4PHKA 2LUCA 3DF0B 4I5LB 2NCOA 1QS7A 4MRYA 1KWOB 1DGVA 3SG4A 1S6CA 1UHIA 2TN4A 1PSRA 2KSPA 5AANA 2JOJA 3FS7A 3PATA 5TNCA 2Y1MA 1V1FA 1XVJA 4OV2A 3SG2A 3GK2A 1K9KA 2WCBA 4AOMA 4WRIA 1JF0A 4A4BA 1KQVA 2GGZA 2VRGA 4ORCB 1ALWA 3VRPA 1B7TZ 2NZ0A 4A4CA 4OCIA 1DF0A 1M63B 1OMVA 2B1UA 3CR5X 3LCPC 4C0LA 1EH2A 5AEQA 1M39A 4DUQA 2JC2A 2V53A 4CLNA 2MHHA 1YX7A 1RJVA 2IS9A 1L7ZA 1YX8A 3PN7C 4YI8A 1TNXA 2LMUA 1U5IA 1IWQA 1LA0A 2JXLA 1TOPA 5CSIA 1QJTA 2M1KB 1MF8B 4JWQA 2KQYA 1Q80A 4YI9A 2BBNA 1WRZA 5F6TA 3TS5B 2FJUB 2LVKA 4AQJA 2ZNDA 2LLUA 2EHBA 1KQMB 2LP2A 2ZKMX 1Y1UA 5DKNA 3NXAA 2K7CA 3D0YA 2LVJA 3LK1A 3O78A 1SKTA 1M45A 5BPJA 2LVIA 1AUIB 2LVVA 2FCEA 1OMRA 3CTNA 3M0WA 1XFYO 1LXFC 2CCMA 4PE0A 1GGWA 5AFPA 1CLMA 1N2DA 2F3ZA 3ZNIA 1SL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQM A;  1A75 A;  1B7T Y;  2OS8 C;  1SR6 C;  1BG1 A;  5ER4 X;  2WND A;  1JF2 A;  5D69 A;  1AK8 A;  1DVI A;  3H4S E;  4M2P A;  3WHT B;  4JQ0 D;  3BXK A;  1OE9 B;  1N0Y A;  2LV7 A;  1XFU O;  2KGR A;  2G9B A;  4GGN A;  2MJW B;  1GJY A;  2HF5 A;  1KSO A;  1XO5 A;  1NPQ A;  5GQQ C;  1FPW A;  3VRR A;  3LL8 B;  1MUX A;  4HSZ A;  2O60 A;  1PSB A;  2H61 A;  4PHM A;  2JPT A;  1REC A;  1K9P A;  1KK8 C;  1DMO A;  3EK8 A;  2H2K A;  2LLT A;  2PMY A;  4E68 A;  4ETO A;  1D1O A;  5I2L A;  2KHN A;  1BOD A;  2QAC A;  4FTG A;  3LK0 A;  1J55 A;  1BJF A;  1EJ3 A;  1SCM C;  3OHM B;  3KEV A;  1S5G Z;  2BE4 A;  1YUR A;  4NDD A;  5AER A;  2BKI B;  1RK9 A;  1WY9 A;  1S6I A;  3CLN A;  2JT3 A;  5CSF A;  1BLQ A;  3AKB A;  2LHI A;  1FI6 A;  1J1D A;  2D8N A;  3PAL A;  1OMD A;  3I5H C;  4C0K A;  3PSR A;  4GGF C;  3BUX B;  1QAT A;  1RFJ A;  3BUW B;  1TN4 A;  4CID A;  1H4B A;  2M8U A;  2F2P A;  2KAY A;  4D1E A;  1DJX A;  2M97 A;  3DVE A;  1WDC C;  3PM8 A;  4MBE A;  1AVS A;  1OZS A;  1S36 A;  4OKH A;  1CMF A;  3CR4 X;  1B8L A;  2ZRS A;  1JFK A;  4P2Y B;  2PAL A;  2M7L A;  1IJ6 A;  2CTN A;  4I5N B;  3GK4 X;  3JTD C;  1TNP A;  2HPS A;  4XJK B;  1RRO A;  2M29 A;  1QX2 A;  3PN7 B;  1CTR A;  2ZN8 A;  2K61 A;  4JPZ B;  4MLW A;  3SG5 A;  3DVK A;  3TDZ A;  2E6W A;  5JJG A;  1E8A A;  1NP8 A;  2COL B;  1B8R A;  2WC8 A;  1YRU B;  1OQP A;  1YTZ C;  1QXP A;  5HKZ A;  1ZUZ A;  2L50 A;  2LUX A;  3AAK A;  4N1F A;  3EKJ A;  3PLF B;  1UP5 A;  1YR5 A;  1ZFS A;  1JFJ A;  1W7I B;  3BOW B;  1EL4 A;  2KAV A;  2JXC A;  2M9G A;  2PRU A;  3SG6 A;  4ICB A;  1SPY A;  3FWB A;  1SL8 A;  2JTT A;  4HRE E;  1UHN A;  1PRW A;  5HKY A;  1K94 A;  5K89 A;  5DKR A;  1CKK A;  2KQ6 A;  2BCB A;  1KK7 Z;  1B8C A;  3OX5 A;  5IBW A;  4MVF A;  5HYD A;  1WRK A;  2M3W A;  3NSL A;  2JRF A;  1TNQ A;  2M49 B;  2WCF A;  4PHN A;  1M31 A;  2F8P A;  1CMG A;  2MLF C;  1FW4 A;  2LP3 A;  1HQV A;  1NX3 A;  1KFX S;  1NCZ A;  1K93 D;  2PAS A;  1QIV A;  2BE6 A;  3DVM A;  4Q04 A;  2KAX A;  1DJI A;  4TNC A;  1CB1 A;  4MZL A;  2OTG C;  1K8U A;  1SR6 B;  5DKQ A;  5I8N A;  1QIW A;  2JNF A;  3OP0 A;  2HQW A;  2Q91 A;  1NX0 A;  4MZJ A;  3I5I B;  4NDC A;  1F4Q A;  1LA3 A;  2KI4 C;  1S3P A;  1L2O C;  4XJK A;  2I94 A;  4HRH A;  3RLZ A;  1J7P A;  2NLN A;  3JVT B;  1R6P A;  1GGZ A;  3DF0 A;  2LCP A;  1X02 A;  1A2X A;  1QVI Z;  2L51 A;  3O2P A;  4NDB A;  2LC5 A;  1SBJ A;  1OZO A;  2MRD A;  3EVV A;  2KOT A;  4GFT A;  1K90 D;  4U8D A;  3TDI A;  4QJ4 B;  1UUS A;  3QRX A;  2GGM A;  3BUN B;  1OOJ A;  5KSZ A;  1SK6 D;  4DCK A;  1B4C A;  5CPV A;  5KU1 A;  3EK7 A;  3I5G C;  2I18 A;  4WQ3 A;  3DVJ A;  3CWG A;  2WOS A;  1JBA A;  1QLS A;  3BUM B;  1F70 A;  5AXI A;  2LHL A;  2HET A;  4ZCV A;  1KK7 Y;  2WOR A;  2ZRT A;  1NCY A;  3AAJ A;  4XYN A;  4PHJ A;  1K96 A;  4FQO A;  1S6J A;  5I2O A;  1XK4 A;  1B9A A;  3FIA A;  2ZN9 A;  4P5O E;  3EVU A;  1KFX L;  2Q4U A;  2ZNE A;  2G2B A;  1G8I A;  4BY5 A;  2H61 C;  3NSK A;  1DGU A;  2K2A A;  1QTX A;  1CM4 A;  3O4Y A;  1IQ5 A;  3TS5 C;  1DJG A;  1YUT A;  3VRN A;  1ZAC A;  2F3Y A;  2AMI A;  4F0Z B;  2MBX A;  4UPG A;  5J3X A;  4WQ2 A;  3D10 A;  1CLL A;  1G33 A;  1KQM C;  1PK0 D;  2AAO A;  2SAS A;  1F8H A;  1IQ3 A;  3TUY C;  1J1E A;  2M7N A;  1S26 D;  1SYM A;  1IJ5 A;  2LAN A;  3BQ3 A;  5B8I B;  1OSA A;  1QVI Y;  3GOF A;  1ALV A;  1QV1 A;  3HCM A;  1TIZ A;  2K8M B;  1SL7 A;  5CSJ A;  1JC2 A;  1F54 A;  1R2U A;  2K7D A;  3KPX A;  5I2Q A;  4IL1 A;  2LAP A;  3SG7 A;  3MSE B;  3CZT X;  3TDU A;  4AQI A;  2GV5 A;  1MHO A;  3EK4 A;  3WNX B;  1F4O A;  3ZWH A;  1BF5 A;  1WLZ A;  5JOL A;  3I5F C;  2NCP A;  3EKH A;  4PDZ A;  1PVA A;  3OB1 B;  1DF0 B;  3FWC A;  2LM5 A;  1QX5 B;  1CDM A;  1EG4 A;  1AHR A;  1NIW A;  1XFW O;  4ORA B;  3VRO A;  1SMG A;  1IH0 A;  3KHE A;  2CNP A;  3NSI A;  4PE7 A;  4PAL A;  1JSA A;  1PVB A;  1AP4 A;  2BL0 C;  2L0P A;  2O5G A;  5HLO A;  1U5I B;  3A4U B;  2EC6 C;  4YBH B;  2M1U A;  3PFV A;  2KDH A;  1RWY A;  2KI6 C;  1CFC A;  1NSH A;  1CDL A;  1MXL C;  2L5X B;  4MSP A;  1DJW A;  2OTG B;  4YGB B;  1CDN A;  1TCO B;  3IQQ A;  2MAZ A;  3BUO B;  2MLE C;  1S5G Y;  1MWN A;  3KO0 A;  3VGO A;  1Y0V H;  2KYF A;  1CFP A;  5CSN A;  3D0Y B;  2KI4 B;  1L2O B;  1IKU A;  1TRF A;  2BCA A;  5G08 A;  2JNX A;  2MA2 A;  4ZCU A;  1AJ4 A;  4BY4 A;  1DTL A;  2JT0 A;  4YGD B;  1JUO A;  4DIR A;  3SJS A;  5ER5 A;  1KFU L;  1TCF A;  2EGD A;  4HRG A;  3CR2 A;  3OX6 A;  3VRQ A;  4NQG A;  2KGB C;  3I5G B;  3BYA A;  1A75 B;  1K95 A;  3GK1 A;  4R1E A;  4ORB B;  3DD4 A;  4MN0 A;  1DJH A;  2JU0 A;  2SCP A;  2OS8 B;  1M46 A;  1YUU A;  2KNE A;  4MRX A;  1SRA A;  1TTX A;  2LMT A;  2K2F A;  1A4P A;  2Y1N A;  4C0J A;  1HT9 A;  4PE1 A;  1LVC D;  4QJ3 B;  2QPT A;  4PE4 A;  2BEC A;  1XFX O;  1BT6 A;  2A4J A;  2AUC A;  2Y4Q A;  2ZFD A;  1KWO C;  1H8B A;  1CDP A;  2L4H A;  3TZ1 A;  1B47 A;  1Y6W A;  4N1G A;  1SY9 A;  5KTY A;  1KK8 B;  3KF9 A;  4YGE B;  5PAL A;  2OPO A;  1NCX A;  1W7J B;  5D7F A;  1FF1 A;  1DJZ A;  1YUS A;  2K7B A;  3BOW A;  2BCX A;  1BR4 B;  3CS1 A;  3LLE A;  3TUY B;  1ZOT B;  1SCM B;  1ZMZ A;  3WXA A;  3HX4 A;  4CFR A;  2L4I A;  1EXR A;  1XK4 C;  1LKJ A;  2E30 A;  1C07 A;  1QX7 A;  1V1G A;  1DJY A;  1Y1A A;  1YRT B;  1F71 A;  3RM1 A;  3NSO A;  4I5J A;  1JWD A;  3I5H B;  2LE9 B;  3WHU B;  2JQ6 A;  1K2H A;  1SNL A;  4DRW A;  2I2R E;  1SCV A;  3O6B A;  4MZK A;  1ODB A;  4GAO A;  2LMV A;  1XFZ O;  2KI6 D;  2CBL A;  2M0R A;  1CNP A;  3I5F B;  1MQ1 A;  2JUL A;  2HQ8 A;  2PSR A;  4OR9 B;  1J7Q A;  2NXQ A;  1Y1X A;  4I5K A;  2L2E A;  1QV0 A;  1WDC B;  4DS7 A;  1XYD A;  1C7V A;  2JZI A;  3ICB A;  1VRK A;  4L9M A;  2JT8 A;  4USL A;  3CGA A;  1AJ5 A;  1BU3 A;  1YVH A;  3I5I C;  2F33 A;  2KFG A;  2PVB A;  5HKW A;  4N5X A;  1FI5 A;  1NUB A;  3F45 A;  4QJ5 B;  3JTD B;  2JTZ A;  1BOC A;  1XFV O;  2BL0 B;  1CFD A;  2JWW A;  3JVT C;  2EC6 B;  4M2Q A;  1F55 A;  1NWD A;  1UHH A;  1LIN A;  1XA5 A;  2K7O A;  4GPL B;  1NX1 A;  1KSM A;  1UHJ A;  1N65 A;  1BR1 B;  1RTP 1;  2ISD A;  3AKA A;  4M2O A;  2BBM A;  2L98 A;  1IGV A;  1WLM A;  1MR8 A;  3IF7 A;  1A29 A;  1PUL A;  1TNW A;  3OB2 B;  1A03 A;  1BMO A;  1J7R A;  1FBV A;  1KFU S;  5FYX A;  2RGI A;  1KCY A;  4CFQ A;  1S1E A;  1YVL A;  2CXJ A;  2K0J A;  1UWO A;  2FOT A;  2LNK A;  2F2O A;  2FCD A;  1DT7 B;  2Y5I A;  3SIA A;  3A8R A;  3SIB A;  1PAL A;  1CLB A;  2WCE A;  1UUR A;  2CT9 A;  2KFF A;  3E3R A;  4GUK A;  4CPV A;  1SW8 A;  1QLK A;  1CM1 A;  2P6B B;  3IQO A;  1WRL A;  5HLV A;  4GGF A;  3SG3 A;  1B1G A;  4OVN F;  1J7O A;  1MXE A;  3EVR A;  1QAS A;  4GBA A;  1NYA A;  2KYC A;  4YGA A;  2BKH B;  1C7W A;  1IG5 A;  2KBI A;  2I7A A;  4YRU A;  3K21 A;  1IRJ A;  1K9U A;  1CFF A;  2R2I A;  1NX2 A;  1G4Y R;  4GNK B;  4MEW A;  1UHK A;  2KFH A;  2LLS A;  2DOQ A;  1EG3 A;  2KBM A;  4YGC B;  4PCW A;  3C1V A;  4PHK A;  2LUC A;  3DF0 B;  4I5L B;  2NCO A;  1QS7 A;  4MRY A;  1KWO B;  1DGV A;  3SG4 A;  1S6C A;  1UHI A;  2TN4 A;  1PSR A;  2KSP A;  5AAN A;  2JOJ A;  3FS7 A;  3PAT A;  5TNC A;  2Y1M A;  1V1F A;  1XVJ A;  4OV2 A;  3SG2 A;  3GK2 A;  1K9K A;  2WCB A;  4AOM A;  4WRI A;  1JF0 A;  4A4B A;  1KQV A;  2GGZ A;  2VRG A;  4ORC B;  1ALW A;  3VRP A;  1B7T Z;  2NZ0 A;  4A4C A;  4OCI A;  1DF0 A;  1M63 B;  1OMV A;  2B1U A;  3CR5 X;  3LCP C;  4C0L A;  1EH2 A;  5AEQ A;  1M39 A;  4DUQ A;  2JC2 A;  2V53 A;  4CLN A;  2MHH A;  1YX7 A;  1RJV A;  2IS9 A;  1L7Z A;  1YX8 A;  3PN7 C;  4YI8 A;  1TNX A;  2LMU A;  1U5I A;  1IWQ A;  1LA0 A;  2JXL A;  1TOP A;  5CSI A;  1QJT A;  2M1K B;  1MF8 B;  4JWQ A;  2KQY A;  1Q80 A;  4YI9 A;  2BBN A;  1WRZ A;  5F6T A;  3TS5 B;  2FJU B;  2LVK A;  4AQJ A;  2ZND A;  2LLU A;  2EHB A;  1KQM B;  2LP2 A;  2ZKM X;  1Y1U A;  5DKN A;  3NXA A;  2K7C A;  3D0Y A;  2LVJ A;  3LK1 A;  3O78 A;  1SKT A;  1M45 A;  5BPJ A;  2LVI A;  1AUI B;  2LVV A;  2FCE A;  1OMR A;  3CTN A;  3M0W A;  1XFY O;  1LXF C;  2CCM A;  4PE0 A;  1GGW A;  5AFP A;  1CLM A;  1N2D A;  2F3Z A;  3ZNI A;  1SL9 A; 
#chains in the Genus database with same CATH topology
 3FE9 A;  3QME A;  1GQM A;  1A75 A;  1B7T Y;  2OS8 C;  1OOF A;  1SR6 C;  1BG1 A;  5ER4 X;  2WND A;  1JF2 A;  3BJH A;  2L2C A;  5D69 A;  1AK8 A;  1DVI A;  3DYE A;  3H4S E;  4M2P A;  3WHT B;  4JQ0 D;  3BXK A;  1OE9 B;  1N0Y A;  2LV7 A;  1XFU O;  2KGR A;  2G9B A;  3B7A A;  4GGN A;  2MJW B;  1GJY A;  3OBV A;  1T14 A;  4IJ7 A;  2HF5 A;  1KSO A;  1XO5 A;  1NPQ A;  5GQQ C;  1FPW A;  3VRR A;  2QDI A;  3UNW A;  3LL8 B;  1MUX A;  4HSZ A;  2O60 A;  1PSB A;  2H61 A;  4PHM A;  2JPT A;  1REC A;  1K9P A;  1KK8 C;  1DMO A;  3EK8 A;  2H2K A;  2LLT A;  2PMY A;  3D74 A;  1XFR A;  4ETO A;  5I2L A;  4JD9 A;  4E68 A;  1D1O A;  2KHN A;  1BOD A;  2QAC A;  4FTG A;  3LK0 A;  1J55 A;  1BJF A;  1EJ3 A;  1SCM C;  3OHM B;  3KEV A;  1S5G Z;  2BE4 A;  1YUR A;  4NDD A;  3SS3 A;  5AER A;  2BKI B;  1RK9 A;  1WY9 A;  1S6I A;  3CLN A;  2JT3 A;  5CSF A;  1BLQ A;  3AKB A;  2LHI A;  5FI7 A;  1FI6 A;  1J1D A;  2D8N A;  3PAL A;  1OMD A;  3I5H C;  4C0K A;  1OOH A;  3PSR A;  3BUX B;  4GGF C;  1QAT A;  1RFJ A;  3BUW B;  1TN4 A;  4CID A;  1H4B A;  2M8U A;  2F2P A;  2KAY A;  3D78 A;  4D1E A;  1DJX A;  2M97 A;  2GTE A;  3DVE A;  3RZS A;  3BFB A;  1WDC C;  3PM8 A;  4MBE A;  1AVS A;  3SS5 A;  1OZS A;  1S36 A;  4OKH A;  1CMF A;  3CR4 X;  1B8L A;  2ZRS A;  1JFK A;  4P2Y B;  2PAL A;  2M7L A;  1IJ6 A;  2CTN A;  4I5N B;  3GK4 X;  3JTD C;  1TNP A;  2HPS A;  4XJK B;  1RRO A;  2M29 A;  1QX2 A;  4PT1 A;  3PN7 B;  1CTR A;  2ZN8 A;  2K61 A;  4JPZ B;  4MLW A;  3SG5 A;  3DVK A;  2WCJ A;  3TDZ A;  2E6W A;  2QEO A;  5JJG A;  1E8A A;  1NP8 A;  2COL B;  1B8R A;  2WC8 A;  1W9Z A;  1YRU B;  1OQP A;  1YTZ C;  1QXP A;  5HKZ A;  1ZUZ A;  2L50 A;  2LUX A;  3AAK A;  4N1F A;  3EKJ A;  3PLF B;  1UP5 A;  4INW A;  1YR5 A;  2JPO A;  1ZFS A;  1JFJ A;  1W7I B;  3BOW B;  1EL4 A;  3L47 A;  2KAV A;  2JXC A;  2M9G A;  2PRU A;  3SG6 A;  4ICB A;  1SPY A;  3FWB A;  1SL8 A;  2JTT A;  4HRE E;  1UHN A;  1PRW A;  2WC5 A;  1K94 A;  5HKY A;  5K89 A;  5DKR A;  1CKK A;  2KQ6 A;  2BCB A;  1KK7 Z;  1B8C A;  3OX5 A;  5IBW A;  4MVF A;  5HYD A;  1WRK A;  2M3W A;  3NSL A;  2JRF A;  2WCM A;  3S0E A;  1TNQ A;  2M49 B;  2WCF A;  4PHN A;  1DC1 A;  1M31 A;  2F8P A;  1CMG A;  2MLF C;  1FW4 A;  2LP3 A;  3B86 A;  3PM2 A;  1HQV A;  1NX3 A;  1KFX S;  1NCZ A;  1K93 D;  2PAS A;  1OOG A;  1QIV A;  2BE6 A;  3DVM A;  4Q04 A;  2KAX A;  1DJI A;  4TNC A;  1CB1 A;  4MZL A;  2OTG C;  1K8U A;  1SR6 B;  5DKQ A;  5I8N A;  1QIW A;  2JNF A;  3OP0 A;  2HQW A;  2Q91 A;  1NX0 A;  3PJI A;  4MZJ A;  3I5I B;  3CZ1 A;  4NDC A;  1F4Q A;  1LA3 A;  2KI4 C;  1S3P A;  1L2O C;  4XJK A;  1TUZ A;  2I94 A;  4HRH A;  3RLZ A;  1J7P A;  2NLN A;  3JVT B;  1R6P A;  1GGZ A;  3DF0 A;  2LCP A;  1X02 A;  1A2X A;  1QVI Z;  2L51 A;  3O2P A;  4NDB A;  2LC5 A;  1SBJ A;  1OZO A;  2MRD A;  3EVV A;  2KOT A;  4GFT A;  1K90 D;  4U8D A;  3TDI A;  4QJ4 B;  1UUS A;  3QRX A;  2GGM A;  3BUN B;  1OOJ A;  5KSZ A;  1SK6 D;  4DCK A;  1B4C A;  5CPV A;  2WCK A;  3IVT A;  5KU1 A;  3EK7 A;  3DY9 A;  3I5G C;  2I18 A;  4WQ3 A;  3DVJ A;  3CWG A;  2WOS A;  1JBA A;  1QLS A;  3BUM B;  1F70 A;  5AXI A;  2LHL A;  2HET A;  4ZCV A;  1KK7 Y;  2WOR A;  3NGV A;  2ZRT A;  1NCY A;  3AAJ A;  4XYN A;  4PHJ A;  1K96 A;  4FQO A;  1S6J A;  5I2O A;  1XK4 A;  1B9A A;  1LS8 A;  3BFA A;  3FE6 A;  2ZN9 A;  3FIA A;  4P5O E;  3EVU A;  1KFX L;  1OW4 A;  2Q4U A;  2ZNE A;  2G2B A;  1G8I A;  4BY5 A;  2H61 C;  3NSK A;  1DGU A;  4OZD A;  2K2A A;  1QTX A;  1CM4 A;  3O4Y A;  1IQ5 A;  3TS5 C;  1DJG A;  1YUT A;  3V2L A;  3VRN A;  1ZAC A;  2F3Y A;  2AMI A;  4F0Z B;  2MBX A;  5DIC A;  4UPG A;  5J3X A;  4WQ2 A;  3D10 A;  1CLL A;  1DEK A;  1DQE A;  1G33 A;  1KQM C;  1PK0 D;  2AAO A;  2SAS A;  1F8H A;  1IQ3 A;  3TUY C;  1J1E A;  2M7N A;  1S26 D;  1SYM A;  1IJ5 A;  2LAN A;  3BQ3 A;  3O4X A;  5B8I B;  1OSA A;  1QVI Y;  3GOF A;  1ALV A;  1QV1 A;  2PYQ A;  3HCM A;  1TIZ A;  2K8M B;  1SL7 A;  5CSJ A;  1JC2 A;  1F54 A;  1R2U A;  2K7D A;  3KPX A;  3FE8 A;  3K1E A;  5I2Q A;  3CYZ A;  4IL1 A;  2LAP A;  3SG7 A;  3MSE B;  3CZT X;  3TDU A;  4AQI A;  2GV5 A;  2BAP A;  1MHO A;  3EK4 A;  3WNX B;  1F4O A;  3S0F A;  3ZWH A;  1BF5 A;  1WLZ A;  5JOL A;  3I5F C;  2NCP A;  3EKH A;  5I94 A;  4PDZ A;  2H8V A;  1PVA A;  3OB1 B;  1DF0 B;  3FWC A;  2LM5 A;  1QX5 B;  1P28 A;  1CDM A;  1EG4 A;  1AHR A;  1NIW A;  1XFW O;  4ORA B;  3VRO A;  1SMG A;  1IH0 A;  2FJY A;  3KHE A;  2CNP A;  3NSI A;  4PE7 A;  4PAL A;  1JSA A;  1PVB A;  2P71 A;  1AP4 A;  2BL0 C;  2L0P A;  2O5G A;  5HLO A;  1SSE B;  1U5I B;  3A4U B;  3B88 A;  2EC6 C;  3CZ2 A;  4YBH B;  2M1U A;  2PQL A;  2QEB A;  3PFV A;  3UO9 A;  2KDH A;  3D76 A;  1RWY A;  2YGU A;  2KI6 C;  1CFC A;  1NSH A;  1CDL A;  1MXL C;  2L5X B;  4MSP A;  1DJW A;  2OTG B;  4YGB B;  3S0B A;  1CDN A;  1TCO B;  3IQQ A;  2MAZ A;  3BUO B;  2MLE C;  1S5G Y;  1MWN A;  3KO0 A;  3VGO A;  1Y0V H;  2KYF A;  3D73 A;  5CSN A;  3D0Y B;  1CFP A;  2KI4 B;  1L2O B;  1IKU A;  1TRF A;  2BCA A;  5G08 A;  2JNX A;  2MA2 A;  4ZCU A;  1AJ4 A;  4BY4 A;  1ORG A;  1DTL A;  2JT0 A;  4YGD B;  1JUO A;  4DIR A;  3CZ0 A;  5ER5 A;  3SJS A;  1KFU L;  1TCF A;  3B6X A;  2EGD A;  4HRG A;  3CR2 A;  3OX6 A;  3VRQ A;  4NQG A;  2KGB C;  3I5G B;  3BYA A;  1A75 B;  1K95 A;  3GK1 A;  4R1E A;  4ORB B;  3DD4 A;  4MN0 A;  2ERB A;  3S0A A;  1DJH A;  2JU0 A;  2WCH A;  2SCP A;  2OS8 B;  1M46 A;  1YUU A;  2KNE A;  4MRX A;  1SRA A;  3R1V A;  1TTX A;  2LMT A;  2K2F A;  1A4P A;  2Y1N A;  4C0J A;  2WCL A;  1HT9 A;  4PE1 A;  1LVC D;  4QJ3 B;  4KYN A;  2QPT A;  4PE4 A;  3OGN A;  2BEC A;  1XFX O;  2KPH A;  5HL1 A;  1BT6 A;  2A4J A;  2AUC A;  2Y4Q A;  2ZFD A;  1KWO C;  1H8B A;  1CDP A;  3DZT A;  2L4H A;  4JKT A;  3TZ1 A;  1Z2C B;  1B47 A;  1Y6W A;  1C3Y A;  4N1G A;  1SY9 A;  5KTY A;  1KK8 B;  3KF9 A;  4YGE B;  5PAL A;  2OPO A;  1NCX A;  1W7J B;  5D7F A;  1FF1 A;  1DJZ A;  1YUS A;  2K7B A;  3BOW A;  2BCX A;  1BR4 B;  3CS1 A;  3LLE A;  3L4L A;  3TUY B;  1ZOT B;  1SCM B;  1ZMZ A;  3WXA A;  3HX4 A;  4CFR A;  2L4I A;  1EXR A;  1XK4 C;  1LKJ A;  2E30 A;  1C07 A;  1QX7 A;  3S0G A;  5D3O A;  3R72 A;  1V1G A;  1DJY A;  1Y1A A;  1YRT B;  1F71 A;  2K60 A;  3NSO A;  4I5J A;  3RM1 A;  2WC6 A;  3I5H B;  1JWD A;  2LE9 B;  3WHU B;  2JQ6 A;  1K2H A;  1SNL A;  4DRW A;  2I2R E;  1OOI X;  1SCV A;  3O6B A;  3CAB A;  3CDN A;  4MZK A;  1ODB A;  4GAO A;  2LMV A;  1XFZ O;  2KI6 D;  2CBL A;  2M0R A;  1CNP A;  3I5F B;  1MQ1 A;  2JUL A;  2HQ8 A;  2PSR A;  4OR9 B;  1J7Q A;  2NXQ A;  5FI2 A;  1Y1X A;  3R1P A;  4I5K A;  1Z4H A;  2L2E A;  1QV0 A;  2QEV A;  1WDC B;  4DS7 A;  1XYD A;  1C7V A;  2JZI A;  2KLD A;  1DEL A;  1VRK A;  3ICB A;  4L9M A;  2JT8 A;  4USL A;  3CGA A;  1AJ5 A;  1BU3 A;  1YVH A;  3I5I C;  2F33 A;  2KFG A;  2PVB A;  3NHT A;  3R1O A;  4N5X A;  5HKW A;  1FI5 A;  1NUB A;  3F45 A;  4QJ5 B;  3JTD B;  2JTZ A;  1BOC A;  1XFV O;  2BL0 B;  1CFD A;  2JWW A;  3JVT C;  3L4A A;  2EC6 B;  4M2Q A;  1F55 A;  1NWD A;  1UHH A;  1LIN A;  1XA5 A;  2K7O A;  4GPL B;  1NX1 A;  5EL2 A;  1KSM A;  1UHJ A;  1N65 A;  1BR1 B;  1RTP 1;  2L5Y A;  2ISD A;  4F7F A;  3AKA A;  4M2O A;  2BBM A;  2L98 A;  1IGV A;  1WLM A;  1MR8 A;  3IF7 A;  1A29 A;  3B87 A;  1PUL A;  1TNW A;  3OB2 B;  1A03 A;  1BMO A;  1J7R A;  1FBV A;  1KFU S;  5FYX A;  2RGI A;  1KCY A;  4CFQ A;  1S1E A;  1YVL A;  2CXJ A;  2K0J A;  1UWO A;  2FOT A;  2LNK A;  3Q8I A;  2F2O A;  2FCD A;  1DT7 B;  2Y5I A;  3SIA A;  3A8R A;  3D77 A;  3SIB A;  1C3Z A;  1PAL A;  2WCE A;  1CLB A;  1UUR A;  2CT9 A;  2KFF A;  3E3R A;  4GUK A;  4CPV A;  1SW8 A;  1QLK A;  1TUJ A;  3S0D A;  1CM1 A;  2P6B B;  3IQO A;  3VB1 A;  1WRL A;  5HLV A;  4GGF A;  3SG3 A;  1B1G A;  4OVN F;  1J7O A;  1MXE A;  3EVR A;  1QAS A;  1TWO A;  4GBA A;  1NYA A;  2KYC A;  2P70 A;  4YGA A;  2BKH B;  1C7W A;  1IG5 A;  2KBI A;  2I7A A;  4YRU A;  3K21 A;  1IRJ A;  1K9U A;  1CFF A;  2R2I A;  1NX2 A;  1G4Y R;  4GNK B;  4MEW A;  1UHK A;  2KFH A;  2LLS A;  2DOQ A;  1EG3 A;  2KBM A;  4YGC B;  4PCW A;  3C1V A;  4PHK A;  2LUC A;  3DF0 B;  4I5L B;  2NCO A;  1QS7 A;  4MRY A;  1KWO B;  1DGV A;  3SG4 A;  1S6C A;  1UHI A;  2TN4 A;  1PSR A;  2KSP A;  5AAN A;  2JOJ A;  3FS7 A;  3PAT A;  1IIO A;  5TNC A;  2Y1M A;  1V1F A;  1XVJ A;  2BNX A;  4OV2 A;  3SG2 A;  3GK2 A;  1K9K A;  2WCB A;  4AOM A;  4WRI A;  1JF0 A;  4A4B A;  1KQV A;  2GGZ A;  2VRG A;  4ORC B;  1ALW A;  3VRP A;  1B7T Z;  2NZ0 A;  4A4C A;  1GM0 A;  3N7H A;  4OCI A;  1DF0 A;  1M63 B;  1OMV A;  2B1U A;  3CR5 X;  3LCP C;  4C0L A;  1EH2 A;  2QEH A;  5AEQ A;  1M39 A;  4DUQ A;  2JC2 A;  2V53 A;  4CLN A;  2MHH A;  1YX7 A;  1RJV A;  2IS9 A;  1L7Z A;  1YX8 A;  3PN7 C;  4YI8 A;  1TNX A;  2LMU A;  1U5I A;  1IWQ A;  1LA0 A;  2JXL A;  1TOP A;  5CSI A;  1QJT A;  2M1K B;  1MF8 B;  3SS4 A;  4JWQ A;  3NHI A;  5FI6 A;  2KQY A;  1Q80 A;  4YI9 A;  2BBN A;  1WRZ A;  5F6T A;  3TS5 B;  2KLE A;  2FJU B;  2LVK A;  3BFH A;  4AQJ A;  2ZND A;  1QWV A;  2LLU A;  2EHB A;  1KQM B;  2LP2 A;  2ZKM X;  1Y1U A;  5DKN A;  3NXA A;  2K7C A;  3D0Y A;  2LVJ A;  3LK1 A;  3O78 A;  4FQT A;  3DXL A;  1SKT A;  1M45 A;  5BPJ A;  2LVI A;  1AUI B;  2LVV A;  3EG5 B;  2FCE A;  1OMR A;  3CTN A;  3M0W A;  1XFY O;  1LXF C;  2CCM A;  3D75 A;  4PE0 A;  1GGW A;  5AFP A;  1CLM A;  1N2D A;  2F3Z A;  3ZNI A;  1SL9 A;  4INX A; 
#chains in the Genus database with same CATH homology
 1GQM A;  1A75 A;  1B7T Y;  2OS8 C;  1SR6 C;  1BG1 A;  5ER4 X;  2WND A;  1JF2 A;  5D69 A;  1AK8 A;  1DVI A;  3H4S E;  4M2P A;  3WHT B;  4JQ0 D;  3BXK A;  1OE9 B;  1N0Y A;  2LV7 A;  1XFU O;  2KGR A;  2G9B A;  4GGN A;  2MJW B;  1GJY A;  2HF5 A;  1KSO A;  1XO5 A;  1NPQ A;  5GQQ C;  1FPW A;  3VRR A;  3LL8 B;  1MUX A;  4HSZ A;  2O60 A;  1PSB A;  2H61 A;  4PHM A;  2JPT A;  1REC A;  1K9P A;  1KK8 C;  1DMO A;  3EK8 A;  2H2K A;  2LLT A;  2PMY A;  4E68 A;  4ETO A;  1D1O A;  5I2L A;  2KHN A;  1BOD A;  2QAC A;  4FTG A;  3LK0 A;  1J55 A;  1BJF A;  1EJ3 A;  1SCM C;  3OHM B;  3KEV A;  1S5G Z;  2BE4 A;  1YUR A;  4NDD A;  5AER A;  2BKI B;  1RK9 A;  1WY9 A;  1S6I A;  3CLN A;  2JT3 A;  5CSF A;  1BLQ A;  3AKB A;  2LHI A;  1FI6 A;  1J1D A;  2D8N A;  3PAL A;  1OMD A;  3I5H C;  4C0K A;  3PSR A;  4GGF C;  3BUX B;  1QAT A;  1RFJ A;  3BUW B;  1TN4 A;  4CID A;  1H4B A;  2M8U A;  2F2P A;  2KAY A;  4D1E A;  1DJX A;  2M97 A;  3DVE A;  1WDC C;  3PM8 A;  4MBE A;  1AVS A;  1OZS A;  1S36 A;  4OKH A;  1CMF A;  3CR4 X;  1B8L A;  2ZRS A;  1JFK A;  4P2Y B;  2PAL A;  2M7L A;  1IJ6 A;  2CTN A;  4I5N B;  3GK4 X;  3JTD C;  1TNP A;  2HPS A;  4XJK B;  1RRO A;  2M29 A;  1QX2 A;  3PN7 B;  1CTR A;  2ZN8 A;  2K61 A;  4JPZ B;  4MLW A;  3SG5 A;  3DVK A;  3TDZ A;  2E6W A;  5JJG A;  1E8A A;  1NP8 A;  2COL B;  1B8R A;  2WC8 A;  1YRU B;  1OQP A;  1YTZ C;  1QXP A;  5HKZ A;  1ZUZ A;  2L50 A;  2LUX A;  3AAK A;  4N1F A;  3EKJ A;  3PLF B;  1UP5 A;  1YR5 A;  1ZFS A;  1JFJ A;  1W7I B;  3BOW B;  1EL4 A;  2KAV A;  2JXC A;  2M9G A;  2PRU A;  3SG6 A;  4ICB A;  1SPY A;  3FWB A;  1SL8 A;  2JTT A;  4HRE E;  1UHN A;  1PRW A;  5HKY A;  1K94 A;  5K89 A;  5DKR A;  1CKK A;  2KQ6 A;  2BCB A;  1KK7 Z;  1B8C A;  3OX5 A;  5IBW A;  4MVF A;  5HYD A;  1WRK A;  2M3W A;  3NSL A;  2JRF A;  1TNQ A;  2M49 B;  2WCF A;  4PHN A;  1M31 A;  2F8P A;  1CMG A;  2MLF C;  1FW4 A;  2LP3 A;  1HQV A;  1NX3 A;  1KFX S;  1NCZ A;  1K93 D;  2PAS A;  1QIV A;  2BE6 A;  3DVM A;  4Q04 A;  2KAX A;  1DJI A;  4TNC A;  1CB1 A;  4MZL A;  2OTG C;  1K8U A;  1SR6 B;  5DKQ A;  5I8N A;  1QIW A;  2JNF A;  3OP0 A;  2HQW A;  2Q91 A;  1NX0 A;  4MZJ A;  3I5I B;  4NDC A;  1F4Q A;  1LA3 A;  2KI4 C;  1S3P A;  1L2O C;  4XJK A;  2I94 A;  4HRH A;  3RLZ A;  1J7P A;  2NLN A;  3JVT B;  1R6P A;  1GGZ A;  3DF0 A;  2LCP A;  1X02 A;  1A2X A;  1QVI Z;  2L51 A;  3O2P A;  4NDB A;  2LC5 A;  1SBJ A;  1OZO A;  2MRD A;  3EVV A;  2KOT A;  4GFT A;  1K90 D;  4U8D A;  3TDI A;  4QJ4 B;  1UUS A;  3QRX A;  2GGM A;  3BUN B;  1OOJ A;  5KSZ A;  1SK6 D;  4DCK A;  1B4C A;  5CPV A;  5KU1 A;  3EK7 A;  3I5G C;  2I18 A;  4WQ3 A;  3DVJ A;  3CWG A;  2WOS A;  1JBA A;  1QLS A;  3BUM B;  1F70 A;  5AXI A;  2LHL A;  2HET A;  4ZCV A;  1KK7 Y;  2WOR A;  2ZRT A;  1NCY A;  3AAJ A;  4XYN A;  4PHJ A;  1K96 A;  4FQO A;  1S6J A;  5I2O A;  1XK4 A;  1B9A A;  3FIA A;  2ZN9 A;  4P5O E;  3EVU A;  1KFX L;  2Q4U A;  2ZNE A;  2G2B A;  1G8I A;  4BY5 A;  2H61 C;  3NSK A;  1DGU A;  2K2A A;  1QTX A;  1CM4 A;  3O4Y A;  1IQ5 A;  3TS5 C;  1DJG A;  1YUT A;  3VRN A;  1ZAC A;  2F3Y A;  2AMI A;  4F0Z B;  2MBX A;  4UPG A;  5J3X A;  4WQ2 A;  3D10 A;  1CLL A;  1G33 A;  1KQM C;  1PK0 D;  2AAO A;  2SAS A;  1F8H A;  1IQ3 A;  3TUY C;  1J1E A;  2M7N A;  1S26 D;  1SYM A;  1IJ5 A;  2LAN A;  3BQ3 A;  5B8I B;  1OSA A;  1QVI Y;  3GOF A;  1ALV A;  1QV1 A;  3HCM A;  1TIZ A;  2K8M B;  1SL7 A;  5CSJ A;  1JC2 A;  1F54 A;  1R2U A;  2K7D A;  3KPX A;  5I2Q A;  4IL1 A;  2LAP A;  3SG7 A;  3MSE B;  3CZT X;  3TDU A;  4AQI A;  2GV5 A;  1MHO A;  3EK4 A;  3WNX B;  1F4O A;  3ZWH A;  1BF5 A;  1WLZ A;  5JOL A;  3I5F C;  2NCP A;  3EKH A;  4PDZ A;  1PVA A;  3OB1 B;  1DF0 B;  3FWC A;  2LM5 A;  1QX5 B;  1CDM A;  1EG4 A;  1AHR A;  1NIW A;  1XFW O;  4ORA B;  3VRO A;  1SMG A;  1IH0 A;  3KHE A;  2CNP A;  3NSI A;  4PE7 A;  4PAL A;  1JSA A;  1PVB A;  1AP4 A;  2BL0 C;  2L0P A;  2O5G A;  5HLO A;  1U5I B;  3A4U B;  2EC6 C;  4YBH B;  2M1U A;  3PFV A;  2KDH A;  1RWY A;  2KI6 C;  1CFC A;  1NSH A;  1CDL A;  1MXL C;  2L5X B;  4MSP A;  1DJW A;  2OTG B;  4YGB B;  1CDN A;  1TCO B;  3IQQ A;  2MAZ A;  3BUO B;  2MLE C;  1S5G Y;  1MWN A;  3KO0 A;  3VGO A;  1Y0V H;  2KYF A;  1CFP A;  5CSN A;  3D0Y B;  2KI4 B;  1L2O B;  1IKU A;  1TRF A;  2BCA A;  5G08 A;  2JNX A;  2MA2 A;  4ZCU A;  1AJ4 A;  4BY4 A;  1DTL A;  2JT0 A;  4YGD B;  1JUO A;  4DIR A;  3SJS A;  5ER5 A;  1KFU L;  1TCF A;  2EGD A;  4HRG A;  3CR2 A;  3OX6 A;  3VRQ A;  4NQG A;  2KGB C;  3I5G B;  3BYA A;  1A75 B;  1K95 A;  3GK1 A;  4R1E A;  4ORB B;  3DD4 A;  4MN0 A;  1DJH A;  2JU0 A;  2SCP A;  2OS8 B;  1M46 A;  1YUU A;  2KNE A;  4MRX A;  1SRA A;  1TTX A;  2LMT A;  2K2F A;  1A4P A;  2Y1N A;  4C0J A;  1HT9 A;  4PE1 A;  1LVC D;  4QJ3 B;  2QPT A;  4PE4 A;  2BEC A;  1XFX O;  1BT6 A;  2A4J A;  2AUC A;  2Y4Q A;  2ZFD A;  1KWO C;  1H8B A;  1CDP A;  2L4H A;  3TZ1 A;  1B47 A;  1Y6W A;  4N1G A;  1SY9 A;  5KTY A;  1KK8 B;  3KF9 A;  4YGE B;  5PAL A;  2OPO A;  1NCX A;  1W7J B;  5D7F A;  1FF1 A;  1DJZ A;  1YUS A;  2K7B A;  3BOW A;  2BCX A;  1BR4 B;  3CS1 A;  3LLE A;  3TUY B;  1ZOT B;  1SCM B;  1ZMZ A;  3WXA A;  3HX4 A;  4CFR A;  2L4I A;  1EXR A;  1XK4 C;  1LKJ A;  2E30 A;  1C07 A;  1QX7 A;  1V1G A;  1DJY A;  1Y1A A;  1YRT B;  1F71 A;  3RM1 A;  3NSO A;  4I5J A;  1JWD A;  3I5H B;  2LE9 B;  3WHU B;  2JQ6 A;  1K2H A;  1SNL A;  4DRW A;  2I2R E;  1SCV A;  3O6B A;  4MZK A;  1ODB A;  4GAO A;  2LMV A;  1XFZ O;  2KI6 D;  2CBL A;  2M0R A;  1CNP A;  3I5F B;  1MQ1 A;  2JUL A;  2HQ8 A;  2PSR A;  4OR9 B;  1J7Q A;  2NXQ A;  1Y1X A;  4I5K A;  2L2E A;  1QV0 A;  1WDC B;  4DS7 A;  1XYD A;  1C7V A;  2JZI A;  3ICB A;  1VRK A;  4L9M A;  2JT8 A;  4USL A;  3CGA A;  1AJ5 A;  1BU3 A;  1YVH A;  3I5I C;  2F33 A;  2KFG A;  2PVB A;  5HKW A;  4N5X A;  1FI5 A;  1NUB A;  3F45 A;  4QJ5 B;  3JTD B;  2JTZ A;  1BOC A;  1XFV O;  2BL0 B;  1CFD A;  2JWW A;  3JVT C;  2EC6 B;  4M2Q A;  1F55 A;  1NWD A;  1UHH A;  1LIN A;  1XA5 A;  2K7O A;  4GPL B;  1NX1 A;  1KSM A;  1UHJ A;  1N65 A;  1BR1 B;  1RTP 1;  2ISD A;  3AKA A;  4M2O A;  2BBM A;  2L98 A;  1IGV A;  1WLM A;  1MR8 A;  3IF7 A;  1A29 A;  1PUL A;  1TNW A;  3OB2 B;  1A03 A;  1BMO A;  1J7R A;  1FBV A;  1KFU S;  5FYX A;  2RGI A;  1KCY A;  4CFQ A;  1S1E A;  1YVL A;  2CXJ A;  2K0J A;  1UWO A;  2FOT A;  2LNK A;  2F2O A;  2FCD A;  1DT7 B;  2Y5I A;  3SIA A;  3A8R A;  3SIB A;  1PAL A;  1CLB A;  2WCE A;  1UUR A;  2CT9 A;  2KFF A;  3E3R A;  4GUK A;  4CPV A;  1SW8 A;  1QLK A;  1CM1 A;  2P6B B;  3IQO A;  1WRL A;  5HLV A;  4GGF A;  3SG3 A;  1B1G A;  4OVN F;  1J7O A;  1MXE A;  3EVR A;  1QAS A;  4GBA A;  1NYA A;  2KYC A;  4YGA A;  2BKH B;  1C7W A;  1IG5 A;  2KBI A;  2I7A A;  4YRU A;  3K21 A;  1IRJ A;  1K9U A;  1CFF A;  2R2I A;  1NX2 A;  1G4Y R;  4GNK B;  4MEW A;  1UHK A;  2KFH A;  2LLS A;  2DOQ A;  1EG3 A;  2KBM A;  4YGC B;  4PCW A;  3C1V A;  4PHK A;  2LUC A;  3DF0 B;  4I5L B;  2NCO A;  1QS7 A;  4MRY A;  1KWO B;  1DGV A;  3SG4 A;  1S6C A;  1UHI A;  2TN4 A;  1PSR A;  2KSP A;  5AAN A;  2JOJ A;  3FS7 A;  3PAT A;  5TNC A;  2Y1M A;  1V1F A;  1XVJ A;  4OV2 A;  3SG2 A;  3GK2 A;  1K9K A;  2WCB A;  4AOM A;  4WRI A;  1JF0 A;  4A4B A;  1KQV A;  2GGZ A;  2VRG A;  4ORC B;  1ALW A;  3VRP A;  1B7T Z;  2NZ0 A;  4A4C A;  4OCI A;  1DF0 A;  1M63 B;  1OMV A;  2B1U A;  3CR5 X;  3LCP C;  4C0L A;  1EH2 A;  5AEQ A;  1M39 A;  4DUQ A;  2JC2 A;  2V53 A;  4CLN A;  2MHH A;  1YX7 A;  1RJV A;  2IS9 A;  1L7Z A;  1YX8 A;  3PN7 C;  4YI8 A;  1TNX A;  2LMU A;  1U5I A;  1IWQ A;  1LA0 A;  2JXL A;  1TOP A;  5CSI A;  1QJT A;  2M1K B;  1MF8 B;  4JWQ A;  2KQY A;  1Q80 A;  4YI9 A;  2BBN A;  1WRZ A;  5F6T A;  3TS5 B;  2FJU B;  2LVK A;  4AQJ A;  2ZND A;  2LLU A;  2EHB A;  1KQM B;  2LP2 A;  2ZKM X;  1Y1U A;  5DKN A;  3NXA A;  2K7C A;  3D0Y A;  2LVJ A;  3LK1 A;  3O78 A;  1SKT A;  1M45 A;  5BPJ A;  2LVI A;  1AUI B;  2LVV A;  2FCE A;  1OMR A;  3CTN A;  3M0W A;  1XFY O;  1LXF C;  2CCM A;  4PE0 A;  1GGW A;  5AFP A;  1CLM A;  1N2D A;  2F3Z A;  3ZNI A;  1SL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...