3F45A

Structure of the r75a mutant of rat alpha-parvalbumin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDAADLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parvalbumin alpha
publication title Removing the invariant salt bridge of parvalbumin increases flexibility in the AB-loop structure
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium binding protein
total genus 41
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3f45A00
5CSJA 2HQ8A 1GQMA 2FOTA 1QX7A 3F45A 3IF7A 1DVIA 1S1EA 1XYDA 2BE6A 2PMYA 3O6BA 4HSZA 1LA3A 5ER5A 1DJWA 1W7IB 5HKWA 3GOFA 1CKKA 1MWNA 1DJIA 2MAZA 2K8MB 1TNWA 1K9KA 1SL9A 2LHIA 2JULA 4PE7A 3H4SE 2OTGC 4I5NB 5I2QA 2Y5IA 1MXLC 4WQ2A 1NYAA 2Q91A 1L2OC 4MLWA 2ZNEA 1DMOA 1MF8B 1KK7Y 1JUOA 3JTDB 1ODBA 1DJXA 5F6TA 2JXCA 1K93D 2BKHB 3SG2A 4YBHB 2JTTA 2VRGA 1RTP1 3SG7A 1NPQA 2HQWA 3MSEB 1KFXS 3TDIA 3PLFB 2PSRA 4XJKB 2LAPA 4M2PA 2WORA 4YGCB 5AERA 3PN7C 4JQ0D 3DF0B 3OB2B 3SG6A 1V1FA 2HETA 3CLNA 5PALA 2KBMA 2KFFA 1YURA 1TIZA 2MLFC 1C7VA 2GGZA 1RJVA 4HRHA 4N5XA 4DCKA 2WCBA 4QJ5B 4YI8A 1XFZO 2LCPA 4GGFC 1JC2A 2BL0C 3DD4A 3DVKA 2OS8C 1DJYA 2Y1NA 1XVJA 4GUKA 1Q80A 2B1UA 1BJFA 2F3YA 5AFPA 5K89A 2BBNA 2H61C 1ALVA 3K21A 1L7ZA 1F70A 3EK8A 3VRNA 2LMTA 4MVFA 3I5HB 1QXPA 4P5OE 1RK9A 1QLKA 3I5GB 3GK4X 3FS7A 1RECA 4USLA 3WNXB 3EVRA 5IBWA 3BUOB 4MN0A 3CGAA 4ETOA 1DTLA 2WCFA 4ORBB 3TS5B 1JF2A 1U5IB 3I5FC 2KSPA 2LP3A 1WRZA 3EK4A 4MBEA 5AEQA 1C7WA 2LVJA 4GGNA 1EXRA 1K95A 4AQJA 3TUYC 1CTRA 2BKIB 2I94A 5I2OA 2M1KB 2L51A 1YRUB 3NSOA 2CNPA 1TTXA 4YGEB 1ZFSA 1WDCC 2NZ0A 2ZKMX 3NXAA 1CDMA 2O5GA 5ER4X 2LC5A 4PDZA 2ZN8A 5CPVA 5KU1A 1M63B 3IQOA 5HKZA 1PSBA 2LMUA 1R6PA 1CNPA 1JFKA 2GGMA 1WRKA 5AANA 2EGDA 1IQ5A 3QRXA 2KQ6A 1FPWA 3IQQA 1BR4B 3A4UB 1K90D 1PK0D 2P6BB 4NDBA 4C0JA 2D8NA 1NWDA 4OVNF 1UURA 2BCBA 3CR4X 2KFGA 5B8IB 1B7TZ 4A4CA 1JFJA 1KK8C 2EC6C 2Y1MA 3TDUA 1TNPA 2K7OA 1BG1A 3BUNB 1DT7B 1VRKA 3GK2A 3O4YA 4ORCB 3ZWHA 1X02A 1YTZC 2LV7A 4BY5A 1EG4A 1SL8A 1XO5A 2LUCA 1BMOA 3BUXB 2QACA 2ZNDA 1IQ3A 3TZ1A 4UPGA 1AJ5A 3DF0A 1PALA 1OMRA 1LKJA 1F8HA 1XFUO 1GGZA 3BYAA 1J1EA 5HKYA 1WRLA 3PM8A 1C07A 3I5IC 2KQYA 1M39A 2KI6C 3JVTB 1CM1A 2M29A 3PALA 4WQ3A 2M97A 4DIRA 1XK4C 4NQGA 2JRFA 1S26D 3HCMA 5I2LA 1M46A 1UHHA 3AKBA 4PE1A 1IG5A 1PVBA 3FWCA 5JOLA 2LE9B 2M9GA 3SIBA 1SKTA 1SCVA 4PHMA 1FW4A 1FF1A 2LVKA 1FI6A 1LA0A 3OX6A 1DJHA 1QLSA 1XFVO 1B47A 1D1OA 1B7TY 5FYXA 1IKUA 4I5KA 1K2HA 1CLLA 4YI9A 3WHTB 4TNCA 1YVHA 2LHLA 3BUWB 1DGUA 1U5IA 2HF5A 1OZSA 2JT3A 3O2PA 3WXAA 1UWOA 3FIAA 1AP4A 1AUIB 3C1VA 1H8BA 2E30A 2MRDA 2K2FA 1LVCD 1PSRA 1TRFA 2F2OA 4PE0A 1ZOTB 2L5XB 2MJWB 1LINA 1TOPA 4YGBB 3E3RA 1K9PA 1S3PA 2H61A 2I2RE 2KOTA 1YUTA 4MEWA 3AKAA 2LLUA 1F4QA 1OSAA 4AOMA 1ZACA 2PRUA 3PATA 4HRGA 1XFYO 3OX5A 5BPJA 1J55A 3EVVA 2LMVA 2OTGB 3HX4A 4DRWA 1NP8A 2Y4QA 3CTNA 1L2OB 3NSLA 3D0YB 1NCYA 3EVUA 4MRYA 1QV1A 1SPYA 2NCOA 1E8AA 3KHEA 1S6JA 1JSAA 2KYCA 2BBMA 1YR5A 1SL7A 1EL4A 3TS5C 1B4CA 1KSMA 1Y1XA 2ZFDA 1B8LA 2ISDA 1IJ5A 1F54A 4ZCUA 4AQIA 4GFTA 1F4OA 2M1UA 3BXKA 1OMDA 1QVIY 2I18A 4YRUA 5D69A 4F0ZB 2WC8A 1N0YA 2K2AA 1SRAA 1WLMA 4PE4A 1NX2A 1CFDA 2BL0B 1G8IA 2ZRSA 2L2EA 2OS8B 2O60A 1HQVA 2K0JA 2KHNA 2KGRA 4D1EA 1FI5A 1SR6C 4P2YB 4R1EA 1CLBA 2F8PA 2JC2A 1XA5A 2KI4C 2LUXA 2JQ6A 2LP2A 5KSZA 2NCPA 2JOJA 1CDLA 2KNEA 1F55A 1CDPA 1CFCA 3PSRA 3OHMB 1QV0A 3A8RA 1K94A 2AUCA 1BLQA 2L4HA 4OV2A 1M31A 3LLEA 2ZN9A 5CSNA 5GQQC 2F2PA 3SJSA 5AXIA 1NCXA 2RGIA 1IRJA 3EKJA 2JNXA 1HT9A 4GNKB 5D7FA 1NX3A 5HYDA 1YRTB 4M2QA 1G33A 1W7JB 3OB1B 2QPTA 3KPXA 4PCWA 1KQMC 3TUYB 1SCMC 1J7QA 2CBLA 2JWWA 2JT0A 4JWQA 1R2UA 1NX1A 2KGBC 2LANA 3TDZA 3VRPA 1KWOC 4ICBA 4CFRA 4E68A 2JT8A 1CM4A 1XK4A 1S6CA 2SASA 1A2XA 2LM5A 2OPOA 1GGWA 5KTYA 2SCPA 3SG4A 5J3XA 1UHJA 2CXJA 3O78A 1WDCB 4PHNA 4XYNA 4NDDA 4MRXA 2JZIA 1BT6A 1IJ6A 2L4IA 4I5LB 4CLNA 2BCXA 1S5GZ 3CR2A 2I7AA 1UHIA 2FCEA 1KQVA 3ZNIA 1RROA 1BOCA 1EH2A 5DKQA 2DOQA 4C0KA 2LLSA 4GPLB 1UP5A 3D0YA 3CWGA 2KBIA 1KFUL 2JXLA 2PASA 1BR1B 2F33A 3VRRA 3RLZA 1ZMZA 3AAJA 3DVEA 1DF0A 5I8NA 1JWDA 1J7PA 2F3ZA 4DUQA 3JTDC 2BE4A 1BU3A 1Y0VH 3SIAA 2FCDA 2V53A 3BOWA 1SNLA 1WLZA 1KSOA 1KCYA 2JPTA 2Q4UA 3OP0A 5DKNA 3VGOA 4DS7A 2H2KA 3BQ3A 3I5IB 1QVIZ 1SMGA 1UUSA 3VRQA 4GGFA 1SBJA 4IL1A 1QS7A 3SG5A 3RM1A 1TN4A 1S5GY 1MXEA 5JJGA 4CIDA 1MQ1A 2M49B 2PALA 1DJZA 4GBAA 3VROA 1PRWA 2KYFA 1CFPA 1LXFC 1IH0A 2KAYA 1B1GA 2KAVA 2L0PA 1CFFA 1RWYA 2K7CA 2KI6D 1OQPA 2K7BA 1QASA 4YGDB 1OMVA 3I5HC 4ORAB 1NCZA 5HLOA 1NSHA 1NUBA 3I5GC 2LVIA 1YX8A 2JNFA 5DKRA 1ZUZA 1YUSA 1DF0B 2IS9A 2WOSA 3SG3A 3LCPC 2AAOA 1B9AA 1JBAA 3ICBA 3PN7B 1SY9A 1QTXA 2M3WA 1TNXA 1OZOA 2EHBA 3BOWB 1K96A 1DGVA 3GK1A 3KO0A 2PVBA 1NIWA 2K61A 2KDHA 3D10A 4JPZB 3AAKA 3LK1A 2TN4A 2LLTA 4BY4A 1KFUS 1Y6WA 1K9UA 1QX2A 2MLEC 4CPVA 2M8UA 1CLMA 2R2IA 1V1GA 2WCEA 4N1FA 1QIVA 1S36A 2MA2A 4MZKA 2LVVA 1PVAA 1RFJA 1S6IA 1OE9B 2A4JA 1AJ4A 2COLB 2GV5A 4OCIA 5HLVA 4MZJA 2MHHA 4A4BA 3NSIA 1ALWA 1M45A 4OKHA 1F71A 1AK8A 4YGAA 2HPSA 4MSPA 2M7NA 1A29A 2CCMA 1FBVA 2K7DA 1QX5B 2M0RA 3EKHA 1K8UA 3PFVA 4I5JA 4OR9B 4PALA 4QJ4B 1TCFA 1N65A 4PHJA 2LNKA 3NSKA 1H4BA 3I5FB 2BECA 1PULA 1J7OA 3CR5X 1A75A 1BODA 1B8CA 5G08A 2CT9A 2BCAA 2L50A 3FWBA 4C0LA 1YUUA 3CS1A 1XFWO 4U8DA 2KFHA 3M0WA 4WRIA 1A4PA 1Y1AA 4NDCA 1YVLA 1SR6B 3BUMB 1KFXL 1EG3A 1YX7A 1CMFA 2KI4B 1UHNA 3KEVA 1MR8A 1G4YR 1SYMA 3JVTC 5CSIA 1N2DA 4HREE 4FTGA 1IGVA 2KAXA 1J1DA 2G9BA 2ZRTA 1XFXO 4MZLA 3WHUB 1SW8A 2JTZA 4CFQA 1AHRA 4FQOA 2FJUB 1DJGA 1EJ3A 4M2OA 4QJ3B 5CSFA 1NX0A 1QJTA 1UHKA 2NLNA 5TNCA 1SK6D 1KK7Z 3LL8B 1IWQA 1JF0A 2E6WA 4L9MA 1CB1A 1TNQA 2M7LA 3CZTX 2G2BA 1KK8B 2EC6B 2NXQA 3LK0A 4Q04A 4XJKA 1J7RA 3DVJA 2MBXA 2AMIA 4GAOA 2JU0A 1QIWA 1KQMB 3EK7A 1SCMB 2WNDA 1CDNA 1GJYA 1KWOB 1CMGA 1OOJA 3DVMA 1MUXA 1BF5A 1AVSA 1B8RA 2L98A 3KF9A 4ZCVA 1A03A 1QATA 4N1GA 2CTNA 4PHKA 1MHOA 1TCOB 1WY9A 1Y1UA 1A75B
chains in the Genus database with same CATH superfamily
5CSJA 2HQ8A 1GQMA 2FOTA 1QX7A 3F45A 3FE6A 3IF7A 1DVIA 1S1EA 1XYDA 2BE6A 2PMYA 3O6BA 4HSZA 1LA3A 5ER5A 1DJWA 1W7IB 5HKWA 3GOFA 1CKKA 2YGUA 1MWNA 1DJIA 2MAZA 2K8MB 1TNWA 1K9KA 2QEOA 1SL9A 2LHIA 2JULA 4PE7A 3H4SE 2OTGC 4I5NB 5I2QA 2Y5IA 2KLEA 1MXLC 4WQ2A 1NYAA 2Q91A 1L2OC 4MLWA 1W9ZA 2ZNEA 1DMOA 1MF8B 3K1EA 1KK7Y 1JUOA 3JTDB 1ODBA 1DJXA 5F6TA 2JXCA 1K93D 2BKHB 3SG2A 4YBHB 2JTTA 2VRGA 1RTP1 3SG7A 1NPQA 2HQWA 3MSEB 1KFXS 3TDIA 2P71A 3PLFB 2PSRA 4XJKB 2LAPA 4M2PA 2WORA 4YGCB 3SS4A 3PN7C 5AERA 4JQ0D 3DF0B 3OB2B 3SG6A 1V1FA 2HETA 3CLNA 5PALA 3IVTA 3L4AA 1TUZA 2KBMA 2JPOA 2KFFA 1YURA 1TIZA 2MLFC 1C7VA 2GGZA 1RJVA 4HRHA 4N5XA 4DCKA 2WCBA 4QJ5B 1QWVA 2WCLA 3BFBA 4YI8A 1XFZO 2LCPA 4GGFC 1JC2A 2BL0C 3DD4A 3DVKA 2OS8C 1DJYA 2Y1NA 1XVJA 4GUKA 1Q80A 2B1UA 1BJFA 2F3YA 5AFPA 5K89A 2BBNA 2H61C 1ALVA 3NGVA 3K21A 1L7ZA 1F70A 3EK8A 3VRNA 2LMTA 3CZ1A 4MVFA 3I5HB 1QXPA 4P5OE 1RK9A 1QLKA 3I5GB 3GK4X 3FS7A 1RECA 4USLA 3WNXB 3EVRA 5IBWA 3BUOB 4MN0A 3CGAA 4ETOA 1DTLA 2WCFA 4ORBB 3TS5B 1JF2A 1U5IB 3I5FC 2KSPA 2LP3A 5FI7A 1WRZA 3EK4A 3O4XA 4MBEA 5AEQA 1C7WA 2LVJA 4GGNA 1EXRA 1K95A 4AQJA 3TUYC 1CTRA 2BKIB 2I94A 5I2OA 2M1KB 2BNXA 2L51A 1YRUB 3B86A 3NSOA 2CNPA 1TTXA 3DZTA 4YGEB 1FI5A 1ZFSA 1WDCC 4F7FA 2WCKA 2NZ0A 2ZKMX 3NHTA 3NXAA 1CDMA 2O5GA 5ER4X 2QDIA 2LC5A 4PDZA 2ZN8A 5CPVA 3V2LA 5KU1A 1M63B 3IQOA 5HKZA 1PSBA 2LMUA 1R6PA 1CNPA 1JFKA 2GGMA 1WRKA 5AANA 2EGDA 1IQ5A 3QRXA 2KQ6A 1FPWA 3IQQA 1BR4B 3A4UB 1K90D 1PK0D 2P6BB 4NDBA 1IIOA 4C0JA 2D8NA 1NWDA 4OVNF 1UURA 2BCBA 3CR4X 2KFGA 5B8IB 1B7TZ 1XFRA 4A4CA 1JFJA 1KK8C 2EC6C 2Y1MA 3UNWA 3TDUA 1TNPA 2K7OA 1BG1A 3BUNB 1DT7B 1VRKA 3GK2A 3S0AA 3O4YA 2FJYA 4ORCB 3ZWHA 1X02A 1YTZC 2LV7A 4KYNA 4BY5A 1EG4A 1SL8A 3D75A 1XO5A 2LUCA 1BMOA 3BUXB 2QACA 2ZNDA 1IQ3A 3TZ1A 4UPGA 4IJ7A 1AJ5A 3DF0A 1PALA 1OMRA 3CZ2A 1LKJA 1F8HA 1XFUO 1GGZA 3BYAA 1J1EA 5HKYA 1WRLA 1ORGA 3PM8A 1C07A 3CZ0A 3I5IC 2KQYA 1M39A 2KI6C 3JVTB 1CM1A 2M29A 3PALA 4WQ3A 2M97A 4DIRA 1XK4C 4NQGA 2JRFA 1S26D 3HCMA 5I2LA 1M46A 2WCHA 1UHHA 2PQLA 3AKBA 4PE1A 4INXA 1IG5A 1PVBA 3FWCA 5JOLA 2LE9B 2M9GA 3SIBA 1OOHA 2ERBA 1SKTA 1SCVA 4PHMA 1FW4A 1FF1A 2LVKA 1FI6A 1LA0A 1LS8A 3OX6A 1DJHA 1QLSA 1XFVO 1B47A 1D1OA 1B7TY 5FYXA 1IKUA 4I5KA 1K2HA 1CLLA 4YI9A 3WHTB 4TNCA 1YVHA 2LHLA 3BUWB 1DGUA 3L4LA 3UO9A 1U5IA 2HF5A 1OZSA 2JT3A 2P70A 3O2PA 3SS3A 3WXAA 1UWOA 3D74A 3FIAA 1AP4A 1AUIB 1DEKA 2WC6A 3C1VA 1H8BA 2E30A 2MRDA 2K60A 2K2FA 1LVCD 1PSRA 1TRFA 2F2OA 4PE0A 1ZOTB 2L5XB 2MJWB 3D77A 1LINA 1TOPA 3B7AA 5FI6A 4YGBB 3E3RA 3BFHA 1K9PA 1S3PA 2H61A 2I2RE 3R1PA 2KOTA 1YUTA 4MEWA 3AKAA 2LLUA 3S0EA 1F4QA 1OOGA 1OSAA 1ZACA 2PRUA 3PATA 4AOMA 4HRGA 1XFYO 3OX5A 5BPJA 1J55A 3EVVA 3RZSA 2LMVA 2OTGB 3HX4A 4DRWA 1NP8A 2Y4QA 3CTNA 1DQEA 1L2OB 3NSLA 3D0YB 1NCYA 3EVUA 4MRYA 1QV1A 1SPYA 2NCOA 1E8AA 2WCJA 3KHEA 4PT1A 1S6JA 1JSAA 2KYCA 2BBMA 1YR5A 1SL7A 1EL4A 3TS5C 1B4CA 1KSMA 5EL2A 1Y1XA 2ZFDA 1B8LA 2ISDA 1IJ5A 1F54A 4ZCUA 4AQIA 4GFTA 1F4OA 2M1UA 3BXKA 4INWA 1OMDA 1QVIY 2I18A 4YRUA 5D69A 4F0ZB 2WC8A 1N0YA 2K2AA 1SRAA 1WLMA 4OZDA 2H8VA 4PE4A 3CABA 1NX2A 4FQTA 1CFDA 2BL0B 1G8IA 2KLDA 2L2EA 2OS8B 2O60A 1HQVA 2K0JA 2KHNA 2KGRA 2ZRSA 4D1EA 1SR6C 4P2YB 4R1EA 5DICA 1CLBA 2F8PA 2JC2A 1XA5A 2KI4C 2LUXA 2JQ6A 2LP2A 5KSZA 3DYEA 2NCPA 2JOJA 3N7HA 1CDLA 2KNEA 3EG5B 1F55A 1CDPA 2WC5A 1CFCA 1SSEB 3PSRA 3OHMB 1QV0A 3A8RA 1K94A 2AUCA 1BLQA 2L4HA 4OV2A 1M31A 2GTEA 2ZN9A 3LLEA 5CSNA 5D3OA 5GQQC 2F2PA 3SJSA 5AXIA 1OOFA 3L47A 1NCXA 2RGIA 1IRJA 3EKJA 2JNXA 1HT9A 3FE8A 4GNKB 5D7FA 1NX3A 5HYDA 5FI2A 3S0BA 1YRTB 4M2QA 1G33A 1W7JB 3QMEA 3OB1B 2QPTA 1TUJA 3KPXA 4PCWA 1KQMC 3TUYB 1SCMC 1J7QA 2CBLA 2JWWA 2JT0A 4JWQA 1R2UA 1NX1A 2KGBC 2LANA 3TDZA 3VRPA 1KWOC 4ICBA 4CFRA 4E68A 2JT8A 1CM4A 1XK4A 1S6CA 2SASA 1A2XA 2LM5A 2OPOA 1GGWA 5KTYA 2SCPA 3SG4A 5J3XA 1UHJA 2CXJA 3O78A 1WDCB 4PHNA 4XYNA 4NDDA 4MRXA 2JZIA 1BT6A 1IJ6A 2L4IA 4I5LB 5HL1A 3VB1A 4CLNA 2BCXA 1S5GZ 3CR2A 2I7AA 1UHIA 2FCEA 1KQVA 3ZNIA 1RROA 1DC1A 1BOCA 1EH2A 3S0DA 5DKQA 2DOQA 4C0KA 2LLSA 4GPLB 1UP5A 3D0YA 3CWGA 2KBIA 3BJHA 1KFUL 2JXLA 2PASA 3D78A 1BR1B 2F33A 3VRRA 3RLZA 1ZMZA 3AAJA 3DVEA 1DF0A 5I8NA 1JWDA 1J7PA 2F3ZA 4DUQA 3JTDC 3S0GA 2BE4A 1C3ZA 1BU3A 1Y0VH 3SIAA 3DY9A 1OOIX 2FCDA 2V53A 3Q8IA 3BOWA 1SNLA 1WLZA 1KSOA 1KCYA 2JPTA 2Q4UA 3OP0A 5DKNA 3VGOA 4DS7A 2H2KA 3BQ3A 3I5IB 3CYZA 1QVIZ 1SMGA 1UUSA 3VRQA 4GGFA 1SBJA 3D73A 4IL1A 1QS7A 4JD9A 3SG5A 3RM1A 1TN4A 1S5GY 1MXEA 5JJGA 4CIDA 1MQ1A 2M49B 2PALA 3CDNA 1DJZA 4GBAA 1C3YA 3VROA 1PRWA 2KYFA 1CFPA 1LXFC 2WCMA 1IH0A 2KAYA 1B1GA 2KAVA 2L0PA 1CFFA 1RWYA 1Z4HA 2K7CA 2KI6D 1OQPA 2K7BA 1QASA 4YGDB 1OMVA 3I5HC 4ORAB 1NCZA 5HLOA 1NSHA 1NUBA 3I5GC 2LVIA 1YX8A 2JNFA 5DKRA 3B87A 1ZUZA 1YUSA 1DF0B 3R72A 2IS9A 2WOSA 3SG3A 3LCPC 2AAOA 1B9AA 1JBAA 3ICBA 3PN7B 1SY9A 1QTXA 2M3WA 3OBVA 3R1OA 1TNXA 1OZOA 2EHBA 3BOWB 1K96A 1DGVA 3GK1A 3KO0A 2PVBA 1NIWA 2K61A 2KDHA 3D10A 2BAPA 3FE9A 3AAKA 4JPZB 3LK1A 3PM2A 2L5YA 2LLTA 1OW4A 2TN4A 4BY4A 1KFUS 1Y6WA 1K9UA 1QX2A 3B6XA 3PJIA 2MLEC 5I94A 3NHIA 4CPVA 2M8UA 1CLMA 2R2IA 1V1GA 2WCEA 4N1FA 1QIVA 1S36A 2MA2A 4MZKA 2LVVA 1PVAA 1RFJA 1S6IA 1OE9B 2A4JA 1AJ4A 2COLB 2GV5A 4OCIA 5HLVA 4MZJA 2MHHA 4A4BA 3NSIA 1ALWA 1M45A 4OKHA 1F71A 3S0FA 4YGAA 2HPSA 1AK8A 4MSPA 2M7NA 1A29A 2CCMA 1FBVA 2K7DA 1QX5B 2M0RA 3EKHA 1K8UA 3PFVA 4I5JA 4OR9B 4PALA 4QJ4B 1TCFA 1N65A 4PHJA 2LNKA 3NSKA 1H4BA 3I5FB 2BECA 1PULA 1J7OA 3CR5X 1A75A 1BODA 1B8CA 5G08A 2CT9A 2BCAA 2L50A 3FWBA 4C0LA 1YUUA 3CS1A 1XFWO 4U8DA 2KFHA 3M0WA 4WRIA 1A4PA 1TWOA 1Y1AA 4NDCA 1YVLA 1SR6B 3BUMB 1KFXL 1EG3A 1YX7A 1CMFA 2KI4B 4JKTA 3BFAA 1UHNA 2QEHA 1T14A 3KEVA 1MR8A 1G4YR 1SYMA 3JVTC 5CSIA 1N2DA 4HREE 4FTGA 1IGVA 2KAXA 1J1DA 2G9BA 2ZRTA 1XFXO 2QEBA 4MZLA 1P28A 3WHUB 1SW8A 2JTZA 4CFQA 1AHRA 4FQOA 2PYQA 2FJUB 1DJGA 1EJ3A 4M2OA 4QJ3B 1DELA 5CSFA 3OGNA 1GM0A 1NX0A 1QJTA 1UHKA 2NLNA 3SS5A 5TNCA 1SK6D 1KK7Z 3LL8B 1IWQA 1JF0A 1Z2CB 2E6WA 4L9MA 1CB1A 1TNQA 2M7LA 3CZTX 3B88A 2G2BA 1KK8B 2EC6B 2NXQA 2L2CA 3LK0A 4Q04A 1J7RA 3DVJA 4XJKA 3D76A 2AMIA 4GAOA 2JU0A 1QIWA 3DXLA 2MBXA 1KQMB 3EK7A 1SCMB 2KPHA 2WNDA 1CDNA 1GJYA 1KWOB 1CMGA 1OOJA 3DVMA 1MUXA 1BF5A 1AVSA 1B8RA 2L98A 3KF9A 4ZCVA 1A03A 1QATA 4N1GA 3R1VA 2CTNA 2QEVA 4PHKA 1MHOA 1TCOB 1WY9A 1Y1UA 1A75B
chains in the Genus database with same CATH topology
5CSJA 2HQ8A 1GQMA 2FOTA 1QX7A 3F45A 3IF7A 1DVIA 1S1EA 1XYDA 2BE6A 2PMYA 3O6BA 4HSZA 1LA3A 5ER5A 1DJWA 1W7IB 5HKWA 3GOFA 1CKKA 1MWNA 1DJIA 2MAZA 2K8MB 1TNWA 1K9KA 1SL9A 2LHIA 2JULA 4PE7A 3H4SE 2OTGC 4I5NB 5I2QA 2Y5IA 1MXLC 4WQ2A 1NYAA 2Q91A 1L2OC 4MLWA 2ZNEA 1DMOA 1MF8B 1KK7Y 1JUOA 3JTDB 1ODBA 1DJXA 5F6TA 2JXCA 1K93D 2BKHB 3SG2A 4YBHB 2JTTA 2VRGA 1RTP1 3SG7A 1NPQA 2HQWA 3MSEB 1KFXS 3TDIA 3PLFB 2PSRA 4XJKB 2LAPA 4M2PA 2WORA 4YGCB 5AERA 3PN7C 4JQ0D 3DF0B 3OB2B 3SG6A 1V1FA 2HETA 3CLNA 5PALA 2KBMA 2KFFA 1YURA 1TIZA 2MLFC 1C7VA 2GGZA 1RJVA 4HRHA 4N5XA 4DCKA 2WCBA 4QJ5B 4YI8A 1XFZO 2LCPA 4GGFC 1JC2A 2BL0C 3DD4A 3DVKA 2OS8C 1DJYA 2Y1NA 1XVJA 4GUKA 1Q80A 2B1UA 1BJFA 2F3YA 5AFPA 5K89A 2BBNA 2H61C 1ALVA 3K21A 1L7ZA 1F70A 3EK8A 3VRNA 2LMTA 4MVFA 3I5HB 1QXPA 4P5OE 1RK9A 1QLKA 3I5GB 3GK4X 3FS7A 1RECA 4USLA 3WNXB 3EVRA 5IBWA 3BUOB 4MN0A 3CGAA 4ETOA 1DTLA 2WCFA 4ORBB 3TS5B 1JF2A 1U5IB 3I5FC 2KSPA 2LP3A 1WRZA 3EK4A 4MBEA 5AEQA 1C7WA 2LVJA 4GGNA 1EXRA 1K95A 4AQJA 3TUYC 1CTRA 2BKIB 2I94A 5I2OA 2M1KB 2L51A 1YRUB 3NSOA 2CNPA 1TTXA 4YGEB 1ZFSA 1WDCC 2NZ0A 2ZKMX 3NXAA 1CDMA 2O5GA 5ER4X 2LC5A 4PDZA 2ZN8A 5CPVA 5KU1A 1M63B 3IQOA 5HKZA 1PSBA 2LMUA 1R6PA 1CNPA 1JFKA 2GGMA 1WRKA 5AANA 2EGDA 1IQ5A 3QRXA 2KQ6A 1FPWA 3IQQA 1BR4B 3A4UB 1K90D 1PK0D 2P6BB 4NDBA 4C0JA 2D8NA 1NWDA 4OVNF 1UURA 2BCBA 3CR4X 2KFGA 5B8IB 1B7TZ 4A4CA 1JFJA 1KK8C 2EC6C 2Y1MA 3TDUA 1TNPA 2K7OA 1BG1A 3BUNB 1DT7B 1VRKA 3GK2A 3O4YA 4ORCB 3ZWHA 1X02A 1YTZC 2LV7A 4BY5A 1EG4A 1SL8A 1XO5A 2LUCA 1BMOA 3BUXB 2QACA 2ZNDA 1IQ3A 3TZ1A 4UPGA 1AJ5A 3DF0A 1PALA 1OMRA 1LKJA 1F8HA 1XFUO 1GGZA 3BYAA 1J1EA 5HKYA 1WRLA 3PM8A 1C07A 3I5IC 2KQYA 1M39A 2KI6C 3JVTB 1CM1A 2M29A 3PALA 4WQ3A 2M97A 4DIRA 1XK4C 4NQGA 2JRFA 1S26D 3HCMA 5I2LA 1M46A 1UHHA 3AKBA 4PE1A 1IG5A 1PVBA 3FWCA 5JOLA 2LE9B 2M9GA 3SIBA 1SKTA 1SCVA 4PHMA 1FW4A 1FF1A 2LVKA 1FI6A 1LA0A 3OX6A 1DJHA 1QLSA 1XFVO 1B47A 1D1OA 1B7TY 5FYXA 1IKUA 4I5KA 1K2HA 1CLLA 4YI9A 3WHTB 4TNCA 1YVHA 2LHLA 3BUWB 1DGUA 1U5IA 2HF5A 1OZSA 2JT3A 3O2PA 3WXAA 1UWOA 3FIAA 1AP4A 1AUIB 3C1VA 1H8BA 2E30A 2MRDA 2K2FA 1LVCD 1PSRA 1TRFA 2F2OA 4PE0A 1ZOTB 2L5XB 2MJWB 1LINA 1TOPA 4YGBB 3E3RA 1K9PA 1S3PA 2H61A 2I2RE 2KOTA 1YUTA 4MEWA 3AKAA 2LLUA 1F4QA 1OSAA 4AOMA 1ZACA 2PRUA 3PATA 4HRGA 1XFYO 3OX5A 5BPJA 1J55A 3EVVA 2LMVA 2OTGB 3HX4A 4DRWA 1NP8A 2Y4QA 3CTNA 1L2OB 3NSLA 3D0YB 1NCYA 3EVUA 4MRYA 1QV1A 1SPYA 2NCOA 1E8AA 3KHEA 1S6JA 1JSAA 2KYCA 2BBMA 1YR5A 1SL7A 1EL4A 3TS5C 1B4CA 1KSMA 1Y1XA 2ZFDA 1B8LA 2ISDA 1IJ5A 1F54A 4ZCUA 4AQIA 4GFTA 1F4OA 2M1UA 3BXKA 1OMDA 1QVIY 2I18A 4YRUA 5D69A 4F0ZB 2WC8A 1N0YA 2K2AA 1SRAA 1WLMA 4PE4A 1NX2A 1CFDA 2BL0B 1G8IA 2ZRSA 2L2EA 2OS8B 2O60A 1HQVA 2K0JA 2KHNA 2KGRA 4D1EA 1FI5A 1SR6C 4P2YB 4R1EA 1CLBA 2F8PA 2JC2A 1XA5A 2KI4C 2LUXA 2JQ6A 2LP2A 5KSZA 2NCPA 2JOJA 1CDLA 2KNEA 1F55A 1CDPA 1CFCA 3PSRA 3OHMB 1QV0A 3A8RA 1K94A 2AUCA 1BLQA 2L4HA 4OV2A 1M31A 3LLEA 2ZN9A 5CSNA 5GQQC 2F2PA 3SJSA 5AXIA 1NCXA 2RGIA 1IRJA 3EKJA 2JNXA 1HT9A 4GNKB 5D7FA 1NX3A 5HYDA 1YRTB 4M2QA 1G33A 1W7JB 3OB1B 2QPTA 3KPXA 4PCWA 1KQMC 3TUYB 1SCMC 1J7QA 2CBLA 2JWWA 2JT0A 4JWQA 1R2UA 1NX1A 2KGBC 2LANA 3TDZA 3VRPA 1KWOC 4ICBA 4CFRA 4E68A 2JT8A 1CM4A 1XK4A 1S6CA 2SASA 1A2XA 2LM5A 2OPOA 1GGWA 5KTYA 2SCPA 3SG4A 5J3XA 1UHJA 2CXJA 3O78A 1WDCB 4PHNA 4XYNA 4NDDA 4MRXA 2JZIA 1BT6A 1IJ6A 2L4IA 4I5LB 4CLNA 2BCXA 1S5GZ 3CR2A 2I7AA 1UHIA 2FCEA 1KQVA 3ZNIA 1RROA 1BOCA 1EH2A 5DKQA 2DOQA 4C0KA 2LLSA 4GPLB 1UP5A 3D0YA 3CWGA 2KBIA 1KFUL 2JXLA 2PASA 1BR1B 2F33A 3VRRA 3RLZA 1ZMZA 3AAJA 3DVEA 1DF0A 5I8NA 1JWDA 1J7PA 2F3ZA 4DUQA 3JTDC 2BE4A 1BU3A 1Y0VH 3SIAA 2FCDA 2V53A 3BOWA 1SNLA 1WLZA 1KSOA 1KCYA 2JPTA 2Q4UA 3OP0A 5DKNA 3VGOA 4DS7A 2H2KA 3BQ3A 3I5IB 1QVIZ 1SMGA 1UUSA 3VRQA 4GGFA 1SBJA 4IL1A 1QS7A 3SG5A 3RM1A 1TN4A 1S5GY 1MXEA 5JJGA 4CIDA 1MQ1A 2M49B 2PALA 1DJZA 4GBAA 3VROA 1PRWA 2KYFA 1CFPA 1LXFC 1IH0A 2KAYA 1B1GA 2KAVA 2L0PA 1CFFA 1RWYA 2K7CA 2KI6D 1OQPA 2K7BA 1QASA 4YGDB 1OMVA 3I5HC 4ORAB 1NCZA 5HLOA 1NSHA 1NUBA 3I5GC 2LVIA 1YX8A 2JNFA 5DKRA 1ZUZA 1YUSA 1DF0B 2IS9A 2WOSA 3SG3A 3LCPC 2AAOA 1B9AA 1JBAA 3ICBA 3PN7B 1SY9A 1QTXA 2M3WA 1TNXA 1OZOA 2EHBA 3BOWB 1K96A 1DGVA 3GK1A 3KO0A 2PVBA 1NIWA 2K61A 2KDHA 3D10A 4JPZB 3AAKA 3LK1A 2TN4A 2LLTA 4BY4A 1KFUS 1Y6WA 1K9UA 1QX2A 2MLEC 4CPVA 2M8UA 1CLMA 2R2IA 1V1GA 2WCEA 4N1FA 1QIVA 1S36A 2MA2A 4MZKA 2LVVA 1PVAA 1RFJA 1S6IA 1OE9B 2A4JA 1AJ4A 2COLB 2GV5A 4OCIA 5HLVA 4MZJA 2MHHA 4A4BA 3NSIA 1ALWA 1M45A 4OKHA 1F71A 1AK8A 4YGAA 2HPSA 4MSPA 2M7NA 1A29A 2CCMA 1FBVA 2K7DA 1QX5B 2M0RA 3EKHA 1K8UA 3PFVA 4I5JA 4OR9B 4PALA 4QJ4B 1TCFA 1N65A 4PHJA 2LNKA 3NSKA 1H4BA 3I5FB 2BECA 1PULA 1J7OA 3CR5X 1A75A 1BODA 1B8CA 5G08A 2CT9A 2BCAA 2L50A 3FWBA 4C0LA 1YUUA 3CS1A 1XFWO 4U8DA 2KFHA 3M0WA 4WRIA 1A4PA 1Y1AA 4NDCA 1YVLA 1SR6B 3BUMB 1KFXL 1EG3A 1YX7A 1CMFA 2KI4B 1UHNA 3KEVA 1MR8A 1G4YR 1SYMA 3JVTC 5CSIA 1N2DA 4HREE 4FTGA 1IGVA 2KAXA 1J1DA 2G9BA 2ZRTA 1XFXO 4MZLA 3WHUB 1SW8A 2JTZA 4CFQA 1AHRA 4FQOA 2FJUB 1DJGA 1EJ3A 4M2OA 4QJ3B 5CSFA 1NX0A 1QJTA 1UHKA 2NLNA 5TNCA 1SK6D 1KK7Z 3LL8B 1IWQA 1JF0A 2E6WA 4L9MA 1CB1A 1TNQA 2M7LA 3CZTX 2G2BA 1KK8B 2EC6B 2NXQA 3LK0A 4Q04A 4XJKA 1J7RA 3DVJA 2MBXA 2AMIA 4GAOA 2JU0A 1QIWA 1KQMB 3EK7A 1SCMB 2WNDA 1CDNA 1GJYA 1KWOB 1CMGA 1OOJA 3DVMA 1MUXA 1BF5A 1AVSA 1B8RA 2L98A 3KF9A 4ZCVA 1A03A 1QATA 4N1GA 2CTNA 4PHKA 1MHOA 1TCOB 1WY9A 1Y1UA 1A75B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CSJ A;  2HQ8 A;  1GQM A;  2FOT A;  1QX7 A;  3F45 A;  3IF7 A;  1DVI A;  1S1E A;  1XYD A;  2BE6 A;  2PMY A;  3O6B A;  4HSZ A;  1LA3 A;  5ER5 A;  1DJW A;  1W7I B;  5HKW A;  3GOF A;  1CKK A;  1MWN A;  1DJI A;  2MAZ A;  2K8M B;  1TNW A;  1K9K A;  1SL9 A;  2LHI A;  2JUL A;  4PE7 A;  3H4S E;  2OTG C;  4I5N B;  5I2Q A;  2Y5I A;  1MXL C;  4WQ2 A;  1NYA A;  2Q91 A;  1L2O C;  4MLW A;  2ZNE A;  1DMO A;  1MF8 B;  1KK7 Y;  1JUO A;  3JTD B;  1ODB A;  1DJX A;  5F6T A;  2JXC A;  1K93 D;  2BKH B;  3SG2 A;  4YBH B;  2JTT A;  2VRG A;  1RTP 1;  3SG7 A;  1NPQ A;  2HQW A;  3MSE B;  1KFX S;  3TDI A;  3PLF B;  2PSR A;  4XJK B;  2LAP A;  4M2P A;  2WOR A;  4YGC B;  5AER A;  3PN7 C;  4JQ0 D;  3DF0 B;  3OB2 B;  3SG6 A;  1V1F A;  2HET A;  3CLN A;  5PAL A;  2KBM A;  2KFF A;  1YUR A;  1TIZ A;  2MLF C;  1C7V A;  2GGZ A;  1RJV A;  4HRH A;  4N5X A;  4DCK A;  2WCB A;  4QJ5 B;  4YI8 A;  1XFZ O;  2LCP A;  4GGF C;  1JC2 A;  2BL0 C;  3DD4 A;  3DVK A;  2OS8 C;  1DJY A;  2Y1N A;  1XVJ A;  4GUK A;  1Q80 A;  2B1U A;  1BJF A;  2F3Y A;  5AFP A;  5K89 A;  2BBN A;  2H61 C;  1ALV A;  3K21 A;  1L7Z A;  1F70 A;  3EK8 A;  3VRN A;  2LMT A;  4MVF A;  3I5H B;  1QXP A;  4P5O E;  1RK9 A;  1QLK A;  3I5G B;  3GK4 X;  3FS7 A;  1REC A;  4USL A;  3WNX B;  3EVR A;  5IBW A;  3BUO B;  4MN0 A;  3CGA A;  4ETO A;  1DTL A;  2WCF A;  4ORB B;  3TS5 B;  1JF2 A;  1U5I B;  3I5F C;  2KSP A;  2LP3 A;  1WRZ A;  3EK4 A;  4MBE A;  5AEQ A;  1C7W A;  2LVJ A;  4GGN A;  1EXR A;  1K95 A;  4AQJ A;  3TUY C;  1CTR A;  2BKI B;  2I94 A;  5I2O A;  2M1K B;  2L51 A;  1YRU B;  3NSO A;  2CNP A;  1TTX A;  4YGE B;  1ZFS A;  1WDC C;  2NZ0 A;  2ZKM X;  3NXA A;  1CDM A;  2O5G A;  5ER4 X;  2LC5 A;  4PDZ A;  2ZN8 A;  5CPV A;  5KU1 A;  1M63 B;  3IQO A;  5HKZ A;  1PSB A;  2LMU A;  1R6P A;  1CNP A;  1JFK A;  2GGM A;  1WRK A;  5AAN A;  2EGD A;  1IQ5 A;  3QRX A;  2KQ6 A;  1FPW A;  3IQQ A;  1BR4 B;  3A4U B;  1K90 D;  1PK0 D;  2P6B B;  4NDB A;  4C0J A;  2D8N A;  1NWD A;  4OVN F;  1UUR A;  2BCB A;  3CR4 X;  2KFG A;  5B8I B;  1B7T Z;  4A4C A;  1JFJ A;  1KK8 C;  2EC6 C;  2Y1M A;  3TDU A;  1TNP A;  2K7O A;  1BG1 A;  3BUN B;  1DT7 B;  1VRK A;  3GK2 A;  3O4Y A;  4ORC B;  3ZWH A;  1X02 A;  1YTZ C;  2LV7 A;  4BY5 A;  1EG4 A;  1SL8 A;  1XO5 A;  2LUC A;  1BMO A;  3BUX B;  2QAC A;  2ZND A;  1IQ3 A;  3TZ1 A;  4UPG A;  1AJ5 A;  3DF0 A;  1PAL A;  1OMR A;  1LKJ A;  1F8H A;  1XFU O;  1GGZ A;  3BYA A;  1J1E A;  5HKY A;  1WRL A;  3PM8 A;  1C07 A;  3I5I C;  2KQY A;  1M39 A;  2KI6 C;  3JVT B;  1CM1 A;  2M29 A;  3PAL A;  4WQ3 A;  2M97 A;  4DIR A;  1XK4 C;  4NQG A;  2JRF A;  1S26 D;  3HCM A;  5I2L A;  1M46 A;  1UHH A;  3AKB A;  4PE1 A;  1IG5 A;  1PVB A;  3FWC A;  5JOL A;  2LE9 B;  2M9G A;  3SIB A;  1SKT A;  1SCV A;  4PHM A;  1FW4 A;  1FF1 A;  2LVK A;  1FI6 A;  1LA0 A;  3OX6 A;  1DJH A;  1QLS A;  1XFV O;  1B47 A;  1D1O A;  1B7T Y;  5FYX A;  1IKU A;  4I5K A;  1K2H A;  1CLL A;  4YI9 A;  3WHT B;  4TNC A;  1YVH A;  2LHL A;  3BUW B;  1DGU A;  1U5I A;  2HF5 A;  1OZS A;  2JT3 A;  3O2P A;  3WXA A;  1UWO A;  3FIA A;  1AP4 A;  1AUI B;  3C1V A;  1H8B A;  2E30 A;  2MRD A;  2K2F A;  1LVC D;  1PSR A;  1TRF A;  2F2O A;  4PE0 A;  1ZOT B;  2L5X B;  2MJW B;  1LIN A;  1TOP A;  4YGB B;  3E3R A;  1K9P A;  1S3P A;  2H61 A;  2I2R E;  2KOT A;  1YUT A;  4MEW A;  3AKA A;  2LLU A;  1F4Q A;  1OSA A;  4AOM A;  1ZAC A;  2PRU A;  3PAT A;  4HRG A;  1XFY O;  3OX5 A;  5BPJ A;  1J55 A;  3EVV A;  2LMV A;  2OTG B;  3HX4 A;  4DRW A;  1NP8 A;  2Y4Q A;  3CTN A;  1L2O B;  3NSL A;  3D0Y B;  1NCY A;  3EVU A;  4MRY A;  1QV1 A;  1SPY A;  2NCO A;  1E8A A;  3KHE A;  1S6J A;  1JSA A;  2KYC A;  2BBM A;  1YR5 A;  1SL7 A;  1EL4 A;  3TS5 C;  1B4C A;  1KSM A;  1Y1X A;  2ZFD A;  1B8L A;  2ISD A;  1IJ5 A;  1F54 A;  4ZCU A;  4AQI A;  4GFT A;  1F4O A;  2M1U A;  3BXK A;  1OMD A;  1QVI Y;  2I18 A;  4YRU A;  5D69 A;  4F0Z B;  2WC8 A;  1N0Y A;  2K2A A;  1SRA A;  1WLM A;  4PE4 A;  1NX2 A;  1CFD A;  2BL0 B;  1G8I A;  2ZRS A;  2L2E A;  2OS8 B;  2O60 A;  1HQV A;  2K0J A;  2KHN A;  2KGR A;  4D1E A;  1FI5 A;  1SR6 C;  4P2Y B;  4R1E A;  1CLB A;  2F8P A;  2JC2 A;  1XA5 A;  2KI4 C;  2LUX A;  2JQ6 A;  2LP2 A;  5KSZ A;  2NCP A;  2JOJ A;  1CDL A;  2KNE A;  1F55 A;  1CDP A;  1CFC A;  3PSR A;  3OHM B;  1QV0 A;  3A8R A;  1K94 A;  2AUC A;  1BLQ A;  2L4H A;  4OV2 A;  1M31 A;  3LLE A;  2ZN9 A;  5CSN A;  5GQQ C;  2F2P A;  3SJS A;  5AXI A;  1NCX A;  2RGI A;  1IRJ A;  3EKJ A;  2JNX A;  1HT9 A;  4GNK B;  5D7F A;  1NX3 A;  5HYD A;  1YRT B;  4M2Q A;  1G33 A;  1W7J B;  3OB1 B;  2QPT A;  3KPX A;  4PCW A;  1KQM C;  3TUY B;  1SCM C;  1J7Q A;  2CBL A;  2JWW A;  2JT0 A;  4JWQ A;  1R2U A;  1NX1 A;  2KGB C;  2LAN A;  3TDZ A;  3VRP A;  1KWO C;  4ICB A;  4CFR A;  4E68 A;  2JT8 A;  1CM4 A;  1XK4 A;  1S6C A;  2SAS A;  1A2X A;  2LM5 A;  2OPO A;  1GGW A;  5KTY A;  2SCP A;  3SG4 A;  5J3X A;  1UHJ A;  2CXJ A;  3O78 A;  1WDC B;  4PHN A;  4XYN A;  4NDD A;  4MRX A;  2JZI A;  1BT6 A;  1IJ6 A;  2L4I A;  4I5L B;  4CLN A;  2BCX A;  1S5G Z;  3CR2 A;  2I7A A;  1UHI A;  2FCE A;  1KQV A;  3ZNI A;  1RRO A;  1BOC A;  1EH2 A;  5DKQ A;  2DOQ A;  4C0K A;  2LLS A;  4GPL B;  1UP5 A;  3D0Y A;  3CWG A;  2KBI A;  1KFU L;  2JXL A;  2PAS A;  1BR1 B;  2F33 A;  3VRR A;  3RLZ A;  1ZMZ A;  3AAJ A;  3DVE A;  1DF0 A;  5I8N A;  1JWD A;  1J7P A;  2F3Z A;  4DUQ A;  3JTD C;  2BE4 A;  1BU3 A;  1Y0V H;  3SIA A;  2FCD A;  2V53 A;  3BOW A;  1SNL A;  1WLZ A;  1KSO A;  1KCY A;  2JPT A;  2Q4U A;  3OP0 A;  5DKN A;  3VGO A;  4DS7 A;  2H2K A;  3BQ3 A;  3I5I B;  1QVI Z;  1SMG A;  1UUS A;  3VRQ A;  4GGF A;  1SBJ A;  4IL1 A;  1QS7 A;  3SG5 A;  3RM1 A;  1TN4 A;  1S5G Y;  1MXE A;  5JJG A;  4CID A;  1MQ1 A;  2M49 B;  2PAL A;  1DJZ A;  4GBA A;  3VRO A;  1PRW A;  2KYF A;  1CFP A;  1LXF C;  1IH0 A;  2KAY A;  1B1G A;  2KAV A;  2L0P A;  1CFF A;  1RWY A;  2K7C A;  2KI6 D;  1OQP A;  2K7B A;  1QAS A;  4YGD B;  1OMV A;  3I5H C;  4ORA B;  1NCZ A;  5HLO A;  1NSH A;  1NUB A;  3I5G C;  2LVI A;  1YX8 A;  2JNF A;  5DKR A;  1ZUZ A;  1YUS A;  1DF0 B;  2IS9 A;  2WOS A;  3SG3 A;  3LCP C;  2AAO A;  1B9A A;  1JBA A;  3ICB A;  3PN7 B;  1SY9 A;  1QTX A;  2M3W A;  1TNX A;  1OZO A;  2EHB A;  3BOW B;  1K96 A;  1DGV A;  3GK1 A;  3KO0 A;  2PVB A;  1NIW A;  2K61 A;  2KDH A;  3D10 A;  4JPZ B;  3AAK A;  3LK1 A;  2TN4 A;  2LLT A;  4BY4 A;  1KFU S;  1Y6W A;  1K9U A;  1QX2 A;  2MLE C;  4CPV A;  2M8U A;  1CLM A;  2R2I A;  1V1G A;  2WCE A;  4N1F A;  1QIV A;  1S36 A;  2MA2 A;  4MZK A;  2LVV A;  1PVA A;  1RFJ A;  1S6I A;  1OE9 B;  2A4J A;  1AJ4 A;  2COL B;  2GV5 A;  4OCI A;  5HLV A;  4MZJ A;  2MHH A;  4A4B A;  3NSI A;  1ALW A;  1M45 A;  4OKH A;  1F71 A;  1AK8 A;  4YGA A;  2HPS A;  4MSP A;  2M7N A;  1A29 A;  2CCM A;  1FBV A;  2K7D A;  1QX5 B;  2M0R A;  3EKH A;  1K8U A;  3PFV A;  4I5J A;  4OR9 B;  4PAL A;  4QJ4 B;  1TCF A;  1N65 A;  4PHJ A;  2LNK A;  3NSK A;  1H4B A;  3I5F B;  2BEC A;  1PUL A;  1J7O A;  3CR5 X;  1A75 A;  1BOD A;  1B8C A;  5G08 A;  2CT9 A;  2BCA A;  2L50 A;  3FWB A;  4C0L A;  1YUU A;  3CS1 A;  1XFW O;  4U8D A;  2KFH A;  3M0W A;  4WRI A;  1A4P A;  1Y1A A;  4NDC A;  1YVL A;  1SR6 B;  3BUM B;  1KFX L;  1EG3 A;  1YX7 A;  1CMF A;  2KI4 B;  1UHN A;  3KEV A;  1MR8 A;  1G4Y R;  1SYM A;  3JVT C;  5CSI A;  1N2D A;  4HRE E;  4FTG A;  1IGV A;  2KAX A;  1J1D A;  2G9B A;  2ZRT A;  1XFX O;  4MZL A;  3WHU B;  1SW8 A;  2JTZ A;  4CFQ A;  1AHR A;  4FQO A;  2FJU B;  1DJG A;  1EJ3 A;  4M2O A;  4QJ3 B;  5CSF A;  1NX0 A;  1QJT A;  1UHK A;  2NLN A;  5TNC A;  1SK6 D;  1KK7 Z;  3LL8 B;  1IWQ A;  1JF0 A;  2E6W A;  4L9M A;  1CB1 A;  1TNQ A;  2M7L A;  3CZT X;  2G2B A;  1KK8 B;  2EC6 B;  2NXQ A;  3LK0 A;  4Q04 A;  4XJK A;  1J7R A;  3DVJ A;  2MBX A;  2AMI A;  4GAO A;  2JU0 A;  1QIW A;  1KQM B;  3EK7 A;  1SCM B;  2WND A;  1CDN A;  1GJY A;  1KWO B;  1CMG A;  1OOJ A;  3DVM A;  1MUX A;  1BF5 A;  1AVS A;  1B8R A;  2L98 A;  3KF9 A;  4ZCV A;  1A03 A;  1QAT A;  4N1G A;  2CTN A;  4PHK A;  1MHO A;  1TCO B;  1WY9 A;  1Y1U A;  1A75 B; 
#chains in the Genus database with same CATH topology
 5CSJ A;  2HQ8 A;  1GQM A;  2FOT A;  1QX7 A;  3F45 A;  3FE6 A;  3IF7 A;  1DVI A;  1S1E A;  1XYD A;  2BE6 A;  2PMY A;  3O6B A;  4HSZ A;  1LA3 A;  5ER5 A;  1DJW A;  1W7I B;  5HKW A;  3GOF A;  1CKK A;  2YGU A;  1MWN A;  1DJI A;  2MAZ A;  2K8M B;  1TNW A;  1K9K A;  2QEO A;  1SL9 A;  2LHI A;  2JUL A;  4PE7 A;  3H4S E;  2OTG C;  4I5N B;  5I2Q A;  2Y5I A;  2KLE A;  1MXL C;  4WQ2 A;  1NYA A;  2Q91 A;  1L2O C;  4MLW A;  1W9Z A;  2ZNE A;  1DMO A;  1MF8 B;  3K1E A;  1KK7 Y;  1JUO A;  3JTD B;  1ODB A;  1DJX A;  5F6T A;  2JXC A;  1K93 D;  2BKH B;  3SG2 A;  4YBH B;  2JTT A;  2VRG A;  1RTP 1;  3SG7 A;  1NPQ A;  2HQW A;  3MSE B;  1KFX S;  3TDI A;  2P71 A;  3PLF B;  2PSR A;  4XJK B;  2LAP A;  4M2P A;  2WOR A;  4YGC B;  3SS4 A;  3PN7 C;  5AER A;  4JQ0 D;  3DF0 B;  3OB2 B;  3SG6 A;  1V1F A;  2HET A;  3CLN A;  5PAL A;  3IVT A;  3L4A A;  1TUZ A;  2KBM A;  2JPO A;  2KFF A;  1YUR A;  1TIZ A;  2MLF C;  1C7V A;  2GGZ A;  1RJV A;  4HRH A;  4N5X A;  4DCK A;  2WCB A;  4QJ5 B;  1QWV A;  2WCL A;  3BFB A;  4YI8 A;  1XFZ O;  2LCP A;  4GGF C;  1JC2 A;  2BL0 C;  3DD4 A;  3DVK A;  2OS8 C;  1DJY A;  2Y1N A;  1XVJ A;  4GUK A;  1Q80 A;  2B1U A;  1BJF A;  2F3Y A;  5AFP A;  5K89 A;  2BBN A;  2H61 C;  1ALV A;  3NGV A;  3K21 A;  1L7Z A;  1F70 A;  3EK8 A;  3VRN A;  2LMT A;  3CZ1 A;  4MVF A;  3I5H B;  1QXP A;  4P5O E;  1RK9 A;  1QLK A;  3I5G B;  3GK4 X;  3FS7 A;  1REC A;  4USL A;  3WNX B;  3EVR A;  5IBW A;  3BUO B;  4MN0 A;  3CGA A;  4ETO A;  1DTL A;  2WCF A;  4ORB B;  3TS5 B;  1JF2 A;  1U5I B;  3I5F C;  2KSP A;  2LP3 A;  5FI7 A;  1WRZ A;  3EK4 A;  3O4X A;  4MBE A;  5AEQ A;  1C7W A;  2LVJ A;  4GGN A;  1EXR A;  1K95 A;  4AQJ A;  3TUY C;  1CTR A;  2BKI B;  2I94 A;  5I2O A;  2M1K B;  2BNX A;  2L51 A;  1YRU B;  3B86 A;  3NSO A;  2CNP A;  1TTX A;  3DZT A;  4YGE B;  1FI5 A;  1ZFS A;  1WDC C;  4F7F A;  2WCK A;  2NZ0 A;  2ZKM X;  3NHT A;  3NXA A;  1CDM A;  2O5G A;  5ER4 X;  2QDI A;  2LC5 A;  4PDZ A;  2ZN8 A;  5CPV A;  3V2L A;  5KU1 A;  1M63 B;  3IQO A;  5HKZ A;  1PSB A;  2LMU A;  1R6P A;  1CNP A;  1JFK A;  2GGM A;  1WRK A;  5AAN A;  2EGD A;  1IQ5 A;  3QRX A;  2KQ6 A;  1FPW A;  3IQQ A;  1BR4 B;  3A4U B;  1K90 D;  1PK0 D;  2P6B B;  4NDB A;  1IIO A;  4C0J A;  2D8N A;  1NWD A;  4OVN F;  1UUR A;  2BCB A;  3CR4 X;  2KFG A;  5B8I B;  1B7T Z;  1XFR A;  4A4C A;  1JFJ A;  1KK8 C;  2EC6 C;  2Y1M A;  3UNW A;  3TDU A;  1TNP A;  2K7O A;  1BG1 A;  3BUN B;  1DT7 B;  1VRK A;  3GK2 A;  3S0A A;  3O4Y A;  2FJY A;  4ORC B;  3ZWH A;  1X02 A;  1YTZ C;  2LV7 A;  4KYN A;  4BY5 A;  1EG4 A;  1SL8 A;  3D75 A;  1XO5 A;  2LUC A;  1BMO A;  3BUX B;  2QAC A;  2ZND A;  1IQ3 A;  3TZ1 A;  4UPG A;  4IJ7 A;  1AJ5 A;  3DF0 A;  1PAL A;  1OMR A;  3CZ2 A;  1LKJ A;  1F8H A;  1XFU O;  1GGZ A;  3BYA A;  1J1E A;  5HKY A;  1WRL A;  1ORG A;  3PM8 A;  1C07 A;  3CZ0 A;  3I5I C;  2KQY A;  1M39 A;  2KI6 C;  3JVT B;  1CM1 A;  2M29 A;  3PAL A;  4WQ3 A;  2M97 A;  4DIR A;  1XK4 C;  4NQG A;  2JRF A;  1S26 D;  3HCM A;  5I2L A;  1M46 A;  2WCH A;  1UHH A;  2PQL A;  3AKB A;  4PE1 A;  4INX A;  1IG5 A;  1PVB A;  3FWC A;  5JOL A;  2LE9 B;  2M9G A;  3SIB A;  1OOH A;  2ERB A;  1SKT A;  1SCV A;  4PHM A;  1FW4 A;  1FF1 A;  2LVK A;  1FI6 A;  1LA0 A;  1LS8 A;  3OX6 A;  1DJH A;  1QLS A;  1XFV O;  1B47 A;  1D1O A;  1B7T Y;  5FYX A;  1IKU A;  4I5K A;  1K2H A;  1CLL A;  4YI9 A;  3WHT B;  4TNC A;  1YVH A;  2LHL A;  3BUW B;  1DGU A;  3L4L A;  3UO9 A;  1U5I A;  2HF5 A;  1OZS A;  2JT3 A;  2P70 A;  3O2P A;  3SS3 A;  3WXA A;  1UWO A;  3D74 A;  3FIA A;  1AP4 A;  1AUI B;  1DEK A;  2WC6 A;  3C1V A;  1H8B A;  2E30 A;  2MRD A;  2K60 A;  2K2F A;  1LVC D;  1PSR A;  1TRF A;  2F2O A;  4PE0 A;  1ZOT B;  2L5X B;  2MJW B;  3D77 A;  1LIN A;  1TOP A;  3B7A A;  5FI6 A;  4YGB B;  3E3R A;  3BFH A;  1K9P A;  1S3P A;  2H61 A;  2I2R E;  3R1P A;  2KOT A;  1YUT A;  4MEW A;  3AKA A;  2LLU A;  3S0E A;  1F4Q A;  1OOG A;  1OSA A;  1ZAC A;  2PRU A;  3PAT A;  4AOM A;  4HRG A;  1XFY O;  3OX5 A;  5BPJ A;  1J55 A;  3EVV A;  3RZS A;  2LMV A;  2OTG B;  3HX4 A;  4DRW A;  1NP8 A;  2Y4Q A;  3CTN A;  1DQE A;  1L2O B;  3NSL A;  3D0Y B;  1NCY A;  3EVU A;  4MRY A;  1QV1 A;  1SPY A;  2NCO A;  1E8A A;  2WCJ A;  3KHE A;  4PT1 A;  1S6J A;  1JSA A;  2KYC A;  2BBM A;  1YR5 A;  1SL7 A;  1EL4 A;  3TS5 C;  1B4C A;  1KSM A;  5EL2 A;  1Y1X A;  2ZFD A;  1B8L A;  2ISD A;  1IJ5 A;  1F54 A;  4ZCU A;  4AQI A;  4GFT A;  1F4O A;  2M1U A;  3BXK A;  4INW A;  1OMD A;  1QVI Y;  2I18 A;  4YRU A;  5D69 A;  4F0Z B;  2WC8 A;  1N0Y A;  2K2A A;  1SRA A;  1WLM A;  4OZD A;  2H8V A;  4PE4 A;  3CAB A;  1NX2 A;  4FQT A;  1CFD A;  2BL0 B;  1G8I A;  2KLD A;  2L2E A;  2OS8 B;  2O60 A;  1HQV A;  2K0J A;  2KHN A;  2KGR A;  2ZRS A;  4D1E A;  1SR6 C;  4P2Y B;  4R1E A;  5DIC A;  1CLB A;  2F8P A;  2JC2 A;  1XA5 A;  2KI4 C;  2LUX A;  2JQ6 A;  2LP2 A;  5KSZ A;  3DYE A;  2NCP A;  2JOJ A;  3N7H A;  1CDL A;  2KNE A;  3EG5 B;  1F55 A;  1CDP A;  2WC5 A;  1CFC A;  1SSE B;  3PSR A;  3OHM B;  1QV0 A;  3A8R A;  1K94 A;  2AUC A;  1BLQ A;  2L4H A;  4OV2 A;  1M31 A;  2GTE A;  2ZN9 A;  3LLE A;  5CSN A;  5D3O A;  5GQQ C;  2F2P A;  3SJS A;  5AXI A;  1OOF A;  3L47 A;  1NCX A;  2RGI A;  1IRJ A;  3EKJ A;  2JNX A;  1HT9 A;  3FE8 A;  4GNK B;  5D7F A;  1NX3 A;  5HYD A;  5FI2 A;  3S0B A;  1YRT B;  4M2Q A;  1G33 A;  1W7J B;  3QME A;  3OB1 B;  2QPT A;  1TUJ A;  3KPX A;  4PCW A;  1KQM C;  3TUY B;  1SCM C;  1J7Q A;  2CBL A;  2JWW A;  2JT0 A;  4JWQ A;  1R2U A;  1NX1 A;  2KGB C;  2LAN A;  3TDZ A;  3VRP A;  1KWO C;  4ICB A;  4CFR A;  4E68 A;  2JT8 A;  1CM4 A;  1XK4 A;  1S6C A;  2SAS A;  1A2X A;  2LM5 A;  2OPO A;  1GGW A;  5KTY A;  2SCP A;  3SG4 A;  5J3X A;  1UHJ A;  2CXJ A;  3O78 A;  1WDC B;  4PHN A;  4XYN A;  4NDD A;  4MRX A;  2JZI A;  1BT6 A;  1IJ6 A;  2L4I A;  4I5L B;  5HL1 A;  3VB1 A;  4CLN A;  2BCX A;  1S5G Z;  3CR2 A;  2I7A A;  1UHI A;  2FCE A;  1KQV A;  3ZNI A;  1RRO A;  1DC1 A;  1BOC A;  1EH2 A;  3S0D A;  5DKQ A;  2DOQ A;  4C0K A;  2LLS A;  4GPL B;  1UP5 A;  3D0Y A;  3CWG A;  2KBI A;  3BJH A;  1KFU L;  2JXL A;  2PAS A;  3D78 A;  1BR1 B;  2F33 A;  3VRR A;  3RLZ A;  1ZMZ A;  3AAJ A;  3DVE A;  1DF0 A;  5I8N A;  1JWD A;  1J7P A;  2F3Z A;  4DUQ A;  3JTD C;  3S0G A;  2BE4 A;  1C3Z A;  1BU3 A;  1Y0V H;  3SIA A;  3DY9 A;  1OOI X;  2FCD A;  2V53 A;  3Q8I A;  3BOW A;  1SNL A;  1WLZ A;  1KSO A;  1KCY A;  2JPT A;  2Q4U A;  3OP0 A;  5DKN A;  3VGO A;  4DS7 A;  2H2K A;  3BQ3 A;  3I5I B;  3CYZ A;  1QVI Z;  1SMG A;  1UUS A;  3VRQ A;  4GGF A;  1SBJ A;  3D73 A;  4IL1 A;  1QS7 A;  4JD9 A;  3SG5 A;  3RM1 A;  1TN4 A;  1S5G Y;  1MXE A;  5JJG A;  4CID A;  1MQ1 A;  2M49 B;  2PAL A;  3CDN A;  1DJZ A;  4GBA A;  1C3Y A;  3VRO A;  1PRW A;  2KYF A;  1CFP A;  1LXF C;  2WCM A;  1IH0 A;  2KAY A;  1B1G A;  2KAV A;  2L0P A;  1CFF A;  1RWY A;  1Z4H A;  2K7C A;  2KI6 D;  1OQP A;  2K7B A;  1QAS A;  4YGD B;  1OMV A;  3I5H C;  4ORA B;  1NCZ A;  5HLO A;  1NSH A;  1NUB A;  3I5G C;  2LVI A;  1YX8 A;  2JNF A;  5DKR A;  3B87 A;  1ZUZ A;  1YUS A;  1DF0 B;  3R72 A;  2IS9 A;  2WOS A;  3SG3 A;  3LCP C;  2AAO A;  1B9A A;  1JBA A;  3ICB A;  3PN7 B;  1SY9 A;  1QTX A;  2M3W A;  3OBV A;  3R1O A;  1TNX A;  1OZO A;  2EHB A;  3BOW B;  1K96 A;  1DGV A;  3GK1 A;  3KO0 A;  2PVB A;  1NIW A;  2K61 A;  2KDH A;  3D10 A;  2BAP A;  3FE9 A;  3AAK A;  4JPZ B;  3LK1 A;  3PM2 A;  2L5Y A;  2LLT A;  1OW4 A;  2TN4 A;  4BY4 A;  1KFU S;  1Y6W A;  1K9U A;  1QX2 A;  3B6X A;  3PJI A;  2MLE C;  5I94 A;  3NHI A;  4CPV A;  2M8U A;  1CLM A;  2R2I A;  1V1G A;  2WCE A;  4N1F A;  1QIV A;  1S36 A;  2MA2 A;  4MZK A;  2LVV A;  1PVA A;  1RFJ A;  1S6I A;  1OE9 B;  2A4J A;  1AJ4 A;  2COL B;  2GV5 A;  4OCI A;  5HLV A;  4MZJ A;  2MHH A;  4A4B A;  3NSI A;  1ALW A;  1M45 A;  4OKH A;  1F71 A;  3S0F A;  4YGA A;  2HPS A;  1AK8 A;  4MSP A;  2M7N A;  1A29 A;  2CCM A;  1FBV A;  2K7D A;  1QX5 B;  2M0R A;  3EKH A;  1K8U A;  3PFV A;  4I5J A;  4OR9 B;  4PAL A;  4QJ4 B;  1TCF A;  1N65 A;  4PHJ A;  2LNK A;  3NSK A;  1H4B A;  3I5F B;  2BEC A;  1PUL A;  1J7O A;  3CR5 X;  1A75 A;  1BOD A;  1B8C A;  5G08 A;  2CT9 A;  2BCA A;  2L50 A;  3FWB A;  4C0L A;  1YUU A;  3CS1 A;  1XFW O;  4U8D A;  2KFH A;  3M0W A;  4WRI A;  1A4P A;  1TWO A;  1Y1A A;  4NDC A;  1YVL A;  1SR6 B;  3BUM B;  1KFX L;  1EG3 A;  1YX7 A;  1CMF A;  2KI4 B;  4JKT A;  3BFA A;  1UHN A;  2QEH A;  1T14 A;  3KEV A;  1MR8 A;  1G4Y R;  1SYM A;  3JVT C;  5CSI A;  1N2D A;  4HRE E;  4FTG A;  1IGV A;  2KAX A;  1J1D A;  2G9B A;  2ZRT A;  1XFX O;  2QEB A;  4MZL A;  1P28 A;  3WHU B;  1SW8 A;  2JTZ A;  4CFQ A;  1AHR A;  4FQO A;  2PYQ A;  2FJU B;  1DJG A;  1EJ3 A;  4M2O A;  4QJ3 B;  1DEL A;  5CSF A;  3OGN A;  1GM0 A;  1NX0 A;  1QJT A;  1UHK A;  2NLN A;  3SS5 A;  5TNC A;  1SK6 D;  1KK7 Z;  3LL8 B;  1IWQ A;  1JF0 A;  1Z2C B;  2E6W A;  4L9M A;  1CB1 A;  1TNQ A;  2M7L A;  3CZT X;  3B88 A;  2G2B A;  1KK8 B;  2EC6 B;  2NXQ A;  2L2C A;  3LK0 A;  4Q04 A;  1J7R A;  3DVJ A;  4XJK A;  3D76 A;  2AMI A;  4GAO A;  2JU0 A;  1QIW A;  3DXL A;  2MBX A;  1KQM B;  3EK7 A;  1SCM B;  2KPH A;  2WND A;  1CDN A;  1GJY A;  1KWO B;  1CMG A;  1OOJ A;  3DVM A;  1MUX A;  1BF5 A;  1AVS A;  1B8R A;  2L98 A;  3KF9 A;  4ZCV A;  1A03 A;  1QAT A;  4N1G A;  3R1V A;  2CTN A;  2QEV A;  4PHK A;  1MHO A;  1TCO B;  1WY9 A;  1Y1U A;  1A75 B; 
#chains in the Genus database with same CATH homology
 5CSJ A;  2HQ8 A;  1GQM A;  2FOT A;  1QX7 A;  3F45 A;  3IF7 A;  1DVI A;  1S1E A;  1XYD A;  2BE6 A;  2PMY A;  3O6B A;  4HSZ A;  1LA3 A;  5ER5 A;  1DJW A;  1W7I B;  5HKW A;  3GOF A;  1CKK A;  1MWN A;  1DJI A;  2MAZ A;  2K8M B;  1TNW A;  1K9K A;  1SL9 A;  2LHI A;  2JUL A;  4PE7 A;  3H4S E;  2OTG C;  4I5N B;  5I2Q A;  2Y5I A;  1MXL C;  4WQ2 A;  1NYA A;  2Q91 A;  1L2O C;  4MLW A;  2ZNE A;  1DMO A;  1MF8 B;  1KK7 Y;  1JUO A;  3JTD B;  1ODB A;  1DJX A;  5F6T A;  2JXC A;  1K93 D;  2BKH B;  3SG2 A;  4YBH B;  2JTT A;  2VRG A;  1RTP 1;  3SG7 A;  1NPQ A;  2HQW A;  3MSE B;  1KFX S;  3TDI A;  3PLF B;  2PSR A;  4XJK B;  2LAP A;  4M2P A;  2WOR A;  4YGC B;  5AER A;  3PN7 C;  4JQ0 D;  3DF0 B;  3OB2 B;  3SG6 A;  1V1F A;  2HET A;  3CLN A;  5PAL A;  2KBM A;  2KFF A;  1YUR A;  1TIZ A;  2MLF C;  1C7V A;  2GGZ A;  1RJV A;  4HRH A;  4N5X A;  4DCK A;  2WCB A;  4QJ5 B;  4YI8 A;  1XFZ O;  2LCP A;  4GGF C;  1JC2 A;  2BL0 C;  3DD4 A;  3DVK A;  2OS8 C;  1DJY A;  2Y1N A;  1XVJ A;  4GUK A;  1Q80 A;  2B1U A;  1BJF A;  2F3Y A;  5AFP A;  5K89 A;  2BBN A;  2H61 C;  1ALV A;  3K21 A;  1L7Z A;  1F70 A;  3EK8 A;  3VRN A;  2LMT A;  4MVF A;  3I5H B;  1QXP A;  4P5O E;  1RK9 A;  1QLK A;  3I5G B;  3GK4 X;  3FS7 A;  1REC A;  4USL A;  3WNX B;  3EVR A;  5IBW A;  3BUO B;  4MN0 A;  3CGA A;  4ETO A;  1DTL A;  2WCF A;  4ORB B;  3TS5 B;  1JF2 A;  1U5I B;  3I5F C;  2KSP A;  2LP3 A;  1WRZ A;  3EK4 A;  4MBE A;  5AEQ A;  1C7W A;  2LVJ A;  4GGN A;  1EXR A;  1K95 A;  4AQJ A;  3TUY C;  1CTR A;  2BKI B;  2I94 A;  5I2O A;  2M1K B;  2L51 A;  1YRU B;  3NSO A;  2CNP A;  1TTX A;  4YGE B;  1ZFS A;  1WDC C;  2NZ0 A;  2ZKM X;  3NXA A;  1CDM A;  2O5G A;  5ER4 X;  2LC5 A;  4PDZ A;  2ZN8 A;  5CPV A;  5KU1 A;  1M63 B;  3IQO A;  5HKZ A;  1PSB A;  2LMU A;  1R6P A;  1CNP A;  1JFK A;  2GGM A;  1WRK A;  5AAN A;  2EGD A;  1IQ5 A;  3QRX A;  2KQ6 A;  1FPW A;  3IQQ A;  1BR4 B;  3A4U B;  1K90 D;  1PK0 D;  2P6B B;  4NDB A;  4C0J A;  2D8N A;  1NWD A;  4OVN F;  1UUR A;  2BCB A;  3CR4 X;  2KFG A;  5B8I B;  1B7T Z;  4A4C A;  1JFJ A;  1KK8 C;  2EC6 C;  2Y1M A;  3TDU A;  1TNP A;  2K7O A;  1BG1 A;  3BUN B;  1DT7 B;  1VRK A;  3GK2 A;  3O4Y A;  4ORC B;  3ZWH A;  1X02 A;  1YTZ C;  2LV7 A;  4BY5 A;  1EG4 A;  1SL8 A;  1XO5 A;  2LUC A;  1BMO A;  3BUX B;  2QAC A;  2ZND A;  1IQ3 A;  3TZ1 A;  4UPG A;  1AJ5 A;  3DF0 A;  1PAL A;  1OMR A;  1LKJ A;  1F8H A;  1XFU O;  1GGZ A;  3BYA A;  1J1E A;  5HKY A;  1WRL A;  3PM8 A;  1C07 A;  3I5I C;  2KQY A;  1M39 A;  2KI6 C;  3JVT B;  1CM1 A;  2M29 A;  3PAL A;  4WQ3 A;  2M97 A;  4DIR A;  1XK4 C;  4NQG A;  2JRF A;  1S26 D;  3HCM A;  5I2L A;  1M46 A;  1UHH A;  3AKB A;  4PE1 A;  1IG5 A;  1PVB A;  3FWC A;  5JOL A;  2LE9 B;  2M9G A;  3SIB A;  1SKT A;  1SCV A;  4PHM A;  1FW4 A;  1FF1 A;  2LVK A;  1FI6 A;  1LA0 A;  3OX6 A;  1DJH A;  1QLS A;  1XFV O;  1B47 A;  1D1O A;  1B7T Y;  5FYX A;  1IKU A;  4I5K A;  1K2H A;  1CLL A;  4YI9 A;  3WHT B;  4TNC A;  1YVH A;  2LHL A;  3BUW B;  1DGU A;  1U5I A;  2HF5 A;  1OZS A;  2JT3 A;  3O2P A;  3WXA A;  1UWO A;  3FIA A;  1AP4 A;  1AUI B;  3C1V A;  1H8B A;  2E30 A;  2MRD A;  2K2F A;  1LVC D;  1PSR A;  1TRF A;  2F2O A;  4PE0 A;  1ZOT B;  2L5X B;  2MJW B;  1LIN A;  1TOP A;  4YGB B;  3E3R A;  1K9P A;  1S3P A;  2H61 A;  2I2R E;  2KOT A;  1YUT A;  4MEW A;  3AKA A;  2LLU A;  1F4Q A;  1OSA A;  4AOM A;  1ZAC A;  2PRU A;  3PAT A;  4HRG A;  1XFY O;  3OX5 A;  5BPJ A;  1J55 A;  3EVV A;  2LMV A;  2OTG B;  3HX4 A;  4DRW A;  1NP8 A;  2Y4Q A;  3CTN A;  1L2O B;  3NSL A;  3D0Y B;  1NCY A;  3EVU A;  4MRY A;  1QV1 A;  1SPY A;  2NCO A;  1E8A A;  3KHE A;  1S6J A;  1JSA A;  2KYC A;  2BBM A;  1YR5 A;  1SL7 A;  1EL4 A;  3TS5 C;  1B4C A;  1KSM A;  1Y1X A;  2ZFD A;  1B8L A;  2ISD A;  1IJ5 A;  1F54 A;  4ZCU A;  4AQI A;  4GFT A;  1F4O A;  2M1U A;  3BXK A;  1OMD A;  1QVI Y;  2I18 A;  4YRU A;  5D69 A;  4F0Z B;  2WC8 A;  1N0Y A;  2K2A A;  1SRA A;  1WLM A;  4PE4 A;  1NX2 A;  1CFD A;  2BL0 B;  1G8I A;  2ZRS A;  2L2E A;  2OS8 B;  2O60 A;  1HQV A;  2K0J A;  2KHN A;  2KGR A;  4D1E A;  1FI5 A;  1SR6 C;  4P2Y B;  4R1E A;  1CLB A;  2F8P A;  2JC2 A;  1XA5 A;  2KI4 C;  2LUX A;  2JQ6 A;  2LP2 A;  5KSZ A;  2NCP A;  2JOJ A;  1CDL A;  2KNE A;  1F55 A;  1CDP A;  1CFC A;  3PSR A;  3OHM B;  1QV0 A;  3A8R A;  1K94 A;  2AUC A;  1BLQ A;  2L4H A;  4OV2 A;  1M31 A;  3LLE A;  2ZN9 A;  5CSN A;  5GQQ C;  2F2P A;  3SJS A;  5AXI A;  1NCX A;  2RGI A;  1IRJ A;  3EKJ A;  2JNX A;  1HT9 A;  4GNK B;  5D7F A;  1NX3 A;  5HYD A;  1YRT B;  4M2Q A;  1G33 A;  1W7J B;  3OB1 B;  2QPT A;  3KPX A;  4PCW A;  1KQM C;  3TUY B;  1SCM C;  1J7Q A;  2CBL A;  2JWW A;  2JT0 A;  4JWQ A;  1R2U A;  1NX1 A;  2KGB C;  2LAN A;  3TDZ A;  3VRP A;  1KWO C;  4ICB A;  4CFR A;  4E68 A;  2JT8 A;  1CM4 A;  1XK4 A;  1S6C A;  2SAS A;  1A2X A;  2LM5 A;  2OPO A;  1GGW A;  5KTY A;  2SCP A;  3SG4 A;  5J3X A;  1UHJ A;  2CXJ A;  3O78 A;  1WDC B;  4PHN A;  4XYN A;  4NDD A;  4MRX A;  2JZI A;  1BT6 A;  1IJ6 A;  2L4I A;  4I5L B;  4CLN A;  2BCX A;  1S5G Z;  3CR2 A;  2I7A A;  1UHI A;  2FCE A;  1KQV A;  3ZNI A;  1RRO A;  1BOC A;  1EH2 A;  5DKQ A;  2DOQ A;  4C0K A;  2LLS A;  4GPL B;  1UP5 A;  3D0Y A;  3CWG A;  2KBI A;  1KFU L;  2JXL A;  2PAS A;  1BR1 B;  2F33 A;  3VRR A;  3RLZ A;  1ZMZ A;  3AAJ A;  3DVE A;  1DF0 A;  5I8N A;  1JWD A;  1J7P A;  2F3Z A;  4DUQ A;  3JTD C;  2BE4 A;  1BU3 A;  1Y0V H;  3SIA A;  2FCD A;  2V53 A;  3BOW A;  1SNL A;  1WLZ A;  1KSO A;  1KCY A;  2JPT A;  2Q4U A;  3OP0 A;  5DKN A;  3VGO A;  4DS7 A;  2H2K A;  3BQ3 A;  3I5I B;  1QVI Z;  1SMG A;  1UUS A;  3VRQ A;  4GGF A;  1SBJ A;  4IL1 A;  1QS7 A;  3SG5 A;  3RM1 A;  1TN4 A;  1S5G Y;  1MXE A;  5JJG A;  4CID A;  1MQ1 A;  2M49 B;  2PAL A;  1DJZ A;  4GBA A;  3VRO A;  1PRW A;  2KYF A;  1CFP A;  1LXF C;  1IH0 A;  2KAY A;  1B1G A;  2KAV A;  2L0P A;  1CFF A;  1RWY A;  2K7C A;  2KI6 D;  1OQP A;  2K7B A;  1QAS A;  4YGD B;  1OMV A;  3I5H C;  4ORA B;  1NCZ A;  5HLO A;  1NSH A;  1NUB A;  3I5G C;  2LVI A;  1YX8 A;  2JNF A;  5DKR A;  1ZUZ A;  1YUS A;  1DF0 B;  2IS9 A;  2WOS A;  3SG3 A;  3LCP C;  2AAO A;  1B9A A;  1JBA A;  3ICB A;  3PN7 B;  1SY9 A;  1QTX A;  2M3W A;  1TNX A;  1OZO A;  2EHB A;  3BOW B;  1K96 A;  1DGV A;  3GK1 A;  3KO0 A;  2PVB A;  1NIW A;  2K61 A;  2KDH A;  3D10 A;  4JPZ B;  3AAK A;  3LK1 A;  2TN4 A;  2LLT A;  4BY4 A;  1KFU S;  1Y6W A;  1K9U A;  1QX2 A;  2MLE C;  4CPV A;  2M8U A;  1CLM A;  2R2I A;  1V1G A;  2WCE A;  4N1F A;  1QIV A;  1S36 A;  2MA2 A;  4MZK A;  2LVV A;  1PVA A;  1RFJ A;  1S6I A;  1OE9 B;  2A4J A;  1AJ4 A;  2COL B;  2GV5 A;  4OCI A;  5HLV A;  4MZJ A;  2MHH A;  4A4B A;  3NSI A;  1ALW A;  1M45 A;  4OKH A;  1F71 A;  1AK8 A;  4YGA A;  2HPS A;  4MSP A;  2M7N A;  1A29 A;  2CCM A;  1FBV A;  2K7D A;  1QX5 B;  2M0R A;  3EKH A;  1K8U A;  3PFV A;  4I5J A;  4OR9 B;  4PAL A;  4QJ4 B;  1TCF A;  1N65 A;  4PHJ A;  2LNK A;  3NSK A;  1H4B A;  3I5F B;  2BEC A;  1PUL A;  1J7O A;  3CR5 X;  1A75 A;  1BOD A;  1B8C A;  5G08 A;  2CT9 A;  2BCA A;  2L50 A;  3FWB A;  4C0L A;  1YUU A;  3CS1 A;  1XFW O;  4U8D A;  2KFH A;  3M0W A;  4WRI A;  1A4P A;  1Y1A A;  4NDC A;  1YVL A;  1SR6 B;  3BUM B;  1KFX L;  1EG3 A;  1YX7 A;  1CMF A;  2KI4 B;  1UHN A;  3KEV A;  1MR8 A;  1G4Y R;  1SYM A;  3JVT C;  5CSI A;  1N2D A;  4HRE E;  4FTG A;  1IGV A;  2KAX A;  1J1D A;  2G9B A;  2ZRT A;  1XFX O;  4MZL A;  3WHU B;  1SW8 A;  2JTZ A;  4CFQ A;  1AHR A;  4FQO A;  2FJU B;  1DJG A;  1EJ3 A;  4M2O A;  4QJ3 B;  5CSF A;  1NX0 A;  1QJT A;  1UHK A;  2NLN A;  5TNC A;  1SK6 D;  1KK7 Z;  3LL8 B;  1IWQ A;  1JF0 A;  2E6W A;  4L9M A;  1CB1 A;  1TNQ A;  2M7L A;  3CZT X;  2G2B A;  1KK8 B;  2EC6 B;  2NXQ A;  3LK0 A;  4Q04 A;  4XJK A;  1J7R A;  3DVJ A;  2MBX A;  2AMI A;  4GAO A;  2JU0 A;  1QIW A;  1KQM B;  3EK7 A;  1SCM B;  2WND A;  1CDN A;  1GJY A;  1KWO B;  1CMG A;  1OOJ A;  3DVM A;  1MUX A;  1BF5 A;  1AVS A;  1B8R A;  2L98 A;  3KF9 A;  4ZCV A;  1A03 A;  1QAT A;  4N1G A;  2CTN A;  4PHK A;  1MHO A;  1TCO B;  1WY9 A;  1Y1U A;  1A75 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...