3F45A

Structure of the r75a mutant of rat alpha-parvalbumin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDAADLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Parvalbumin alpha
publication title Removing the invariant salt bridge of parvalbumin increases flexibility in the AB-loop structure
pubmed doi rcsb
source organism Rattus norvegicus
total genus 41
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3f45A00
1KWOC 2HETA 2BKHB 2DOQA 2L50A 3EVVA 3BUNB 3GOFA 2FCEA 2L98A 1TCOB 2F33A 4OV2A 1JWDA 1H8BA 1NP8A 1QX7A 2LMVA 3SIAA 1PSRA 1Q80A 2LAPA 1CFPA 3OHMB 2JNXA 2A4JA 2IS9A 4YI8A 1KFXL 2KI4C 1S36A 1S6CA 1IGVA 2LHIA 2F2OA 1DJWA 1XFXO 2WORA 3O6BA 4CPVA 1FW4A 1FI5A 1X02A 1CB1A 1CLMA 1DF0B 1BJFA 3NSOA 1PVAA 1IQ3A 1OZSA 2EGDA 3LK1A 1CM4A 1CDNA 4PE0A 3AAJA 1JF0A 1C7VA 2JXLA 1KSOA 3SG4A 1GGZA 1M63B 3I5GC 1KFUL 3ZNIA 1V1GA 1YURA 1K8UA 4DCKA 1EG4A 1JF2A 2HQWA 1G33A 3KHEA 2OTGB 3A4UB 1DJGA 1B8CA 1RWYA 2BBNA 4QJ5B 2LC5A 2JULA 5CPVA 3PALA 1RK9A 2BKIB 3BOWB 4YGCB 2LVJA 1D1OA 5CSIA 1J1DA 1K93D 1YUTA 2BBMA 4NQGA 2LUXA 1EL4A 3AKBA 2E6WA 1U5IB 3CS1A 1AUIB 2KAVA 2M0RA 1YVHA 2K7OA 1KFXS 2LCPA 4IL1A 3VRNA 2KAYA 5KU1A 3H4SE 2CCMA 2NLNA 1CLBA 1ZFSA 4MBEA 1IWQA 5DKRA 5AERA 1CNPA 2BL0B 4FTGA 2PSRA 2COLB 1B7TZ 3TDUA 4JWQA 5BPJA 3ICBA 3PN7B 4I5KA 5JJGA 1QTXA 1LKJA 2L2EA 1CDPA 1QX5B 2KQ6A 2BCXA 3EKJA 5AXIA 1KFUS 3TS5C 1A4PA 1YR5A 2LANA 1EG3A 1B1GA 2LP3A 2PVBA 4N1FA 3CTNA 2ZN9A 3ZWHA 3PATA 4MZLA 1TNQA 1ZUZA 1NCZA 3QRXA 2LVIA 2HPSA 4GGFC 1QV0A 3OB2B 1KSMA 3JTDC 2F3YA 1MUXA 1UHJA 1QV1A 3KF9A 2ZRTA 2GGMA 1M46A 4BY5A 2K7BA 4MZKA 4PE7A 1B7TY 2CT9A 1FPWA 1LA0A 4N5XA 1PALA 2G9BA 2Y5IA 2MRDA 3I5FB 2O5GA 2JT0A 2JTTA 4MRXA 2K2AA 1XFYO 2M1UA 5K89A 1Y1XA 3BXKA 3O2PA 1PK0D 1XFUO 1ODBA 4C0KA 2JT8A 5JOLA 1OQPA 4ETOA 1J55A 1NWDA 2L0PA 2WNDA 2TN4A 3D0YB 2AMIA 2FOTA 2JQ6A 2JXCA 4OKHA 1BOCA 2ZRSA 1W7JB 4MN0A 1J7PA 2WCFA 1TNWA 1DT7B 2NXQA 3DVJA 1J7OA 1XVJA 4Q04A 1C7WA 1BG1A 2GV5A 2F3ZA 2AUCA 1CFDA 1K2HA 4PE4A 3F45A 5GQQC 1KQMC 2HQ8A 1R2UA 3GK1A 4NDDA 1S6IA 4HSZA 4JQ0D 4GAOA 2LMUA 3TUYB 1YRTB 1XA5A 3NXAA 1N0YA 4D1EA 1PSBA 2HF5A 1SCMC 2PMYA 4GNKB 3BUOB 1KCYA 1JUOA 1QASA 2LMTA 1NX2A 4QJ3B 3FS7A 1SK6D 4WQ3A 2KHNA 4GGFA 2PRUA 2Y4QA 1OSAA 1WRKA 2K61A 1K95A 2KDHA 1K96A 1SW8A 1OZOA 3IQOA 3K21A 1G8IA 2P6BB 1XK4C 1QJTA 1QX2A 1DGVA 1A75A 3PM8A 3O78A 1CMFA 1MWNA 2M7NA 1ALWA 1J1EA 1LVCD 2E30A 3BUXB 3GK2A 2D8NA 1PULA 1FBVA 4CLNA 1RJVA 1BMOA 2KYFA 1SNLA 2KI4B 4XJKB 1QXPA 2ZFDA 5ER5A 5IBWA 1DVIA 1K94A 1S26D 4PE1A 3CZTX 1WLZA 4PHNA 3A8RA 4YGAA 1CKKA 2B1UA 3E3RA 1SL7A 3PSRA 3CWGA 3LK0A 5I2LA 2OTGC 3M0WA 3CR4X 1NX0A 3DD4A 1WRLA 3I5IC 4YGEB 1BT6A 1NSHA 1TOPA 2BE6A 4YRUA 3NSLA 4USLA 1HT9A 2Y1MA 2AAOA 4PHKA 2M1KB 4ICBA 1A03A 1Y6WA 1SRAA 2SASA 2L4HA 1OOJA 1DGUA 3KEVA 4MEWA 1NX1A 1XYDA 2LHLA 2H2KA 2I94A 4CIDA 1NX3A 1DMOA 3DVKA 2I18A 1MHOA 1BF5A 2ISDA 3EK4A 1WRZA 2GGZA 2LE9B 4N1GA 1KK8B 4M2PA 1UHIA 1ZACA 1F4OA 4BY4A 1JBAA 1CM1A 5HKWA 5G08A 1IG5A 3PFVA 2JTZA 4CFQA 4PHMA 4OVNF 1CFCA 4AOMA 4FQOA 3JVTB 1PRWA 3WNXB 1LINA 3TDZA 2OPOA 3GK4X 2BL0C 1XK4A 1WY9A 4P2YB 1CDMA 3IF7A 1JFKA 1JSAA 4AQJA 2R2IA 3PN7C 4M2QA 3SG2A 1F54A 2PASA 3OX6A 4A4BA 4A4CA 1OMRA 1TN4A 2K7DA 1M45A 1SBJA 5ER4X 3VGOA 1SY9A 2PALA 1DJYA 1UHHA 1DF0A 1DTLA 1UP5A 5KSZA 3CR5X 3TS5B 2LNKA 1XFVO 1QLSA 1B8RA 1H4BA 1GJYA 2BCAA 1QIWA 1MXEA 1UUSA 2JC2A 1DJZA 1ZMZA 3I5HB 5CSFA 2L4IA 2BCBA 1NUBA 2K0JA 2JU0A 3SG7A 1K9PA 4M2OA 1MR8A 1RFJA 1SR6B 1S1EA 1B4CA 2VRGA 5HLOA 1OMVA 2OS8B 3DF0A 1A29A 2M29A 1L2OC 4MRYA 2QACA 3I5FC 5I2OA 1FF1A 1SKTA 1OE9B 4NDCA 2M49B 3BQ3A 4U8DA 1V1FA 1S5GZ 5PALA 3BOWA 4F0ZB 2LM5A 2MBXA 2EC6B 3OX5A 1SMGA 1YRUB 2K2FA 2KAXA 3DVMA 4C0JA 1QIVA 2ZN8A 2L5XB 4DRWA 1KQVA 1B47A 1K90D 2LLSA 3TDIA 2KI6C 2M3WA 1IJ6A 1U5IA 1XO5A 3AKAA 4E68A 1AHRA 3OB1B 5HYDA 3CR2A 1FI6A 1WDCB 2MLEC 4GFTA 2G2BA 1S6JA 2L51A 3O4YA 2V53A 1S5GY 1EH2A 2KGRA 2LP2A 5HLVA 2JRFA 5F6TA 1N65A 3KPXA 3C1VA 2WCEA 1A2XA 2QPTA 2H61C 5FYXA 1IQ5A 3TUYC 3EK7A 1UURA 4PDZA 2O60A 3CLNA 4HRHA 2KOTA 1SCVA 5B8IB 1KWOB 4YGDB 4DUQA 1E8AA 1AK8A 1BLQA 4CFRA 2JNFA 4ORAB 4YGBB 1SYMA 1W7IB 3WXAA 3SIBA 5DKNA 1C07A 2ZNEA 1B8LA 1F4QA 3TZ1A 2M7LA 1KK7Z 1AVSA 2M9GA 1BU3A 4GPLB 4OR9B 2JPTA 1BR4B 3EK8A 1QS7A 3BYAA 4ZCUA 1F71A 4C0LA 1UWOA 1RTP1 4GUKA 2EHBA 2M97A 3NSIA 1QATA 1JC2A 4MVFA 3SJSA 3EKHA 1WLMA 4ORCB 4QJ4B 3DVEA 5AEQA 5KTYA 1BODA 2KQYA 3FWCA 1L7ZA 3I5GB 1XFZO 3NSKA 1GQMA 2KFGA 1UHNA 2KSPA 2NZ0A 5D69A 4AQIA 4GBAA 2KFHA 1CLLA 2CTNA 1KK7Y 2MA2A 5I8NA 3D0YA 5J3XA 1TRFA 3VRRA 1OMDA 4MLWA 1EJ3A 2I7AA 2CBLA 4R1EA 1XFWO 2LVKA 2M8UA 4XYNA 4DIRA 3I5IB 4YI9A 1ZOTB 4JPZB 3DF0B 3CGAA 1CMGA 3IQQA 2JT3A 2MLFC 3OP0A 1RROA 3VROA 3FWBA 4HRGA 1DJIA 3MSEB 1Y0VH 2H61A 3LLEA 1S3PA 1KK8C 4MZJA 4MSPA 3EVUA 3VRQA 1K9KA 3LCPC 2ZNDA 1IH0A 5DKQA 2I2RE 2ZKMX 1F55A 2NCPA 4HREE 1NYAA 3JVTC 1YVLA 4ZCVA 2BECA 1YTZC 4OCIA 4I5JA 1NCXA 2KBIA 4P5OE 2MJWB 5HKZA 1SL8A 3EVRA 5CSNA 1QVIZ 2Q4UA 2MHHA 3PLFB 4I5NB 1MXLC 2Y1NA 1NIWA 1UHKA 1TIZA 1VRKA 1TTXA 2KBMA 4XJKA 3BUWB 2KI6D 1NPQA 1J7QA 5AANA 5I2QA 3JTDB 2JWWA 2RGIA 1CFFA 4NDBA 3I5HC 2JOJA 3WHUB 1Y1AA 1B9AA 1K9UA 1A75B 2BE4A 3FIAA 3RLZA 1YUUA 4I5LB 1ALVA 1JFJA 1SPYA 3VRPA 1SR6C 4ORBB 2WC8A 4DS7A 2KFFA 3D10A 2OS8C 1AJ4A 2F8PA 2WCBA 5TNCA 1QVIY 2SCPA 3SG6A 2WOSA 1RECA 4TNCA 1M31A 1TNXA 1HQVA 2K8MB 3LL8B 1L2OB 1M39A 3AAKA 2KGBC 2EC6C 1IKUA 1R6PA 3SG3A 1J7RA 1DJHA 1LA3A 2CNPA 1IJ5A 2JZIA 3WHTB 5AFPA 1DJXA 3BUMB 5CSJA 1YX8A 1MQ1A 5HKYA 1EXRA 5D7FA 3RM1A 1F70A 4GGNA 1G4YR 1QLKA 2KYCA 4PHJA 2LUCA 4PALA 2NCOA 1N2DA 2F2PA 2MAZA 2KNEA 1Y1UA 4L9MA 1AJ5A 2LLTA 1WDCC 4WRIA 4YBHB 1SL9A 2LV7A 1BR1B 1CTRA 1KQMB 3KO0A 2FCDA 2LVVA 1CDLA 1TCFA 1F8HA 2Q91A 3SG5A 1YUSA 3HCMA 2LLUA 1NCYA 4PCWA 4WQ2A 2K7CA 1TNPA 2FJUB 2CXJA 1AP4A 1SCMB 1LXFC 1PVBA 1YX7A 3HX4A 1MF8B 1GGWA 4UPGA 1IRJA
chains in the Genus database with same CATH superfamily
1KWOC 2HETA 2BKHB 2DOQA 2L50A 3EVVA 5EL2A 3BUNB 3GOFA 2FCEA 2L98A 1TCOB 2F33A 4OV2A 1JWDA 1H8BA 1NP8A 4JKTA 1QX7A 3PM2A 2LMVA 3SIAA 1PSRA 1Q80A 2LAPA 1CFPA 3OHMB 2JNXA 2A4JA 2IS9A 4YI8A 1KFXL 2KI4C 1S36A 1S6CA 1IGVA 2LHIA 2F2OA 1DJWA 1XFXO 2WORA 3O6BA 4CPVA 1FW4A 4F7FA 1X02A 1FI5A 1CB1A 1CLMA 1DF0B 1BJFA 3NSOA 1PVAA 1IQ3A 1OZSA 2EGDA 3LK1A 1CM4A 1CDNA 4PE0A 3AAJA 1JF0A 1C7VA 2JXLA 1KSOA 3RZSA 3SG4A 1GGZA 1M63B 3I5GC 1KFUL 3ZNIA 1V1GA 3CYZA 1TUZA 1YURA 1K8UA 4DCKA 1EG4A 1GM0A 1JF2A 3D77A 2HQWA 1G33A 3KHEA 2OTGB 3A4UB 1DJGA 1B8CA 1RWYA 2BBNA 4QJ5B 2LC5A 2JULA 5CPVA 3PALA 3V2LA 3L47A 1RK9A 2BKIB 3BOWB 4YGCB 2LVJA 1D1OA 5CSIA 4INXA 3FE8A 3IVTA 1J1DA 1K93D 1YUTA 3FE9A 2BBMA 4NQGA 2LUXA 3DY9A 3CDNA 1EL4A 3AKBA 2E6WA 3NHIA 1QWVA 1U5IB 3CS1A 1Z4HA 1AUIB 2KAVA 2M0RA 1YVHA 2K7OA 1KFXS 2LCPA 4IL1A 3VRNA 2KAYA 2BNXA 5KU1A 3H4SE 2CCMA 2NLNA 1CLBA 1ZFSA 3QMEA 4MBEA 1IWQA 5DKRA 2QEHA 5AERA 1CNPA 2BL0B 4FTGA 3S0AA 3L4AA 2PSRA 2COLB 1B7TZ 3TDUA 4JWQA 5BPJA 2WCJA 2L2CA 3ICBA 3PN7B 4I5KA 1QTXA 1LKJA 5JJGA 2L2EA 1CDPA 1QX5B 2KQ6A 2BCXA 3EKJA 5AXIA 1KFUS 3TS5C 1A4PA 1YR5A 2LANA 1EG3A 1B1GA 2LP3A 2PVBA 4N1FA 3CTNA 2ZN9A 3ZWHA 1OOHA 3PATA 1TNQA 1ZUZA 1NCZA 3QRXA 4MZLA 1C3YA 2LVIA 2HPSA 4GGFC 1QV0A 2WCKA 3OB2B 1KSMA 3JTDC 2F3YA 1MUXA 1UHJA 2PYQA 1QV1A 4OZDA 3KF9A 3D74A 2YGUA 2ZRTA 2GGMA 1M46A 4BY5A 2K7BA 2QEVA 4MZKA 4PE7A 1B7TY 2CT9A 1FPWA 1LA0A 4N5XA 1PALA 2G9BA 2Y5IA 2MRDA 3I5FB 2O5GA 2JT0A 2JTTA 4MRXA 2K2AA 1XFYO 2M1UA 3O4XA 5K89A 1Y1XA 3BXKA 3O2PA 1PK0D 1XFUO 1ODBA 4C0KA 2JT8A 5JOLA 1OQPA 4ETOA 2WC6A 1J55A 1NWDA 2L0PA 4IJ7A 2WNDA 2TN4A 3D0YB 2AMIA 2FOTA 2JQ6A 2JXCA 4OKHA 3VB1A 2ZRSA 1W7JB 4MN0A 1BOCA 1J7PA 2WCFA 1TNWA 1DT7B 2NXQA 3DVJA 1J7OA 1XVJA 4Q04A 1C7WA 1BG1A 2GV5A 2F3ZA 2AUCA 1CFDA 1K2HA 4PE4A 3F45A 5GQQC 1KQMC 2HQ8A 1R2UA 3GK1A 2GTEA 4NDDA 1S6IA 4HSZA 4JQ0D 4GAOA 2LMUA 3TUYB 1YRTB 1DC1A 1XA5A 3NXAA 1N0YA 4D1EA 1PSBA 2HF5A 1SCMC 2PMYA 4GNKB 3BUOB 1KCYA 1JUOA 1QASA 2LMTA 1NX2A 4QJ3B 3FS7A 1SK6D 4WQ3A 2KHNA 4GGFA 2PRUA 2Y4QA 1OSAA 1WRKA 2K61A 1K95A 2KDHA 1K96A 1SW8A 1OZOA 3IQOA 3K21A 1G8IA 2P6BB 5HL1A 1XK4C 1QJTA 1QX2A 1DGVA 1IIOA 3EG5B 1A75A 3PM8A 3O78A 1CMFA 1MWNA 2M7NA 1ALWA 1J1EA 1LVCD 2E30A 3BUXB 3GK2A 2D8NA 1PULA 1FBVA 4CLNA 1RJVA 1BMOA 2KYFA 1SNLA 2KI4B 4XJKB 1QXPA 2ZFDA 3D75A 5ER5A 5IBWA 1DVIA 1K94A 1S26D 4PE1A 2K60A 3CZTX 1WLZA 3CABA 4PHNA 3A8RA 4YGAA 1CKKA 2B1UA 3E3RA 1SL7A 1T14A 3CWGA 3PSRA 1ORGA 3LK0A 5I2LA 3CZ0A 2QEBA 2OTGC 3M0WA 3CR4X 1NX0A 3DD4A 1WRLA 3I5IC 4YGEB 2KLEA 1BT6A 1NSHA 1TOPA 2BE6A 4YRUA 3NSLA 4USLA 1HT9A 2Y1MA 3S0EA 2AAOA 4PHKA 2M1KB 4ICBA 3UO9A 1A03A 1Y6WA 1SRAA 2SASA 2L4HA 1OOJA 1DGUA 3KEVA 2JPOA 4MEWA 1NX1A 1XYDA 2LHLA 2H2KA 2I94A 4CIDA 3BJHA 1NX3A 5DICA 1DMOA 3DVKA 2I18A 1MHOA 1BF5A 2ISDA 3EK4A 1WRZA 2GGZA 2LE9B 3BFBA 1KK8B 4M2PA 1UHIA 4N1GA 3BFHA 1ZACA 1F4OA 4BY4A 1JBAA 2KPHA 1CM1A 5HKWA 5G08A 1IG5A 3PFVA 2JTZA 4CFQA 4PHMA 4OVNF 3R1PA 1CFCA 4AOMA 4FQOA 3JVTB 1PRWA 3WNXB 1LINA 3TDZA 2OPOA 1Z2CB 3GK4X 2BL0C 1XK4A 1WY9A 4P2YB 1CDMA 3IF7A 1JFKA 1JSAA 4AQJA 2R2IA 3PN7C 4M2QA 3SG2A 1F54A 2PASA 3OX6A 4A4BA 4A4CA 1OMRA 1TN4A 2K7DA 1M45A 1SBJA 5ER4X 3VGOA 1SY9A 2PALA 1DJYA 1UHHA 1DF0A 1DTLA 1UP5A 5KSZA 3SS3A 3CR5X 3TS5B 2LNKA 1XFVO 1QLSA 1B8RA 1H4BA 1GJYA 2BCAA 1QIWA 1MXEA 1UUSA 2JC2A 5I94A 1DJZA 1ZMZA 3I5HB 5FI2A 5CSFA 2L4IA 3B87A 2BCBA 1NUBA 3NGVA 2K0JA 2JU0A 3S0BA 3SG7A 1K9PA 1OOFA 4M2OA 2WCLA 1MR8A 1RFJA 1SR6B 1S1EA 1B4CA 2VRGA 5HLOA 1OMVA 3CZ2A 2OS8B 3DF0A 1A29A 2M29A 1L2OC 4MRYA 2QACA 3I5FC 5I2OA 1FF1A 1SKTA 1OE9B 4NDCA 2M49B 3BQ3A 4U8DA 1V1FA 1S5GZ 5PALA 3BOWA 4F0ZB 2LM5A 3NHTA 2MBXA 2EC6B 3OX5A 1SMGA 1YRUB 2K2FA 2KAXA 3DVMA 1SSEB 4FQTA 4C0JA 2PQLA 1QIVA 2ZN8A 2P70A 3L4LA 2L5XB 4DRWA 1KQVA 1B47A 1K90D 2LLSA 4INWA 3TDIA 2KI6C 2M3WA 1IJ6A 1U5IA 1XO5A 3AKAA 4E68A 1AHRA 3OB1B 5HYDA 3CR2A 1DQEA 3SS5A 1WDCB 1FI6A 2MLEC 4GFTA 1P28A 1S6JA 2G2BA 2L51A 3O4YA 2V53A 1S5GY 1EH2A 2KGRA 2LP2A 5HLVA 2JRFA 5F6TA 1N65A 3KPXA 3R1VA 3C1VA 2WCEA 1A2XA 2QPTA 2H61C 5FYXA 1IQ5A 3TUYC 3EK7A 1UURA 4PDZA 2O60A 3CLNA 4HRHA 2KOTA 3B6XA 1SCVA 5B8IB 1KWOB 4YGDB 4DUQA 1E8AA 1AK8A 1BLQA 4CFRA 2JNFA 4ORAB 4YGBB 1SYMA 1W7IB 3WXAA 3B86A 5DKNA 3SIBA 1C07A 2ZNEA 1B8LA 1F4QA 2BAPA 3TZ1A 2M7LA 1KK7Z 1AVSA 2M9GA 3S0FA 1BU3A 2QDIA 4GPLB 4OR9B 2JPTA 1BR4B 3EK8A 1QS7A 3BYAA 4ZCUA 1F71A 4C0LA 1UWOA 1RTP1 4GUKA 2EHBA 2M97A 3NSIA 1QATA 1JC2A 4MVFA 3SJSA 3EKHA 1WLMA 3Q8IA 4ORCB 4QJ4B 3DVEA 5AEQA 3N7HA 5KTYA 1BODA 2KQYA 3FWCA 1L7ZA 3I5GB 1XFZO 3DZTA 3NSKA 1GQMA 3OGNA 2KFGA 1UHNA 3S0DA 2KSPA 2NZ0A 5D69A 1OOIX 5FI7A 4GBAA 4AQIA 2KFHA 1CLLA 2CTNA 1KK7Y 2MA2A 2FJYA 5I8NA 3D0YA 5J3XA 1TRFA 3VRRA 1OMDA 4MLWA 1EJ3A 2I7AA 2CBLA 4R1EA 3S0GA 1XFWO 2LVKA 2M8UA 2WCHA 3PJIA 4XYNA 3I5IB 4YI9A 4DIRA 1ZOTB 3DXLA 4JPZB 3DF0B 3CGAA 1CMGA 3IQQA 3SS4A 2JT3A 2MLFC 3OP0A 1RROA 3VROA 3FWBA 4HRGA 2WC5A 4JD9A 1OOGA 1DJIA 3MSEB 1Y0VH 2H61A 3LLEA 1S3PA 1KK8C 4MZJA 4MSPA 3EVUA 3VRQA 1K9KA 3LCPC 2ZNDA 1IH0A 2L5YA 5DKQA 2I2RE 2ZKMX 3FE6A 2NCPA 3B7AA 4HREE 5FI6A 1F55A 1NYAA 3CZ1A 3JVTC 1YVLA 4ZCVA 2BECA 1TUJA 5D3OA 1YTZC 4OCIA 4I5JA 1NCXA 2KBIA 4P5OE 2MJWB 5HKZA 3K1EA 3DYEA 1SL8A 3EVRA 3R1OA 5CSNA 1QVIZ 2Q4UA 4KYNA 2MHHA 3PLFB 4I5NB 1MXLC 2P71A 2KLDA 2Y1NA 1NIWA 1UHKA 1TIZA 1VRKA 1TTXA 2KBMA 4XJKA 3BUWB 2KI6D 1LS8A 3OBVA 1NPQA 1J7QA 5AANA 5I2QA 3JTDB 1XFRA 3B88A 2JWWA 2RGIA 1CFFA 4NDBA 3D78A 3I5HC 2JOJA 3WHUB 1Y1AA 1B9AA 1K9UA 1A75B 2BE4A 3FIAA 3RLZA 1YUUA 4I5LB 1ALVA 1JFJA 1SPYA 3VRPA 1SR6C 4ORBB 2WC8A 4DS7A 2KFFA 3D10A 2OS8C 1AJ4A 1W9ZA 2F8PA 2WCBA 1DEKA 1QVIY 5TNCA 2SCPA 2WCMA 3UNWA 3BFAA 3SG6A 2WOSA 1RECA 4TNCA 1M31A 2QEOA 1TNXA 1HQVA 2K8MB 1C3ZA 3LL8B 1L2OB 1M39A 3AAKA 2KGBC 2EC6C 1IKUA 1R6PA 3SG3A 1J7RA 1DJHA 1LA3A 2CNPA 1IJ5A 2JZIA 3WHTB 5AFPA 1DJXA 3BUMB 5CSJA 1TWOA 1OW4A 1MQ1A 1YX8A 5HKYA 1EXRA 5D7FA 3RM1A 1F70A 4GGNA 1G4YR 1QLKA 2ERBA 2KYCA 4PHJA 2LUCA 3R72A 4PALA 2NCOA 1N2DA 2F2PA 3D76A 2MAZA 2KNEA 1Y1UA 4L9MA 1AJ5A 2LLTA 1WDCC 4WRIA 4YBHB 1SL9A 2LV7A 1BR1B 2H8VA 1CTRA 1KQMB 3KO0A 2FCDA 2LVVA 1CDLA 1TCFA 3D73A 1F8HA 2Q91A 4PT1A 3SG5A 1YUSA 3HCMA 2LLUA 1NCYA 4PCWA 4WQ2A 1DELA 2K7CA 1TNPA 2FJUB 2CXJA 1AP4A 1SCMB 1LXFC 1PVBA 1YX7A 3HX4A 1MF8B 1GGWA 4UPGA 1IRJA
chains in the Genus database with same CATH topology
1KWOC 2HETA 2BKHB 2DOQA 2L50A 3EVVA 3BUNB 3GOFA 2FCEA 2L98A 1TCOB 2F33A 4OV2A 1JWDA 1H8BA 1NP8A 1QX7A 2LMVA 3SIAA 1PSRA 1Q80A 2LAPA 1CFPA 3OHMB 2JNXA 2A4JA 2IS9A 4YI8A 1KFXL 2KI4C 1S36A 1S6CA 1IGVA 2LHIA 2F2OA 1DJWA 1XFXO 2WORA 3O6BA 4CPVA 1FW4A 1FI5A 1X02A 1CB1A 1CLMA 1DF0B 1BJFA 3NSOA 1PVAA 1IQ3A 1OZSA 2EGDA 3LK1A 1CM4A 1CDNA 4PE0A 3AAJA 1JF0A 1C7VA 2JXLA 1KSOA 3SG4A 1GGZA 1M63B 3I5GC 1KFUL 3ZNIA 1V1GA 1YURA 1K8UA 4DCKA 1EG4A 1JF2A 2HQWA 1G33A 3KHEA 2OTGB 3A4UB 1DJGA 1B8CA 1RWYA 2BBNA 4QJ5B 2LC5A 2JULA 5CPVA 3PALA 1RK9A 2BKIB 3BOWB 4YGCB 2LVJA 1D1OA 5CSIA 1J1DA 1K93D 1YUTA 2BBMA 4NQGA 2LUXA 1EL4A 3AKBA 2E6WA 1U5IB 3CS1A 1AUIB 2KAVA 2M0RA 1YVHA 2K7OA 1KFXS 2LCPA 4IL1A 3VRNA 2KAYA 5KU1A 3H4SE 2CCMA 2NLNA 1CLBA 1ZFSA 4MBEA 1IWQA 5DKRA 5AERA 1CNPA 2BL0B 4FTGA 2PSRA 2COLB 1B7TZ 3TDUA 4JWQA 5BPJA 3ICBA 3PN7B 4I5KA 5JJGA 1QTXA 1LKJA 2L2EA 1CDPA 1QX5B 2KQ6A 2BCXA 3EKJA 5AXIA 1KFUS 3TS5C 1A4PA 1YR5A 2LANA 1EG3A 1B1GA 2LP3A 2PVBA 4N1FA 3CTNA 2ZN9A 3ZWHA 3PATA 4MZLA 1TNQA 1ZUZA 1NCZA 3QRXA 2LVIA 2HPSA 4GGFC 1QV0A 3OB2B 1KSMA 3JTDC 2F3YA 1MUXA 1UHJA 1QV1A 3KF9A 2ZRTA 2GGMA 1M46A 4BY5A 2K7BA 4MZKA 4PE7A 1B7TY 2CT9A 1FPWA 1LA0A 4N5XA 1PALA 2G9BA 2Y5IA 2MRDA 3I5FB 2O5GA 2JT0A 2JTTA 4MRXA 2K2AA 1XFYO 2M1UA 5K89A 1Y1XA 3BXKA 3O2PA 1PK0D 1XFUO 1ODBA 4C0KA 2JT8A 5JOLA 1OQPA 4ETOA 1J55A 1NWDA 2L0PA 2WNDA 2TN4A 3D0YB 2AMIA 2FOTA 2JQ6A 2JXCA 4OKHA 1BOCA 2ZRSA 1W7JB 4MN0A 1J7PA 2WCFA 1TNWA 1DT7B 2NXQA 3DVJA 1J7OA 1XVJA 4Q04A 1C7WA 1BG1A 2GV5A 2F3ZA 2AUCA 1CFDA 1K2HA 4PE4A 3F45A 5GQQC 1KQMC 2HQ8A 1R2UA 3GK1A 4NDDA 1S6IA 4HSZA 4JQ0D 4GAOA 2LMUA 3TUYB 1YRTB 1XA5A 3NXAA 1N0YA 4D1EA 1PSBA 2HF5A 1SCMC 2PMYA 4GNKB 3BUOB 1KCYA 1JUOA 1QASA 2LMTA 1NX2A 4QJ3B 3FS7A 1SK6D 4WQ3A 2KHNA 4GGFA 2PRUA 2Y4QA 1OSAA 1WRKA 2K61A 1K95A 2KDHA 1K96A 1SW8A 1OZOA 3IQOA 3K21A 1G8IA 2P6BB 1XK4C 1QJTA 1QX2A 1DGVA 1A75A 3PM8A 3O78A 1CMFA 1MWNA 2M7NA 1ALWA 1J1EA 1LVCD 2E30A 3BUXB 3GK2A 2D8NA 1PULA 1FBVA 4CLNA 1RJVA 1BMOA 2KYFA 1SNLA 2KI4B 4XJKB 1QXPA 2ZFDA 5ER5A 5IBWA 1DVIA 1K94A 1S26D 4PE1A 3CZTX 1WLZA 4PHNA 3A8RA 4YGAA 1CKKA 2B1UA 3E3RA 1SL7A 3PSRA 3CWGA 3LK0A 5I2LA 2OTGC 3M0WA 3CR4X 1NX0A 3DD4A 1WRLA 3I5IC 4YGEB 1BT6A 1NSHA 1TOPA 2BE6A 4YRUA 3NSLA 4USLA 1HT9A 2Y1MA 2AAOA 4PHKA 2M1KB 4ICBA 1A03A 1Y6WA 1SRAA 2SASA 2L4HA 1OOJA 1DGUA 3KEVA 4MEWA 1NX1A 1XYDA 2LHLA 2H2KA 2I94A 4CIDA 1NX3A 1DMOA 3DVKA 2I18A 1MHOA 1BF5A 2ISDA 3EK4A 1WRZA 2GGZA 2LE9B 4N1GA 1KK8B 4M2PA 1UHIA 1ZACA 1F4OA 4BY4A 1JBAA 1CM1A 5HKWA 5G08A 1IG5A 3PFVA 2JTZA 4CFQA 4PHMA 4OVNF 1CFCA 4AOMA 4FQOA 3JVTB 1PRWA 3WNXB 1LINA 3TDZA 2OPOA 3GK4X 2BL0C 1XK4A 1WY9A 4P2YB 1CDMA 3IF7A 1JFKA 1JSAA 4AQJA 2R2IA 3PN7C 4M2QA 3SG2A 1F54A 2PASA 3OX6A 4A4BA 4A4CA 1OMRA 1TN4A 2K7DA 1M45A 1SBJA 5ER4X 3VGOA 1SY9A 2PALA 1DJYA 1UHHA 1DF0A 1DTLA 1UP5A 5KSZA 3CR5X 3TS5B 2LNKA 1XFVO 1QLSA 1B8RA 1H4BA 1GJYA 2BCAA 1QIWA 1MXEA 1UUSA 2JC2A 1DJZA 1ZMZA 3I5HB 5CSFA 2L4IA 2BCBA 1NUBA 2K0JA 2JU0A 3SG7A 1K9PA 4M2OA 1MR8A 1RFJA 1SR6B 1S1EA 1B4CA 2VRGA 5HLOA 1OMVA 2OS8B 3DF0A 1A29A 2M29A 1L2OC 4MRYA 2QACA 3I5FC 5I2OA 1FF1A 1SKTA 1OE9B 4NDCA 2M49B 3BQ3A 4U8DA 1V1FA 1S5GZ 5PALA 3BOWA 4F0ZB 2LM5A 2MBXA 2EC6B 3OX5A 1SMGA 1YRUB 2K2FA 2KAXA 3DVMA 4C0JA 1QIVA 2ZN8A 2L5XB 4DRWA 1KQVA 1B47A 1K90D 2LLSA 3TDIA 2KI6C 2M3WA 1IJ6A 1U5IA 1XO5A 3AKAA 4E68A 1AHRA 3OB1B 5HYDA 3CR2A 1FI6A 1WDCB 2MLEC 4GFTA 2G2BA 1S6JA 2L51A 3O4YA 2V53A 1S5GY 1EH2A 2KGRA 2LP2A 5HLVA 2JRFA 5F6TA 1N65A 3KPXA 3C1VA 2WCEA 1A2XA 2QPTA 2H61C 5FYXA 1IQ5A 3TUYC 3EK7A 1UURA 4PDZA 2O60A 3CLNA 4HRHA 2KOTA 1SCVA 5B8IB 1KWOB 4YGDB 4DUQA 1E8AA 1AK8A 1BLQA 4CFRA 2JNFA 4ORAB 4YGBB 1SYMA 1W7IB 3WXAA 3SIBA 5DKNA 1C07A 2ZNEA 1B8LA 1F4QA 3TZ1A 2M7LA 1KK7Z 1AVSA 2M9GA 1BU3A 4GPLB 4OR9B 2JPTA 1BR4B 3EK8A 1QS7A 3BYAA 4ZCUA 1F71A 4C0LA 1UWOA 1RTP1 4GUKA 2EHBA 2M97A 3NSIA 1QATA 1JC2A 4MVFA 3SJSA 3EKHA 1WLMA 4ORCB 4QJ4B 3DVEA 5AEQA 5KTYA 1BODA 2KQYA 3FWCA 1L7ZA 3I5GB 1XFZO 3NSKA 1GQMA 2KFGA 1UHNA 2KSPA 2NZ0A 5D69A 4AQIA 4GBAA 2KFHA 1CLLA 2CTNA 1KK7Y 2MA2A 5I8NA 3D0YA 5J3XA 1TRFA 3VRRA 1OMDA 4MLWA 1EJ3A 2I7AA 2CBLA 4R1EA 1XFWO 2LVKA 2M8UA 4XYNA 4DIRA 3I5IB 4YI9A 1ZOTB 4JPZB 3DF0B 3CGAA 1CMGA 3IQQA 2JT3A 2MLFC 3OP0A 1RROA 3VROA 3FWBA 4HRGA 1DJIA 3MSEB 1Y0VH 2H61A 3LLEA 1S3PA 1KK8C 4MZJA 4MSPA 3EVUA 3VRQA 1K9KA 3LCPC 2ZNDA 1IH0A 5DKQA 2I2RE 2ZKMX 1F55A 2NCPA 4HREE 1NYAA 3JVTC 1YVLA 4ZCVA 2BECA 1YTZC 4OCIA 4I5JA 1NCXA 2KBIA 4P5OE 2MJWB 5HKZA 1SL8A 3EVRA 5CSNA 1QVIZ 2Q4UA 2MHHA 3PLFB 4I5NB 1MXLC 2Y1NA 1NIWA 1UHKA 1TIZA 1VRKA 1TTXA 2KBMA 4XJKA 3BUWB 2KI6D 1NPQA 1J7QA 5AANA 5I2QA 3JTDB 2JWWA 2RGIA 1CFFA 4NDBA 3I5HC 2JOJA 3WHUB 1Y1AA 1B9AA 1K9UA 1A75B 2BE4A 3FIAA 3RLZA 1YUUA 4I5LB 1ALVA 1JFJA 1SPYA 3VRPA 1SR6C 4ORBB 2WC8A 4DS7A 2KFFA 3D10A 2OS8C 1AJ4A 2F8PA 2WCBA 5TNCA 1QVIY 2SCPA 3SG6A 2WOSA 1RECA 4TNCA 1M31A 1TNXA 1HQVA 2K8MB 3LL8B 1L2OB 1M39A 3AAKA 2KGBC 2EC6C 1IKUA 1R6PA 3SG3A 1J7RA 1DJHA 1LA3A 2CNPA 1IJ5A 2JZIA 3WHTB 5AFPA 1DJXA 3BUMB 5CSJA 1YX8A 1MQ1A 5HKYA 1EXRA 5D7FA 3RM1A 1F70A 4GGNA 1G4YR 1QLKA 2KYCA 4PHJA 2LUCA 4PALA 2NCOA 1N2DA 2F2PA 2MAZA 2KNEA 1Y1UA 4L9MA 1AJ5A 2LLTA 1WDCC 4WRIA 4YBHB 1SL9A 2LV7A 1BR1B 1CTRA 1KQMB 3KO0A 2FCDA 2LVVA 1CDLA 1TCFA 1F8HA 2Q91A 3SG5A 1YUSA 3HCMA 2LLUA 1NCYA 4PCWA 4WQ2A 2K7CA 1TNPA 2FJUB 2CXJA 1AP4A 1SCMB 1LXFC 1PVBA 1YX7A 3HX4A 1MF8B 1GGWA 4UPGA 1IRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KWO C;  2HET A;  2BKH B;  2DOQ A;  2L50 A;  3EVV A;  3BUN B;  3GOF A;  2FCE A;  2L98 A;  1TCO B;  2F33 A;  4OV2 A;  1JWD A;  1H8B A;  1NP8 A;  1QX7 A;  2LMV A;  3SIA A;  1PSR A;  1Q80 A;  2LAP A;  1CFP A;  3OHM B;  2JNX A;  2A4J A;  2IS9 A;  4YI8 A;  1KFX L;  2KI4 C;  1S36 A;  1S6C A;  1IGV A;  2LHI A;  2F2O A;  1DJW A;  1XFX O;  2WOR A;  3O6B A;  4CPV A;  1FW4 A;  1FI5 A;  1X02 A;  1CB1 A;  1CLM A;  1DF0 B;  1BJF A;  3NSO A;  1PVA A;  1IQ3 A;  1OZS A;  2EGD A;  3LK1 A;  1CM4 A;  1CDN A;  4PE0 A;  3AAJ A;  1JF0 A;  1C7V A;  2JXL A;  1KSO A;  3SG4 A;  1GGZ A;  1M63 B;  3I5G C;  1KFU L;  3ZNI A;  1V1G A;  1YUR A;  1K8U A;  4DCK A;  1EG4 A;  1JF2 A;  2HQW A;  1G33 A;  3KHE A;  2OTG B;  3A4U B;  1DJG A;  1B8C A;  1RWY A;  2BBN A;  4QJ5 B;  2LC5 A;  2JUL A;  5CPV A;  3PAL A;  1RK9 A;  2BKI B;  3BOW B;  4YGC B;  2LVJ A;  1D1O A;  5CSI A;  1J1D A;  1K93 D;  1YUT A;  2BBM A;  4NQG A;  2LUX A;  1EL4 A;  3AKB A;  2E6W A;  1U5I B;  3CS1 A;  1AUI B;  2KAV A;  2M0R A;  1YVH A;  2K7O A;  1KFX S;  2LCP A;  4IL1 A;  3VRN A;  2KAY A;  5KU1 A;  3H4S E;  2CCM A;  2NLN A;  1CLB A;  1ZFS A;  4MBE A;  1IWQ A;  5DKR A;  5AER A;  1CNP A;  2BL0 B;  4FTG A;  2PSR A;  2COL B;  1B7T Z;  3TDU A;  4JWQ A;  5BPJ A;  3ICB A;  3PN7 B;  4I5K A;  5JJG A;  1QTX A;  1LKJ A;  2L2E A;  1CDP A;  1QX5 B;  2KQ6 A;  2BCX A;  3EKJ A;  5AXI A;  1KFU S;  3TS5 C;  1A4P A;  1YR5 A;  2LAN A;  1EG3 A;  1B1G A;  2LP3 A;  2PVB A;  4N1F A;  3CTN A;  2ZN9 A;  3ZWH A;  3PAT A;  4MZL A;  1TNQ A;  1ZUZ A;  1NCZ A;  3QRX A;  2LVI A;  2HPS A;  4GGF C;  1QV0 A;  3OB2 B;  1KSM A;  3JTD C;  2F3Y A;  1MUX A;  1UHJ A;  1QV1 A;  3KF9 A;  2ZRT A;  2GGM A;  1M46 A;  4BY5 A;  2K7B A;  4MZK A;  4PE7 A;  1B7T Y;  2CT9 A;  1FPW A;  1LA0 A;  4N5X A;  1PAL A;  2G9B A;  2Y5I A;  2MRD A;  3I5F B;  2O5G A;  2JT0 A;  2JTT A;  4MRX A;  2K2A A;  1XFY O;  2M1U A;  5K89 A;  1Y1X A;  3BXK A;  3O2P A;  1PK0 D;  1XFU O;  1ODB A;  4C0K A;  2JT8 A;  5JOL A;  1OQP A;  4ETO A;  1J55 A;  1NWD A;  2L0P A;  2WND A;  2TN4 A;  3D0Y B;  2AMI A;  2FOT A;  2JQ6 A;  2JXC A;  4OKH A;  1BOC A;  2ZRS A;  1W7J B;  4MN0 A;  1J7P A;  2WCF A;  1TNW A;  1DT7 B;  2NXQ A;  3DVJ A;  1J7O A;  1XVJ A;  4Q04 A;  1C7W A;  1BG1 A;  2GV5 A;  2F3Z A;  2AUC A;  1CFD A;  1K2H A;  4PE4 A;  3F45 A;  5GQQ C;  1KQM C;  2HQ8 A;  1R2U A;  3GK1 A;  4NDD A;  1S6I A;  4HSZ A;  4JQ0 D;  4GAO A;  2LMU A;  3TUY B;  1YRT B;  1XA5 A;  3NXA A;  1N0Y A;  4D1E A;  1PSB A;  2HF5 A;  1SCM C;  2PMY A;  4GNK B;  3BUO B;  1KCY A;  1JUO A;  1QAS A;  2LMT A;  1NX2 A;  4QJ3 B;  3FS7 A;  1SK6 D;  4WQ3 A;  2KHN A;  4GGF A;  2PRU A;  2Y4Q A;  1OSA A;  1WRK A;  2K61 A;  1K95 A;  2KDH A;  1K96 A;  1SW8 A;  1OZO A;  3IQO A;  3K21 A;  1G8I A;  2P6B B;  1XK4 C;  1QJT A;  1QX2 A;  1DGV A;  1A75 A;  3PM8 A;  3O78 A;  1CMF A;  1MWN A;  2M7N A;  1ALW A;  1J1E A;  1LVC D;  2E30 A;  3BUX B;  3GK2 A;  2D8N A;  1PUL A;  1FBV A;  4CLN A;  1RJV A;  1BMO A;  2KYF A;  1SNL A;  2KI4 B;  4XJK B;  1QXP A;  2ZFD A;  5ER5 A;  5IBW A;  1DVI A;  1K94 A;  1S26 D;  4PE1 A;  3CZT X;  1WLZ A;  4PHN A;  3A8R A;  4YGA A;  1CKK A;  2B1U A;  3E3R A;  1SL7 A;  3PSR A;  3CWG A;  3LK0 A;  5I2L A;  2OTG C;  3M0W A;  3CR4 X;  1NX0 A;  3DD4 A;  1WRL A;  3I5I C;  4YGE B;  1BT6 A;  1NSH A;  1TOP A;  2BE6 A;  4YRU A;  3NSL A;  4USL A;  1HT9 A;  2Y1M A;  2AAO A;  4PHK A;  2M1K B;  4ICB A;  1A03 A;  1Y6W A;  1SRA A;  2SAS A;  2L4H A;  1OOJ A;  1DGU A;  3KEV A;  4MEW A;  1NX1 A;  1XYD A;  2LHL A;  2H2K A;  2I94 A;  4CID A;  1NX3 A;  1DMO A;  3DVK A;  2I18 A;  1MHO A;  1BF5 A;  2ISD A;  3EK4 A;  1WRZ A;  2GGZ A;  2LE9 B;  4N1G A;  1KK8 B;  4M2P A;  1UHI A;  1ZAC A;  1F4O A;  4BY4 A;  1JBA A;  1CM1 A;  5HKW A;  5G08 A;  1IG5 A;  3PFV A;  2JTZ A;  4CFQ A;  4PHM A;  4OVN F;  1CFC A;  4AOM A;  4FQO A;  3JVT B;  1PRW A;  3WNX B;  1LIN A;  3TDZ A;  2OPO A;  3GK4 X;  2BL0 C;  1XK4 A;  1WY9 A;  4P2Y B;  1CDM A;  3IF7 A;  1JFK A;  1JSA A;  4AQJ A;  2R2I A;  3PN7 C;  4M2Q A;  3SG2 A;  1F54 A;  2PAS A;  3OX6 A;  4A4B A;  4A4C A;  1OMR A;  1TN4 A;  2K7D A;  1M45 A;  1SBJ A;  5ER4 X;  3VGO A;  1SY9 A;  2PAL A;  1DJY A;  1UHH A;  1DF0 A;  1DTL A;  1UP5 A;  5KSZ A;  3CR5 X;  3TS5 B;  2LNK A;  1XFV O;  1QLS A;  1B8R A;  1H4B A;  1GJY A;  2BCA A;  1QIW A;  1MXE A;  1UUS A;  2JC2 A;  1DJZ A;  1ZMZ A;  3I5H B;  5CSF A;  2L4I A;  2BCB A;  1NUB A;  2K0J A;  2JU0 A;  3SG7 A;  1K9P A;  4M2O A;  1MR8 A;  1RFJ A;  1SR6 B;  1S1E A;  1B4C A;  2VRG A;  5HLO A;  1OMV A;  2OS8 B;  3DF0 A;  1A29 A;  2M29 A;  1L2O C;  4MRY A;  2QAC A;  3I5F C;  5I2O A;  1FF1 A;  1SKT A;  1OE9 B;  4NDC A;  2M49 B;  3BQ3 A;  4U8D A;  1V1F A;  1S5G Z;  5PAL A;  3BOW A;  4F0Z B;  2LM5 A;  2MBX A;  2EC6 B;  3OX5 A;  1SMG A;  1YRU B;  2K2F A;  2KAX A;  3DVM A;  4C0J A;  1QIV A;  2ZN8 A;  2L5X B;  4DRW A;  1KQV A;  1B47 A;  1K90 D;  2LLS A;  3TDI A;  2KI6 C;  2M3W A;  1IJ6 A;  1U5I A;  1XO5 A;  3AKA A;  4E68 A;  1AHR A;  3OB1 B;  5HYD A;  3CR2 A;  1FI6 A;  1WDC B;  2MLE C;  4GFT A;  2G2B A;  1S6J A;  2L51 A;  3O4Y A;  2V53 A;  1S5G Y;  1EH2 A;  2KGR A;  2LP2 A;  5HLV A;  2JRF A;  5F6T A;  1N65 A;  3KPX A;  3C1V A;  2WCE A;  1A2X A;  2QPT A;  2H61 C;  5FYX A;  1IQ5 A;  3TUY C;  3EK7 A;  1UUR A;  4PDZ A;  2O60 A;  3CLN A;  4HRH A;  2KOT A;  1SCV A;  5B8I B;  1KWO B;  4YGD B;  4DUQ A;  1E8A A;  1AK8 A;  1BLQ A;  4CFR A;  2JNF A;  4ORA B;  4YGB B;  1SYM A;  1W7I B;  3WXA A;  3SIB A;  5DKN A;  1C07 A;  2ZNE A;  1B8L A;  1F4Q A;  3TZ1 A;  2M7L A;  1KK7 Z;  1AVS A;  2M9G A;  1BU3 A;  4GPL B;  4OR9 B;  2JPT A;  1BR4 B;  3EK8 A;  1QS7 A;  3BYA A;  4ZCU A;  1F71 A;  4C0L A;  1UWO A;  1RTP 1;  4GUK A;  2EHB A;  2M97 A;  3NSI A;  1QAT A;  1JC2 A;  4MVF A;  3SJS A;  3EKH A;  1WLM A;  4ORC B;  4QJ4 B;  3DVE A;  5AEQ A;  5KTY A;  1BOD A;  2KQY A;  3FWC A;  1L7Z A;  3I5G B;  1XFZ O;  3NSK A;  1GQM A;  2KFG A;  1UHN A;  2KSP A;  2NZ0 A;  5D69 A;  4AQI A;  4GBA A;  2KFH A;  1CLL A;  2CTN A;  1KK7 Y;  2MA2 A;  5I8N A;  3D0Y A;  5J3X A;  1TRF A;  3VRR A;  1OMD A;  4MLW A;  1EJ3 A;  2I7A A;  2CBL A;  4R1E A;  1XFW O;  2LVK A;  2M8U A;  4XYN A;  4DIR A;  3I5I B;  4YI9 A;  1ZOT B;  4JPZ B;  3DF0 B;  3CGA A;  1CMG A;  3IQQ A;  2JT3 A;  2MLF C;  3OP0 A;  1RRO A;  3VRO A;  3FWB A;  4HRG A;  1DJI A;  3MSE B;  1Y0V H;  2H61 A;  3LLE A;  1S3P A;  1KK8 C;  4MZJ A;  4MSP A;  3EVU A;  3VRQ A;  1K9K A;  3LCP C;  2ZND A;  1IH0 A;  5DKQ A;  2I2R E;  2ZKM X;  1F55 A;  2NCP A;  4HRE E;  1NYA A;  3JVT C;  1YVL A;  4ZCV A;  2BEC A;  1YTZ C;  4OCI A;  4I5J A;  1NCX A;  2KBI A;  4P5O E;  2MJW B;  5HKZ A;  1SL8 A;  3EVR A;  5CSN A;  1QVI Z;  2Q4U A;  2MHH A;  3PLF B;  4I5N B;  1MXL C;  2Y1N A;  1NIW A;  1UHK A;  1TIZ A;  1VRK A;  1TTX A;  2KBM A;  4XJK A;  3BUW B;  2KI6 D;  1NPQ A;  1J7Q A;  5AAN A;  5I2Q A;  3JTD B;  2JWW A;  2RGI A;  1CFF A;  4NDB A;  3I5H C;  2JOJ A;  3WHU B;  1Y1A A;  1B9A A;  1K9U A;  1A75 B;  2BE4 A;  3FIA A;  3RLZ A;  1YUU A;  4I5L B;  1ALV A;  1JFJ A;  1SPY A;  3VRP A;  1SR6 C;  4ORB B;  2WC8 A;  4DS7 A;  2KFF A;  3D10 A;  2OS8 C;  1AJ4 A;  2F8P A;  2WCB A;  5TNC A;  1QVI Y;  2SCP A;  3SG6 A;  2WOS A;  1REC A;  4TNC A;  1M31 A;  1TNX A;  1HQV A;  2K8M B;  3LL8 B;  1L2O B;  1M39 A;  3AAK A;  2KGB C;  2EC6 C;  1IKU A;  1R6P A;  3SG3 A;  1J7R A;  1DJH A;  1LA3 A;  2CNP A;  1IJ5 A;  2JZI A;  3WHT B;  5AFP A;  1DJX A;  3BUM B;  5CSJ A;  1YX8 A;  1MQ1 A;  5HKY A;  1EXR A;  5D7F A;  3RM1 A;  1F70 A;  4GGN A;  1G4Y R;  1QLK A;  2KYC A;  4PHJ A;  2LUC A;  4PAL A;  2NCO A;  1N2D A;  2F2P A;  2MAZ A;  2KNE A;  1Y1U A;  4L9M A;  1AJ5 A;  2LLT A;  1WDC C;  4WRI A;  4YBH B;  1SL9 A;  2LV7 A;  1BR1 B;  1CTR A;  1KQM B;  3KO0 A;  2FCD A;  2LVV A;  1CDL A;  1TCF A;  1F8H A;  2Q91 A;  3SG5 A;  1YUS A;  3HCM A;  2LLU A;  1NCY A;  4PCW A;  4WQ2 A;  2K7C A;  1TNP A;  2FJU B;  2CXJ A;  1AP4 A;  1SCM B;  1LXF C;  1PVB A;  1YX7 A;  3HX4 A;  1MF8 B;  1GGW A;  4UPG A;  1IRJ A; 
#chains in the Genus database with same CATH topology
 1KWO C;  2HET A;  2BKH B;  2DOQ A;  2L50 A;  3EVV A;  5EL2 A;  3BUN B;  3GOF A;  2FCE A;  2L98 A;  1TCO B;  2F33 A;  4OV2 A;  1JWD A;  1H8B A;  1NP8 A;  4JKT A;  1QX7 A;  3PM2 A;  2LMV A;  3SIA A;  1PSR A;  1Q80 A;  2LAP A;  1CFP A;  3OHM B;  2JNX A;  2A4J A;  2IS9 A;  4YI8 A;  1KFX L;  2KI4 C;  1S36 A;  1S6C A;  1IGV A;  2LHI A;  2F2O A;  1DJW A;  1XFX O;  2WOR A;  3O6B A;  4CPV A;  1FW4 A;  4F7F A;  1X02 A;  1FI5 A;  1CB1 A;  1CLM A;  1DF0 B;  1BJF A;  3NSO A;  1PVA A;  1IQ3 A;  1OZS A;  2EGD A;  3LK1 A;  1CM4 A;  1CDN A;  4PE0 A;  3AAJ A;  1JF0 A;  1C7V A;  2JXL A;  1KSO A;  3RZS A;  3SG4 A;  1GGZ A;  1M63 B;  3I5G C;  1KFU L;  3ZNI A;  1V1G A;  3CYZ A;  1TUZ A;  1YUR A;  1K8U A;  4DCK A;  1EG4 A;  1GM0 A;  1JF2 A;  3D77 A;  2HQW A;  1G33 A;  3KHE A;  2OTG B;  3A4U B;  1DJG A;  1B8C A;  1RWY A;  2BBN A;  4QJ5 B;  2LC5 A;  2JUL A;  5CPV A;  3PAL A;  3V2L A;  3L47 A;  1RK9 A;  2BKI B;  3BOW B;  4YGC B;  2LVJ A;  1D1O A;  5CSI A;  4INX A;  3FE8 A;  3IVT A;  1J1D A;  1K93 D;  1YUT A;  3FE9 A;  2BBM A;  4NQG A;  2LUX A;  3DY9 A;  3CDN A;  1EL4 A;  3AKB A;  2E6W A;  3NHI A;  1QWV A;  1U5I B;  3CS1 A;  1Z4H A;  1AUI B;  2KAV A;  2M0R A;  1YVH A;  2K7O A;  1KFX S;  2LCP A;  4IL1 A;  3VRN A;  2KAY A;  2BNX A;  5KU1 A;  3H4S E;  2CCM A;  2NLN A;  1CLB A;  1ZFS A;  3QME A;  4MBE A;  1IWQ A;  5DKR A;  2QEH A;  5AER A;  1CNP A;  2BL0 B;  4FTG A;  3S0A A;  3L4A A;  2PSR A;  2COL B;  1B7T Z;  3TDU A;  4JWQ A;  5BPJ A;  2WCJ A;  2L2C A;  3ICB A;  3PN7 B;  4I5K A;  1QTX A;  1LKJ A;  5JJG A;  2L2E A;  1CDP A;  1QX5 B;  2KQ6 A;  2BCX A;  3EKJ A;  5AXI A;  1KFU S;  3TS5 C;  1A4P A;  1YR5 A;  2LAN A;  1EG3 A;  1B1G A;  2LP3 A;  2PVB A;  4N1F A;  3CTN A;  2ZN9 A;  3ZWH A;  1OOH A;  3PAT A;  1TNQ A;  1ZUZ A;  1NCZ A;  3QRX A;  4MZL A;  1C3Y A;  2LVI A;  2HPS A;  4GGF C;  1QV0 A;  2WCK A;  3OB2 B;  1KSM A;  3JTD C;  2F3Y A;  1MUX A;  1UHJ A;  2PYQ A;  1QV1 A;  4OZD A;  3KF9 A;  3D74 A;  2YGU A;  2ZRT A;  2GGM A;  1M46 A;  4BY5 A;  2K7B A;  2QEV A;  4MZK A;  4PE7 A;  1B7T Y;  2CT9 A;  1FPW A;  1LA0 A;  4N5X A;  1PAL A;  2G9B A;  2Y5I A;  2MRD A;  3I5F B;  2O5G A;  2JT0 A;  2JTT A;  4MRX A;  2K2A A;  1XFY O;  2M1U A;  3O4X A;  5K89 A;  1Y1X A;  3BXK A;  3O2P A;  1PK0 D;  1XFU O;  1ODB A;  4C0K A;  2JT8 A;  5JOL A;  1OQP A;  4ETO A;  2WC6 A;  1J55 A;  1NWD A;  2L0P A;  4IJ7 A;  2WND A;  2TN4 A;  3D0Y B;  2AMI A;  2FOT A;  2JQ6 A;  2JXC A;  4OKH A;  3VB1 A;  2ZRS A;  1W7J B;  4MN0 A;  1BOC A;  1J7P A;  2WCF A;  1TNW A;  1DT7 B;  2NXQ A;  3DVJ A;  1J7O A;  1XVJ A;  4Q04 A;  1C7W A;  1BG1 A;  2GV5 A;  2F3Z A;  2AUC A;  1CFD A;  1K2H A;  4PE4 A;  3F45 A;  5GQQ C;  1KQM C;  2HQ8 A;  1R2U A;  3GK1 A;  2GTE A;  4NDD A;  1S6I A;  4HSZ A;  4JQ0 D;  4GAO A;  2LMU A;  3TUY B;  1YRT B;  1DC1 A;  1XA5 A;  3NXA A;  1N0Y A;  4D1E A;  1PSB A;  2HF5 A;  1SCM C;  2PMY A;  4GNK B;  3BUO B;  1KCY A;  1JUO A;  1QAS A;  2LMT A;  1NX2 A;  4QJ3 B;  3FS7 A;  1SK6 D;  4WQ3 A;  2KHN A;  4GGF A;  2PRU A;  2Y4Q A;  1OSA A;  1WRK A;  2K61 A;  1K95 A;  2KDH A;  1K96 A;  1SW8 A;  1OZO A;  3IQO A;  3K21 A;  1G8I A;  2P6B B;  5HL1 A;  1XK4 C;  1QJT A;  1QX2 A;  1DGV A;  1IIO A;  3EG5 B;  1A75 A;  3PM8 A;  3O78 A;  1CMF A;  1MWN A;  2M7N A;  1ALW A;  1J1E A;  1LVC D;  2E30 A;  3BUX B;  3GK2 A;  2D8N A;  1PUL A;  1FBV A;  4CLN A;  1RJV A;  1BMO A;  2KYF A;  1SNL A;  2KI4 B;  4XJK B;  1QXP A;  2ZFD A;  3D75 A;  5ER5 A;  5IBW A;  1DVI A;  1K94 A;  1S26 D;  4PE1 A;  2K60 A;  3CZT X;  1WLZ A;  3CAB A;  4PHN A;  3A8R A;  4YGA A;  1CKK A;  2B1U A;  3E3R A;  1SL7 A;  1T14 A;  3CWG A;  3PSR A;  1ORG A;  3LK0 A;  5I2L A;  3CZ0 A;  2QEB A;  2OTG C;  3M0W A;  3CR4 X;  1NX0 A;  3DD4 A;  1WRL A;  3I5I C;  4YGE B;  2KLE A;  1BT6 A;  1NSH A;  1TOP A;  2BE6 A;  4YRU A;  3NSL A;  4USL A;  1HT9 A;  2Y1M A;  3S0E A;  2AAO A;  4PHK A;  2M1K B;  4ICB A;  3UO9 A;  1A03 A;  1Y6W A;  1SRA A;  2SAS A;  2L4H A;  1OOJ A;  1DGU A;  3KEV A;  2JPO A;  4MEW A;  1NX1 A;  1XYD A;  2LHL A;  2H2K A;  2I94 A;  4CID A;  3BJH A;  1NX3 A;  5DIC A;  1DMO A;  3DVK A;  2I18 A;  1MHO A;  1BF5 A;  2ISD A;  3EK4 A;  1WRZ A;  2GGZ A;  2LE9 B;  3BFB A;  1KK8 B;  4M2P A;  1UHI A;  4N1G A;  3BFH A;  1ZAC A;  1F4O A;  4BY4 A;  1JBA A;  2KPH A;  1CM1 A;  5HKW A;  5G08 A;  1IG5 A;  3PFV A;  2JTZ A;  4CFQ A;  4PHM A;  4OVN F;  3R1P A;  1CFC A;  4AOM A;  4FQO A;  3JVT B;  1PRW A;  3WNX B;  1LIN A;  3TDZ A;  2OPO A;  1Z2C B;  3GK4 X;  2BL0 C;  1XK4 A;  1WY9 A;  4P2Y B;  1CDM A;  3IF7 A;  1JFK A;  1JSA A;  4AQJ A;  2R2I A;  3PN7 C;  4M2Q A;  3SG2 A;  1F54 A;  2PAS A;  3OX6 A;  4A4B A;  4A4C A;  1OMR A;  1TN4 A;  2K7D A;  1M45 A;  1SBJ A;  5ER4 X;  3VGO A;  1SY9 A;  2PAL A;  1DJY A;  1UHH A;  1DF0 A;  1DTL A;  1UP5 A;  5KSZ A;  3SS3 A;  3CR5 X;  3TS5 B;  2LNK A;  1XFV O;  1QLS A;  1B8R A;  1H4B A;  1GJY A;  2BCA A;  1QIW A;  1MXE A;  1UUS A;  2JC2 A;  5I94 A;  1DJZ A;  1ZMZ A;  3I5H B;  5FI2 A;  5CSF A;  2L4I A;  3B87 A;  2BCB A;  1NUB A;  3NGV A;  2K0J A;  2JU0 A;  3S0B A;  3SG7 A;  1K9P A;  1OOF A;  4M2O A;  2WCL A;  1MR8 A;  1RFJ A;  1SR6 B;  1S1E A;  1B4C A;  2VRG A;  5HLO A;  1OMV A;  3CZ2 A;  2OS8 B;  3DF0 A;  1A29 A;  2M29 A;  1L2O C;  4MRY A;  2QAC A;  3I5F C;  5I2O A;  1FF1 A;  1SKT A;  1OE9 B;  4NDC A;  2M49 B;  3BQ3 A;  4U8D A;  1V1F A;  1S5G Z;  5PAL A;  3BOW A;  4F0Z B;  2LM5 A;  3NHT A;  2MBX A;  2EC6 B;  3OX5 A;  1SMG A;  1YRU B;  2K2F A;  2KAX A;  3DVM A;  1SSE B;  4FQT A;  4C0J A;  2PQL A;  1QIV A;  2ZN8 A;  2P70 A;  3L4L A;  2L5X B;  4DRW A;  1KQV A;  1B47 A;  1K90 D;  2LLS A;  4INW A;  3TDI A;  2KI6 C;  2M3W A;  1IJ6 A;  1U5I A;  1XO5 A;  3AKA A;  4E68 A;  1AHR A;  3OB1 B;  5HYD A;  3CR2 A;  1DQE A;  3SS5 A;  1WDC B;  1FI6 A;  2MLE C;  4GFT A;  1P28 A;  1S6J A;  2G2B A;  2L51 A;  3O4Y A;  2V53 A;  1S5G Y;  1EH2 A;  2KGR A;  2LP2 A;  5HLV A;  2JRF A;  5F6T A;  1N65 A;  3KPX A;  3R1V A;  3C1V A;  2WCE A;  1A2X A;  2QPT A;  2H61 C;  5FYX A;  1IQ5 A;  3TUY C;  3EK7 A;  1UUR A;  4PDZ A;  2O60 A;  3CLN A;  4HRH A;  2KOT A;  3B6X A;  1SCV A;  5B8I B;  1KWO B;  4YGD B;  4DUQ A;  1E8A A;  1AK8 A;  1BLQ A;  4CFR A;  2JNF A;  4ORA B;  4YGB B;  1SYM A;  1W7I B;  3WXA A;  3B86 A;  5DKN A;  3SIB A;  1C07 A;  2ZNE A;  1B8L A;  1F4Q A;  2BAP A;  3TZ1 A;  2M7L A;  1KK7 Z;  1AVS A;  2M9G A;  3S0F A;  1BU3 A;  2QDI A;  4GPL B;  4OR9 B;  2JPT A;  1BR4 B;  3EK8 A;  1QS7 A;  3BYA A;  4ZCU A;  1F71 A;  4C0L A;  1UWO A;  1RTP 1;  4GUK A;  2EHB A;  2M97 A;  3NSI A;  1QAT A;  1JC2 A;  4MVF A;  3SJS A;  3EKH A;  1WLM A;  3Q8I A;  4ORC B;  4QJ4 B;  3DVE A;  5AEQ A;  3N7H A;  5KTY A;  1BOD A;  2KQY A;  3FWC A;  1L7Z A;  3I5G B;  1XFZ O;  3DZT A;  3NSK A;  1GQM A;  3OGN A;  2KFG A;  1UHN A;  3S0D A;  2KSP A;  2NZ0 A;  5D69 A;  1OOI X;  5FI7 A;  4GBA A;  4AQI A;  2KFH A;  1CLL A;  2CTN A;  1KK7 Y;  2MA2 A;  2FJY A;  5I8N A;  3D0Y A;  5J3X A;  1TRF A;  3VRR A;  1OMD A;  4MLW A;  1EJ3 A;  2I7A A;  2CBL A;  4R1E A;  3S0G A;  1XFW O;  2LVK A;  2M8U A;  2WCH A;  3PJI A;  4XYN A;  3I5I B;  4YI9 A;  4DIR A;  1ZOT B;  3DXL A;  4JPZ B;  3DF0 B;  3CGA A;  1CMG A;  3IQQ A;  3SS4 A;  2JT3 A;  2MLF C;  3OP0 A;  1RRO A;  3VRO A;  3FWB A;  4HRG A;  2WC5 A;  4JD9 A;  1OOG A;  1DJI A;  3MSE B;  1Y0V H;  2H61 A;  3LLE A;  1S3P A;  1KK8 C;  4MZJ A;  4MSP A;  3EVU A;  3VRQ A;  1K9K A;  3LCP C;  2ZND A;  1IH0 A;  2L5Y A;  5DKQ A;  2I2R E;  2ZKM X;  3FE6 A;  2NCP A;  3B7A A;  4HRE E;  5FI6 A;  1F55 A;  1NYA A;  3CZ1 A;  3JVT C;  1YVL A;  4ZCV A;  2BEC A;  1TUJ A;  5D3O A;  1YTZ C;  4OCI A;  4I5J A;  1NCX A;  2KBI A;  4P5O E;  2MJW B;  5HKZ A;  3K1E A;  3DYE A;  1SL8 A;  3EVR A;  3R1O A;  5CSN A;  1QVI Z;  2Q4U A;  4KYN A;  2MHH A;  3PLF B;  4I5N B;  1MXL C;  2P71 A;  2KLD A;  2Y1N A;  1NIW A;  1UHK A;  1TIZ A;  1VRK A;  1TTX A;  2KBM A;  4XJK A;  3BUW B;  2KI6 D;  1LS8 A;  3OBV A;  1NPQ A;  1J7Q A;  5AAN A;  5I2Q A;  3JTD B;  1XFR A;  3B88 A;  2JWW A;  2RGI A;  1CFF A;  4NDB A;  3D78 A;  3I5H C;  2JOJ A;  3WHU B;  1Y1A A;  1B9A A;  1K9U A;  1A75 B;  2BE4 A;  3FIA A;  3RLZ A;  1YUU A;  4I5L B;  1ALV A;  1JFJ A;  1SPY A;  3VRP A;  1SR6 C;  4ORB B;  2WC8 A;  4DS7 A;  2KFF A;  3D10 A;  2OS8 C;  1AJ4 A;  1W9Z A;  2F8P A;  2WCB A;  1DEK A;  1QVI Y;  5TNC A;  2SCP A;  2WCM A;  3UNW A;  3BFA A;  3SG6 A;  2WOS A;  1REC A;  4TNC A;  1M31 A;  2QEO A;  1TNX A;  1HQV A;  2K8M B;  1C3Z A;  3LL8 B;  1L2O B;  1M39 A;  3AAK A;  2KGB C;  2EC6 C;  1IKU A;  1R6P A;  3SG3 A;  1J7R A;  1DJH A;  1LA3 A;  2CNP A;  1IJ5 A;  2JZI A;  3WHT B;  5AFP A;  1DJX A;  3BUM B;  5CSJ A;  1TWO A;  1OW4 A;  1MQ1 A;  1YX8 A;  5HKY A;  1EXR A;  5D7F A;  3RM1 A;  1F70 A;  4GGN A;  1G4Y R;  1QLK A;  2ERB A;  2KYC A;  4PHJ A;  2LUC A;  3R72 A;  4PAL A;  2NCO A;  1N2D A;  2F2P A;  3D76 A;  2MAZ A;  2KNE A;  1Y1U A;  4L9M A;  1AJ5 A;  2LLT A;  1WDC C;  4WRI A;  4YBH B;  1SL9 A;  2LV7 A;  1BR1 B;  2H8V A;  1CTR A;  1KQM B;  3KO0 A;  2FCD A;  2LVV A;  1CDL A;  1TCF A;  3D73 A;  1F8H A;  2Q91 A;  4PT1 A;  3SG5 A;  1YUS A;  3HCM A;  2LLU A;  1NCY A;  4PCW A;  4WQ2 A;  1DEL A;  2K7C A;  1TNP A;  2FJU B;  2CXJ A;  1AP4 A;  1SCM B;  1LXF C;  1PVB A;  1YX7 A;  3HX4 A;  1MF8 B;  1GGW A;  4UPG A;  1IRJ A; 
#chains in the Genus database with same CATH homology
 1KWO C;  2HET A;  2BKH B;  2DOQ A;  2L50 A;  3EVV A;  3BUN B;  3GOF A;  2FCE A;  2L98 A;  1TCO B;  2F33 A;  4OV2 A;  1JWD A;  1H8B A;  1NP8 A;  1QX7 A;  2LMV A;  3SIA A;  1PSR A;  1Q80 A;  2LAP A;  1CFP A;  3OHM B;  2JNX A;  2A4J A;  2IS9 A;  4YI8 A;  1KFX L;  2KI4 C;  1S36 A;  1S6C A;  1IGV A;  2LHI A;  2F2O A;  1DJW A;  1XFX O;  2WOR A;  3O6B A;  4CPV A;  1FW4 A;  1FI5 A;  1X02 A;  1CB1 A;  1CLM A;  1DF0 B;  1BJF A;  3NSO A;  1PVA A;  1IQ3 A;  1OZS A;  2EGD A;  3LK1 A;  1CM4 A;  1CDN A;  4PE0 A;  3AAJ A;  1JF0 A;  1C7V A;  2JXL A;  1KSO A;  3SG4 A;  1GGZ A;  1M63 B;  3I5G C;  1KFU L;  3ZNI A;  1V1G A;  1YUR A;  1K8U A;  4DCK A;  1EG4 A;  1JF2 A;  2HQW A;  1G33 A;  3KHE A;  2OTG B;  3A4U B;  1DJG A;  1B8C A;  1RWY A;  2BBN A;  4QJ5 B;  2LC5 A;  2JUL A;  5CPV A;  3PAL A;  1RK9 A;  2BKI B;  3BOW B;  4YGC B;  2LVJ A;  1D1O A;  5CSI A;  1J1D A;  1K93 D;  1YUT A;  2BBM A;  4NQG A;  2LUX A;  1EL4 A;  3AKB A;  2E6W A;  1U5I B;  3CS1 A;  1AUI B;  2KAV A;  2M0R A;  1YVH A;  2K7O A;  1KFX S;  2LCP A;  4IL1 A;  3VRN A;  2KAY A;  5KU1 A;  3H4S E;  2CCM A;  2NLN A;  1CLB A;  1ZFS A;  4MBE A;  1IWQ A;  5DKR A;  5AER A;  1CNP A;  2BL0 B;  4FTG A;  2PSR A;  2COL B;  1B7T Z;  3TDU A;  4JWQ A;  5BPJ A;  3ICB A;  3PN7 B;  4I5K A;  5JJG A;  1QTX A;  1LKJ A;  2L2E A;  1CDP A;  1QX5 B;  2KQ6 A;  2BCX A;  3EKJ A;  5AXI A;  1KFU S;  3TS5 C;  1A4P A;  1YR5 A;  2LAN A;  1EG3 A;  1B1G A;  2LP3 A;  2PVB A;  4N1F A;  3CTN A;  2ZN9 A;  3ZWH A;  3PAT A;  4MZL A;  1TNQ A;  1ZUZ A;  1NCZ A;  3QRX A;  2LVI A;  2HPS A;  4GGF C;  1QV0 A;  3OB2 B;  1KSM A;  3JTD C;  2F3Y A;  1MUX A;  1UHJ A;  1QV1 A;  3KF9 A;  2ZRT A;  2GGM A;  1M46 A;  4BY5 A;  2K7B A;  4MZK A;  4PE7 A;  1B7T Y;  2CT9 A;  1FPW A;  1LA0 A;  4N5X A;  1PAL A;  2G9B A;  2Y5I A;  2MRD A;  3I5F B;  2O5G A;  2JT0 A;  2JTT A;  4MRX A;  2K2A A;  1XFY O;  2M1U A;  5K89 A;  1Y1X A;  3BXK A;  3O2P A;  1PK0 D;  1XFU O;  1ODB A;  4C0K A;  2JT8 A;  5JOL A;  1OQP A;  4ETO A;  1J55 A;  1NWD A;  2L0P A;  2WND A;  2TN4 A;  3D0Y B;  2AMI A;  2FOT A;  2JQ6 A;  2JXC A;  4OKH A;  1BOC A;  2ZRS A;  1W7J B;  4MN0 A;  1J7P A;  2WCF A;  1TNW A;  1DT7 B;  2NXQ A;  3DVJ A;  1J7O A;  1XVJ A;  4Q04 A;  1C7W A;  1BG1 A;  2GV5 A;  2F3Z A;  2AUC A;  1CFD A;  1K2H A;  4PE4 A;  3F45 A;  5GQQ C;  1KQM C;  2HQ8 A;  1R2U A;  3GK1 A;  4NDD A;  1S6I A;  4HSZ A;  4JQ0 D;  4GAO A;  2LMU A;  3TUY B;  1YRT B;  1XA5 A;  3NXA A;  1N0Y A;  4D1E A;  1PSB A;  2HF5 A;  1SCM C;  2PMY A;  4GNK B;  3BUO B;  1KCY A;  1JUO A;  1QAS A;  2LMT A;  1NX2 A;  4QJ3 B;  3FS7 A;  1SK6 D;  4WQ3 A;  2KHN A;  4GGF A;  2PRU A;  2Y4Q A;  1OSA A;  1WRK A;  2K61 A;  1K95 A;  2KDH A;  1K96 A;  1SW8 A;  1OZO A;  3IQO A;  3K21 A;  1G8I A;  2P6B B;  1XK4 C;  1QJT A;  1QX2 A;  1DGV A;  1A75 A;  3PM8 A;  3O78 A;  1CMF A;  1MWN A;  2M7N A;  1ALW A;  1J1E A;  1LVC D;  2E30 A;  3BUX B;  3GK2 A;  2D8N A;  1PUL A;  1FBV A;  4CLN A;  1RJV A;  1BMO A;  2KYF A;  1SNL A;  2KI4 B;  4XJK B;  1QXP A;  2ZFD A;  5ER5 A;  5IBW A;  1DVI A;  1K94 A;  1S26 D;  4PE1 A;  3CZT X;  1WLZ A;  4PHN A;  3A8R A;  4YGA A;  1CKK A;  2B1U A;  3E3R A;  1SL7 A;  3PSR A;  3CWG A;  3LK0 A;  5I2L A;  2OTG C;  3M0W A;  3CR4 X;  1NX0 A;  3DD4 A;  1WRL A;  3I5I C;  4YGE B;  1BT6 A;  1NSH A;  1TOP A;  2BE6 A;  4YRU A;  3NSL A;  4USL A;  1HT9 A;  2Y1M A;  2AAO A;  4PHK A;  2M1K B;  4ICB A;  1A03 A;  1Y6W A;  1SRA A;  2SAS A;  2L4H A;  1OOJ A;  1DGU A;  3KEV A;  4MEW A;  1NX1 A;  1XYD A;  2LHL A;  2H2K A;  2I94 A;  4CID A;  1NX3 A;  1DMO A;  3DVK A;  2I18 A;  1MHO A;  1BF5 A;  2ISD A;  3EK4 A;  1WRZ A;  2GGZ A;  2LE9 B;  4N1G A;  1KK8 B;  4M2P A;  1UHI A;  1ZAC A;  1F4O A;  4BY4 A;  1JBA A;  1CM1 A;  5HKW A;  5G08 A;  1IG5 A;  3PFV A;  2JTZ A;  4CFQ A;  4PHM A;  4OVN F;  1CFC A;  4AOM A;  4FQO A;  3JVT B;  1PRW A;  3WNX B;  1LIN A;  3TDZ A;  2OPO A;  3GK4 X;  2BL0 C;  1XK4 A;  1WY9 A;  4P2Y B;  1CDM A;  3IF7 A;  1JFK A;  1JSA A;  4AQJ A;  2R2I A;  3PN7 C;  4M2Q A;  3SG2 A;  1F54 A;  2PAS A;  3OX6 A;  4A4B A;  4A4C A;  1OMR A;  1TN4 A;  2K7D A;  1M45 A;  1SBJ A;  5ER4 X;  3VGO A;  1SY9 A;  2PAL A;  1DJY A;  1UHH A;  1DF0 A;  1DTL A;  1UP5 A;  5KSZ A;  3CR5 X;  3TS5 B;  2LNK A;  1XFV O;  1QLS A;  1B8R A;  1H4B A;  1GJY A;  2BCA A;  1QIW A;  1MXE A;  1UUS A;  2JC2 A;  1DJZ A;  1ZMZ A;  3I5H B;  5CSF A;  2L4I A;  2BCB A;  1NUB A;  2K0J A;  2JU0 A;  3SG7 A;  1K9P A;  4M2O A;  1MR8 A;  1RFJ A;  1SR6 B;  1S1E A;  1B4C A;  2VRG A;  5HLO A;  1OMV A;  2OS8 B;  3DF0 A;  1A29 A;  2M29 A;  1L2O C;  4MRY A;  2QAC A;  3I5F C;  5I2O A;  1FF1 A;  1SKT A;  1OE9 B;  4NDC A;  2M49 B;  3BQ3 A;  4U8D A;  1V1F A;  1S5G Z;  5PAL A;  3BOW A;  4F0Z B;  2LM5 A;  2MBX A;  2EC6 B;  3OX5 A;  1SMG A;  1YRU B;  2K2F A;  2KAX A;  3DVM A;  4C0J A;  1QIV A;  2ZN8 A;  2L5X B;  4DRW A;  1KQV A;  1B47 A;  1K90 D;  2LLS A;  3TDI A;  2KI6 C;  2M3W A;  1IJ6 A;  1U5I A;  1XO5 A;  3AKA A;  4E68 A;  1AHR A;  3OB1 B;  5HYD A;  3CR2 A;  1FI6 A;  1WDC B;  2MLE C;  4GFT A;  2G2B A;  1S6J A;  2L51 A;  3O4Y A;  2V53 A;  1S5G Y;  1EH2 A;  2KGR A;  2LP2 A;  5HLV A;  2JRF A;  5F6T A;  1N65 A;  3KPX A;  3C1V A;  2WCE A;  1A2X A;  2QPT A;  2H61 C;  5FYX A;  1IQ5 A;  3TUY C;  3EK7 A;  1UUR A;  4PDZ A;  2O60 A;  3CLN A;  4HRH A;  2KOT A;  1SCV A;  5B8I B;  1KWO B;  4YGD B;  4DUQ A;  1E8A A;  1AK8 A;  1BLQ A;  4CFR A;  2JNF A;  4ORA B;  4YGB B;  1SYM A;  1W7I B;  3WXA A;  3SIB A;  5DKN A;  1C07 A;  2ZNE A;  1B8L A;  1F4Q A;  3TZ1 A;  2M7L A;  1KK7 Z;  1AVS A;  2M9G A;  1BU3 A;  4GPL B;  4OR9 B;  2JPT A;  1BR4 B;  3EK8 A;  1QS7 A;  3BYA A;  4ZCU A;  1F71 A;  4C0L A;  1UWO A;  1RTP 1;  4GUK A;  2EHB A;  2M97 A;  3NSI A;  1QAT A;  1JC2 A;  4MVF A;  3SJS A;  3EKH A;  1WLM A;  4ORC B;  4QJ4 B;  3DVE A;  5AEQ A;  5KTY A;  1BOD A;  2KQY A;  3FWC A;  1L7Z A;  3I5G B;  1XFZ O;  3NSK A;  1GQM A;  2KFG A;  1UHN A;  2KSP A;  2NZ0 A;  5D69 A;  4AQI A;  4GBA A;  2KFH A;  1CLL A;  2CTN A;  1KK7 Y;  2MA2 A;  5I8N A;  3D0Y A;  5J3X A;  1TRF A;  3VRR A;  1OMD A;  4MLW A;  1EJ3 A;  2I7A A;  2CBL A;  4R1E A;  1XFW O;  2LVK A;  2M8U A;  4XYN A;  4DIR A;  3I5I B;  4YI9 A;  1ZOT B;  4JPZ B;  3DF0 B;  3CGA A;  1CMG A;  3IQQ A;  2JT3 A;  2MLF C;  3OP0 A;  1RRO A;  3VRO A;  3FWB A;  4HRG A;  1DJI A;  3MSE B;  1Y0V H;  2H61 A;  3LLE A;  1S3P A;  1KK8 C;  4MZJ A;  4MSP A;  3EVU A;  3VRQ A;  1K9K A;  3LCP C;  2ZND A;  1IH0 A;  5DKQ A;  2I2R E;  2ZKM X;  1F55 A;  2NCP A;  4HRE E;  1NYA A;  3JVT C;  1YVL A;  4ZCV A;  2BEC A;  1YTZ C;  4OCI A;  4I5J A;  1NCX A;  2KBI A;  4P5O E;  2MJW B;  5HKZ A;  1SL8 A;  3EVR A;  5CSN A;  1QVI Z;  2Q4U A;  2MHH A;  3PLF B;  4I5N B;  1MXL C;  2Y1N A;  1NIW A;  1UHK A;  1TIZ A;  1VRK A;  1TTX A;  2KBM A;  4XJK A;  3BUW B;  2KI6 D;  1NPQ A;  1J7Q A;  5AAN A;  5I2Q A;  3JTD B;  2JWW A;  2RGI A;  1CFF A;  4NDB A;  3I5H C;  2JOJ A;  3WHU B;  1Y1A A;  1B9A A;  1K9U A;  1A75 B;  2BE4 A;  3FIA A;  3RLZ A;  1YUU A;  4I5L B;  1ALV A;  1JFJ A;  1SPY A;  3VRP A;  1SR6 C;  4ORB B;  2WC8 A;  4DS7 A;  2KFF A;  3D10 A;  2OS8 C;  1AJ4 A;  2F8P A;  2WCB A;  5TNC A;  1QVI Y;  2SCP A;  3SG6 A;  2WOS A;  1REC A;  4TNC A;  1M31 A;  1TNX A;  1HQV A;  2K8M B;  3LL8 B;  1L2O B;  1M39 A;  3AAK A;  2KGB C;  2EC6 C;  1IKU A;  1R6P A;  3SG3 A;  1J7R A;  1DJH A;  1LA3 A;  2CNP A;  1IJ5 A;  2JZI A;  3WHT B;  5AFP A;  1DJX A;  3BUM B;  5CSJ A;  1YX8 A;  1MQ1 A;  5HKY A;  1EXR A;  5D7F A;  3RM1 A;  1F70 A;  4GGN A;  1G4Y R;  1QLK A;  2KYC A;  4PHJ A;  2LUC A;  4PAL A;  2NCO A;  1N2D A;  2F2P A;  2MAZ A;  2KNE A;  1Y1U A;  4L9M A;  1AJ5 A;  2LLT A;  1WDC C;  4WRI A;  4YBH B;  1SL9 A;  2LV7 A;  1BR1 B;  1CTR A;  1KQM B;  3KO0 A;  2FCD A;  2LVV A;  1CDL A;  1TCF A;  1F8H A;  2Q91 A;  3SG5 A;  1YUS A;  3HCM A;  2LLU A;  1NCY A;  4PCW A;  4WQ2 A;  2K7C A;  1TNP A;  2FJU B;  2CXJ A;  1AP4 A;  1SCM B;  1LXF C;  1PVB A;  1YX7 A;  3HX4 A;  1MF8 B;  1GGW A;  4UPG A;  1IRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...