1RTP1

Refined x-ray structure of rat parvalbumin, a mammalian alpha-lineage parvalbumin, at 2.0 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords ALPHA-PARVALBUMIN
publication title Refined crystal structure of rat parvalbumin, a mammalian alpha-lineage parvalbumin, at 2.0 A resolution.
pubmed doi rcsb
source organism Rattus rattus
total genus 42
structure length 109
sequence length 109
chains with identical sequence 2, 3
ec nomenclature
pdb deposition date 1993-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rtp100
1DGVA 2HETA 2O5GA 2LMUA 2GGMA 2ZKMX 1A03A 2WCBA 4N1FA 1CDLA 2LVVA 1IGVA 4OR9B 2M8UA 5ER4X 1IWQA 1YURA 1QVIY 1SBJA 1QV0A 2LV7A 3LCPC 4GNKB 5DKNA 1JFJA 1U5IA 3SJSA 2VRGA 3HX4A 3QRXA 2JWWA 1CB1A 3EKJA 2LNKA 4NQGA 1AP4A 3IQQA 1J7OA 1NP8A 3I5HB 2E30A 4F0ZB 4HRHA 1BT6A 2BECA 4A4CA 4HRGA 3PN7C 3EVVA 1DJIA 4DCKA 1N0YA 2MHHA 3I5FC 5FYXA 1F55A 2JT3A 1YR5A 2CCMA 1NPQA 1V1GA 4C0LA 3VGOA 4C0KA 4GBAA 2OPOA 1CFDA 2K61A 1TNPA 1S6CA 1HQVA 3KHEA 5HLOA 2FCEA 1DJHA 1U5IB 2K7DA 2QACA 1YTZC 1XO5A 2F3ZA 3CTNA 3EVRA 1F4QA 5CSJA 2K7BA 1Y1AA 1QLKA 2KGRA 2MLFC 3CGAA 4MSPA 3WNXB 2KSPA 1KFXS 1RECA 4M2OA 1GGZA 1XFVO 3SG5A 1XK4C 3FWCA 4I5KA 2LM5A 1W7IB 4MEWA 1MWNA 2KFFA 4YGCB 1NSHA 3TS5C 1C07A 1SCMC 5PALA 3LL8B 1QX5B 3JVTC 1CKKA 1CFCA 2HF5A 3I5FB 3SG3A 1XK4A 5GQQC 1F54A 2L98A 4L9MA 1S3PA 1IQ3A 1QXPA 1K9KA 1LA3A 1QIVA 1WRKA 2LLTA 4P5OE 4IL1A 4XJKA 2LANA 1CNPA 2LHIA 1IH0A 2BCAA 1SR6C 4DS7A 5F6TA 4YGAA 4PHJA 1K94A 4A4BA 2E6WA 2O60A 1A2XA 1ODBA 2M1UA 4JQ0D 4DUQA 1CMFA 3DVEA 2CNPA 1NIWA 2ZN8A 1FF1A 1N65A 2H2KA 1QX7A 3CS1A 1AHRA 4GAOA 1WDCC 4M2PA 2F3YA 4D1EA 1KK8B 3BOWA 2LVKA 2L0PA 4MZJA 2FOTA 3VRQA 5BPJA 3TUYC 2JOJA 1AJ4A 2KYCA 2JC2A 2M7LA 1JSAA 4XJKB 1DMOA 1Q80A 1WLZA 3I5IB 1JF0A 5HLVA 1CDNA 1QJTA 1J55A 3O4YA 1TNQA 4PE7A 4AOMA 3OX6A 2K2AA 1QS7A 2KHNA 1BG1A 1EJ3A 2F8PA 1JBAA 1S26D 1F70A 4NDDA 3BOWB 2LUCA 1H4BA 2KQ6A 2PRUA 1UURA 1OQPA 1S1EA 1Y6WA 2IS9A 3FWBA 1BODA 2JTZA 1F8HA 1K8UA 3BYAA 1Y1UA 3O2PA 2G9BA 4C0JA 1IKUA 2WOSA 1PRWA 2I7AA 5I8NA 2CT9A 2ZNEA 4ICBA 4DRWA 4PALA 2JULA 1SMGA 3DVJA 4M2QA 3SG2A 3C1VA 1AK8A 1XFUO 2M7NA 3EKHA 3TUYB 1B8CA 1MF8B 2HQ8A 1YX7A 2K0JA 4XYNA 1V1FA 5IBWA 2KDHA 1R2UA 1XA5A 3RLZA 3AKBA 5AEQA 3VRPA 2OTGC 2M9GA 1M45A 5J3XA 1AUIB 2Q91A 2CXJA 1L7ZA 4ETOA 3DF0B 2JRFA 1L2OC 4PE1A 1DJWA 3MSEB 2MAZA 4GGFC 2BE4A 3PLFB 1QIWA 4MN0A 1PULA 1DGUA 1OOJA 1B47A 1NX0A 4WQ2A 2I2RE 1F4OA 2QPTA 4UPGA 4FTGA 2MA2A 3DVMA 1SKTA 3IQOA 1CLBA 1JUOA 2BBNA 1BR4B 1TNWA 3EK8A 4YI9A 2P6BB 1RROA 4Q04A 2WCEA 4GGFA 1J7RA 2CBLA 3CZTX 4BY4A 1G8IA 3GK4X 3SG4A 1DT7B 3A8RA 2LE9B 1PK0D 4GUKA 1B1GA 1B4CA 1PALA 2BE6A 5DKRA 2L50A 4AQIA 5AFPA 5B8IB 1MR8A 3CR4X 1CFFA 1DTLA 1C7VA 3OHMB 1WLMA 1M39A 1IRJA 3SIBA 1GJYA 3KO0A 3VROA 1MUXA 1TTXA 2KGBC 2OTGB 1KQVA 1E8AA 3A4UB 1XFZO 5KSZA 1J7PA 2ZFDA 3BXKA 2BL0C 2WCFA 1DF0B 3CR2A 2EGDA 4PDZA 1F71A 1L2OB 1CFPA 1KK8C 1YUUA 1NWDA 2EC6B 2F2PA 2K7CA 1UHJA 5KTYA 1OMVA 2RGIA 1C7WA 4HREE 5CSIA 4HSZA 1R6PA 1NUBA 1QLSA 4CFRA 3ZNIA 1WRZA 4OVNF 3I5IC 3KPXA 2JNFA 1LKJA 5I2QA 1QX2A 3D10A 1DJXA 2CTNA 3AKAA 2AAOA 1H8BA 3BUOB 2B1UA 1PVBA 2D8NA 2LVJA 4YI8A 2LAPA 2MJWB 5I2OA 4BY5A 3HCMA 4CIDA 1OMRA 1OZSA 1K9UA 1XYDA 1IJ5A 4I5JA 1KQMB 3OP0A 1OE9B 1CM1A 1VRKA 3O78A 1KWOC 2Q4UA 1TCOB 2M97A 4CPVA 2Y1NA 2KFHA 4OKHA 2LP2A 4WQ3A 2M29A 4PE0A 4YGBB 3BUNB 1B9AA 4ORAB 5DKQA 1BJFA 3O6BA 2AMIA 2BL0B 2PVBA 4ORBB 1ZMZA 4N5XA 1IQ5A 2AUCA 2JXCA 4OCIA 2JU0A 1UUSA 4NDBA 3KEVA 2LMTA 2LCPA 4MZKA 3WHTB 1LVCD 3AAJA 3F45A 1BU3A 1ALWA 1WY9A 3GOFA 1A4PA 2JT8A 1KCYA 5TNCA 2BCBA 1KFUL 3D0YA 3BUWB 1TRFA 4FQOA 3CR5X 3CWGA 4USLA 2KQYA 5CSNA 3BUMB 1S6IA 3PATA 1D1OA 2I94A 3M0WA 1B8RA 2KAVA 3SG7A 4ZCUA 3SIAA 2SCPA 5CSFA 1WRLA 1AVSA 1KWOB 1LINA 3DF0A 1TNXA 4MRYA 1TN4A 5I2LA 1SL9A 5AXIA 1YUSA 1LXFC 5K89A 2KNEA 1DJZA 2MLEC 4GFTA 2NCOA 5AANA 3TDZA 2PMYA 3D0YB 1ALVA 2WORA 3WHUB 1S5GZ 2LMVA 2EHBA 1CM4A 3I5GC 1BF5A 1TOPA 1B7TZ 3NSIA 2JNXA 3K21A 1JC2A 1NX3A 3PM8A 1EG4A 2ZNDA 3OB2B 3OX5A 2KAXA 4I5LB 1BR1B 1NYAA 1A75A 2NXQA 2HPSA 1RTP1 4R1EA 1YRTB 1N2DA 1UP5A 1K9PA 3PALA 2I18A 1AJ5A 1XFXO 2EC6C 2LHLA 1KSMA 4YBHB 2JT0A 1NX2A 1J7QA 2Y5IA 2WC8A 4U8DA 2KBIA 1NCZA 1PSBA 4P2YB 2F33A 2OS8C 2KBMA 1DJYA 4OV2A 1W7JB 4PHKA 4ZCVA 2PASA 2BKHB 5HKYA 1K2HA 1EXRA 1ZFSA 1DF0A 1QV1A 1SCVA 1A29A 4PHMA 4CFQA 2FCDA 1IJ6A 1A75B 1EG3A 1QATA 1PVAA 3NSLA 4I5NB 2ZN9A 3FIAA 4GPLB 4DIRA 2HQWA 1NX1A 1KQMC 4JWQA 1SW8A 2L5XB 3H4SE 3DD4A 3I5GB 4QJ4B 2KFGA 1KFXL 1Y0VH 1QTXA 1S5GY 3KF9A 1RJVA 1K96A 1B7TY 1FW4A 1FI5A 3TZ1A 3JTDC 1S6JA 2LLUA 2LP3A 1G4YR 3DVKA 5JOLA 1YRUB 3VRNA 1XFYO 1LA0A 1JWDA 1SL7A 5G08A 1K90D 2JZIA 2L51A 1OZOA 1TCFA 1GGWA 2M1KB 2OS8B 3TDIA 2G2BA 2LLSA 1YVLA 3ICBA 2PALA 3TDUA 1TIZA 2FJUB 1DVIA 3PFVA 2BBMA 2M3WA 2ZRSA 1YX8A 4MLWA 1RK9A 2KYFA 1M31A 1RFJA 2SASA 5HYDA 1X02A 2KOTA 1ZUZA 4NDCA 1B8LA 1MQ1A 1NCXA 4ORCB 4PCWA 1DJGA 3LK0A 1SPYA 2MBXA 2L4IA 4MBEA 5KU1A 3AAKA 1SRAA 3LLEA 1CTRA 3EVUA 1BLQA 1J1EA 3BQ3A 1YUTA 3EK7A 3PN7B 3FS7A 5D7FA 3VRRA 3JTDB 5ER5A 1PSRA 4PHNA 5D69A 3NXAA 4N1GA 1K95A 1M63B 1FI6A 1YVHA 4JPZB 1UWOA 3SG6A 1CDMA 1UHNA 1CLLA 1MXLC 1JF2A 1UHKA 2JTTA 2ZRTA 1KK7Z 3WXAA 1SNLA 1SK6D 2KI6C 1ZACA 3BUXB 1UHIA 1ZOTB 2MRDA 2V53A 2GGZA 2K8MB 2K7OA 4MZLA 1BMOA 4QJ5B 2KI6D 2M0RA 1CLMA 1J1DA 5CPVA 2F2OA 1QASA 2K2FA 3E3RA 2NLNA 1SL8A 1EL4A 1JFKA 1IG5A 2BCXA 4YGDB 3GK1A 4PE4A 3IF7A 4CLNA 1CDPA 3NSKA 2GV5A 1G33A 2KI4C 2Y4QA 3LK1A 1K93D 3TS5B 5HKZA 2H61C 1SCMB 3GK2A 2A4JA 3JVTB 1Y1XA 1OSAA 1QVIZ 1GQMA 1BOCA 4WRIA 2JXLA 1KSOA 1XFWO 5AERA 1MXEA 2L4HA 3EK4A 2LUXA 5JJGA 3NSOA 2PSRA 3PSRA 4QJ3B 1KFUS 2H61A 2COLB 3I5HC 1KK7Y 1SR6B 2L2EA 2JQ6A 4E68A 2LVIA 2WNDA 4TNCA 2R2IA 2Y1MA 1EH2A 3RM1A 2LC5A 1SYMA 3OB1B 1UHHA 1FPWA 4MRXA 2NZ0A 1NCYA 1OMDA 1RWYA 2KAYA 3ZWHA 1M46A 1CMGA 1SY9A 1WDCB 2BKIB 2DOQA 4AQJA 4MVFA 2NCPA 4YGEB 2ISDA 4YRUA 2JPTA 2M49B 1S36A 2TN4A 3CLNA 1FBVA 1HT9A 2KI4B 1MHOA 4GGNA 5HKWA 1XVJA
chains in the Genus database with same CATH superfamily
1OOHA 1DGVA 2WC5A 2HETA 2O5GA 2LMUA 2GGMA 2ZKMX 1DEKA 1A03A 2WCBA 4N1FA 1CDLA 2LVVA 1IGVA 4OR9B 2M8UA 5ER4X 1IWQA 1YURA 1QVIY 1SBJA 1QV0A 2LV7A 2QEBA 2QEOA 3FE6A 3LCPC 1U5IA 4GNKB 2VRGA 3HX4A 3QRXA 2JWWA 3SJSA 3EKJA 5DKNA 2LNKA 4NQGA 1AP4A 3IQQA 1J7OA 1NP8A 3I5HB 2E30A 4F0ZB 4HRHA 1BT6A 2BECA 4A4CA 4HRGA 3PN7C 3EVVA 1DJIA 4DCKA 1N0YA 2MHHA 3I5FC 5FYXA 1F55A 2JT3A 3S0GA 1YR5A 2JPOA 2CCMA 1NPQA 1C3YA 1V1GA 1TWOA 4C0LA 2WCHA 3VGOA 4C0KA 4GBAA 2OPOA 1CFDA 2K61A 1TNPA 1S6CA 1HQVA 3KHEA 3L4LA 5HLOA 2FCEA 1DJHA 1TUJA 1U5IB 2K7DA 1YTZC 2QACA 1XO5A 2F3ZA 3CTNA 3EVRA 3SS3A 1F4QA 5CSJA 2K7BA 1Y1AA 1QLKA 2KGRA 2MLFC 1Z4HA 3CGAA 4MSPA 2KSPA 3WNXB 1KFXS 1RECA 4M2OA 2PYQA 4PT1A 1GGZA 1XFVO 3SG5A 1XK4C 3FWCA 4I5KA 2LM5A 1SSEB 1W7IB 4MEWA 1MWNA 3VB1A 2KFFA 4YGCB 1NSHA 3TS5C 1GM0A 1C07A 1SCMC 5PALA 3LL8B 1QX5B 3JVTC 1CKKA 1CFCA 2HF5A 3UNWA 2WCLA 3I5FB 1DC1A 3SG3A 1XK4A 5GQQC 1F54A 2L98A 4L9MA 1S3PA 2GTEA 1OOFA 1IQ3A 1QXPA 4FQTA 1K9KA 1LA3A 3S0DA 1QIVA 1WRKA 2LLTA 3CZ2A 4P5OE 4IL1A 4XJKA 2LANA 1CNPA 2LHIA 1IH0A 2BCAA 1SR6C 4DS7A 5F6TA 4YGAA 4PHJA 1K94A 4A4BA 2E6WA 2O60A 1A2XA 1ODBA 2M1UA 4JQ0D 4DUQA 1CMFA 3DVEA 2CNPA 1NIWA 2ZN8A 5D3OA 3S0EA 1FF1A 1N65A 2H2KA 1QX7A 3CS1A 1AHRA 4GAOA 1WDCC 4M2PA 2F3YA 4D1EA 1QWVA 1KK8B 3BOWA 2LVKA 2L0PA 4MZJA 2FOTA 3VRQA 5BPJA 3TUYC 2JOJA 1AJ4A 2KYCA 2JC2A 2M7LA 1JSAA 3CABA 4XJKB 1DMOA 1Q80A 1WLZA 3I5IB 1JF0A 5HLVA 3B7AA 1CDNA 1QJTA 1J55A 2KPHA 1TNQA 3O4YA 3OBVA 4PE7A 4AOMA 3OX6A 2K2AA 1QS7A 2KHNA 1BG1A 1EJ3A 2F8PA 3B6XA 3R1VA 1OOGA 1S26D 1JBAA 1F70A 4NDDA 2BNXA 3BOWB 2LUCA 1H4BA 2KQ6A 2PRUA 1UURA 1OQPA 1S1EA 1Y6WA 2IS9A 3D74A 3FWBA 2JTZA 1BODA 1F8HA 1K8UA 3BYAA 1CB1A 1Y1UA 3O2PA 2G9BA 4C0JA 1IKUA 2WOSA 1PRWA 2I7AA 5I8NA 2CT9A 2ZNEA 4ICBA 4DRWA 4PALA 2JULA 1SMGA 3DVJA 4M2QA 3SG2A 3C1VA 1AK8A 1DELA 1XFUO 2M7NA 4INWA 3EKHA 3TUYB 1B8CA 1MF8B 2HQ8A 1YX7A 2K0JA 3PM2A 4OZDA 1V1FA 4XYNA 5IBWA 1F71A 2KDHA 1R2UA 1XA5A 3K1EA 3RLZA 3AKBA 5AEQA 3VRPA 2OTGC 3R72A 2M9GA 1M45A 2QDIA 1AUIB 5J3XA 2Q91A 2CXJA 1L7ZA 4ETOA 3DF0B 2JRFA 1L2OC 3NGVA 4PE1A 1DJWA 2KLDA 2MAZA 3MSEB 2BE4A 4GGFC 3PLFB 3ZWHA 3SS5A 3L4AA 1QIWA 4MN0A 1PULA 1DGUA 1OOJA 1B47A 1NX0A 4WQ2A 2I2RE 1F4OA 2QPTA 4UPGA 4FTGA 2MA2A 3NHTA 3DVMA 1SKTA 3DXLA 3IQOA 1CLBA 1JUOA 2BBNA 1BR4B 1TNWA 3EK8A 4YI9A 2P6BB 1RROA 4Q04A 2WCEA 4GGFA 1J7RA 2CBLA 3CDNA 3CZTX 4BY4A 1G8IA 3GK4X 3SG4A 1DT7B 3A8RA 2LE9B 1PK0D 3CZ0A 4GUKA 1B1GA 1B4CA 1PALA 2BE6A 5DKRA 2L50A 4AQIA 5AFPA 5B8IB 1MR8A 3CR4X 1CFFA 1DTLA 3O4XA 1C7VA 3OHMB 1WLMA 1M39A 1IRJA 3SIBA 1GJYA 2QEHA 2WCKA 3KO0A 3VROA 1MUXA 1TTXA 2KGBC 2OTGB 1KQVA 1E8AA 3A4UB 1XFZO 2L5YA 5KSZA 1J7PA 2ZFDA 3BXKA 2BL0C 2WCFA 1DF0B 3CR2A 2EGDA 4IJ7A 4PDZA 1L2OB 1CFPA 1KK8C 1YUUA 1NWDA 2EC6B 2F2PA 2K7CA 1OOIX 1UHJA 5KTYA 1OMVA 2RGIA 1C7WA 4HREE 5CSIA 4HSZA 1R6PA 1NUBA 1QLSA 4CFRA 3ZNIA 1WRZA 4OVNF 1T14A 3I5IC 1TUZA 3KPXA 2FJYA 2JNFA 1LKJA 3BFHA 5I2QA 1QX2A 3D10A 1DJXA 2CTNA 3AKAA 4JKTA 2AAOA 1H8BA 3BUOB 3RZSA 2B1UA 1PVBA 2K60A 2D8NA 2LVJA 4YI8A 2LAPA 2MJWB 5I2OA 4BY5A 3HCMA 4CIDA 1OMRA 1OZSA 1K9UA 1XYDA 1IJ5A 4I5JA 1KQMB 3OP0A 1OE9B 1CM1A 1P28A 1VRKA 3O78A 3S0AA 1KWOC 2Q4UA 1TCOB 2M97A 4CPVA 2Y1NA 2KFHA 3R1OA 2LP2A 4OKHA 4WQ3A 2M29A 3PJIA 4PE0A 4YGBB 3BUNB 1B9AA 4ORAB 5DKQA 1BJFA 3O6BA 2AMIA 2BL0B 2PVBA 3EG5B 4ORBB 3V2LA 5DICA 1ZMZA 1DQEA 1IQ5A 2AUCA 2JXCA 4N5XA 4OCIA 1JFJA 2JU0A 1UUSA 4NDBA 3KEVA 2LMTA 4INXA 2LCPA 4MZKA 3WHTB 1LVCD 3AAJA 3F45A 5I94A 3B86A 1BU3A 1ALWA 1WY9A 3GOFA 1A4PA 2JT8A 1Z2CB 1KCYA 5TNCA 2BCBA 1KFUL 3D0YA 3BUWB 1TRFA 4FQOA 3CR5X 3CWGA 4USLA 2KQYA 5CSNA 3BUMB 3Q8IA 1S6IA 3PATA 1D1OA 2I94A 3M0WA 1B8RA 2KAVA 3SG7A 4ZCUA 3SIAA 2SCPA 3SS4A 5CSFA 1WRLA 1AVSA 1KWOB 1LINA 3DF0A 1TNXA 4MRYA 2WCMA 1TN4A 3UO9A 5I2LA 1XFRA 1SL9A 5AXIA 1YUSA 3D73A 1LXFC 5K89A 1ORGA 2KNEA 1DJZA 3D77A 2MLEC 4GFTA 2NCOA 5AANA 3TDZA 3OGNA 2PMYA 3D0YB 1ALVA 2WORA 3WHUB 1S5GZ 2WCJA 2LMVA 2P71A 2EHBA 1CM4A 3I5GC 1BF5A 3DZTA 1TOPA 1B7TZ 3NSIA 2JNXA 3K21A 1JC2A 1NX3A 3PM8A 1EG4A 2ZNDA 3OB2B 3OX5A 2KAXA 4I5LB 1BR1B 1NYAA 1A75A 2NXQA 2HPSA 1RTP1 3R1PA 4R1EA 1YRTB 1N2DA 1UP5A 1K9PA 3PALA 2I18A 1AJ5A 3B88A 1XFXO 2EC6C 2LHLA 1KSMA 4YBHB 2JT0A 1NX2A 1J7QA 2Y5IA 2WC8A 4U8DA 2KBIA 1NCZA 3FE8A 1PSBA 4P2YB 2F33A 2OS8C 2KBMA 1DJYA 4OV2A 1W7JB 3D78A 4PHKA 4ZCVA 2PASA 2BKHB 5HKYA 1K2HA 1EXRA 1ZFSA 1DF0A 3IVTA 1QV1A 1SCVA 1A29A 4PHMA 4CFQA 2FCDA 1IJ6A 1A75B 1EG3A 2YGUA 1QATA 1PVAA 3NSLA 3FE9A 4I5NB 2ZN9A 3FIAA 4GPLB 4DIRA 2HQWA 1NX1A 1KQMC 4JWQA 1SW8A 3S0BA 2L5XB 3H4SE 3DD4A 3I5GB 4QJ4B 2KFGA 1KFXL 1Y0VH 1QTXA 1S5GY 3KF9A 1RJVA 1K96A 1B7TY 1FW4A 1FI5A 3N7HA 3TZ1A 3JTDC 1S6JA 2LLUA 2LP3A 3DYEA 1G4YR 3DVKA 5JOLA 1YRUB 3VRNA 1XFYO 1LA0A 1JWDA 1SL7A 5G08A 1K90D 2JZIA 5EL2A 2L51A 3B87A 1OZOA 1TCFA 1GGWA 2M1KB 1OW4A 2OS8B 3TDIA 4KYNA 2G2BA 2L2CA 1YVLA 2LLSA 3ICBA 2PALA 3TDUA 5FI7A 1TIZA 2FJUB 3BFBA 1DVIA 3PFVA 2BBMA 2M3WA 2ZRSA 2PQLA 1YX8A 4MLWA 5HL1A 1RK9A 1W9ZA 2KYFA 1M31A 1RFJA 3DY9A 2SASA 3CZ1A 5HYDA 1X02A 2KOTA 1ZUZA 4NDCA 1B8LA 1MQ1A 1NCXA 4ORCB 4PCWA 1DJGA 3LK0A 3NHIA 1SPYA 2MBXA 2L4IA 4MBEA 5KU1A 3AAKA 1SRAA 3LLEA 1CTRA 3EVUA 1BLQA 1J1EA 3BQ3A 1YUTA 3EK7A 3PN7B 3FS7A 5D7FA 3VRRA 3JTDB 5ER5A 1PSRA 4PHNA 5D69A 3NXAA 4N1GA 2ERBA 1K95A 1M63B 1FI6A 1YVHA 3L47A 4JPZB 1IIOA 1UWOA 3SG6A 3BFAA 1CDMA 1UHNA 1CLLA 1MXLC 1JF2A 1UHKA 2JTTA 2ZRTA 1KK7Z 3S0FA 3WXAA 1SNLA 1SK6D 2KI6C 2QEVA 1ZACA 3BUXB 3D76A 1UHIA 1ZOTB 2MRDA 2V53A 2GGZA 2K8MB 2BAPA 2K7OA 4MZLA 1BMOA 4QJ5B 2KI6D 2M0RA 1CLMA 1J1DA 5CPVA 2P70A 2F2OA 1QASA 2K2FA 3E3RA 2NLNA 1SL8A 1EL4A 1JFKA 1IG5A 2BCXA 3CYZA 4YGDB 3GK1A 4PE4A 3IF7A 4CLNA 1CDPA 3NSKA 2GV5A 1CMGA 1G33A 2KI4C 2Y4QA 3LK1A 1K93D 3TS5B 5HKZA 2WC6A 4F7FA 1C3ZA 2H61C 5FI2A 1SCMB 3GK2A 2A4JA 3JVTB 3QMEA 1Y1XA 1LS8A 1OSAA 1QVIZ 1GQMA 1BOCA 4WRIA 2JXLA 1KSOA 1XFWO 5AERA 1MXEA 2L4HA 3EK4A 2LUXA 5JJGA 3NSOA 2PSRA 3PSRA 4QJ3B 1KFUS 2H61A 2COLB 3I5HC 1KK7Y 1SR6B 2L2EA 2JQ6A 4E68A 2LVIA 2WNDA 4TNCA 2R2IA 2Y1MA 1EH2A 3RM1A 2LC5A 1SYMA 3OB1B 3D75A 4JD9A 1UHHA 1FPWA 2H8VA 2NZ0A 1NCYA 1OMDA 1RWYA 2KAYA 4MRXA 1M46A 5FI6A 1SY9A 1WDCB 2BKIB 2DOQA 4AQJA 4MVFA 2NCPA 4YGEB 2ISDA 4YRUA 2JPTA 2M49B 1S36A 2TN4A 3CLNA 1FBVA 1HT9A 2KI4B 1MHOA 4GGNA 5HKWA 2KLEA 3BJHA 1XVJA
chains in the Genus database with same CATH topology
1DGVA 2HETA 2O5GA 2LMUA 2GGMA 2ZKMX 1A03A 2WCBA 4N1FA 1CDLA 2LVVA 1IGVA 4OR9B 2M8UA 5ER4X 1IWQA 1YURA 1QVIY 1SBJA 1QV0A 2LV7A 3LCPC 4GNKB 5DKNA 1JFJA 1U5IA 3SJSA 2VRGA 3HX4A 3QRXA 2JWWA 1CB1A 3EKJA 2LNKA 4NQGA 1AP4A 3IQQA 1J7OA 1NP8A 3I5HB 2E30A 4F0ZB 4HRHA 1BT6A 2BECA 4A4CA 4HRGA 3PN7C 3EVVA 1DJIA 4DCKA 1N0YA 2MHHA 3I5FC 5FYXA 1F55A 2JT3A 1YR5A 2CCMA 1NPQA 1V1GA 4C0LA 3VGOA 4C0KA 4GBAA 2OPOA 1CFDA 2K61A 1TNPA 1S6CA 1HQVA 3KHEA 5HLOA 2FCEA 1DJHA 1U5IB 2K7DA 2QACA 1YTZC 1XO5A 2F3ZA 3CTNA 3EVRA 1F4QA 5CSJA 2K7BA 1Y1AA 1QLKA 2KGRA 2MLFC 3CGAA 4MSPA 3WNXB 2KSPA 1KFXS 1RECA 4M2OA 1GGZA 1XFVO 3SG5A 1XK4C 3FWCA 4I5KA 2LM5A 1W7IB 4MEWA 1MWNA 2KFFA 4YGCB 1NSHA 3TS5C 1C07A 1SCMC 5PALA 3LL8B 1QX5B 3JVTC 1CKKA 1CFCA 2HF5A 3I5FB 3SG3A 1XK4A 5GQQC 1F54A 2L98A 4L9MA 1S3PA 1IQ3A 1QXPA 1K9KA 1LA3A 1QIVA 1WRKA 2LLTA 4P5OE 4IL1A 4XJKA 2LANA 1CNPA 2LHIA 1IH0A 2BCAA 1SR6C 4DS7A 5F6TA 4YGAA 4PHJA 1K94A 4A4BA 2E6WA 2O60A 1A2XA 1ODBA 2M1UA 4JQ0D 4DUQA 1CMFA 3DVEA 2CNPA 1NIWA 2ZN8A 1FF1A 1N65A 2H2KA 1QX7A 3CS1A 1AHRA 4GAOA 1WDCC 4M2PA 2F3YA 4D1EA 1KK8B 3BOWA 2LVKA 2L0PA 4MZJA 2FOTA 3VRQA 5BPJA 3TUYC 2JOJA 1AJ4A 2KYCA 2JC2A 2M7LA 1JSAA 4XJKB 1DMOA 1Q80A 1WLZA 3I5IB 1JF0A 5HLVA 1CDNA 1QJTA 1J55A 3O4YA 1TNQA 4PE7A 4AOMA 3OX6A 2K2AA 1QS7A 2KHNA 1BG1A 1EJ3A 2F8PA 1JBAA 1S26D 1F70A 4NDDA 3BOWB 2LUCA 1H4BA 2KQ6A 2PRUA 1UURA 1OQPA 1S1EA 1Y6WA 2IS9A 3FWBA 1BODA 2JTZA 1F8HA 1K8UA 3BYAA 1Y1UA 3O2PA 2G9BA 4C0JA 1IKUA 2WOSA 1PRWA 2I7AA 5I8NA 2CT9A 2ZNEA 4ICBA 4DRWA 4PALA 2JULA 1SMGA 3DVJA 4M2QA 3SG2A 3C1VA 1AK8A 1XFUO 2M7NA 3EKHA 3TUYB 1B8CA 1MF8B 2HQ8A 1YX7A 2K0JA 4XYNA 1V1FA 5IBWA 2KDHA 1R2UA 1XA5A 3RLZA 3AKBA 5AEQA 3VRPA 2OTGC 2M9GA 1M45A 5J3XA 1AUIB 2Q91A 2CXJA 1L7ZA 4ETOA 3DF0B 2JRFA 1L2OC 4PE1A 1DJWA 3MSEB 2MAZA 4GGFC 2BE4A 3PLFB 1QIWA 4MN0A 1PULA 1DGUA 1OOJA 1B47A 1NX0A 4WQ2A 2I2RE 1F4OA 2QPTA 4UPGA 4FTGA 2MA2A 3DVMA 1SKTA 3IQOA 1CLBA 1JUOA 2BBNA 1BR4B 1TNWA 3EK8A 4YI9A 2P6BB 1RROA 4Q04A 2WCEA 4GGFA 1J7RA 2CBLA 3CZTX 4BY4A 1G8IA 3GK4X 3SG4A 1DT7B 3A8RA 2LE9B 1PK0D 4GUKA 1B1GA 1B4CA 1PALA 2BE6A 5DKRA 2L50A 4AQIA 5AFPA 5B8IB 1MR8A 3CR4X 1CFFA 1DTLA 1C7VA 3OHMB 1WLMA 1M39A 1IRJA 3SIBA 1GJYA 3KO0A 3VROA 1MUXA 1TTXA 2KGBC 2OTGB 1KQVA 1E8AA 3A4UB 1XFZO 5KSZA 1J7PA 2ZFDA 3BXKA 2BL0C 2WCFA 1DF0B 3CR2A 2EGDA 4PDZA 1F71A 1L2OB 1CFPA 1KK8C 1YUUA 1NWDA 2EC6B 2F2PA 2K7CA 1UHJA 5KTYA 1OMVA 2RGIA 1C7WA 4HREE 5CSIA 4HSZA 1R6PA 1NUBA 1QLSA 4CFRA 3ZNIA 1WRZA 4OVNF 3I5IC 3KPXA 2JNFA 1LKJA 5I2QA 1QX2A 3D10A 1DJXA 2CTNA 3AKAA 2AAOA 1H8BA 3BUOB 2B1UA 1PVBA 2D8NA 2LVJA 4YI8A 2LAPA 2MJWB 5I2OA 4BY5A 3HCMA 4CIDA 1OMRA 1OZSA 1K9UA 1XYDA 1IJ5A 4I5JA 1KQMB 3OP0A 1OE9B 1CM1A 1VRKA 3O78A 1KWOC 2Q4UA 1TCOB 2M97A 4CPVA 2Y1NA 2KFHA 4OKHA 2LP2A 4WQ3A 2M29A 4PE0A 4YGBB 3BUNB 1B9AA 4ORAB 5DKQA 1BJFA 3O6BA 2AMIA 2BL0B 2PVBA 4ORBB 1ZMZA 4N5XA 1IQ5A 2AUCA 2JXCA 4OCIA 2JU0A 1UUSA 4NDBA 3KEVA 2LMTA 2LCPA 4MZKA 3WHTB 1LVCD 3AAJA 3F45A 1BU3A 1ALWA 1WY9A 3GOFA 1A4PA 2JT8A 1KCYA 5TNCA 2BCBA 1KFUL 3D0YA 3BUWB 1TRFA 4FQOA 3CR5X 3CWGA 4USLA 2KQYA 5CSNA 3BUMB 1S6IA 3PATA 1D1OA 2I94A 3M0WA 1B8RA 2KAVA 3SG7A 4ZCUA 3SIAA 2SCPA 5CSFA 1WRLA 1AVSA 1KWOB 1LINA 3DF0A 1TNXA 4MRYA 1TN4A 5I2LA 1SL9A 5AXIA 1YUSA 1LXFC 5K89A 2KNEA 1DJZA 2MLEC 4GFTA 2NCOA 5AANA 3TDZA 2PMYA 3D0YB 1ALVA 2WORA 3WHUB 1S5GZ 2LMVA 2EHBA 1CM4A 3I5GC 1BF5A 1TOPA 1B7TZ 3NSIA 2JNXA 3K21A 1JC2A 1NX3A 3PM8A 1EG4A 2ZNDA 3OB2B 3OX5A 2KAXA 4I5LB 1BR1B 1NYAA 1A75A 2NXQA 2HPSA 1RTP1 4R1EA 1YRTB 1N2DA 1UP5A 1K9PA 3PALA 2I18A 1AJ5A 1XFXO 2EC6C 2LHLA 1KSMA 4YBHB 2JT0A 1NX2A 1J7QA 2Y5IA 2WC8A 4U8DA 2KBIA 1NCZA 1PSBA 4P2YB 2F33A 2OS8C 2KBMA 1DJYA 4OV2A 1W7JB 4PHKA 4ZCVA 2PASA 2BKHB 5HKYA 1K2HA 1EXRA 1ZFSA 1DF0A 1QV1A 1SCVA 1A29A 4PHMA 4CFQA 2FCDA 1IJ6A 1A75B 1EG3A 1QATA 1PVAA 3NSLA 4I5NB 2ZN9A 3FIAA 4GPLB 4DIRA 2HQWA 1NX1A 1KQMC 4JWQA 1SW8A 2L5XB 3H4SE 3DD4A 3I5GB 4QJ4B 2KFGA 1KFXL 1Y0VH 1QTXA 1S5GY 3KF9A 1RJVA 1K96A 1B7TY 1FW4A 1FI5A 3TZ1A 3JTDC 1S6JA 2LLUA 2LP3A 1G4YR 3DVKA 5JOLA 1YRUB 3VRNA 1XFYO 1LA0A 1JWDA 1SL7A 5G08A 1K90D 2JZIA 2L51A 1OZOA 1TCFA 1GGWA 2M1KB 2OS8B 3TDIA 2G2BA 2LLSA 1YVLA 3ICBA 2PALA 3TDUA 1TIZA 2FJUB 1DVIA 3PFVA 2BBMA 2M3WA 2ZRSA 1YX8A 4MLWA 1RK9A 2KYFA 1M31A 1RFJA 2SASA 5HYDA 1X02A 2KOTA 1ZUZA 4NDCA 1B8LA 1MQ1A 1NCXA 4ORCB 4PCWA 1DJGA 3LK0A 1SPYA 2MBXA 2L4IA 4MBEA 5KU1A 3AAKA 1SRAA 3LLEA 1CTRA 3EVUA 1BLQA 1J1EA 3BQ3A 1YUTA 3EK7A 3PN7B 3FS7A 5D7FA 3VRRA 3JTDB 5ER5A 1PSRA 4PHNA 5D69A 3NXAA 4N1GA 1K95A 1M63B 1FI6A 1YVHA 4JPZB 1UWOA 3SG6A 1CDMA 1UHNA 1CLLA 1MXLC 1JF2A 1UHKA 2JTTA 2ZRTA 1KK7Z 3WXAA 1SNLA 1SK6D 2KI6C 1ZACA 3BUXB 1UHIA 1ZOTB 2MRDA 2V53A 2GGZA 2K8MB 2K7OA 4MZLA 1BMOA 4QJ5B 2KI6D 2M0RA 1CLMA 1J1DA 5CPVA 2F2OA 1QASA 2K2FA 3E3RA 2NLNA 1SL8A 1EL4A 1JFKA 1IG5A 2BCXA 4YGDB 3GK1A 4PE4A 3IF7A 4CLNA 1CDPA 3NSKA 2GV5A 1G33A 2KI4C 2Y4QA 3LK1A 1K93D 3TS5B 5HKZA 2H61C 1SCMB 3GK2A 2A4JA 3JVTB 1Y1XA 1OSAA 1QVIZ 1GQMA 1BOCA 4WRIA 2JXLA 1KSOA 1XFWO 5AERA 1MXEA 2L4HA 3EK4A 2LUXA 5JJGA 3NSOA 2PSRA 3PSRA 4QJ3B 1KFUS 2H61A 2COLB 3I5HC 1KK7Y 1SR6B 2L2EA 2JQ6A 4E68A 2LVIA 2WNDA 4TNCA 2R2IA 2Y1MA 1EH2A 3RM1A 2LC5A 1SYMA 3OB1B 1UHHA 1FPWA 4MRXA 2NZ0A 1NCYA 1OMDA 1RWYA 2KAYA 3ZWHA 1M46A 1CMGA 1SY9A 1WDCB 2BKIB 2DOQA 4AQJA 4MVFA 2NCPA 4YGEB 2ISDA 4YRUA 2JPTA 2M49B 1S36A 2TN4A 3CLNA 1FBVA 1HT9A 2KI4B 1MHOA 4GGNA 5HKWA 1XVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGV A;  2HET A;  2O5G A;  2LMU A;  2GGM A;  2ZKM X;  1A03 A;  2WCB A;  4N1F A;  1CDL A;  2LVV A;  1IGV A;  4OR9 B;  2M8U A;  5ER4 X;  1IWQ A;  1YUR A;  1QVI Y;  1SBJ A;  1QV0 A;  2LV7 A;  3LCP C;  4GNK B;  5DKN A;  1JFJ A;  1U5I A;  3SJS A;  2VRG A;  3HX4 A;  3QRX A;  2JWW A;  1CB1 A;  3EKJ A;  2LNK A;  4NQG A;  1AP4 A;  3IQQ A;  1J7O A;  1NP8 A;  3I5H B;  2E30 A;  4F0Z B;  4HRH A;  1BT6 A;  2BEC A;  4A4C A;  4HRG A;  3PN7 C;  3EVV A;  1DJI A;  4DCK A;  1N0Y A;  2MHH A;  3I5F C;  5FYX A;  1F55 A;  2JT3 A;  1YR5 A;  2CCM A;  1NPQ A;  1V1G A;  4C0L A;  3VGO A;  4C0K A;  4GBA A;  2OPO A;  1CFD A;  2K61 A;  1TNP A;  1S6C A;  1HQV A;  3KHE A;  5HLO A;  2FCE A;  1DJH A;  1U5I B;  2K7D A;  2QAC A;  1YTZ C;  1XO5 A;  2F3Z A;  3CTN A;  3EVR A;  1F4Q A;  5CSJ A;  2K7B A;  1Y1A A;  1QLK A;  2KGR A;  2MLF C;  3CGA A;  4MSP A;  3WNX B;  2KSP A;  1KFX S;  1REC A;  4M2O A;  1GGZ A;  1XFV O;  3SG5 A;  1XK4 C;  3FWC A;  4I5K A;  2LM5 A;  1W7I B;  4MEW A;  1MWN A;  2KFF A;  4YGC B;  1NSH A;  3TS5 C;  1C07 A;  1SCM C;  5PAL A;  3LL8 B;  1QX5 B;  3JVT C;  1CKK A;  1CFC A;  2HF5 A;  3I5F B;  3SG3 A;  1XK4 A;  5GQQ C;  1F54 A;  2L98 A;  4L9M A;  1S3P A;  1IQ3 A;  1QXP A;  1K9K A;  1LA3 A;  1QIV A;  1WRK A;  2LLT A;  4P5O E;  4IL1 A;  4XJK A;  2LAN A;  1CNP A;  2LHI A;  1IH0 A;  2BCA A;  1SR6 C;  4DS7 A;  5F6T A;  4YGA A;  4PHJ A;  1K94 A;  4A4B A;  2E6W A;  2O60 A;  1A2X A;  1ODB A;  2M1U A;  4JQ0 D;  4DUQ A;  1CMF A;  3DVE A;  2CNP A;  1NIW A;  2ZN8 A;  1FF1 A;  1N65 A;  2H2K A;  1QX7 A;  3CS1 A;  1AHR A;  4GAO A;  1WDC C;  4M2P A;  2F3Y A;  4D1E A;  1KK8 B;  3BOW A;  2LVK A;  2L0P A;  4MZJ A;  2FOT A;  3VRQ A;  5BPJ A;  3TUY C;  2JOJ A;  1AJ4 A;  2KYC A;  2JC2 A;  2M7L A;  1JSA A;  4XJK B;  1DMO A;  1Q80 A;  1WLZ A;  3I5I B;  1JF0 A;  5HLV A;  1CDN A;  1QJT A;  1J55 A;  3O4Y A;  1TNQ A;  4PE7 A;  4AOM A;  3OX6 A;  2K2A A;  1QS7 A;  2KHN A;  1BG1 A;  1EJ3 A;  2F8P A;  1JBA A;  1S26 D;  1F70 A;  4NDD A;  3BOW B;  2LUC A;  1H4B A;  2KQ6 A;  2PRU A;  1UUR A;  1OQP A;  1S1E A;  1Y6W A;  2IS9 A;  3FWB A;  1BOD A;  2JTZ A;  1F8H A;  1K8U A;  3BYA A;  1Y1U A;  3O2P A;  2G9B A;  4C0J A;  1IKU A;  2WOS A;  1PRW A;  2I7A A;  5I8N A;  2CT9 A;  2ZNE A;  4ICB A;  4DRW A;  4PAL A;  2JUL A;  1SMG A;  3DVJ A;  4M2Q A;  3SG2 A;  3C1V A;  1AK8 A;  1XFU O;  2M7N A;  3EKH A;  3TUY B;  1B8C A;  1MF8 B;  2HQ8 A;  1YX7 A;  2K0J A;  4XYN A;  1V1F A;  5IBW A;  2KDH A;  1R2U A;  1XA5 A;  3RLZ A;  3AKB A;  5AEQ A;  3VRP A;  2OTG C;  2M9G A;  1M45 A;  5J3X A;  1AUI B;  2Q91 A;  2CXJ A;  1L7Z A;  4ETO A;  3DF0 B;  2JRF A;  1L2O C;  4PE1 A;  1DJW A;  3MSE B;  2MAZ A;  4GGF C;  2BE4 A;  3PLF B;  1QIW A;  4MN0 A;  1PUL A;  1DGU A;  1OOJ A;  1B47 A;  1NX0 A;  4WQ2 A;  2I2R E;  1F4O A;  2QPT A;  4UPG A;  4FTG A;  2MA2 A;  3DVM A;  1SKT A;  3IQO A;  1CLB A;  1JUO A;  2BBN A;  1BR4 B;  1TNW A;  3EK8 A;  4YI9 A;  2P6B B;  1RRO A;  4Q04 A;  2WCE A;  4GGF A;  1J7R A;  2CBL A;  3CZT X;  4BY4 A;  1G8I A;  3GK4 X;  3SG4 A;  1DT7 B;  3A8R A;  2LE9 B;  1PK0 D;  4GUK A;  1B1G A;  1B4C A;  1PAL A;  2BE6 A;  5DKR A;  2L50 A;  4AQI A;  5AFP A;  5B8I B;  1MR8 A;  3CR4 X;  1CFF A;  1DTL A;  1C7V A;  3OHM B;  1WLM A;  1M39 A;  1IRJ A;  3SIB A;  1GJY A;  3KO0 A;  3VRO A;  1MUX A;  1TTX A;  2KGB C;  2OTG B;  1KQV A;  1E8A A;  3A4U B;  1XFZ O;  5KSZ A;  1J7P A;  2ZFD A;  3BXK A;  2BL0 C;  2WCF A;  1DF0 B;  3CR2 A;  2EGD A;  4PDZ A;  1F71 A;  1L2O B;  1CFP A;  1KK8 C;  1YUU A;  1NWD A;  2EC6 B;  2F2P A;  2K7C A;  1UHJ A;  5KTY A;  1OMV A;  2RGI A;  1C7W A;  4HRE E;  5CSI A;  4HSZ A;  1R6P A;  1NUB A;  1QLS A;  4CFR A;  3ZNI A;  1WRZ A;  4OVN F;  3I5I C;  3KPX A;  2JNF A;  1LKJ A;  5I2Q A;  1QX2 A;  3D10 A;  1DJX A;  2CTN A;  3AKA A;  2AAO A;  1H8B A;  3BUO B;  2B1U A;  1PVB A;  2D8N A;  2LVJ A;  4YI8 A;  2LAP A;  2MJW B;  5I2O A;  4BY5 A;  3HCM A;  4CID A;  1OMR A;  1OZS A;  1K9U A;  1XYD A;  1IJ5 A;  4I5J A;  1KQM B;  3OP0 A;  1OE9 B;  1CM1 A;  1VRK A;  3O78 A;  1KWO C;  2Q4U A;  1TCO B;  2M97 A;  4CPV A;  2Y1N A;  2KFH A;  4OKH A;  2LP2 A;  4WQ3 A;  2M29 A;  4PE0 A;  4YGB B;  3BUN B;  1B9A A;  4ORA B;  5DKQ A;  1BJF A;  3O6B A;  2AMI A;  2BL0 B;  2PVB A;  4ORB B;  1ZMZ A;  4N5X A;  1IQ5 A;  2AUC A;  2JXC A;  4OCI A;  2JU0 A;  1UUS A;  4NDB A;  3KEV A;  2LMT A;  2LCP A;  4MZK A;  3WHT B;  1LVC D;  3AAJ A;  3F45 A;  1BU3 A;  1ALW A;  1WY9 A;  3GOF A;  1A4P A;  2JT8 A;  1KCY A;  5TNC A;  2BCB A;  1KFU L;  3D0Y A;  3BUW B;  1TRF A;  4FQO A;  3CR5 X;  3CWG A;  4USL A;  2KQY A;  5CSN A;  3BUM B;  1S6I A;  3PAT A;  1D1O A;  2I94 A;  3M0W A;  1B8R A;  2KAV A;  3SG7 A;  4ZCU A;  3SIA A;  2SCP A;  5CSF A;  1WRL A;  1AVS A;  1KWO B;  1LIN A;  3DF0 A;  1TNX A;  4MRY A;  1TN4 A;  5I2L A;  1SL9 A;  5AXI A;  1YUS A;  1LXF C;  5K89 A;  2KNE A;  1DJZ A;  2MLE C;  4GFT A;  2NCO A;  5AAN A;  3TDZ A;  2PMY A;  3D0Y B;  1ALV A;  2WOR A;  3WHU B;  1S5G Z;  2LMV A;  2EHB A;  1CM4 A;  3I5G C;  1BF5 A;  1TOP A;  1B7T Z;  3NSI A;  2JNX A;  3K21 A;  1JC2 A;  1NX3 A;  3PM8 A;  1EG4 A;  2ZND A;  3OB2 B;  3OX5 A;  2KAX A;  4I5L B;  1BR1 B;  1NYA A;  1A75 A;  2NXQ A;  2HPS A;  1RTP 1;  4R1E A;  1YRT B;  1N2D A;  1UP5 A;  1K9P A;  3PAL A;  2I18 A;  1AJ5 A;  1XFX O;  2EC6 C;  2LHL A;  1KSM A;  4YBH B;  2JT0 A;  1NX2 A;  1J7Q A;  2Y5I A;  2WC8 A;  4U8D A;  2KBI A;  1NCZ A;  1PSB A;  4P2Y B;  2F33 A;  2OS8 C;  2KBM A;  1DJY A;  4OV2 A;  1W7J B;  4PHK A;  4ZCV A;  2PAS A;  2BKH B;  5HKY A;  1K2H A;  1EXR A;  1ZFS A;  1DF0 A;  1QV1 A;  1SCV A;  1A29 A;  4PHM A;  4CFQ A;  2FCD A;  1IJ6 A;  1A75 B;  1EG3 A;  1QAT A;  1PVA A;  3NSL A;  4I5N B;  2ZN9 A;  3FIA A;  4GPL B;  4DIR A;  2HQW A;  1NX1 A;  1KQM C;  4JWQ A;  1SW8 A;  2L5X B;  3H4S E;  3DD4 A;  3I5G B;  4QJ4 B;  2KFG A;  1KFX L;  1Y0V H;  1QTX A;  1S5G Y;  3KF9 A;  1RJV A;  1K96 A;  1B7T Y;  1FW4 A;  1FI5 A;  3TZ1 A;  3JTD C;  1S6J A;  2LLU A;  2LP3 A;  1G4Y R;  3DVK A;  5JOL A;  1YRU B;  3VRN A;  1XFY O;  1LA0 A;  1JWD A;  1SL7 A;  5G08 A;  1K90 D;  2JZI A;  2L51 A;  1OZO A;  1TCF A;  1GGW A;  2M1K B;  2OS8 B;  3TDI A;  2G2B A;  2LLS A;  1YVL A;  3ICB A;  2PAL A;  3TDU A;  1TIZ A;  2FJU B;  1DVI A;  3PFV A;  2BBM A;  2M3W A;  2ZRS A;  1YX8 A;  4MLW A;  1RK9 A;  2KYF A;  1M31 A;  1RFJ A;  2SAS A;  5HYD A;  1X02 A;  2KOT A;  1ZUZ A;  4NDC A;  1B8L A;  1MQ1 A;  1NCX A;  4ORC B;  4PCW A;  1DJG A;  3LK0 A;  1SPY A;  2MBX A;  2L4I A;  4MBE A;  5KU1 A;  3AAK A;  1SRA A;  3LLE A;  1CTR A;  3EVU A;  1BLQ A;  1J1E A;  3BQ3 A;  1YUT A;  3EK7 A;  3PN7 B;  3FS7 A;  5D7F A;  3VRR A;  3JTD B;  5ER5 A;  1PSR A;  4PHN A;  5D69 A;  3NXA A;  4N1G A;  1K95 A;  1M63 B;  1FI6 A;  1YVH A;  4JPZ B;  1UWO A;  3SG6 A;  1CDM A;  1UHN A;  1CLL A;  1MXL C;  1JF2 A;  1UHK A;  2JTT A;  2ZRT A;  1KK7 Z;  3WXA A;  1SNL A;  1SK6 D;  2KI6 C;  1ZAC A;  3BUX B;  1UHI A;  1ZOT B;  2MRD A;  2V53 A;  2GGZ A;  2K8M B;  2K7O A;  4MZL A;  1BMO A;  4QJ5 B;  2KI6 D;  2M0R A;  1CLM A;  1J1D A;  5CPV A;  2F2O A;  1QAS A;  2K2F A;  3E3R A;  2NLN A;  1SL8 A;  1EL4 A;  1JFK A;  1IG5 A;  2BCX A;  4YGD B;  3GK1 A;  4PE4 A;  3IF7 A;  4CLN A;  1CDP A;  3NSK A;  2GV5 A;  1G33 A;  2KI4 C;  2Y4Q A;  3LK1 A;  1K93 D;  3TS5 B;  5HKZ A;  2H61 C;  1SCM B;  3GK2 A;  2A4J A;  3JVT B;  1Y1X A;  1OSA A;  1QVI Z;  1GQM A;  1BOC A;  4WRI A;  2JXL A;  1KSO A;  1XFW O;  5AER A;  1MXE A;  2L4H A;  3EK4 A;  2LUX A;  5JJG A;  3NSO A;  2PSR A;  3PSR A;  4QJ3 B;  1KFU S;  2H61 A;  2COL B;  3I5H C;  1KK7 Y;  1SR6 B;  2L2E A;  2JQ6 A;  4E68 A;  2LVI A;  2WND A;  4TNC A;  2R2I A;  2Y1M A;  1EH2 A;  3RM1 A;  2LC5 A;  1SYM A;  3OB1 B;  1UHH A;  1FPW A;  4MRX A;  2NZ0 A;  1NCY A;  1OMD A;  1RWY A;  2KAY A;  3ZWH A;  1M46 A;  1CMG A;  1SY9 A;  1WDC B;  2BKI B;  2DOQ A;  4AQJ A;  4MVF A;  2NCP A;  4YGE B;  2ISD A;  4YRU A;  2JPT A;  2M49 B;  1S36 A;  2TN4 A;  3CLN A;  1FBV A;  1HT9 A;  2KI4 B;  1MHO A;  4GGN A;  5HKW A;  1XVJ A; 
#chains in the Genus database with same CATH topology
 1OOH A;  1DGV A;  2WC5 A;  2HET A;  2O5G A;  2LMU A;  2GGM A;  2ZKM X;  1DEK A;  1A03 A;  2WCB A;  4N1F A;  1CDL A;  2LVV A;  1IGV A;  4OR9 B;  2M8U A;  5ER4 X;  1IWQ A;  1YUR A;  1QVI Y;  1SBJ A;  1QV0 A;  2LV7 A;  2QEB A;  2QEO A;  3FE6 A;  3LCP C;  1U5I A;  4GNK B;  2VRG A;  3HX4 A;  3QRX A;  2JWW A;  3SJS A;  3EKJ A;  5DKN A;  2LNK A;  4NQG A;  1AP4 A;  3IQQ A;  1J7O A;  1NP8 A;  3I5H B;  2E30 A;  4F0Z B;  4HRH A;  1BT6 A;  2BEC A;  4A4C A;  4HRG A;  3PN7 C;  3EVV A;  1DJI A;  4DCK A;  1N0Y A;  2MHH A;  3I5F C;  5FYX A;  1F55 A;  2JT3 A;  3S0G A;  1YR5 A;  2JPO A;  2CCM A;  1NPQ A;  1C3Y A;  1V1G A;  1TWO A;  4C0L A;  2WCH A;  3VGO A;  4C0K A;  4GBA A;  2OPO A;  1CFD A;  2K61 A;  1TNP A;  1S6C A;  1HQV A;  3KHE A;  3L4L A;  5HLO A;  2FCE A;  1DJH A;  1TUJ A;  1U5I B;  2K7D A;  1YTZ C;  2QAC A;  1XO5 A;  2F3Z A;  3CTN A;  3EVR A;  3SS3 A;  1F4Q A;  5CSJ A;  2K7B A;  1Y1A A;  1QLK A;  2KGR A;  2MLF C;  1Z4H A;  3CGA A;  4MSP A;  2KSP A;  3WNX B;  1KFX S;  1REC A;  4M2O A;  2PYQ A;  4PT1 A;  1GGZ A;  1XFV O;  3SG5 A;  1XK4 C;  3FWC A;  4I5K A;  2LM5 A;  1SSE B;  1W7I B;  4MEW A;  1MWN A;  3VB1 A;  2KFF A;  4YGC B;  1NSH A;  3TS5 C;  1GM0 A;  1C07 A;  1SCM C;  5PAL A;  3LL8 B;  1QX5 B;  3JVT C;  1CKK A;  1CFC A;  2HF5 A;  3UNW A;  2WCL A;  3I5F B;  1DC1 A;  3SG3 A;  1XK4 A;  5GQQ C;  1F54 A;  2L98 A;  4L9M A;  1S3P A;  2GTE A;  1OOF A;  1IQ3 A;  1QXP A;  4FQT A;  1K9K A;  1LA3 A;  3S0D A;  1QIV A;  1WRK A;  2LLT A;  3CZ2 A;  4P5O E;  4IL1 A;  4XJK A;  2LAN A;  1CNP A;  2LHI A;  1IH0 A;  2BCA A;  1SR6 C;  4DS7 A;  5F6T A;  4YGA A;  4PHJ A;  1K94 A;  4A4B A;  2E6W A;  2O60 A;  1A2X A;  1ODB A;  2M1U A;  4JQ0 D;  4DUQ A;  1CMF A;  3DVE A;  2CNP A;  1NIW A;  2ZN8 A;  5D3O A;  3S0E A;  1FF1 A;  1N65 A;  2H2K A;  1QX7 A;  3CS1 A;  1AHR A;  4GAO A;  1WDC C;  4M2P A;  2F3Y A;  4D1E A;  1QWV A;  1KK8 B;  3BOW A;  2LVK A;  2L0P A;  4MZJ A;  2FOT A;  3VRQ A;  5BPJ A;  3TUY C;  2JOJ A;  1AJ4 A;  2KYC A;  2JC2 A;  2M7L A;  1JSA A;  3CAB A;  4XJK B;  1DMO A;  1Q80 A;  1WLZ A;  3I5I B;  1JF0 A;  5HLV A;  3B7A A;  1CDN A;  1QJT A;  1J55 A;  2KPH A;  1TNQ A;  3O4Y A;  3OBV A;  4PE7 A;  4AOM A;  3OX6 A;  2K2A A;  1QS7 A;  2KHN A;  1BG1 A;  1EJ3 A;  2F8P A;  3B6X A;  3R1V A;  1OOG A;  1S26 D;  1JBA A;  1F70 A;  4NDD A;  2BNX A;  3BOW B;  2LUC A;  1H4B A;  2KQ6 A;  2PRU A;  1UUR A;  1OQP A;  1S1E A;  1Y6W A;  2IS9 A;  3D74 A;  3FWB A;  2JTZ A;  1BOD A;  1F8H A;  1K8U A;  3BYA A;  1CB1 A;  1Y1U A;  3O2P A;  2G9B A;  4C0J A;  1IKU A;  2WOS A;  1PRW A;  2I7A A;  5I8N A;  2CT9 A;  2ZNE A;  4ICB A;  4DRW A;  4PAL A;  2JUL A;  1SMG A;  3DVJ A;  4M2Q A;  3SG2 A;  3C1V A;  1AK8 A;  1DEL A;  1XFU O;  2M7N A;  4INW A;  3EKH A;  3TUY B;  1B8C A;  1MF8 B;  2HQ8 A;  1YX7 A;  2K0J A;  3PM2 A;  4OZD A;  1V1F A;  4XYN A;  5IBW A;  1F71 A;  2KDH A;  1R2U A;  1XA5 A;  3K1E A;  3RLZ A;  3AKB A;  5AEQ A;  3VRP A;  2OTG C;  3R72 A;  2M9G A;  1M45 A;  2QDI A;  1AUI B;  5J3X A;  2Q91 A;  2CXJ A;  1L7Z A;  4ETO A;  3DF0 B;  2JRF A;  1L2O C;  3NGV A;  4PE1 A;  1DJW A;  2KLD A;  2MAZ A;  3MSE B;  2BE4 A;  4GGF C;  3PLF B;  3ZWH A;  3SS5 A;  3L4A A;  1QIW A;  4MN0 A;  1PUL A;  1DGU A;  1OOJ A;  1B47 A;  1NX0 A;  4WQ2 A;  2I2R E;  1F4O A;  2QPT A;  4UPG A;  4FTG A;  2MA2 A;  3NHT A;  3DVM A;  1SKT A;  3DXL A;  3IQO A;  1CLB A;  1JUO A;  2BBN A;  1BR4 B;  1TNW A;  3EK8 A;  4YI9 A;  2P6B B;  1RRO A;  4Q04 A;  2WCE A;  4GGF A;  1J7R A;  2CBL A;  3CDN A;  3CZT X;  4BY4 A;  1G8I A;  3GK4 X;  3SG4 A;  1DT7 B;  3A8R A;  2LE9 B;  1PK0 D;  3CZ0 A;  4GUK A;  1B1G A;  1B4C A;  1PAL A;  2BE6 A;  5DKR A;  2L50 A;  4AQI A;  5AFP A;  5B8I B;  1MR8 A;  3CR4 X;  1CFF A;  1DTL A;  3O4X A;  1C7V A;  3OHM B;  1WLM A;  1M39 A;  1IRJ A;  3SIB A;  1GJY A;  2QEH A;  2WCK A;  3KO0 A;  3VRO A;  1MUX A;  1TTX A;  2KGB C;  2OTG B;  1KQV A;  1E8A A;  3A4U B;  1XFZ O;  2L5Y A;  5KSZ A;  1J7P A;  2ZFD A;  3BXK A;  2BL0 C;  2WCF A;  1DF0 B;  3CR2 A;  2EGD A;  4IJ7 A;  4PDZ A;  1L2O B;  1CFP A;  1KK8 C;  1YUU A;  1NWD A;  2EC6 B;  2F2P A;  2K7C A;  1OOI X;  1UHJ A;  5KTY A;  1OMV A;  2RGI A;  1C7W A;  4HRE E;  5CSI A;  4HSZ A;  1R6P A;  1NUB A;  1QLS A;  4CFR A;  3ZNI A;  1WRZ A;  4OVN F;  1T14 A;  3I5I C;  1TUZ A;  3KPX A;  2FJY A;  2JNF A;  1LKJ A;  3BFH A;  5I2Q A;  1QX2 A;  3D10 A;  1DJX A;  2CTN A;  3AKA A;  4JKT A;  2AAO A;  1H8B A;  3BUO B;  3RZS A;  2B1U A;  1PVB A;  2K60 A;  2D8N A;  2LVJ A;  4YI8 A;  2LAP A;  2MJW B;  5I2O A;  4BY5 A;  3HCM A;  4CID A;  1OMR A;  1OZS A;  1K9U A;  1XYD A;  1IJ5 A;  4I5J A;  1KQM B;  3OP0 A;  1OE9 B;  1CM1 A;  1P28 A;  1VRK A;  3O78 A;  3S0A A;  1KWO C;  2Q4U A;  1TCO B;  2M97 A;  4CPV A;  2Y1N A;  2KFH A;  3R1O A;  2LP2 A;  4OKH A;  4WQ3 A;  2M29 A;  3PJI A;  4PE0 A;  4YGB B;  3BUN B;  1B9A A;  4ORA B;  5DKQ A;  1BJF A;  3O6B A;  2AMI A;  2BL0 B;  2PVB A;  3EG5 B;  4ORB B;  3V2L A;  5DIC A;  1ZMZ A;  1DQE A;  1IQ5 A;  2AUC A;  2JXC A;  4N5X A;  4OCI A;  1JFJ A;  2JU0 A;  1UUS A;  4NDB A;  3KEV A;  2LMT A;  4INX A;  2LCP A;  4MZK A;  3WHT B;  1LVC D;  3AAJ A;  3F45 A;  5I94 A;  3B86 A;  1BU3 A;  1ALW A;  1WY9 A;  3GOF A;  1A4P A;  2JT8 A;  1Z2C B;  1KCY A;  5TNC A;  2BCB A;  1KFU L;  3D0Y A;  3BUW B;  1TRF A;  4FQO A;  3CR5 X;  3CWG A;  4USL A;  2KQY A;  5CSN A;  3BUM B;  3Q8I A;  1S6I A;  3PAT A;  1D1O A;  2I94 A;  3M0W A;  1B8R A;  2KAV A;  3SG7 A;  4ZCU A;  3SIA A;  2SCP A;  3SS4 A;  5CSF A;  1WRL A;  1AVS A;  1KWO B;  1LIN A;  3DF0 A;  1TNX A;  4MRY A;  2WCM A;  1TN4 A;  3UO9 A;  5I2L A;  1XFR A;  1SL9 A;  5AXI A;  1YUS A;  3D73 A;  1LXF C;  5K89 A;  1ORG A;  2KNE A;  1DJZ A;  3D77 A;  2MLE C;  4GFT A;  2NCO A;  5AAN A;  3TDZ A;  3OGN A;  2PMY A;  3D0Y B;  1ALV A;  2WOR A;  3WHU B;  1S5G Z;  2WCJ A;  2LMV A;  2P71 A;  2EHB A;  1CM4 A;  3I5G C;  1BF5 A;  3DZT A;  1TOP A;  1B7T Z;  3NSI A;  2JNX A;  3K21 A;  1JC2 A;  1NX3 A;  3PM8 A;  1EG4 A;  2ZND A;  3OB2 B;  3OX5 A;  2KAX A;  4I5L B;  1BR1 B;  1NYA A;  1A75 A;  2NXQ A;  2HPS A;  1RTP 1;  3R1P A;  4R1E A;  1YRT B;  1N2D A;  1UP5 A;  1K9P A;  3PAL A;  2I18 A;  1AJ5 A;  3B88 A;  1XFX O;  2EC6 C;  2LHL A;  1KSM A;  4YBH B;  2JT0 A;  1NX2 A;  1J7Q A;  2Y5I A;  2WC8 A;  4U8D A;  2KBI A;  1NCZ A;  3FE8 A;  1PSB A;  4P2Y B;  2F33 A;  2OS8 C;  2KBM A;  1DJY A;  4OV2 A;  1W7J B;  3D78 A;  4PHK A;  4ZCV A;  2PAS A;  2BKH B;  5HKY A;  1K2H A;  1EXR A;  1ZFS A;  1DF0 A;  3IVT A;  1QV1 A;  1SCV A;  1A29 A;  4PHM A;  4CFQ A;  2FCD A;  1IJ6 A;  1A75 B;  1EG3 A;  2YGU A;  1QAT A;  1PVA A;  3NSL A;  3FE9 A;  4I5N B;  2ZN9 A;  3FIA A;  4GPL B;  4DIR A;  2HQW A;  1NX1 A;  1KQM C;  4JWQ A;  1SW8 A;  3S0B A;  2L5X B;  3H4S E;  3DD4 A;  3I5G B;  4QJ4 B;  2KFG A;  1KFX L;  1Y0V H;  1QTX A;  1S5G Y;  3KF9 A;  1RJV A;  1K96 A;  1B7T Y;  1FW4 A;  1FI5 A;  3N7H A;  3TZ1 A;  3JTD C;  1S6J A;  2LLU A;  2LP3 A;  3DYE A;  1G4Y R;  3DVK A;  5JOL A;  1YRU B;  3VRN A;  1XFY O;  1LA0 A;  1JWD A;  1SL7 A;  5G08 A;  1K90 D;  2JZI A;  5EL2 A;  2L51 A;  3B87 A;  1OZO A;  1TCF A;  1GGW A;  2M1K B;  1OW4 A;  2OS8 B;  3TDI A;  4KYN A;  2G2B A;  2L2C A;  1YVL A;  2LLS A;  3ICB A;  2PAL A;  3TDU A;  5FI7 A;  1TIZ A;  2FJU B;  3BFB A;  1DVI A;  3PFV A;  2BBM A;  2M3W A;  2ZRS A;  2PQL A;  1YX8 A;  4MLW A;  5HL1 A;  1RK9 A;  1W9Z A;  2KYF A;  1M31 A;  1RFJ A;  3DY9 A;  2SAS A;  3CZ1 A;  5HYD A;  1X02 A;  2KOT A;  1ZUZ A;  4NDC A;  1B8L A;  1MQ1 A;  1NCX A;  4ORC B;  4PCW A;  1DJG A;  3LK0 A;  3NHI A;  1SPY A;  2MBX A;  2L4I A;  4MBE A;  5KU1 A;  3AAK A;  1SRA A;  3LLE A;  1CTR A;  3EVU A;  1BLQ A;  1J1E A;  3BQ3 A;  1YUT A;  3EK7 A;  3PN7 B;  3FS7 A;  5D7F A;  3VRR A;  3JTD B;  5ER5 A;  1PSR A;  4PHN A;  5D69 A;  3NXA A;  4N1G A;  2ERB A;  1K95 A;  1M63 B;  1FI6 A;  1YVH A;  3L47 A;  4JPZ B;  1IIO A;  1UWO A;  3SG6 A;  3BFA A;  1CDM A;  1UHN A;  1CLL A;  1MXL C;  1JF2 A;  1UHK A;  2JTT A;  2ZRT A;  1KK7 Z;  3S0F A;  3WXA A;  1SNL A;  1SK6 D;  2KI6 C;  2QEV A;  1ZAC A;  3BUX B;  3D76 A;  1UHI A;  1ZOT B;  2MRD A;  2V53 A;  2GGZ A;  2K8M B;  2BAP A;  2K7O A;  4MZL A;  1BMO A;  4QJ5 B;  2KI6 D;  2M0R A;  1CLM A;  1J1D A;  5CPV A;  2P70 A;  2F2O A;  1QAS A;  2K2F A;  3E3R A;  2NLN A;  1SL8 A;  1EL4 A;  1JFK A;  1IG5 A;  2BCX A;  3CYZ A;  4YGD B;  3GK1 A;  4PE4 A;  3IF7 A;  4CLN A;  1CDP A;  3NSK A;  2GV5 A;  1CMG A;  1G33 A;  2KI4 C;  2Y4Q A;  3LK1 A;  1K93 D;  3TS5 B;  5HKZ A;  2WC6 A;  4F7F A;  1C3Z A;  2H61 C;  5FI2 A;  1SCM B;  3GK2 A;  2A4J A;  3JVT B;  3QME A;  1Y1X A;  1LS8 A;  1OSA A;  1QVI Z;  1GQM A;  1BOC A;  4WRI A;  2JXL A;  1KSO A;  1XFW O;  5AER A;  1MXE A;  2L4H A;  3EK4 A;  2LUX A;  5JJG A;  3NSO A;  2PSR A;  3PSR A;  4QJ3 B;  1KFU S;  2H61 A;  2COL B;  3I5H C;  1KK7 Y;  1SR6 B;  2L2E A;  2JQ6 A;  4E68 A;  2LVI A;  2WND A;  4TNC A;  2R2I A;  2Y1M A;  1EH2 A;  3RM1 A;  2LC5 A;  1SYM A;  3OB1 B;  3D75 A;  4JD9 A;  1UHH A;  1FPW A;  2H8V A;  2NZ0 A;  1NCY A;  1OMD A;  1RWY A;  2KAY A;  4MRX A;  1M46 A;  5FI6 A;  1SY9 A;  1WDC B;  2BKI B;  2DOQ A;  4AQJ A;  4MVF A;  2NCP A;  4YGE B;  2ISD A;  4YRU A;  2JPT A;  2M49 B;  1S36 A;  2TN4 A;  3CLN A;  1FBV A;  1HT9 A;  2KI4 B;  1MHO A;  4GGN A;  5HKW A;  2KLE A;  3BJH A;  1XVJ A; 
#chains in the Genus database with same CATH homology
 1DGV A;  2HET A;  2O5G A;  2LMU A;  2GGM A;  2ZKM X;  1A03 A;  2WCB A;  4N1F A;  1CDL A;  2LVV A;  1IGV A;  4OR9 B;  2M8U A;  5ER4 X;  1IWQ A;  1YUR A;  1QVI Y;  1SBJ A;  1QV0 A;  2LV7 A;  3LCP C;  4GNK B;  5DKN A;  1JFJ A;  1U5I A;  3SJS A;  2VRG A;  3HX4 A;  3QRX A;  2JWW A;  1CB1 A;  3EKJ A;  2LNK A;  4NQG A;  1AP4 A;  3IQQ A;  1J7O A;  1NP8 A;  3I5H B;  2E30 A;  4F0Z B;  4HRH A;  1BT6 A;  2BEC A;  4A4C A;  4HRG A;  3PN7 C;  3EVV A;  1DJI A;  4DCK A;  1N0Y A;  2MHH A;  3I5F C;  5FYX A;  1F55 A;  2JT3 A;  1YR5 A;  2CCM A;  1NPQ A;  1V1G A;  4C0L A;  3VGO A;  4C0K A;  4GBA A;  2OPO A;  1CFD A;  2K61 A;  1TNP A;  1S6C A;  1HQV A;  3KHE A;  5HLO A;  2FCE A;  1DJH A;  1U5I B;  2K7D A;  2QAC A;  1YTZ C;  1XO5 A;  2F3Z A;  3CTN A;  3EVR A;  1F4Q A;  5CSJ A;  2K7B A;  1Y1A A;  1QLK A;  2KGR A;  2MLF C;  3CGA A;  4MSP A;  3WNX B;  2KSP A;  1KFX S;  1REC A;  4M2O A;  1GGZ A;  1XFV O;  3SG5 A;  1XK4 C;  3FWC A;  4I5K A;  2LM5 A;  1W7I B;  4MEW A;  1MWN A;  2KFF A;  4YGC B;  1NSH A;  3TS5 C;  1C07 A;  1SCM C;  5PAL A;  3LL8 B;  1QX5 B;  3JVT C;  1CKK A;  1CFC A;  2HF5 A;  3I5F B;  3SG3 A;  1XK4 A;  5GQQ C;  1F54 A;  2L98 A;  4L9M A;  1S3P A;  1IQ3 A;  1QXP A;  1K9K A;  1LA3 A;  1QIV A;  1WRK A;  2LLT A;  4P5O E;  4IL1 A;  4XJK A;  2LAN A;  1CNP A;  2LHI A;  1IH0 A;  2BCA A;  1SR6 C;  4DS7 A;  5F6T A;  4YGA A;  4PHJ A;  1K94 A;  4A4B A;  2E6W A;  2O60 A;  1A2X A;  1ODB A;  2M1U A;  4JQ0 D;  4DUQ A;  1CMF A;  3DVE A;  2CNP A;  1NIW A;  2ZN8 A;  1FF1 A;  1N65 A;  2H2K A;  1QX7 A;  3CS1 A;  1AHR A;  4GAO A;  1WDC C;  4M2P A;  2F3Y A;  4D1E A;  1KK8 B;  3BOW A;  2LVK A;  2L0P A;  4MZJ A;  2FOT A;  3VRQ A;  5BPJ A;  3TUY C;  2JOJ A;  1AJ4 A;  2KYC A;  2JC2 A;  2M7L A;  1JSA A;  4XJK B;  1DMO A;  1Q80 A;  1WLZ A;  3I5I B;  1JF0 A;  5HLV A;  1CDN A;  1QJT A;  1J55 A;  3O4Y A;  1TNQ A;  4PE7 A;  4AOM A;  3OX6 A;  2K2A A;  1QS7 A;  2KHN A;  1BG1 A;  1EJ3 A;  2F8P A;  1JBA A;  1S26 D;  1F70 A;  4NDD A;  3BOW B;  2LUC A;  1H4B A;  2KQ6 A;  2PRU A;  1UUR A;  1OQP A;  1S1E A;  1Y6W A;  2IS9 A;  3FWB A;  1BOD A;  2JTZ A;  1F8H A;  1K8U A;  3BYA A;  1Y1U A;  3O2P A;  2G9B A;  4C0J A;  1IKU A;  2WOS A;  1PRW A;  2I7A A;  5I8N A;  2CT9 A;  2ZNE A;  4ICB A;  4DRW A;  4PAL A;  2JUL A;  1SMG A;  3DVJ A;  4M2Q A;  3SG2 A;  3C1V A;  1AK8 A;  1XFU O;  2M7N A;  3EKH A;  3TUY B;  1B8C A;  1MF8 B;  2HQ8 A;  1YX7 A;  2K0J A;  4XYN A;  1V1F A;  5IBW A;  2KDH A;  1R2U A;  1XA5 A;  3RLZ A;  3AKB A;  5AEQ A;  3VRP A;  2OTG C;  2M9G A;  1M45 A;  5J3X A;  1AUI B;  2Q91 A;  2CXJ A;  1L7Z A;  4ETO A;  3DF0 B;  2JRF A;  1L2O C;  4PE1 A;  1DJW A;  3MSE B;  2MAZ A;  4GGF C;  2BE4 A;  3PLF B;  1QIW A;  4MN0 A;  1PUL A;  1DGU A;  1OOJ A;  1B47 A;  1NX0 A;  4WQ2 A;  2I2R E;  1F4O A;  2QPT A;  4UPG A;  4FTG A;  2MA2 A;  3DVM A;  1SKT A;  3IQO A;  1CLB A;  1JUO A;  2BBN A;  1BR4 B;  1TNW A;  3EK8 A;  4YI9 A;  2P6B B;  1RRO A;  4Q04 A;  2WCE A;  4GGF A;  1J7R A;  2CBL A;  3CZT X;  4BY4 A;  1G8I A;  3GK4 X;  3SG4 A;  1DT7 B;  3A8R A;  2LE9 B;  1PK0 D;  4GUK A;  1B1G A;  1B4C A;  1PAL A;  2BE6 A;  5DKR A;  2L50 A;  4AQI A;  5AFP A;  5B8I B;  1MR8 A;  3CR4 X;  1CFF A;  1DTL A;  1C7V A;  3OHM B;  1WLM A;  1M39 A;  1IRJ A;  3SIB A;  1GJY A;  3KO0 A;  3VRO A;  1MUX A;  1TTX A;  2KGB C;  2OTG B;  1KQV A;  1E8A A;  3A4U B;  1XFZ O;  5KSZ A;  1J7P A;  2ZFD A;  3BXK A;  2BL0 C;  2WCF A;  1DF0 B;  3CR2 A;  2EGD A;  4PDZ A;  1F71 A;  1L2O B;  1CFP A;  1KK8 C;  1YUU A;  1NWD A;  2EC6 B;  2F2P A;  2K7C A;  1UHJ A;  5KTY A;  1OMV A;  2RGI A;  1C7W A;  4HRE E;  5CSI A;  4HSZ A;  1R6P A;  1NUB A;  1QLS A;  4CFR A;  3ZNI A;  1WRZ A;  4OVN F;  3I5I C;  3KPX A;  2JNF A;  1LKJ A;  5I2Q A;  1QX2 A;  3D10 A;  1DJX A;  2CTN A;  3AKA A;  2AAO A;  1H8B A;  3BUO B;  2B1U A;  1PVB A;  2D8N A;  2LVJ A;  4YI8 A;  2LAP A;  2MJW B;  5I2O A;  4BY5 A;  3HCM A;  4CID A;  1OMR A;  1OZS A;  1K9U A;  1XYD A;  1IJ5 A;  4I5J A;  1KQM B;  3OP0 A;  1OE9 B;  1CM1 A;  1VRK A;  3O78 A;  1KWO C;  2Q4U A;  1TCO B;  2M97 A;  4CPV A;  2Y1N A;  2KFH A;  4OKH A;  2LP2 A;  4WQ3 A;  2M29 A;  4PE0 A;  4YGB B;  3BUN B;  1B9A A;  4ORA B;  5DKQ A;  1BJF A;  3O6B A;  2AMI A;  2BL0 B;  2PVB A;  4ORB B;  1ZMZ A;  4N5X A;  1IQ5 A;  2AUC A;  2JXC A;  4OCI A;  2JU0 A;  1UUS A;  4NDB A;  3KEV A;  2LMT A;  2LCP A;  4MZK A;  3WHT B;  1LVC D;  3AAJ A;  3F45 A;  1BU3 A;  1ALW A;  1WY9 A;  3GOF A;  1A4P A;  2JT8 A;  1KCY A;  5TNC A;  2BCB A;  1KFU L;  3D0Y A;  3BUW B;  1TRF A;  4FQO A;  3CR5 X;  3CWG A;  4USL A;  2KQY A;  5CSN A;  3BUM B;  1S6I A;  3PAT A;  1D1O A;  2I94 A;  3M0W A;  1B8R A;  2KAV A;  3SG7 A;  4ZCU A;  3SIA A;  2SCP A;  5CSF A;  1WRL A;  1AVS A;  1KWO B;  1LIN A;  3DF0 A;  1TNX A;  4MRY A;  1TN4 A;  5I2L A;  1SL9 A;  5AXI A;  1YUS A;  1LXF C;  5K89 A;  2KNE A;  1DJZ A;  2MLE C;  4GFT A;  2NCO A;  5AAN A;  3TDZ A;  2PMY A;  3D0Y B;  1ALV A;  2WOR A;  3WHU B;  1S5G Z;  2LMV A;  2EHB A;  1CM4 A;  3I5G C;  1BF5 A;  1TOP A;  1B7T Z;  3NSI A;  2JNX A;  3K21 A;  1JC2 A;  1NX3 A;  3PM8 A;  1EG4 A;  2ZND A;  3OB2 B;  3OX5 A;  2KAX A;  4I5L B;  1BR1 B;  1NYA A;  1A75 A;  2NXQ A;  2HPS A;  1RTP 1;  4R1E A;  1YRT B;  1N2D A;  1UP5 A;  1K9P A;  3PAL A;  2I18 A;  1AJ5 A;  1XFX O;  2EC6 C;  2LHL A;  1KSM A;  4YBH B;  2JT0 A;  1NX2 A;  1J7Q A;  2Y5I A;  2WC8 A;  4U8D A;  2KBI A;  1NCZ A;  1PSB A;  4P2Y B;  2F33 A;  2OS8 C;  2KBM A;  1DJY A;  4OV2 A;  1W7J B;  4PHK A;  4ZCV A;  2PAS A;  2BKH B;  5HKY A;  1K2H A;  1EXR A;  1ZFS A;  1DF0 A;  1QV1 A;  1SCV A;  1A29 A;  4PHM A;  4CFQ A;  2FCD A;  1IJ6 A;  1A75 B;  1EG3 A;  1QAT A;  1PVA A;  3NSL A;  4I5N B;  2ZN9 A;  3FIA A;  4GPL B;  4DIR A;  2HQW A;  1NX1 A;  1KQM C;  4JWQ A;  1SW8 A;  2L5X B;  3H4S E;  3DD4 A;  3I5G B;  4QJ4 B;  2KFG A;  1KFX L;  1Y0V H;  1QTX A;  1S5G Y;  3KF9 A;  1RJV A;  1K96 A;  1B7T Y;  1FW4 A;  1FI5 A;  3TZ1 A;  3JTD C;  1S6J A;  2LLU A;  2LP3 A;  1G4Y R;  3DVK A;  5JOL A;  1YRU B;  3VRN A;  1XFY O;  1LA0 A;  1JWD A;  1SL7 A;  5G08 A;  1K90 D;  2JZI A;  2L51 A;  1OZO A;  1TCF A;  1GGW A;  2M1K B;  2OS8 B;  3TDI A;  2G2B A;  2LLS A;  1YVL A;  3ICB A;  2PAL A;  3TDU A;  1TIZ A;  2FJU B;  1DVI A;  3PFV A;  2BBM A;  2M3W A;  2ZRS A;  1YX8 A;  4MLW A;  1RK9 A;  2KYF A;  1M31 A;  1RFJ A;  2SAS A;  5HYD A;  1X02 A;  2KOT A;  1ZUZ A;  4NDC A;  1B8L A;  1MQ1 A;  1NCX A;  4ORC B;  4PCW A;  1DJG A;  3LK0 A;  1SPY A;  2MBX A;  2L4I A;  4MBE A;  5KU1 A;  3AAK A;  1SRA A;  3LLE A;  1CTR A;  3EVU A;  1BLQ A;  1J1E A;  3BQ3 A;  1YUT A;  3EK7 A;  3PN7 B;  3FS7 A;  5D7F A;  3VRR A;  3JTD B;  5ER5 A;  1PSR A;  4PHN A;  5D69 A;  3NXA A;  4N1G A;  1K95 A;  1M63 B;  1FI6 A;  1YVH A;  4JPZ B;  1UWO A;  3SG6 A;  1CDM A;  1UHN A;  1CLL A;  1MXL C;  1JF2 A;  1UHK A;  2JTT A;  2ZRT A;  1KK7 Z;  3WXA A;  1SNL A;  1SK6 D;  2KI6 C;  1ZAC A;  3BUX B;  1UHI A;  1ZOT B;  2MRD A;  2V53 A;  2GGZ A;  2K8M B;  2K7O A;  4MZL A;  1BMO A;  4QJ5 B;  2KI6 D;  2M0R A;  1CLM A;  1J1D A;  5CPV A;  2F2O A;  1QAS A;  2K2F A;  3E3R A;  2NLN A;  1SL8 A;  1EL4 A;  1JFK A;  1IG5 A;  2BCX A;  4YGD B;  3GK1 A;  4PE4 A;  3IF7 A;  4CLN A;  1CDP A;  3NSK A;  2GV5 A;  1G33 A;  2KI4 C;  2Y4Q A;  3LK1 A;  1K93 D;  3TS5 B;  5HKZ A;  2H61 C;  1SCM B;  3GK2 A;  2A4J A;  3JVT B;  1Y1X A;  1OSA A;  1QVI Z;  1GQM A;  1BOC A;  4WRI A;  2JXL A;  1KSO A;  1XFW O;  5AER A;  1MXE A;  2L4H A;  3EK4 A;  2LUX A;  5JJG A;  3NSO A;  2PSR A;  3PSR A;  4QJ3 B;  1KFU S;  2H61 A;  2COL B;  3I5H C;  1KK7 Y;  1SR6 B;  2L2E A;  2JQ6 A;  4E68 A;  2LVI A;  2WND A;  4TNC A;  2R2I A;  2Y1M A;  1EH2 A;  3RM1 A;  2LC5 A;  1SYM A;  3OB1 B;  1UHH A;  1FPW A;  4MRX A;  2NZ0 A;  1NCY A;  1OMD A;  1RWY A;  2KAY A;  3ZWH A;  1M46 A;  1CMG A;  1SY9 A;  1WDC B;  2BKI B;  2DOQ A;  4AQJ A;  4MVF A;  2NCP A;  4YGE B;  2ISD A;  4YRU A;  2JPT A;  2M49 B;  1S36 A;  2TN4 A;  3CLN A;  1FBV A;  1HT9 A;  2KI4 B;  1MHO A;  4GGN A;  5HKW A;  1XVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...