1RTP1

Refined x-ray structure of rat parvalbumin, a mammalian alpha-lineage parvalbumin, at 2.0 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-PARVALBUMIN
publication title Refined crystal structure of rat parvalbumin, a mammalian alpha-lineage parvalbumin, at 2.0 A resolution.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Calcium-binding protein
total genus 42
structure length 109
sequence length 109
chains with identical sequence 2, 3
ec nomenclature
pdb deposition date 1993-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1rtp100
1YR5A 5DKQA 3EVVA 1YVLA 3OHMB 2FCEA 3GK2A 2E30A 1NX0A 2OS8C 3CR2A 4XJKA 1IQ3A 5AEQA 5KU1A 1NWDA 2K7DA 1U5IA 4JQ0D 1MXLC 4MRYA 1TRFA 2KNEA 4C0JA 2LMTA 2NZ0A 3I5FC 1F70A 1S5GY 1UHJA 1IGVA 1SPYA 1K8UA 2HPSA 3EK8A 4WQ3A 2F33A 4MEWA 3EK4A 4N1GA 2MAZA 1V1FA 1BMOA 3PALA 1BG1A 2Y4QA 4ZCVA 3AKBA 1KK8B 1G33A 1NYAA 4PHMA 1JF2A 1RTP1 1PALA 1C07A 3ZNIA 2CTNA 2LAPA 1NSHA 5J3XA 1CFDA 2M7LA 3BYAA 1IQ5A 1WY9A 2M9GA 3IF7A 1OZOA 1RJVA 3FIAA 2JQ6A 5JOLA 4ORAB 5CPVA 3WXAA 1F4OA 1ODBA 5DKNA 3GK1A 1KSMA 5HKZA 3TDIA 1XK4C 1DF0B 4P5OE 4BY5A 2JXLA 2JNXA 1M31A 1B47A 3IQOA 4I5KA 1YRUB 3CR4X 3O6BA 4PCWA 2BL0B 5HLVA 1R2UA 3PN7B 5HKYA 4I5NB 1Q80A 4MBEA 3I5HC 1J7PA 1F4QA 3QRXA 2K2AA 3BQ3A 2CBLA 3SG3A 4YGDB 4N1FA 3H4SE 3OB2B 3OP0A 3AAKA 3GOFA 2EC6B 2WOSA 3NXAA 4PDZA 1KFUL 2JT3A 2KOTA 3BUWB 4MZJA 1DJWA 4R1EA 1YUSA 1S6CA 1KWOB 3RM1A 1CDNA 1QVIZ 1DGUA 1JFJA 1XA5A 2LMUA 1CDMA 2M29A 1FI6A 2K0JA 2L4HA 2L5XB 2LE9B 2LP2A 1EG4A 3DVMA 4MSPA 3I5GB 1QS7A 1TN4A 1KQVA 1WRKA 5HKWA 2MBXA 1K90D 3EVRA 4GBAA 5CSJA 1IKUA 2SASA 1CNPA 2BE4A 5I2QA 3EVUA 4PE4A 2CCMA 3EKHA 2O60A 5AANA 2CXJA 2BCXA 2L51A 5I2LA 1EG3A 4PALA 4MRXA 2BKHB 2BL0C 4GAOA 4F0ZB 5HYDA 1KSOA 1KFXS 1L7ZA 2M7NA 1QX5B 2ISDA 5KSZA 4E68A 1YURA 1B8CA 1FPWA 1HT9A 1XFZO 1J1EA 2VRGA 2JZIA 1A29A 2V53A 1DJZA 4MVFA 2KGBC 4JWQA 1CB1A 4M2OA 2QPTA 3AKAA 2EC6C 1BLQA 1MR8A 1S6JA 4OVNF 1KCYA 4WQ2A 3HX4A 2M97A 2KGRA 1KWOC 1JBAA 3OB1B 1N65A 2KAVA 1MUXA 2CT9A 2O5GA 3A4UB 1RWYA 3SG6A 1FI5A 2ZRTA 2KQ6A 1CLMA 4CPVA 2DOQA 1ZUZA 3I5GC 2HQWA 2JC2A 1MQ1A 1QJTA 4QJ3B 3BUNB 1PVAA 1KK7Y 3DF0B 3D0YB 3NSKA 4PHNA 1F71A 1RFJA 1BU3A 1BJFA 2JULA 4MZLA 4CFQA 2LC5A 1FBVA 3KO0A 2LMVA 4QJ5B 5IBWA 1MF8B 3KF9A 4A4BA 5AERA 4DS7A 1QXPA 4PHJA 1SR6B 2RGIA 4C0KA 1F54A 1JC2A 4ORBB 1S26D 4DUQA 1PSBA 2GGZA 2PRUA 1BR4B 2LHLA 1NCZA 1XFUO 2KHNA 3DVKA 2JTTA 2KYFA 1CDLA 3ZWHA 1ZMZA 2FJUB 2JT8A 3ICBA 4WRIA 4GFTA 1J1DA 1AHRA 1M45A 2KSPA 4JPZB 2KI6D 1IJ6A 1QLSA 1RROA 5I8NA 1UHKA 4XYNA 2D8NA 5FYXA 3BXKA 1KFXL 2MLEC 2ZKMX 4OV2A 1NX3A 3BOWB 1GGWA 1PK0D 2G9BA 1UHNA 2AUCA 1GQMA 2BE6A 1R6PA 3PATA 1XVJA 2ZNEA 1J55A 4ICBA 3TS5B 3JVTB 1W7IB 3GK4X 1A4PA 1SK6D 3BUXB 5HLOA 1BOCA 1K9PA 2K2FA 2JU0A 2Y5IA 1SR6C 3CGAA 3I5IB 1TNXA 4I5JA 4NQGA 1A75B 4PE7A 4C0LA 1S1EA 3SG5A 5F6TA 1YX8A 1N0YA 2E6WA 2GV5A 3WHTB 2WNDA 1NCYA 4GUKA 1CTRA 1SCMB 2JOJA 1Y1AA 2KBIA 3WNXB 1B9AA 3WHUB 1G4YR 2KYCA 2PSRA 1JUOA 1UP5A 1DJIA 1QV1A 1B8LA 2HQ8A 2LHIA 2LLTA 2LVJA 4PE0A 5ER5A 1PRWA 2F3YA 1G8IA 1LA3A 2L98A 3CTNA 5B8IB 1PVBA 1OOJA 1PULA 1OMVA 1LA0A 4MLWA 1B7TZ 1B8RA 3FWBA 1KK8C 3RLZA 2LUXA 3SG4A 1SNLA 2KQYA 2M8UA 1DTLA 1DMOA 1EJ3A 1H4BA 4U8DA 1XFVO 2AMIA 2M49B 1SY9A 1N2DA 3TZ1A 1K96A 2I7AA 2LP3A 3F45A 3JVTC 3O4YA 3TS5C 4AOMA 1PSRA 2K8MB 2KFGA 1RECA 1CFPA 1BF5A 1H8BA 4GGNA 3O2PA 4HRHA 3I5IC 1DJXA 4DCKA 2MLFC 3E3RA 1UUSA 2AAOA 4I5LB 1K9UA 1K93D 1OMRA 2PASA 1YTZC 1SYMA 1C7WA 1SCMC 1XFWO 2H2KA 3PN7C 4YI8A 3OX6A 1TTXA 2H61C 1WRLA 1NUBA 1SL9A 1JF0A 1K2HA 3KHEA 4YBHB 1QVIY 4ORCB 2Y1MA 2OPOA 1DT7B 2R2IA 1CFFA 4GPLB 1BR1B 1DF0A 1QX2A 3CZTX 1K94A 4XJKB 1U5IB 5DKRA 2BCAA 3LK0A 2COLB 3VROA 1OZSA 2GGMA 2QACA 2LNKA 2L2EA 5GQQC 1E8AA 2LM5A 1DVIA 1M39A 2KAYA 3KEVA 3SIBA 1QASA 1W7JB 1ZFSA 2L50A 1LKJA 3BUMB 3PFVA 2TN4A 1MXEA 1HQVA 2JTZA 2ZN9A 1D1OA 1AUIB 3PLFB 2KI4B 3IQQA 2WCFA 1VRKA 3CR5X 3JTDB 3LK1A 1ZACA 2JT0A 3FS7A 1GGZA 2WCEA 2F2OA 3VRNA 5JJGA 2OTGB 3CS1A 1Y1XA 1F8HA 2NCOA 2SCPA 5K89A 1TNQA 2KBMA 1Y6WA 1B1GA 4N5XA 1FF1A 1J7RA 3SJSA 1QATA 1CDPA 2NXQA 3CWGA 1JFKA 1K95A 2MHHA 4DIRA 2WORA 2JXCA 1XFYO 3NSLA 1IRJA 5G08A 1S5GZ 2KI6C 4GGFA 1AK8A 1TCFA 3OX5A 4P2YB 3VGOA 4AQJA 4YGBB 5AFPA 4FTGA 3VRQA 1ALWA 2I2RE 4MN0A 2LLSA 1TNPA 4QJ4B 1OE9B 2MRDA 1QX7A 4PE1A 4D1EA 3CLNA 3FWCA 1Y0VH 1JWDA 3M0WA 4NDBA 1NX2A 1M46A 4CFRA 2KI4C 2K61A 3I5HB 1SBJA 1UWOA 2BBMA 1CM1A 3JTDC 4HREE 1J7OA 4BY4A 2F2PA 1YX7A 2M1KB 2OTGC 2ZNDA 1XFXO 1OQPA 2FCDA 1AJ4A 2KAXA 2KDHA 1S6IA 1UURA 1NIWA 2M1UA 1M63B 2EHBA 4AQIA 1CM4A 1AP4A 1Y1UA 2LV7A 2JRFA 2LVVA 3DF0A 3SG7A 3D0YA 3DVEA 3TUYB 1JSAA 2F8PA 1X02A 2Y1NA 4FQOA 4NDDA 2LVIA 3LL8B 4ZCUA 1IH0A 4M2QA 1QTXA 2K7OA 1NCXA 1UHHA 1YRTB 1KQMB 2LLUA 1XK4A 2EGDA 1TIZA 1SL8A 3PSRA 1YVHA 3DD4A 4PHKA 2IS9A 4IL1A 4OR9B 2BCBA 1J7QA 1TNWA 3LCPC 1WDCB 1ZOTB 3EKJA 2NLNA 1DJYA 1OMDA 1SCVA 2FOTA 1IJ5A 3C1VA 2F3ZA 1DGVA 3BOWA 1RK9A 1WRZA 4YGEB 2G2BA 2LUCA 2Q4UA 1FW4A 3TUYC 1F55A 1GJYA 1L2OB 1XYDA 1S36A 4Q04A 2JNFA 1B7TY 2WC8A 4L9MA 1NPQA 2HETA 2PMYA 2Q91A 2WCBA 5PALA 4CIDA 1SKTA 1NX1A 1SL7A 2BKIB 4HRGA 1LXFC 4TNCA 3VRPA 2L0PA 3EK7A 1EL4A 1K9KA 1YUTA 1QV0A 1KQMC 5AXIA 4GNKB 2LANA 1A75A 2B1UA 4OCIA 1TOPA 3NSOA 2JPTA 4YI9A 2L4IA 3VRRA 5CSIA 2MJWB 3SG2A 4CLNA 1EH2A 2I18A 2NCPA 4NDCA 2LCPA 1XO5A 2LVKA 3DVJA 2H61A 1SRAA 1S3PA 2CNPA 1SW8A 1CMFA 2MA2A 1CMGA 1WDCC 5CSNA 5D7FA 1KK7Z 2JWWA 4DRWA 1YUUA 5TNCA 4UPGA 2A4JA 3I5FB 1BODA 1AJ5A 1CKKA 4YGCB 1IG5A 5BPJA 3A8RA 1AVSA 5KTYA 2BECA 2ZFDA 1CFCA 3D10A 4ETOA 2OS8B 1LINA 1A03A 1SMGA 1BT6A 3HCMA 3TDUA 1C7VA 4MZKA 3O78A 2M3WA 1V1GA 1QIWA 2P6BB 1L2OC 3BUOB 5D69A 1IWQA 2M0RA 4A4CA 4YRUA 1B4CA 3K21A 2HF5A 1LVCD 1EXRA 3PM8A 5CSFA 1TCOB 5ER4X 2K7BA 3KPXA 4YGAA 3MSEB 2ZN8A 3AAJA 4M2PA 3TDZA 4HSZA 2PALA 2K7CA 4OKHA 3SIAA 2KFFA 1DJGA 1NP8A 1OSAA 1MHOA 1MWNA 4USLA 2KFHA 2I94A 1ALVA 1QLKA 5I2OA 2PVBA 4GGFC 2BBNA 1QIVA 1CLLA 1DJHA 3LLEA 1A2XA 1UHIA 1KFUS 1CLBA 1WLMA 2ZRSA 3NSIA 1WLZA
chains in the Genus database with same CATH superfamily
1YR5A 5DKQA 3EVVA 1YVLA 3OHMB 2FCEA 3GK2A 2E30A 1NX0A 2OS8C 3CR2A 4XJKA 3PM2A 5AEQA 1IQ3A 5KU1A 1NWDA 2K7DA 1U5IA 4JQ0D 1MXLC 4MRYA 1TRFA 2KNEA 4C0JA 2LMTA 2NZ0A 4F7FA 3I5FC 1OOFA 1F70A 3D77A 1S5GY 1UHJA 1IGVA 1SPYA 1K8UA 2HPSA 3EK8A 4WQ3A 2F33A 4MEWA 3EK4A 3O4XA 4N1GA 2MAZA 1V1FA 1BMOA 3PALA 1BG1A 2Y4QA 4ZCVA 3AKBA 1KK8B 1G33A 1NYAA 4PHMA 1JF2A 1RTP1 1PALA 1C07A 3ZNIA 2CTNA 2LAPA 3K1EA 1NSHA 5J3XA 1CFDA 2M7LA 3BYAA 1IQ5A 1WY9A 2M9GA 3BFAA 1OZOA 1RJVA 3FIAA 3IF7A 2JQ6A 5JOLA 4ORAB 5CPVA 1C3YA 3D75A 3WXAA 1F4OA 1ODBA 4JD9A 5DKNA 3GK1A 1KSMA 5HKZA 3TDIA 1XK4C 3NHIA 1DF0B 4P5OE 2QEOA 4BY5A 2JXLA 2P71A 2JNXA 1M31A 1B47A 2ERBA 3IQOA 4I5KA 1YRUB 3CR4X 3O6BA 4PCWA 2BL0B 5HLVA 1R2UA 3PN7B 1C3ZA 4I5NB 5HKYA 3OBVA 1Q80A 4MBEA 3I5HC 1J7PA 1F4QA 3QRXA 2K2AA 3BQ3A 2CBLA 3SG3A 4YGDB 4N1FA 3H4SE 3OB2B 3S0EA 3OP0A 5I94A 3AAKA 3GOFA 2EC6B 2WOSA 3NXAA 4PDZA 1KFUL 2JT3A 2KOTA 3BUWB 3S0GA 4MZJA 1DJWA 4R1EA 1YUSA 1S6CA 2YGUA 1KWOB 3RM1A 1CDNA 3L4LA 1QVIZ 1DGUA 2BNXA 1XA5A 2LMUA 1JFJA 1CDMA 2M29A 1Z2CB 1FI6A 2K0JA 2L4HA 2L5XB 2LE9B 2LP2A 1EG4A 3DVMA 4MSPA 3I5GB 1QS7A 1TN4A 1KQVA 1WRKA 5HKWA 2MBXA 1K90D 3EVRA 4GBAA 5CSJA 1IKUA 2SASA 1CNPA 2BE4A 5I2QA 3EVUA 4KYNA 4PE4A 2CCMA 3EKHA 2O60A 5AANA 2CXJA 2BCXA 2L51A 5I2LA 1EG3A 2KLEA 4PALA 4MRXA 2BKHB 2BL0C 3R1VA 4GAOA 4F0ZB 5HYDA 2WCKA 1KSOA 1KFXS 1L7ZA 2M7NA 1QX5B 2ISDA 3SS5A 5KSZA 1YURA 1B8CA 3BFHA 1HT9A 1XFZO 4E68A 1J1EA 2VRGA 2JZIA 1A29A 2V53A 4PT1A 1DJZA 1TUZA 4MVFA 2KGBC 1LS8A 4JWQA 1CB1A 4M2OA 2QPTA 3AKAA 2BAPA 2EC6C 3D73A 3NHTA 1BLQA 3CABA 1MR8A 1S6JA 4OVNF 1KCYA 4WQ2A 1SSEB 3HX4A 2M97A 2KGRA 1KWOC 1JBAA 3OB1B 1N65A 2KAVA 1MUXA 2CT9A 2O5GA 3A4UB 1RWYA 3SG6A 2WCMA 1FI5A 2ZRTA 2KQ6A 1CLMA 4CPVA 5FI2A 1XFRA 1ZUZA 2DOQA 3CZ0A 3I5GC 2HQWA 2JC2A 1MQ1A 1QJTA 4QJ3B 3BUNB 1PVAA 1KK7Y 3DF0B 3D0YB 3NSKA 4PHNA 1F71A 1RFJA 1BU3A 1BJFA 2JULA 4MZLA 4CFQA 2QEHA 2LC5A 1FPWA 1FBVA 3KO0A 3B7AA 2LMVA 4QJ5B 3SS4A 3IVTA 5IBWA 1MF8B 3CZ2A 3KF9A 4A4BA 5AERA 4DS7A 1QXPA 4PHJA 5DICA 1SR6B 2RGIA 4C0KA 1F54A 1JC2A 4ORBB 1S26D 4DUQA 3D76A 1PSBA 2GGZA 2PRUA 1BR4B 2LHLA 1NCZA 1XFUO 2KHNA 3B6XA 3DVKA 2JTTA 2KYFA 1CDLA 5EL2A 3ZWHA 1ZMZA 2FJUB 2JT8A 3ICBA 4WRIA 4GFTA 1J1DA 1AHRA 1M45A 2KSPA 4JPZB 2KI6D 1IJ6A 1QLSA 1RROA 5I8NA 1UHKA 3CZ1A 4XYNA 2D8NA 5FYXA 3BXKA 1KFXL 2MLEC 2ZKMX 4OV2A 5D3OA 2KLDA 1NX3A 3BOWB 1GGWA 1PK0D 2G9BA 1UHNA 2AUCA 1GQMA 2BE6A 1R6PA 3PATA 1XVJA 2ZNEA 1J55A 4ICBA 4OZDA 3JVTB 1W7IB 3TS5B 1T14A 2FJYA 3GK4X 1A4PA 1SK6D 3BUXB 5HLOA 1BOCA 1K9PA 2K2FA 2JU0A 2Y5IA 1SR6C 3CGAA 3I5IB 1TNXA 4I5JA 4NQGA 1A75B 4PE7A 4C0LA 3L4AA 1S1EA 3SG5A 5F6TA 1YX8A 1N0YA 2E6WA 2GV5A 3WHTB 2WNDA 1OW4A 1NCYA 4GUKA 1CTRA 1SCMB 2JOJA 1Y1AA 2KBIA 3WNXB 1B9AA 3WHUB 1G4YR 2WCHA 2KYCA 2PSRA 1JUOA 5FI7A 1UP5A 1DJIA 1QV1A 1B8LA 2HQ8A 2LHIA 2LLTA 2LVJA 4PE0A 5ER5A 3CDNA 1PRWA 2F3YA 3SS3A 1G8IA 1LA3A 2L98A 2WCLA 3CTNA 5B8IB 1PVBA 1OOJA 1PULA 1OMVA 3BFBA 1LA0A 4MLWA 1B7TZ 1B8RA 3FWBA 1KK8C 3RLZA 2LUXA 3SG4A 1SNLA 2KQYA 2M8UA 1DTLA 1DMOA 1EJ3A 1H4BA 4U8DA 1XFVO 2AMIA 2M49B 1SY9A 1N2DA 3TZ1A 1K96A 2I7AA 2LP3A 3F45A 3JVTC 3O4YA 3TS5C 4AOMA 1PSRA 3R1PA 2K8MB 2KFGA 1RECA 1CFPA 1BF5A 1H8BA 4GGNA 3O2PA 4FQTA 4HRHA 2K60A 3I5IC 1DJXA 4DCKA 2MLFC 3E3RA 1UUSA 2AAOA 4I5LB 1K9UA 1K93D 1OMRA 2PASA 1YTZC 1SYMA 1C7WA 1SCMC 1XFWO 2H2KA 3PN7C 4YI8A 3S0FA 3OX6A 1TTXA 2H61C 1WRLA 2QEBA 1NUBA 1SL9A 3OGNA 1JF0A 1K2HA 3KHEA 4YBHB 3FE6A 3S0BA 1QVIY 3NGVA 4ORCB 2Y1MA 2OPOA 1DT7B 2KPHA 2R2IA 1CFFA 4GPLB 1BR1B 1DF0A 1QX2A 3CZTX 1K94A 4XJKB 1U5IB 5DKRA 2BCAA 3LK0A 2COLB 3VROA 2JPOA 1OZSA 2GGMA 2QACA 2LNKA 2L2EA 5GQQC 1E8AA 2LM5A 1DVIA 1M39A 2KAYA 3KEVA 3SIBA 1QASA 1W7JB 1ZFSA 2WC6A 2L50A 1LKJA 3B88A 3BUMB 2QEVA 2TN4A 3BJHA 3PFVA 2GTEA 1MXEA 1HQVA 2JTZA 2ZN9A 1D1OA 1AUIB 3PLFB 2KI4B 3IQQA 2WCFA 1VRKA 3DY9A 2PQLA 3CR5X 3JTDB 3LK1A 3V2LA 1ZACA 2JT0A 3FS7A 1GGZA 2WCEA 2F2OA 3VRNA 5JJGA 2OTGB 3CS1A 1Y1XA 1F8HA 2NCOA 2SCPA 5K89A 1TNQA 2KBMA 1Y6WA 1B1GA 4N5XA 3D74A 1FF1A 1J7RA 3DXLA 3SJSA 1QATA 1CDPA 2NXQA 3CWGA 1JFKA 1K95A 2MHHA 4DIRA 2WORA 2JXCA 1XFYO 3NSLA 1IRJA 4INXA 5G08A 2H8VA 1S5GZ 2KI6C 4GGFA 1AK8A 1TCFA 3OX5A 4P2YB 3EG5B 3VGOA 4AQJA 4YGBB 5AFPA 2QDIA 4FTGA 3VRQA 1ALWA 2I2RE 4MN0A 2LLSA 1TNPA 4QJ4B 1OE9B 3L47A 2MRDA 1QX7A 4PE1A 4D1EA 3CLNA 3FWCA 1Y0VH 1JWDA 3M0WA 4NDBA 3DYEA 1NX2A 1M46A 4CFRA 2KI4C 2K61A 3I5HB 1SBJA 1UWOA 2BBMA 1CM1A 3JTDC 4HREE 1J7OA 4BY4A 2F2PA 1YX7A 2M1KB 2OTGC 2ZNDA 1XFXO 1OQPA 2FCDA 4JKTA 1AJ4A 2KAXA 2KDHA 1S6IA 1UURA 1NIWA 2M1UA 1M63B 2EHBA 4AQIA 1CM4A 1AP4A 1Y1UA 2LV7A 2JRFA 2LVVA 3DF0A 3SG7A 3S0AA 3D0YA 3DVEA 3TUYB 1JSAA 2F8PA 1X02A 2Y1NA 4FQOA 4NDDA 3D78A 2LVIA 3LL8B 4ZCUA 1IH0A 4M2QA 1P28A 1QTXA 2K7OA 1NCXA 1UHHA 1YRTB 1KQMB 2LLUA 1XK4A 2EGDA 1TIZA 5FI6A 3CYZA 1SL8A 3PSRA 1YVHA 3R72A 2WCJA 3DD4A 4PHKA 2IS9A 4IL1A 4OR9B 2BCBA 1TUJA 1J7QA 1TNWA 3LCPC 1WDCB 1DELA 1ZOTB 1OOHA 3EKJA 2NLNA 1DJYA 1OMDA 1SCVA 2FOTA 1IJ5A 2P70A 2F3ZA 3C1VA 1DGVA 1OOGA 3BOWA 1RK9A 1WRZA 4YGEB 1IIOA 2G2BA 2LUCA 2Q4UA 1FW4A 3TUYC 3FE9A 1GJYA 1F55A 1L2OB 3S0DA 1XYDA 1S36A 4Q04A 3B87A 2JNFA 1B7TY 2WC8A 4L9MA 1NPQA 2HETA 2PMYA 2Q91A 2WCBA 3DZTA 5PALA 4CIDA 1DEKA 1SKTA 1NX1A 1SL7A 2BKIB 4HRGA 1LXFC 4TNCA 3VRPA 2L0PA 3EK7A 1EL4A 1K9KA 1YUTA 1QV0A 3RZSA 1KQMC 5AXIA 4GNKB 2LANA 1A75A 2B1UA 4OCIA 1TOPA 3NSOA 2JPTA 4YI9A 2L4IA 3VRRA 5CSIA 2MJWB 3SG2A 1Z4HA 1GM0A 1TWOA 4CLNA 1W9ZA 1EH2A 2I18A 2NCPA 4NDCA 1DC1A 2LCPA 1XO5A 2LVKA 3DVJA 2H61A 1SRAA 1S3PA 2CNPA 1SW8A 1CMFA 2MA2A 1CMGA 1WDCC 5CSNA 5D7FA 1KK7Z 2JWWA 4DRWA 1YUUA 5TNCA 2L5YA 2A4JA 3I5FB 4UPGA 1AJ5A 1BODA 1CKKA 4YGCB 1IG5A 5BPJA 3A8RA 1AVSA 5KTYA 2BECA 2ZFDA 1CFCA 5HL1A 3D10A 3FE8A 4ETOA 2OS8B 1LINA 1A03A 1SMGA 1BT6A 3HCMA 1QWVA 3B86A 3TDUA 1C7VA 4MZKA 3O78A 2M3WA 1ORGA 1V1GA 1QIWA 2P6BB 3QMEA 1L2OC 3BUOB 5D69A 1IWQA 2M0RA 4A4CA 4YRUA 1B4CA 3K21A 2HF5A 3UNWA 1LVCD 3N7HA 2L2CA 1EXRA 3PM8A 3PJIA 5CSFA 3UO9A 1TCOB 5ER4X 2K7BA 3KPXA 4YGAA 3MSEB 2ZN8A 3AAJA 4M2PA 3TDZA 4HSZA 4IJ7A 2PALA 3VB1A 2K7CA 2PYQA 3Q8IA 4OKHA 3SIAA 2KFFA 1DJGA 1NP8A 1OSAA 1MHOA 1MWNA 4USLA 2KFHA 2I94A 1DQEA 1ALVA 1QLKA 5I2OA 2PVBA 4GGFC 2BBNA 1QIVA 4INWA 1CLLA 1DJHA 3LLEA 1A2XA 1OOIX 1UHIA 2WC5A 3R1OA 1KFUS 1CLBA 1WLMA 2ZRSA 3NSIA 1WLZA
chains in the Genus database with same CATH topology
1YR5A 5DKQA 3EVVA 1YVLA 3OHMB 2FCEA 3GK2A 2E30A 1NX0A 2OS8C 3CR2A 4XJKA 1IQ3A 5AEQA 5KU1A 1NWDA 2K7DA 1U5IA 4JQ0D 1MXLC 4MRYA 1TRFA 2KNEA 4C0JA 2LMTA 2NZ0A 3I5FC 1F70A 1S5GY 1UHJA 1IGVA 1SPYA 1K8UA 2HPSA 3EK8A 4WQ3A 2F33A 4MEWA 3EK4A 4N1GA 2MAZA 1V1FA 1BMOA 3PALA 1BG1A 2Y4QA 4ZCVA 3AKBA 1KK8B 1G33A 1NYAA 4PHMA 1JF2A 1RTP1 1PALA 1C07A 3ZNIA 2CTNA 2LAPA 1NSHA 5J3XA 1CFDA 2M7LA 3BYAA 1IQ5A 1WY9A 2M9GA 3IF7A 1OZOA 1RJVA 3FIAA 2JQ6A 5JOLA 4ORAB 5CPVA 3WXAA 1F4OA 1ODBA 5DKNA 3GK1A 1KSMA 5HKZA 3TDIA 1XK4C 1DF0B 4P5OE 4BY5A 2JXLA 2JNXA 1M31A 1B47A 3IQOA 4I5KA 1YRUB 3CR4X 3O6BA 4PCWA 2BL0B 5HLVA 1R2UA 3PN7B 5HKYA 4I5NB 1Q80A 4MBEA 3I5HC 1J7PA 1F4QA 3QRXA 2K2AA 3BQ3A 2CBLA 3SG3A 4YGDB 4N1FA 3H4SE 3OB2B 3OP0A 3AAKA 3GOFA 2EC6B 2WOSA 3NXAA 4PDZA 1KFUL 2JT3A 2KOTA 3BUWB 4MZJA 1DJWA 4R1EA 1YUSA 1S6CA 1KWOB 3RM1A 1CDNA 1QVIZ 1DGUA 1JFJA 1XA5A 2LMUA 1CDMA 2M29A 1FI6A 2K0JA 2L4HA 2L5XB 2LE9B 2LP2A 1EG4A 3DVMA 4MSPA 3I5GB 1QS7A 1TN4A 1KQVA 1WRKA 5HKWA 2MBXA 1K90D 3EVRA 4GBAA 5CSJA 1IKUA 2SASA 1CNPA 2BE4A 5I2QA 3EVUA 4PE4A 2CCMA 3EKHA 2O60A 5AANA 2CXJA 2BCXA 2L51A 5I2LA 1EG3A 4PALA 4MRXA 2BKHB 2BL0C 4GAOA 4F0ZB 5HYDA 1KSOA 1KFXS 1L7ZA 2M7NA 1QX5B 2ISDA 5KSZA 4E68A 1YURA 1B8CA 1FPWA 1HT9A 1XFZO 1J1EA 2VRGA 2JZIA 1A29A 2V53A 1DJZA 4MVFA 2KGBC 4JWQA 1CB1A 4M2OA 2QPTA 3AKAA 2EC6C 1BLQA 1MR8A 1S6JA 4OVNF 1KCYA 4WQ2A 3HX4A 2M97A 2KGRA 1KWOC 1JBAA 3OB1B 1N65A 2KAVA 1MUXA 2CT9A 2O5GA 3A4UB 1RWYA 3SG6A 1FI5A 2ZRTA 2KQ6A 1CLMA 4CPVA 2DOQA 1ZUZA 3I5GC 2HQWA 2JC2A 1MQ1A 1QJTA 4QJ3B 3BUNB 1PVAA 1KK7Y 3DF0B 3D0YB 3NSKA 4PHNA 1F71A 1RFJA 1BU3A 1BJFA 2JULA 4MZLA 4CFQA 2LC5A 1FBVA 3KO0A 2LMVA 4QJ5B 5IBWA 1MF8B 3KF9A 4A4BA 5AERA 4DS7A 1QXPA 4PHJA 1SR6B 2RGIA 4C0KA 1F54A 1JC2A 4ORBB 1S26D 4DUQA 1PSBA 2GGZA 2PRUA 1BR4B 2LHLA 1NCZA 1XFUO 2KHNA 3DVKA 2JTTA 2KYFA 1CDLA 3ZWHA 1ZMZA 2FJUB 2JT8A 3ICBA 4WRIA 4GFTA 1J1DA 1AHRA 1M45A 2KSPA 4JPZB 2KI6D 1IJ6A 1QLSA 1RROA 5I8NA 1UHKA 4XYNA 2D8NA 5FYXA 3BXKA 1KFXL 2MLEC 2ZKMX 4OV2A 1NX3A 3BOWB 1GGWA 1PK0D 2G9BA 1UHNA 2AUCA 1GQMA 2BE6A 1R6PA 3PATA 1XVJA 2ZNEA 1J55A 4ICBA 3TS5B 3JVTB 1W7IB 3GK4X 1A4PA 1SK6D 3BUXB 5HLOA 1BOCA 1K9PA 2K2FA 2JU0A 2Y5IA 1SR6C 3CGAA 3I5IB 1TNXA 4I5JA 4NQGA 1A75B 4PE7A 4C0LA 1S1EA 3SG5A 5F6TA 1YX8A 1N0YA 2E6WA 2GV5A 3WHTB 2WNDA 1NCYA 4GUKA 1CTRA 1SCMB 2JOJA 1Y1AA 2KBIA 3WNXB 1B9AA 3WHUB 1G4YR 2KYCA 2PSRA 1JUOA 1UP5A 1DJIA 1QV1A 1B8LA 2HQ8A 2LHIA 2LLTA 2LVJA 4PE0A 5ER5A 1PRWA 2F3YA 1G8IA 1LA3A 2L98A 3CTNA 5B8IB 1PVBA 1OOJA 1PULA 1OMVA 1LA0A 4MLWA 1B7TZ 1B8RA 3FWBA 1KK8C 3RLZA 2LUXA 3SG4A 1SNLA 2KQYA 2M8UA 1DTLA 1DMOA 1EJ3A 1H4BA 4U8DA 1XFVO 2AMIA 2M49B 1SY9A 1N2DA 3TZ1A 1K96A 2I7AA 2LP3A 3F45A 3JVTC 3O4YA 3TS5C 4AOMA 1PSRA 2K8MB 2KFGA 1RECA 1CFPA 1BF5A 1H8BA 4GGNA 3O2PA 4HRHA 3I5IC 1DJXA 4DCKA 2MLFC 3E3RA 1UUSA 2AAOA 4I5LB 1K9UA 1K93D 1OMRA 2PASA 1YTZC 1SYMA 1C7WA 1SCMC 1XFWO 2H2KA 3PN7C 4YI8A 3OX6A 1TTXA 2H61C 1WRLA 1NUBA 1SL9A 1JF0A 1K2HA 3KHEA 4YBHB 1QVIY 4ORCB 2Y1MA 2OPOA 1DT7B 2R2IA 1CFFA 4GPLB 1BR1B 1DF0A 1QX2A 3CZTX 1K94A 4XJKB 1U5IB 5DKRA 2BCAA 3LK0A 2COLB 3VROA 1OZSA 2GGMA 2QACA 2LNKA 2L2EA 5GQQC 1E8AA 2LM5A 1DVIA 1M39A 2KAYA 3KEVA 3SIBA 1QASA 1W7JB 1ZFSA 2L50A 1LKJA 3BUMB 3PFVA 2TN4A 1MXEA 1HQVA 2JTZA 2ZN9A 1D1OA 1AUIB 3PLFB 2KI4B 3IQQA 2WCFA 1VRKA 3CR5X 3JTDB 3LK1A 1ZACA 2JT0A 3FS7A 1GGZA 2WCEA 2F2OA 3VRNA 5JJGA 2OTGB 3CS1A 1Y1XA 1F8HA 2NCOA 2SCPA 5K89A 1TNQA 2KBMA 1Y6WA 1B1GA 4N5XA 1FF1A 1J7RA 3SJSA 1QATA 1CDPA 2NXQA 3CWGA 1JFKA 1K95A 2MHHA 4DIRA 2WORA 2JXCA 1XFYO 3NSLA 1IRJA 5G08A 1S5GZ 2KI6C 4GGFA 1AK8A 1TCFA 3OX5A 4P2YB 3VGOA 4AQJA 4YGBB 5AFPA 4FTGA 3VRQA 1ALWA 2I2RE 4MN0A 2LLSA 1TNPA 4QJ4B 1OE9B 2MRDA 1QX7A 4PE1A 4D1EA 3CLNA 3FWCA 1Y0VH 1JWDA 3M0WA 4NDBA 1NX2A 1M46A 4CFRA 2KI4C 2K61A 3I5HB 1SBJA 1UWOA 2BBMA 1CM1A 3JTDC 4HREE 1J7OA 4BY4A 2F2PA 1YX7A 2M1KB 2OTGC 2ZNDA 1XFXO 1OQPA 2FCDA 1AJ4A 2KAXA 2KDHA 1S6IA 1UURA 1NIWA 2M1UA 1M63B 2EHBA 4AQIA 1CM4A 1AP4A 1Y1UA 2LV7A 2JRFA 2LVVA 3DF0A 3SG7A 3D0YA 3DVEA 3TUYB 1JSAA 2F8PA 1X02A 2Y1NA 4FQOA 4NDDA 2LVIA 3LL8B 4ZCUA 1IH0A 4M2QA 1QTXA 2K7OA 1NCXA 1UHHA 1YRTB 1KQMB 2LLUA 1XK4A 2EGDA 1TIZA 1SL8A 3PSRA 1YVHA 3DD4A 4PHKA 2IS9A 4IL1A 4OR9B 2BCBA 1J7QA 1TNWA 3LCPC 1WDCB 1ZOTB 3EKJA 2NLNA 1DJYA 1OMDA 1SCVA 2FOTA 1IJ5A 3C1VA 2F3ZA 1DGVA 3BOWA 1RK9A 1WRZA 4YGEB 2G2BA 2LUCA 2Q4UA 1FW4A 3TUYC 1F55A 1GJYA 1L2OB 1XYDA 1S36A 4Q04A 2JNFA 1B7TY 2WC8A 4L9MA 1NPQA 2HETA 2PMYA 2Q91A 2WCBA 5PALA 4CIDA 1SKTA 1NX1A 1SL7A 2BKIB 4HRGA 1LXFC 4TNCA 3VRPA 2L0PA 3EK7A 1EL4A 1K9KA 1YUTA 1QV0A 1KQMC 5AXIA 4GNKB 2LANA 1A75A 2B1UA 4OCIA 1TOPA 3NSOA 2JPTA 4YI9A 2L4IA 3VRRA 5CSIA 2MJWB 3SG2A 4CLNA 1EH2A 2I18A 2NCPA 4NDCA 2LCPA 1XO5A 2LVKA 3DVJA 2H61A 1SRAA 1S3PA 2CNPA 1SW8A 1CMFA 2MA2A 1CMGA 1WDCC 5CSNA 5D7FA 1KK7Z 2JWWA 4DRWA 1YUUA 5TNCA 4UPGA 2A4JA 3I5FB 1BODA 1AJ5A 1CKKA 4YGCB 1IG5A 5BPJA 3A8RA 1AVSA 5KTYA 2BECA 2ZFDA 1CFCA 3D10A 4ETOA 2OS8B 1LINA 1A03A 1SMGA 1BT6A 3HCMA 3TDUA 1C7VA 4MZKA 3O78A 2M3WA 1V1GA 1QIWA 2P6BB 1L2OC 3BUOB 5D69A 1IWQA 2M0RA 4A4CA 4YRUA 1B4CA 3K21A 2HF5A 1LVCD 1EXRA 3PM8A 5CSFA 1TCOB 5ER4X 2K7BA 3KPXA 4YGAA 3MSEB 2ZN8A 3AAJA 4M2PA 3TDZA 4HSZA 2PALA 2K7CA 4OKHA 3SIAA 2KFFA 1DJGA 1NP8A 1OSAA 1MHOA 1MWNA 4USLA 2KFHA 2I94A 1ALVA 1QLKA 5I2OA 2PVBA 4GGFC 2BBNA 1QIVA 1CLLA 1DJHA 3LLEA 1A2XA 1UHIA 1KFUS 1CLBA 1WLMA 2ZRSA 3NSIA 1WLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YR5 A;  5DKQ A;  3EVV A;  1YVL A;  3OHM B;  2FCE A;  3GK2 A;  2E30 A;  1NX0 A;  2OS8 C;  3CR2 A;  4XJK A;  1IQ3 A;  5AEQ A;  5KU1 A;  1NWD A;  2K7D A;  1U5I A;  4JQ0 D;  1MXL C;  4MRY A;  1TRF A;  2KNE A;  4C0J A;  2LMT A;  2NZ0 A;  3I5F C;  1F70 A;  1S5G Y;  1UHJ A;  1IGV A;  1SPY A;  1K8U A;  2HPS A;  3EK8 A;  4WQ3 A;  2F33 A;  4MEW A;  3EK4 A;  4N1G A;  2MAZ A;  1V1F A;  1BMO A;  3PAL A;  1BG1 A;  2Y4Q A;  4ZCV A;  3AKB A;  1KK8 B;  1G33 A;  1NYA A;  4PHM A;  1JF2 A;  1RTP 1;  1PAL A;  1C07 A;  3ZNI A;  2CTN A;  2LAP A;  1NSH A;  5J3X A;  1CFD A;  2M7L A;  3BYA A;  1IQ5 A;  1WY9 A;  2M9G A;  3IF7 A;  1OZO A;  1RJV A;  3FIA A;  2JQ6 A;  5JOL A;  4ORA B;  5CPV A;  3WXA A;  1F4O A;  1ODB A;  5DKN A;  3GK1 A;  1KSM A;  5HKZ A;  3TDI A;  1XK4 C;  1DF0 B;  4P5O E;  4BY5 A;  2JXL A;  2JNX A;  1M31 A;  1B47 A;  3IQO A;  4I5K A;  1YRU B;  3CR4 X;  3O6B A;  4PCW A;  2BL0 B;  5HLV A;  1R2U A;  3PN7 B;  5HKY A;  4I5N B;  1Q80 A;  4MBE A;  3I5H C;  1J7P A;  1F4Q A;  3QRX A;  2K2A A;  3BQ3 A;  2CBL A;  3SG3 A;  4YGD B;  4N1F A;  3H4S E;  3OB2 B;  3OP0 A;  3AAK A;  3GOF A;  2EC6 B;  2WOS A;  3NXA A;  4PDZ A;  1KFU L;  2JT3 A;  2KOT A;  3BUW B;  4MZJ A;  1DJW A;  4R1E A;  1YUS A;  1S6C A;  1KWO B;  3RM1 A;  1CDN A;  1QVI Z;  1DGU A;  1JFJ A;  1XA5 A;  2LMU A;  1CDM A;  2M29 A;  1FI6 A;  2K0J A;  2L4H A;  2L5X B;  2LE9 B;  2LP2 A;  1EG4 A;  3DVM A;  4MSP A;  3I5G B;  1QS7 A;  1TN4 A;  1KQV A;  1WRK A;  5HKW A;  2MBX A;  1K90 D;  3EVR A;  4GBA A;  5CSJ A;  1IKU A;  2SAS A;  1CNP A;  2BE4 A;  5I2Q A;  3EVU A;  4PE4 A;  2CCM A;  3EKH A;  2O60 A;  5AAN A;  2CXJ A;  2BCX A;  2L51 A;  5I2L A;  1EG3 A;  4PAL A;  4MRX A;  2BKH B;  2BL0 C;  4GAO A;  4F0Z B;  5HYD A;  1KSO A;  1KFX S;  1L7Z A;  2M7N A;  1QX5 B;  2ISD A;  5KSZ A;  4E68 A;  1YUR A;  1B8C A;  1FPW A;  1HT9 A;  1XFZ O;  1J1E A;  2VRG A;  2JZI A;  1A29 A;  2V53 A;  1DJZ A;  4MVF A;  2KGB C;  4JWQ A;  1CB1 A;  4M2O A;  2QPT A;  3AKA A;  2EC6 C;  1BLQ A;  1MR8 A;  1S6J A;  4OVN F;  1KCY A;  4WQ2 A;  3HX4 A;  2M97 A;  2KGR A;  1KWO C;  1JBA A;  3OB1 B;  1N65 A;  2KAV A;  1MUX A;  2CT9 A;  2O5G A;  3A4U B;  1RWY A;  3SG6 A;  1FI5 A;  2ZRT A;  2KQ6 A;  1CLM A;  4CPV A;  2DOQ A;  1ZUZ A;  3I5G C;  2HQW A;  2JC2 A;  1MQ1 A;  1QJT A;  4QJ3 B;  3BUN B;  1PVA A;  1KK7 Y;  3DF0 B;  3D0Y B;  3NSK A;  4PHN A;  1F71 A;  1RFJ A;  1BU3 A;  1BJF A;  2JUL A;  4MZL A;  4CFQ A;  2LC5 A;  1FBV A;  3KO0 A;  2LMV A;  4QJ5 B;  5IBW A;  1MF8 B;  3KF9 A;  4A4B A;  5AER A;  4DS7 A;  1QXP A;  4PHJ A;  1SR6 B;  2RGI A;  4C0K A;  1F54 A;  1JC2 A;  4ORB B;  1S26 D;  4DUQ A;  1PSB A;  2GGZ A;  2PRU A;  1BR4 B;  2LHL A;  1NCZ A;  1XFU O;  2KHN A;  3DVK A;  2JTT A;  2KYF A;  1CDL A;  3ZWH A;  1ZMZ A;  2FJU B;  2JT8 A;  3ICB A;  4WRI A;  4GFT A;  1J1D A;  1AHR A;  1M45 A;  2KSP A;  4JPZ B;  2KI6 D;  1IJ6 A;  1QLS A;  1RRO A;  5I8N A;  1UHK A;  4XYN A;  2D8N A;  5FYX A;  3BXK A;  1KFX L;  2MLE C;  2ZKM X;  4OV2 A;  1NX3 A;  3BOW B;  1GGW A;  1PK0 D;  2G9B A;  1UHN A;  2AUC A;  1GQM A;  2BE6 A;  1R6P A;  3PAT A;  1XVJ A;  2ZNE A;  1J55 A;  4ICB A;  3TS5 B;  3JVT B;  1W7I B;  3GK4 X;  1A4P A;  1SK6 D;  3BUX B;  5HLO A;  1BOC A;  1K9P A;  2K2F A;  2JU0 A;  2Y5I A;  1SR6 C;  3CGA A;  3I5I B;  1TNX A;  4I5J A;  4NQG A;  1A75 B;  4PE7 A;  4C0L A;  1S1E A;  3SG5 A;  5F6T A;  1YX8 A;  1N0Y A;  2E6W A;  2GV5 A;  3WHT B;  2WND A;  1NCY A;  4GUK A;  1CTR A;  1SCM B;  2JOJ A;  1Y1A A;  2KBI A;  3WNX B;  1B9A A;  3WHU B;  1G4Y R;  2KYC A;  2PSR A;  1JUO A;  1UP5 A;  1DJI A;  1QV1 A;  1B8L A;  2HQ8 A;  2LHI A;  2LLT A;  2LVJ A;  4PE0 A;  5ER5 A;  1PRW A;  2F3Y A;  1G8I A;  1LA3 A;  2L98 A;  3CTN A;  5B8I B;  1PVB A;  1OOJ A;  1PUL A;  1OMV A;  1LA0 A;  4MLW A;  1B7T Z;  1B8R A;  3FWB A;  1KK8 C;  3RLZ A;  2LUX A;  3SG4 A;  1SNL A;  2KQY A;  2M8U A;  1DTL A;  1DMO A;  1EJ3 A;  1H4B A;  4U8D A;  1XFV O;  2AMI A;  2M49 B;  1SY9 A;  1N2D A;  3TZ1 A;  1K96 A;  2I7A A;  2LP3 A;  3F45 A;  3JVT C;  3O4Y A;  3TS5 C;  4AOM A;  1PSR A;  2K8M B;  2KFG A;  1REC A;  1CFP A;  1BF5 A;  1H8B A;  4GGN A;  3O2P A;  4HRH A;  3I5I C;  1DJX A;  4DCK A;  2MLF C;  3E3R A;  1UUS A;  2AAO A;  4I5L B;  1K9U A;  1K93 D;  1OMR A;  2PAS A;  1YTZ C;  1SYM A;  1C7W A;  1SCM C;  1XFW O;  2H2K A;  3PN7 C;  4YI8 A;  3OX6 A;  1TTX A;  2H61 C;  1WRL A;  1NUB A;  1SL9 A;  1JF0 A;  1K2H A;  3KHE A;  4YBH B;  1QVI Y;  4ORC B;  2Y1M A;  2OPO A;  1DT7 B;  2R2I A;  1CFF A;  4GPL B;  1BR1 B;  1DF0 A;  1QX2 A;  3CZT X;  1K94 A;  4XJK B;  1U5I B;  5DKR A;  2BCA A;  3LK0 A;  2COL B;  3VRO A;  1OZS A;  2GGM A;  2QAC A;  2LNK A;  2L2E A;  5GQQ C;  1E8A A;  2LM5 A;  1DVI A;  1M39 A;  2KAY A;  3KEV A;  3SIB A;  1QAS A;  1W7J B;  1ZFS A;  2L50 A;  1LKJ A;  3BUM B;  3PFV A;  2TN4 A;  1MXE A;  1HQV A;  2JTZ A;  2ZN9 A;  1D1O A;  1AUI B;  3PLF B;  2KI4 B;  3IQQ A;  2WCF A;  1VRK A;  3CR5 X;  3JTD B;  3LK1 A;  1ZAC A;  2JT0 A;  3FS7 A;  1GGZ A;  2WCE A;  2F2O A;  3VRN A;  5JJG A;  2OTG B;  3CS1 A;  1Y1X A;  1F8H A;  2NCO A;  2SCP A;  5K89 A;  1TNQ A;  2KBM A;  1Y6W A;  1B1G A;  4N5X A;  1FF1 A;  1J7R A;  3SJS A;  1QAT A;  1CDP A;  2NXQ A;  3CWG A;  1JFK A;  1K95 A;  2MHH A;  4DIR A;  2WOR A;  2JXC A;  1XFY O;  3NSL A;  1IRJ A;  5G08 A;  1S5G Z;  2KI6 C;  4GGF A;  1AK8 A;  1TCF A;  3OX5 A;  4P2Y B;  3VGO A;  4AQJ A;  4YGB B;  5AFP A;  4FTG A;  3VRQ A;  1ALW A;  2I2R E;  4MN0 A;  2LLS A;  1TNP A;  4QJ4 B;  1OE9 B;  2MRD A;  1QX7 A;  4PE1 A;  4D1E A;  3CLN A;  3FWC A;  1Y0V H;  1JWD A;  3M0W A;  4NDB A;  1NX2 A;  1M46 A;  4CFR A;  2KI4 C;  2K61 A;  3I5H B;  1SBJ A;  1UWO A;  2BBM A;  1CM1 A;  3JTD C;  4HRE E;  1J7O A;  4BY4 A;  2F2P A;  1YX7 A;  2M1K B;  2OTG C;  2ZND A;  1XFX O;  1OQP A;  2FCD A;  1AJ4 A;  2KAX A;  2KDH A;  1S6I A;  1UUR A;  1NIW A;  2M1U A;  1M63 B;  2EHB A;  4AQI A;  1CM4 A;  1AP4 A;  1Y1U A;  2LV7 A;  2JRF A;  2LVV A;  3DF0 A;  3SG7 A;  3D0Y A;  3DVE A;  3TUY B;  1JSA A;  2F8P A;  1X02 A;  2Y1N A;  4FQO A;  4NDD A;  2LVI A;  3LL8 B;  4ZCU A;  1IH0 A;  4M2Q A;  1QTX A;  2K7O A;  1NCX A;  1UHH A;  1YRT B;  1KQM B;  2LLU A;  1XK4 A;  2EGD A;  1TIZ A;  1SL8 A;  3PSR A;  1YVH A;  3DD4 A;  4PHK A;  2IS9 A;  4IL1 A;  4OR9 B;  2BCB A;  1J7Q A;  1TNW A;  3LCP C;  1WDC B;  1ZOT B;  3EKJ A;  2NLN A;  1DJY A;  1OMD A;  1SCV A;  2FOT A;  1IJ5 A;  3C1V A;  2F3Z A;  1DGV A;  3BOW A;  1RK9 A;  1WRZ A;  4YGE B;  2G2B A;  2LUC A;  2Q4U A;  1FW4 A;  3TUY C;  1F55 A;  1GJY A;  1L2O B;  1XYD A;  1S36 A;  4Q04 A;  2JNF A;  1B7T Y;  2WC8 A;  4L9M A;  1NPQ A;  2HET A;  2PMY A;  2Q91 A;  2WCB A;  5PAL A;  4CID A;  1SKT A;  1NX1 A;  1SL7 A;  2BKI B;  4HRG A;  1LXF C;  4TNC A;  3VRP A;  2L0P A;  3EK7 A;  1EL4 A;  1K9K A;  1YUT A;  1QV0 A;  1KQM C;  5AXI A;  4GNK B;  2LAN A;  1A75 A;  2B1U A;  4OCI A;  1TOP A;  3NSO A;  2JPT A;  4YI9 A;  2L4I A;  3VRR A;  5CSI A;  2MJW B;  3SG2 A;  4CLN A;  1EH2 A;  2I18 A;  2NCP A;  4NDC A;  2LCP A;  1XO5 A;  2LVK A;  3DVJ A;  2H61 A;  1SRA A;  1S3P A;  2CNP A;  1SW8 A;  1CMF A;  2MA2 A;  1CMG A;  1WDC C;  5CSN A;  5D7F A;  1KK7 Z;  2JWW A;  4DRW A;  1YUU A;  5TNC A;  4UPG A;  2A4J A;  3I5F B;  1BOD A;  1AJ5 A;  1CKK A;  4YGC B;  1IG5 A;  5BPJ A;  3A8R A;  1AVS A;  5KTY A;  2BEC A;  2ZFD A;  1CFC A;  3D10 A;  4ETO A;  2OS8 B;  1LIN A;  1A03 A;  1SMG A;  1BT6 A;  3HCM A;  3TDU A;  1C7V A;  4MZK A;  3O78 A;  2M3W A;  1V1G A;  1QIW A;  2P6B B;  1L2O C;  3BUO B;  5D69 A;  1IWQ A;  2M0R A;  4A4C A;  4YRU A;  1B4C A;  3K21 A;  2HF5 A;  1LVC D;  1EXR A;  3PM8 A;  5CSF A;  1TCO B;  5ER4 X;  2K7B A;  3KPX A;  4YGA A;  3MSE B;  2ZN8 A;  3AAJ A;  4M2P A;  3TDZ A;  4HSZ A;  2PAL A;  2K7C A;  4OKH A;  3SIA A;  2KFF A;  1DJG A;  1NP8 A;  1OSA A;  1MHO A;  1MWN A;  4USL A;  2KFH A;  2I94 A;  1ALV A;  1QLK A;  5I2O A;  2PVB A;  4GGF C;  2BBN A;  1QIV A;  1CLL A;  1DJH A;  3LLE A;  1A2X A;  1UHI A;  1KFU S;  1CLB A;  1WLM A;  2ZRS A;  3NSI A;  1WLZ A; 
#chains in the Genus database with same CATH topology
 1YR5 A;  5DKQ A;  3EVV A;  1YVL A;  3OHM B;  2FCE A;  3GK2 A;  2E30 A;  1NX0 A;  2OS8 C;  3CR2 A;  4XJK A;  3PM2 A;  5AEQ A;  1IQ3 A;  5KU1 A;  1NWD A;  2K7D A;  1U5I A;  4JQ0 D;  1MXL C;  4MRY A;  1TRF A;  2KNE A;  4C0J A;  2LMT A;  2NZ0 A;  4F7F A;  3I5F C;  1OOF A;  1F70 A;  3D77 A;  1S5G Y;  1UHJ A;  1IGV A;  1SPY A;  1K8U A;  2HPS A;  3EK8 A;  4WQ3 A;  2F33 A;  4MEW A;  3EK4 A;  3O4X A;  4N1G A;  2MAZ A;  1V1F A;  1BMO A;  3PAL A;  1BG1 A;  2Y4Q A;  4ZCV A;  3AKB A;  1KK8 B;  1G33 A;  1NYA A;  4PHM A;  1JF2 A;  1RTP 1;  1PAL A;  1C07 A;  3ZNI A;  2CTN A;  2LAP A;  3K1E A;  1NSH A;  5J3X A;  1CFD A;  2M7L A;  3BYA A;  1IQ5 A;  1WY9 A;  2M9G A;  3BFA A;  1OZO A;  1RJV A;  3FIA A;  3IF7 A;  2JQ6 A;  5JOL A;  4ORA B;  5CPV A;  1C3Y A;  3D75 A;  3WXA A;  1F4O A;  1ODB A;  4JD9 A;  5DKN A;  3GK1 A;  1KSM A;  5HKZ A;  3TDI A;  1XK4 C;  3NHI A;  1DF0 B;  4P5O E;  2QEO A;  4BY5 A;  2JXL A;  2P71 A;  2JNX A;  1M31 A;  1B47 A;  2ERB A;  3IQO A;  4I5K A;  1YRU B;  3CR4 X;  3O6B A;  4PCW A;  2BL0 B;  5HLV A;  1R2U A;  3PN7 B;  1C3Z A;  4I5N B;  5HKY A;  3OBV A;  1Q80 A;  4MBE A;  3I5H C;  1J7P A;  1F4Q A;  3QRX A;  2K2A A;  3BQ3 A;  2CBL A;  3SG3 A;  4YGD B;  4N1F A;  3H4S E;  3OB2 B;  3S0E A;  3OP0 A;  5I94 A;  3AAK A;  3GOF A;  2EC6 B;  2WOS A;  3NXA A;  4PDZ A;  1KFU L;  2JT3 A;  2KOT A;  3BUW B;  3S0G A;  4MZJ A;  1DJW A;  4R1E A;  1YUS A;  1S6C A;  2YGU A;  1KWO B;  3RM1 A;  1CDN A;  3L4L A;  1QVI Z;  1DGU A;  2BNX A;  1XA5 A;  2LMU A;  1JFJ A;  1CDM A;  2M29 A;  1Z2C B;  1FI6 A;  2K0J A;  2L4H A;  2L5X B;  2LE9 B;  2LP2 A;  1EG4 A;  3DVM A;  4MSP A;  3I5G B;  1QS7 A;  1TN4 A;  1KQV A;  1WRK A;  5HKW A;  2MBX A;  1K90 D;  3EVR A;  4GBA A;  5CSJ A;  1IKU A;  2SAS A;  1CNP A;  2BE4 A;  5I2Q A;  3EVU A;  4KYN A;  4PE4 A;  2CCM A;  3EKH A;  2O60 A;  5AAN A;  2CXJ A;  2BCX A;  2L51 A;  5I2L A;  1EG3 A;  2KLE A;  4PAL A;  4MRX A;  2BKH B;  2BL0 C;  3R1V A;  4GAO A;  4F0Z B;  5HYD A;  2WCK A;  1KSO A;  1KFX S;  1L7Z A;  2M7N A;  1QX5 B;  2ISD A;  3SS5 A;  5KSZ A;  1YUR A;  1B8C A;  3BFH A;  1HT9 A;  1XFZ O;  4E68 A;  1J1E A;  2VRG A;  2JZI A;  1A29 A;  2V53 A;  4PT1 A;  1DJZ A;  1TUZ A;  4MVF A;  2KGB C;  1LS8 A;  4JWQ A;  1CB1 A;  4M2O A;  2QPT A;  3AKA A;  2BAP A;  2EC6 C;  3D73 A;  3NHT A;  1BLQ A;  3CAB A;  1MR8 A;  1S6J A;  4OVN F;  1KCY A;  4WQ2 A;  1SSE B;  3HX4 A;  2M97 A;  2KGR A;  1KWO C;  1JBA A;  3OB1 B;  1N65 A;  2KAV A;  1MUX A;  2CT9 A;  2O5G A;  3A4U B;  1RWY A;  3SG6 A;  2WCM A;  1FI5 A;  2ZRT A;  2KQ6 A;  1CLM A;  4CPV A;  5FI2 A;  1XFR A;  1ZUZ A;  2DOQ A;  3CZ0 A;  3I5G C;  2HQW A;  2JC2 A;  1MQ1 A;  1QJT A;  4QJ3 B;  3BUN B;  1PVA A;  1KK7 Y;  3DF0 B;  3D0Y B;  3NSK A;  4PHN A;  1F71 A;  1RFJ A;  1BU3 A;  1BJF A;  2JUL A;  4MZL A;  4CFQ A;  2QEH A;  2LC5 A;  1FPW A;  1FBV A;  3KO0 A;  3B7A A;  2LMV A;  4QJ5 B;  3SS4 A;  3IVT A;  5IBW A;  1MF8 B;  3CZ2 A;  3KF9 A;  4A4B A;  5AER A;  4DS7 A;  1QXP A;  4PHJ A;  5DIC A;  1SR6 B;  2RGI A;  4C0K A;  1F54 A;  1JC2 A;  4ORB B;  1S26 D;  4DUQ A;  3D76 A;  1PSB A;  2GGZ A;  2PRU A;  1BR4 B;  2LHL A;  1NCZ A;  1XFU O;  2KHN A;  3B6X A;  3DVK A;  2JTT A;  2KYF A;  1CDL A;  5EL2 A;  3ZWH A;  1ZMZ A;  2FJU B;  2JT8 A;  3ICB A;  4WRI A;  4GFT A;  1J1D A;  1AHR A;  1M45 A;  2KSP A;  4JPZ B;  2KI6 D;  1IJ6 A;  1QLS A;  1RRO A;  5I8N A;  1UHK A;  3CZ1 A;  4XYN A;  2D8N A;  5FYX A;  3BXK A;  1KFX L;  2MLE C;  2ZKM X;  4OV2 A;  5D3O A;  2KLD A;  1NX3 A;  3BOW B;  1GGW A;  1PK0 D;  2G9B A;  1UHN A;  2AUC A;  1GQM A;  2BE6 A;  1R6P A;  3PAT A;  1XVJ A;  2ZNE A;  1J55 A;  4ICB A;  4OZD A;  3JVT B;  1W7I B;  3TS5 B;  1T14 A;  2FJY A;  3GK4 X;  1A4P A;  1SK6 D;  3BUX B;  5HLO A;  1BOC A;  1K9P A;  2K2F A;  2JU0 A;  2Y5I A;  1SR6 C;  3CGA A;  3I5I B;  1TNX A;  4I5J A;  4NQG A;  1A75 B;  4PE7 A;  4C0L A;  3L4A A;  1S1E A;  3SG5 A;  5F6T A;  1YX8 A;  1N0Y A;  2E6W A;  2GV5 A;  3WHT B;  2WND A;  1OW4 A;  1NCY A;  4GUK A;  1CTR A;  1SCM B;  2JOJ A;  1Y1A A;  2KBI A;  3WNX B;  1B9A A;  3WHU B;  1G4Y R;  2WCH A;  2KYC A;  2PSR A;  1JUO A;  5FI7 A;  1UP5 A;  1DJI A;  1QV1 A;  1B8L A;  2HQ8 A;  2LHI A;  2LLT A;  2LVJ A;  4PE0 A;  5ER5 A;  3CDN A;  1PRW A;  2F3Y A;  3SS3 A;  1G8I A;  1LA3 A;  2L98 A;  2WCL A;  3CTN A;  5B8I B;  1PVB A;  1OOJ A;  1PUL A;  1OMV A;  3BFB A;  1LA0 A;  4MLW A;  1B7T Z;  1B8R A;  3FWB A;  1KK8 C;  3RLZ A;  2LUX A;  3SG4 A;  1SNL A;  2KQY A;  2M8U A;  1DTL A;  1DMO A;  1EJ3 A;  1H4B A;  4U8D A;  1XFV O;  2AMI A;  2M49 B;  1SY9 A;  1N2D A;  3TZ1 A;  1K96 A;  2I7A A;  2LP3 A;  3F45 A;  3JVT C;  3O4Y A;  3TS5 C;  4AOM A;  1PSR A;  3R1P A;  2K8M B;  2KFG A;  1REC A;  1CFP A;  1BF5 A;  1H8B A;  4GGN A;  3O2P A;  4FQT A;  4HRH A;  2K60 A;  3I5I C;  1DJX A;  4DCK A;  2MLF C;  3E3R A;  1UUS A;  2AAO A;  4I5L B;  1K9U A;  1K93 D;  1OMR A;  2PAS A;  1YTZ C;  1SYM A;  1C7W A;  1SCM C;  1XFW O;  2H2K A;  3PN7 C;  4YI8 A;  3S0F A;  3OX6 A;  1TTX A;  2H61 C;  1WRL A;  2QEB A;  1NUB A;  1SL9 A;  3OGN A;  1JF0 A;  1K2H A;  3KHE A;  4YBH B;  3FE6 A;  3S0B A;  1QVI Y;  3NGV A;  4ORC B;  2Y1M A;  2OPO A;  1DT7 B;  2KPH A;  2R2I A;  1CFF A;  4GPL B;  1BR1 B;  1DF0 A;  1QX2 A;  3CZT X;  1K94 A;  4XJK B;  1U5I B;  5DKR A;  2BCA A;  3LK0 A;  2COL B;  3VRO A;  2JPO A;  1OZS A;  2GGM A;  2QAC A;  2LNK A;  2L2E A;  5GQQ C;  1E8A A;  2LM5 A;  1DVI A;  1M39 A;  2KAY A;  3KEV A;  3SIB A;  1QAS A;  1W7J B;  1ZFS A;  2WC6 A;  2L50 A;  1LKJ A;  3B88 A;  3BUM B;  2QEV A;  2TN4 A;  3BJH A;  3PFV A;  2GTE A;  1MXE A;  1HQV A;  2JTZ A;  2ZN9 A;  1D1O A;  1AUI B;  3PLF B;  2KI4 B;  3IQQ A;  2WCF A;  1VRK A;  3DY9 A;  2PQL A;  3CR5 X;  3JTD B;  3LK1 A;  3V2L A;  1ZAC A;  2JT0 A;  3FS7 A;  1GGZ A;  2WCE A;  2F2O A;  3VRN A;  5JJG A;  2OTG B;  3CS1 A;  1Y1X A;  1F8H A;  2NCO A;  2SCP A;  5K89 A;  1TNQ A;  2KBM A;  1Y6W A;  1B1G A;  4N5X A;  3D74 A;  1FF1 A;  1J7R A;  3DXL A;  3SJS A;  1QAT A;  1CDP A;  2NXQ A;  3CWG A;  1JFK A;  1K95 A;  2MHH A;  4DIR A;  2WOR A;  2JXC A;  1XFY O;  3NSL A;  1IRJ A;  4INX A;  5G08 A;  2H8V A;  1S5G Z;  2KI6 C;  4GGF A;  1AK8 A;  1TCF A;  3OX5 A;  4P2Y B;  3EG5 B;  3VGO A;  4AQJ A;  4YGB B;  5AFP A;  2QDI A;  4FTG A;  3VRQ A;  1ALW A;  2I2R E;  4MN0 A;  2LLS A;  1TNP A;  4QJ4 B;  1OE9 B;  3L47 A;  2MRD A;  1QX7 A;  4PE1 A;  4D1E A;  3CLN A;  3FWC A;  1Y0V H;  1JWD A;  3M0W A;  4NDB A;  3DYE A;  1NX2 A;  1M46 A;  4CFR A;  2KI4 C;  2K61 A;  3I5H B;  1SBJ A;  1UWO A;  2BBM A;  1CM1 A;  3JTD C;  4HRE E;  1J7O A;  4BY4 A;  2F2P A;  1YX7 A;  2M1K B;  2OTG C;  2ZND A;  1XFX O;  1OQP A;  2FCD A;  4JKT A;  1AJ4 A;  2KAX A;  2KDH A;  1S6I A;  1UUR A;  1NIW A;  2M1U A;  1M63 B;  2EHB A;  4AQI A;  1CM4 A;  1AP4 A;  1Y1U A;  2LV7 A;  2JRF A;  2LVV A;  3DF0 A;  3SG7 A;  3S0A A;  3D0Y A;  3DVE A;  3TUY B;  1JSA A;  2F8P A;  1X02 A;  2Y1N A;  4FQO A;  4NDD A;  3D78 A;  2LVI A;  3LL8 B;  4ZCU A;  1IH0 A;  4M2Q A;  1P28 A;  1QTX A;  2K7O A;  1NCX A;  1UHH A;  1YRT B;  1KQM B;  2LLU A;  1XK4 A;  2EGD A;  1TIZ A;  5FI6 A;  3CYZ A;  1SL8 A;  3PSR A;  1YVH A;  3R72 A;  2WCJ A;  3DD4 A;  4PHK A;  2IS9 A;  4IL1 A;  4OR9 B;  2BCB A;  1TUJ A;  1J7Q A;  1TNW A;  3LCP C;  1WDC B;  1DEL A;  1ZOT B;  1OOH A;  3EKJ A;  2NLN A;  1DJY A;  1OMD A;  1SCV A;  2FOT A;  1IJ5 A;  2P70 A;  2F3Z A;  3C1V A;  1DGV A;  1OOG A;  3BOW A;  1RK9 A;  1WRZ A;  4YGE B;  1IIO A;  2G2B A;  2LUC A;  2Q4U A;  1FW4 A;  3TUY C;  3FE9 A;  1GJY A;  1F55 A;  1L2O B;  3S0D A;  1XYD A;  1S36 A;  4Q04 A;  3B87 A;  2JNF A;  1B7T Y;  2WC8 A;  4L9M A;  1NPQ A;  2HET A;  2PMY A;  2Q91 A;  2WCB A;  3DZT A;  5PAL A;  4CID A;  1DEK A;  1SKT A;  1NX1 A;  1SL7 A;  2BKI B;  4HRG A;  1LXF C;  4TNC A;  3VRP A;  2L0P A;  3EK7 A;  1EL4 A;  1K9K A;  1YUT A;  1QV0 A;  3RZS A;  1KQM C;  5AXI A;  4GNK B;  2LAN A;  1A75 A;  2B1U A;  4OCI A;  1TOP A;  3NSO A;  2JPT A;  4YI9 A;  2L4I A;  3VRR A;  5CSI A;  2MJW B;  3SG2 A;  1Z4H A;  1GM0 A;  1TWO A;  4CLN A;  1W9Z A;  1EH2 A;  2I18 A;  2NCP A;  4NDC A;  1DC1 A;  2LCP A;  1XO5 A;  2LVK A;  3DVJ A;  2H61 A;  1SRA A;  1S3P A;  2CNP A;  1SW8 A;  1CMF A;  2MA2 A;  1CMG A;  1WDC C;  5CSN A;  5D7F A;  1KK7 Z;  2JWW A;  4DRW A;  1YUU A;  5TNC A;  2L5Y A;  2A4J A;  3I5F B;  4UPG A;  1AJ5 A;  1BOD A;  1CKK A;  4YGC B;  1IG5 A;  5BPJ A;  3A8R A;  1AVS A;  5KTY A;  2BEC A;  2ZFD A;  1CFC A;  5HL1 A;  3D10 A;  3FE8 A;  4ETO A;  2OS8 B;  1LIN A;  1A03 A;  1SMG A;  1BT6 A;  3HCM A;  1QWV A;  3B86 A;  3TDU A;  1C7V A;  4MZK A;  3O78 A;  2M3W A;  1ORG A;  1V1G A;  1QIW A;  2P6B B;  3QME A;  1L2O C;  3BUO B;  5D69 A;  1IWQ A;  2M0R A;  4A4C A;  4YRU A;  1B4C A;  3K21 A;  2HF5 A;  3UNW A;  1LVC D;  3N7H A;  2L2C A;  1EXR A;  3PM8 A;  3PJI A;  5CSF A;  3UO9 A;  1TCO B;  5ER4 X;  2K7B A;  3KPX A;  4YGA A;  3MSE B;  2ZN8 A;  3AAJ A;  4M2P A;  3TDZ A;  4HSZ A;  4IJ7 A;  2PAL A;  3VB1 A;  2K7C A;  2PYQ A;  3Q8I A;  4OKH A;  3SIA A;  2KFF A;  1DJG A;  1NP8 A;  1OSA A;  1MHO A;  1MWN A;  4USL A;  2KFH A;  2I94 A;  1DQE A;  1ALV A;  1QLK A;  5I2O A;  2PVB A;  4GGF C;  2BBN A;  1QIV A;  4INW A;  1CLL A;  1DJH A;  3LLE A;  1A2X A;  1OOI X;  1UHI A;  2WC5 A;  3R1O A;  1KFU S;  1CLB A;  1WLM A;  2ZRS A;  3NSI A;  1WLZ A; 
#chains in the Genus database with same CATH homology
 1YR5 A;  5DKQ A;  3EVV A;  1YVL A;  3OHM B;  2FCE A;  3GK2 A;  2E30 A;  1NX0 A;  2OS8 C;  3CR2 A;  4XJK A;  1IQ3 A;  5AEQ A;  5KU1 A;  1NWD A;  2K7D A;  1U5I A;  4JQ0 D;  1MXL C;  4MRY A;  1TRF A;  2KNE A;  4C0J A;  2LMT A;  2NZ0 A;  3I5F C;  1F70 A;  1S5G Y;  1UHJ A;  1IGV A;  1SPY A;  1K8U A;  2HPS A;  3EK8 A;  4WQ3 A;  2F33 A;  4MEW A;  3EK4 A;  4N1G A;  2MAZ A;  1V1F A;  1BMO A;  3PAL A;  1BG1 A;  2Y4Q A;  4ZCV A;  3AKB A;  1KK8 B;  1G33 A;  1NYA A;  4PHM A;  1JF2 A;  1RTP 1;  1PAL A;  1C07 A;  3ZNI A;  2CTN A;  2LAP A;  1NSH A;  5J3X A;  1CFD A;  2M7L A;  3BYA A;  1IQ5 A;  1WY9 A;  2M9G A;  3IF7 A;  1OZO A;  1RJV A;  3FIA A;  2JQ6 A;  5JOL A;  4ORA B;  5CPV A;  3WXA A;  1F4O A;  1ODB A;  5DKN A;  3GK1 A;  1KSM A;  5HKZ A;  3TDI A;  1XK4 C;  1DF0 B;  4P5O E;  4BY5 A;  2JXL A;  2JNX A;  1M31 A;  1B47 A;  3IQO A;  4I5K A;  1YRU B;  3CR4 X;  3O6B A;  4PCW A;  2BL0 B;  5HLV A;  1R2U A;  3PN7 B;  5HKY A;  4I5N B;  1Q80 A;  4MBE A;  3I5H C;  1J7P A;  1F4Q A;  3QRX A;  2K2A A;  3BQ3 A;  2CBL A;  3SG3 A;  4YGD B;  4N1F A;  3H4S E;  3OB2 B;  3OP0 A;  3AAK A;  3GOF A;  2EC6 B;  2WOS A;  3NXA A;  4PDZ A;  1KFU L;  2JT3 A;  2KOT A;  3BUW B;  4MZJ A;  1DJW A;  4R1E A;  1YUS A;  1S6C A;  1KWO B;  3RM1 A;  1CDN A;  1QVI Z;  1DGU A;  1JFJ A;  1XA5 A;  2LMU A;  1CDM A;  2M29 A;  1FI6 A;  2K0J A;  2L4H A;  2L5X B;  2LE9 B;  2LP2 A;  1EG4 A;  3DVM A;  4MSP A;  3I5G B;  1QS7 A;  1TN4 A;  1KQV A;  1WRK A;  5HKW A;  2MBX A;  1K90 D;  3EVR A;  4GBA A;  5CSJ A;  1IKU A;  2SAS A;  1CNP A;  2BE4 A;  5I2Q A;  3EVU A;  4PE4 A;  2CCM A;  3EKH A;  2O60 A;  5AAN A;  2CXJ A;  2BCX A;  2L51 A;  5I2L A;  1EG3 A;  4PAL A;  4MRX A;  2BKH B;  2BL0 C;  4GAO A;  4F0Z B;  5HYD A;  1KSO A;  1KFX S;  1L7Z A;  2M7N A;  1QX5 B;  2ISD A;  5KSZ A;  4E68 A;  1YUR A;  1B8C A;  1FPW A;  1HT9 A;  1XFZ O;  1J1E A;  2VRG A;  2JZI A;  1A29 A;  2V53 A;  1DJZ A;  4MVF A;  2KGB C;  4JWQ A;  1CB1 A;  4M2O A;  2QPT A;  3AKA A;  2EC6 C;  1BLQ A;  1MR8 A;  1S6J A;  4OVN F;  1KCY A;  4WQ2 A;  3HX4 A;  2M97 A;  2KGR A;  1KWO C;  1JBA A;  3OB1 B;  1N65 A;  2KAV A;  1MUX A;  2CT9 A;  2O5G A;  3A4U B;  1RWY A;  3SG6 A;  1FI5 A;  2ZRT A;  2KQ6 A;  1CLM A;  4CPV A;  2DOQ A;  1ZUZ A;  3I5G C;  2HQW A;  2JC2 A;  1MQ1 A;  1QJT A;  4QJ3 B;  3BUN B;  1PVA A;  1KK7 Y;  3DF0 B;  3D0Y B;  3NSK A;  4PHN A;  1F71 A;  1RFJ A;  1BU3 A;  1BJF A;  2JUL A;  4MZL A;  4CFQ A;  2LC5 A;  1FBV A;  3KO0 A;  2LMV A;  4QJ5 B;  5IBW A;  1MF8 B;  3KF9 A;  4A4B A;  5AER A;  4DS7 A;  1QXP A;  4PHJ A;  1SR6 B;  2RGI A;  4C0K A;  1F54 A;  1JC2 A;  4ORB B;  1S26 D;  4DUQ A;  1PSB A;  2GGZ A;  2PRU A;  1BR4 B;  2LHL A;  1NCZ A;  1XFU O;  2KHN A;  3DVK A;  2JTT A;  2KYF A;  1CDL A;  3ZWH A;  1ZMZ A;  2FJU B;  2JT8 A;  3ICB A;  4WRI A;  4GFT A;  1J1D A;  1AHR A;  1M45 A;  2KSP A;  4JPZ B;  2KI6 D;  1IJ6 A;  1QLS A;  1RRO A;  5I8N A;  1UHK A;  4XYN A;  2D8N A;  5FYX A;  3BXK A;  1KFX L;  2MLE C;  2ZKM X;  4OV2 A;  1NX3 A;  3BOW B;  1GGW A;  1PK0 D;  2G9B A;  1UHN A;  2AUC A;  1GQM A;  2BE6 A;  1R6P A;  3PAT A;  1XVJ A;  2ZNE A;  1J55 A;  4ICB A;  3TS5 B;  3JVT B;  1W7I B;  3GK4 X;  1A4P A;  1SK6 D;  3BUX B;  5HLO A;  1BOC A;  1K9P A;  2K2F A;  2JU0 A;  2Y5I A;  1SR6 C;  3CGA A;  3I5I B;  1TNX A;  4I5J A;  4NQG A;  1A75 B;  4PE7 A;  4C0L A;  1S1E A;  3SG5 A;  5F6T A;  1YX8 A;  1N0Y A;  2E6W A;  2GV5 A;  3WHT B;  2WND A;  1NCY A;  4GUK A;  1CTR A;  1SCM B;  2JOJ A;  1Y1A A;  2KBI A;  3WNX B;  1B9A A;  3WHU B;  1G4Y R;  2KYC A;  2PSR A;  1JUO A;  1UP5 A;  1DJI A;  1QV1 A;  1B8L A;  2HQ8 A;  2LHI A;  2LLT A;  2LVJ A;  4PE0 A;  5ER5 A;  1PRW A;  2F3Y A;  1G8I A;  1LA3 A;  2L98 A;  3CTN A;  5B8I B;  1PVB A;  1OOJ A;  1PUL A;  1OMV A;  1LA0 A;  4MLW A;  1B7T Z;  1B8R A;  3FWB A;  1KK8 C;  3RLZ A;  2LUX A;  3SG4 A;  1SNL A;  2KQY A;  2M8U A;  1DTL A;  1DMO A;  1EJ3 A;  1H4B A;  4U8D A;  1XFV O;  2AMI A;  2M49 B;  1SY9 A;  1N2D A;  3TZ1 A;  1K96 A;  2I7A A;  2LP3 A;  3F45 A;  3JVT C;  3O4Y A;  3TS5 C;  4AOM A;  1PSR A;  2K8M B;  2KFG A;  1REC A;  1CFP A;  1BF5 A;  1H8B A;  4GGN A;  3O2P A;  4HRH A;  3I5I C;  1DJX A;  4DCK A;  2MLF C;  3E3R A;  1UUS A;  2AAO A;  4I5L B;  1K9U A;  1K93 D;  1OMR A;  2PAS A;  1YTZ C;  1SYM A;  1C7W A;  1SCM C;  1XFW O;  2H2K A;  3PN7 C;  4YI8 A;  3OX6 A;  1TTX A;  2H61 C;  1WRL A;  1NUB A;  1SL9 A;  1JF0 A;  1K2H A;  3KHE A;  4YBH B;  1QVI Y;  4ORC B;  2Y1M A;  2OPO A;  1DT7 B;  2R2I A;  1CFF A;  4GPL B;  1BR1 B;  1DF0 A;  1QX2 A;  3CZT X;  1K94 A;  4XJK B;  1U5I B;  5DKR A;  2BCA A;  3LK0 A;  2COL B;  3VRO A;  1OZS A;  2GGM A;  2QAC A;  2LNK A;  2L2E A;  5GQQ C;  1E8A A;  2LM5 A;  1DVI A;  1M39 A;  2KAY A;  3KEV A;  3SIB A;  1QAS A;  1W7J B;  1ZFS A;  2L50 A;  1LKJ A;  3BUM B;  3PFV A;  2TN4 A;  1MXE A;  1HQV A;  2JTZ A;  2ZN9 A;  1D1O A;  1AUI B;  3PLF B;  2KI4 B;  3IQQ A;  2WCF A;  1VRK A;  3CR5 X;  3JTD B;  3LK1 A;  1ZAC A;  2JT0 A;  3FS7 A;  1GGZ A;  2WCE A;  2F2O A;  3VRN A;  5JJG A;  2OTG B;  3CS1 A;  1Y1X A;  1F8H A;  2NCO A;  2SCP A;  5K89 A;  1TNQ A;  2KBM A;  1Y6W A;  1B1G A;  4N5X A;  1FF1 A;  1J7R A;  3SJS A;  1QAT A;  1CDP A;  2NXQ A;  3CWG A;  1JFK A;  1K95 A;  2MHH A;  4DIR A;  2WOR A;  2JXC A;  1XFY O;  3NSL A;  1IRJ A;  5G08 A;  1S5G Z;  2KI6 C;  4GGF A;  1AK8 A;  1TCF A;  3OX5 A;  4P2Y B;  3VGO A;  4AQJ A;  4YGB B;  5AFP A;  4FTG A;  3VRQ A;  1ALW A;  2I2R E;  4MN0 A;  2LLS A;  1TNP A;  4QJ4 B;  1OE9 B;  2MRD A;  1QX7 A;  4PE1 A;  4D1E A;  3CLN A;  3FWC A;  1Y0V H;  1JWD A;  3M0W A;  4NDB A;  1NX2 A;  1M46 A;  4CFR A;  2KI4 C;  2K61 A;  3I5H B;  1SBJ A;  1UWO A;  2BBM A;  1CM1 A;  3JTD C;  4HRE E;  1J7O A;  4BY4 A;  2F2P A;  1YX7 A;  2M1K B;  2OTG C;  2ZND A;  1XFX O;  1OQP A;  2FCD A;  1AJ4 A;  2KAX A;  2KDH A;  1S6I A;  1UUR A;  1NIW A;  2M1U A;  1M63 B;  2EHB A;  4AQI A;  1CM4 A;  1AP4 A;  1Y1U A;  2LV7 A;  2JRF A;  2LVV A;  3DF0 A;  3SG7 A;  3D0Y A;  3DVE A;  3TUY B;  1JSA A;  2F8P A;  1X02 A;  2Y1N A;  4FQO A;  4NDD A;  2LVI A;  3LL8 B;  4ZCU A;  1IH0 A;  4M2Q A;  1QTX A;  2K7O A;  1NCX A;  1UHH A;  1YRT B;  1KQM B;  2LLU A;  1XK4 A;  2EGD A;  1TIZ A;  1SL8 A;  3PSR A;  1YVH A;  3DD4 A;  4PHK A;  2IS9 A;  4IL1 A;  4OR9 B;  2BCB A;  1J7Q A;  1TNW A;  3LCP C;  1WDC B;  1ZOT B;  3EKJ A;  2NLN A;  1DJY A;  1OMD A;  1SCV A;  2FOT A;  1IJ5 A;  3C1V A;  2F3Z A;  1DGV A;  3BOW A;  1RK9 A;  1WRZ A;  4YGE B;  2G2B A;  2LUC A;  2Q4U A;  1FW4 A;  3TUY C;  1F55 A;  1GJY A;  1L2O B;  1XYD A;  1S36 A;  4Q04 A;  2JNF A;  1B7T Y;  2WC8 A;  4L9M A;  1NPQ A;  2HET A;  2PMY A;  2Q91 A;  2WCB A;  5PAL A;  4CID A;  1SKT A;  1NX1 A;  1SL7 A;  2BKI B;  4HRG A;  1LXF C;  4TNC A;  3VRP A;  2L0P A;  3EK7 A;  1EL4 A;  1K9K A;  1YUT A;  1QV0 A;  1KQM C;  5AXI A;  4GNK B;  2LAN A;  1A75 A;  2B1U A;  4OCI A;  1TOP A;  3NSO A;  2JPT A;  4YI9 A;  2L4I A;  3VRR A;  5CSI A;  2MJW B;  3SG2 A;  4CLN A;  1EH2 A;  2I18 A;  2NCP A;  4NDC A;  2LCP A;  1XO5 A;  2LVK A;  3DVJ A;  2H61 A;  1SRA A;  1S3P A;  2CNP A;  1SW8 A;  1CMF A;  2MA2 A;  1CMG A;  1WDC C;  5CSN A;  5D7F A;  1KK7 Z;  2JWW A;  4DRW A;  1YUU A;  5TNC A;  4UPG A;  2A4J A;  3I5F B;  1BOD A;  1AJ5 A;  1CKK A;  4YGC B;  1IG5 A;  5BPJ A;  3A8R A;  1AVS A;  5KTY A;  2BEC A;  2ZFD A;  1CFC A;  3D10 A;  4ETO A;  2OS8 B;  1LIN A;  1A03 A;  1SMG A;  1BT6 A;  3HCM A;  3TDU A;  1C7V A;  4MZK A;  3O78 A;  2M3W A;  1V1G A;  1QIW A;  2P6B B;  1L2O C;  3BUO B;  5D69 A;  1IWQ A;  2M0R A;  4A4C A;  4YRU A;  1B4C A;  3K21 A;  2HF5 A;  1LVC D;  1EXR A;  3PM8 A;  5CSF A;  1TCO B;  5ER4 X;  2K7B A;  3KPX A;  4YGA A;  3MSE B;  2ZN8 A;  3AAJ A;  4M2P A;  3TDZ A;  4HSZ A;  2PAL A;  2K7C A;  4OKH A;  3SIA A;  2KFF A;  1DJG A;  1NP8 A;  1OSA A;  1MHO A;  1MWN A;  4USL A;  2KFH A;  2I94 A;  1ALV A;  1QLK A;  5I2O A;  2PVB A;  4GGF C;  2BBN A;  1QIV A;  1CLL A;  1DJH A;  3LLE A;  1A2X A;  1UHI A;  1KFU S;  1CLB A;  1WLM A;  2ZRS A;  3NSI A;  1WLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...