3F45A

Structure of the r75a mutant of rat alpha-parvalbumin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEEDELGSILKGFSSDAADLSAKETKTLMAAGDKDGDGKIGVEEFSTLVAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Removing the invariant salt bridge of parvalbumin increases flexibility in the AB-loop structure
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium binding protein
molecule keywords Parvalbumin alpha
total genus 41
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3f45A00
2AAOA 1BF5A 1QJTA 5HLVA 1UUSA 2LE9B 2M3WA 5PALA 2FCDA 3BQ3A 1XK4C 5F6TA 1J7QA 1OE9B 4NDDA 2I7AA 1IQ5A 2F3YA 4GAOA 1NWDA 2I18A 2F2PA 1HQVA 2M7NA 4P2YB 2BL0B 2LMUA 2NCOA 2RGIA 2WCBA 1LA3A 1QIVA 2KAVA 3NXAA 2JT0A 4ZCVA 1SCVA 1K90D 1EXRA 1WRZA 1KQMC 2F2OA 4F0ZB 1TNWA 2LP3A 4OCIA 5DKQA 4PE4A 1KSOA 1JF0A 4JWQA 4UPGA 1JSAA 5ER4X 1OMRA 2BL0C 2KNEA 1IKUA 2K61A 2LNKA 3EVVA 1SNLA 4MZJA 3KPXA 4ETOA 2LUCA 2F3ZA 1ZOTB 1XYDA 2KOTA 3TUYC 5AXIA 2PSRA 4NDBA 1NCXA 1Y1UA 2GGMA 3OB2B 2O60A 2Y1NA 2LVKA 1A75B 1SMGA 1G4YR 1CDLA 1X02A 4GNKB 2KSPA 1DJZA 2F33A 1A03A 1Y1AA 3BUWB 3PLFB 2BE4A 5JOLA 1SKTA 2DOQA 1WRLA 2GV5A 3IQOA 1NCYA 2CBLA 1YURA 2M7LA 2JT8A 1J7PA 3CR2A 3EKHA 5HYDA 1GGWA 2K8MB 2ZN9A 1KQMB 2ISDA 1OSAA 2F8PA 2Q4UA 4R1EA 1BG1A 1UWOA 2WNDA 1MXLC 3TDZA 3BUOB 5FYXA 1XFUO 1EL4A 1S6JA 1J7RA 2AMIA 2L51A 1XK4A 4GGFA 1DF0A 4GUKA 2JOJA 5DKRA 2L4HA 4YRUA 2SASA 2NCPA 2O5GA 4HRGA 3RLZA 5I2QA 1F8HA 4HREE 5KSZA 2E30A 1SL9A 2JXCA 1IWQA 3KHEA 2ZNDA 1NCZA 3PN7C 1YVLA 1NX1A 1ALWA 1C07A 2JZIA 1K95A 5CPVA 3TDUA 1QV1A 3O2PA 3EVRA 3NSOA 3D0YA 1XFVO 1NX2A 3NSKA 1RTP1 1CLLA 1OOJA 1J1EA 2LVVA 1DGVA 2BCBA 2JULA 3CGAA 4MZLA 1S1EA 4YI8A 1A29A 1RWYA 3CZTX 1SR6B 1F55A 1TNQA 3EK7A 1JWDA 1S3PA 2KYCA 4MRXA 3H4SE 4YGAA 1TTXA 2K7CA 1OQPA 1DGUA 4MBEA 2D8NA 3AKAA 4AQJA 3FIAA 4JQ0D 1S5GY 1YX7A 2L0PA 3WXAA 3K21A 2EHBA 3LL8B 1H4BA 2JXLA 2PMYA 4Q04A 2WCEA 3TDIA 1CTRA 4HSZA 4E68A 1DF0B 1R6PA 2KQYA 4ORCB 4QJ4B 1CLBA 3EKJA 1AVSA 1L2OC 2KI6C 3HX4A 2KHNA 2HPSA 1EG3A 1IGVA 5KU1A 1LVCD 2Q91A 4A4BA 1B47A 1SW8A 2LMTA 3AAKA 2IS9A 1DJGA 5AFPA 5CSIA 1EH2A 1RFJA 2EC6B 4PHMA 1JC2A 2MA2A 2M0RA 4CLNA 1U5IB 2E6WA 1BR4B 4PHJA 4N1GA 1B4CA 3BYAA 2K7OA 4DRWA 2A4JA 1JF2A 1KFUS 4PCWA 3WHUB 4YGCB 2CT9A 1KK8B 1F70A 1RK9A 2MLFC 2L5XB 3O78A 2H61C 5KTYA 4ICBA 2M8UA 3BXKA 1SR6C 1UHKA 3WHTB 2COLB 1QTXA 2JNXA 1C7VA 1SPYA 1CDNA 2Y4QA 3HCMA 5D7FA 2HF5A 1ZACA 4DCKA 1WRKA 1ZMZA 2NXQA 2LMVA 3GK4X 2JPTA 4YGEB 4MSPA 4MRYA 1G33A 4MVFA 4ORAB 3LK0A 1L2OB 2BCXA 4C0LA 1PVBA 1SY9A 3DVEA 5IBWA 1JFKA 1ZFSA 2OS8C 1RECA 2JU0A 1BMOA 3C1VA 3KO0A 1PULA 4NDCA 4L9MA 3EVUA 1M46A 4CFQA 2LAPA 1CFDA 3NSLA 1JUOA 2EGDA 1DJYA 3PATA 1N2DA 2PASA 3I5HC 1K93D 3FWCA 1J7OA 3CTNA 1V1GA 2LV7A 1TNPA 1WLMA 3EK4A 5DKNA 1DVIA 1B9AA 1ALVA 3DD4A 1NYAA 1BLQA 2KYFA 2G9BA 1L7ZA 1MXEA 2Y1MA 3BUNB 3SJSA 1B1GA 1IJ5A 4QJ3B 3OHMB 1Y1XA 4N5XA 3CLNA 1S6IA 2H61A 5J3XA 1F54A 2LLUA 5I8NA 1OMDA 4M2PA 3LCPC 3LLEA 1KK7Y 1W7IB 2WC8A 1AJ4A 2JNFA 5G08A 2KGBC 1NSHA 2LP2A 3I5FC 4YGBB 1DJIA 2KI4C 4CFRA 1AUIB 5AERA 1N65A 5CSNA 3DVMA 1KK8C 1GQMA 2I2RE 1CFPA 4GBAA 1SYMA 2MRDA 1PRWA 2K2AA 2M1UA 1QLKA 2ZRTA 1B8CA 2JRFA 1WY9A 1XFZO 1KFUL 1OZOA 3AAJA 1B7TZ 3GOFA 2G2BA 1DMOA 4XYNA 4ZCUA 5HKYA 1NP8A 4IL1A 1GJYA 5I2OA 1M63B 5GQQC 1KQVA 3JTDB 3I5FB 1FI5A 2KI4B 2HETA 1CM1A 3PM8A 2KBMA 2OS8B 3PSRA 4C0KA 1WLZA 3F45A 1QATA 1YVHA 3JTDC 2VRGA 1Y0VH 3SG2A 3E3RA 3TZ1A 3VRPA 2JT3A 4I5LB 1SL8A 1GGZA 1QIWA 1TNXA 2K2FA 1QVIY 1DJXA 1A2XA 2TN4A 1KWOC 4BY5A 3OX5A 1K2HA 4HRHA 2LVJA 5D69A 3D0YB 2LHLA 4YGDB 3VGOA 2BCAA 1MQ1A 3I5HB 1DTLA 4OKHA 1K96A 2OTGB 5HKWA 1MF8B 1YRTB 2L4IA 2M1KB 3DF0A 2M9GA 3BUMB 1BOCA 1H8BA 1CLMA 1UHHA 3BOWA 3JVTB 3CWGA 1K94A 3DVJA 1J55A 1LA0A 1CKKA 4WRIA 2BKHB 1TOPA 4QJ5B 2ZKMX 5B8IB 1ODBA 2P6BB 4WQ2A 1QX5B 5CSFA 3FWBA 4P5OE 2GGZA 3CR4X 1TCFA 1M39A 3AKBA 2JQ6A 3CR5X 3ICBA 2BKIB 4FTGA 1MUXA 1S6CA 1W7JB 2K7BA 1CMFA 1F4QA 1DJHA 3WNXB 1BT6A 3M0WA 3OB1B 5CSJA 1C7WA 4MN0A 1VRKA 2L2EA 3OX6A 4XJKA 1CMGA 5BPJA 2OTGC 1AP4A 3D10A 1FBVA 1OZSA 2EC6C 1E8AA 2KI6D 3VROA 3I5GB 1YUUA 4XJKB 2JTTA 1KK7Z 3ZWHA 1NX3A 1FI6A 1IJ6A 2LUXA 2CCMA 2BE6A 2JTZA 2LVIA 3SG7A 3ZNIA 3VRRA 1SBJA 1MWNA 1XA5A 1KWOB 4I5NB 1PALA 2FOTA 2LLSA 3O6BA 4GGNA 2BBNA 4N1FA 4TNCA 1TCOB 3O4YA 2M29A 1FF1A 1SRAA 1IRJA 3DVKA 1AHRA 2NLNA 2ZFDA 3RM1A 1A4PA 1RROA 4U8DA 4PDZA 1S26D 4YI9A 4DUQA 4GPLB 1QVIZ 1IG5A 1QX7A 3JVTC 1LINA 2NZ0A 3SG4A 1AJ5A 1B8LA 4WQ3A 2MLEC 3QRXA 1QXPA 2KAYA 2MBXA 3SG5A 2PALA 4BY4A 4I5JA 1UP5A 2ZRSA 1CB1A 1SK6D 3IQQA 1DJWA 4DS7A 1S36A 1NUBA 1SCMC 1TIZA 3CS1A 2CNPA 4CPVA 4D1EA 1JBAA 4AQIA 3FS7A 2WCFA 2JC2A 2SCPA 2QACA 1K8UA 1LKJA 1JFJA 3PN7B 3GK1A 3DF0B 2MAZA 4MLWA 1MHOA 1B7TY 1R2UA 1CFFA 1XFYO 3I5GC 4PE1A 1XFWO 3PALA 4PE7A 3IF7A 1FPWA 1NIWA 3KEVA 5AANA 1XO5A 1V1FA 1PSRA 2L98A 3SIAA 4YBHB 1AK8A 2L50A 5ER5A 1YR5A 3A8RA 4CIDA 1IQ3A 1D1OA 2LC5A 2OPOA 2KQ6A 2WOSA 1UHIA 4PHNA 2PRUA 4AOMA 1PVAA 2ZNEA 1TN4A 1Y6WA 1HT9A 1EJ3A 1NX0A 1U5IA 3I5IB 1G8IA 4DIRA 1M31A 2KFGA 1KCYA 2QPTA 2HQ8A 3PFVA 4M2QA 1OMVA 1N0YA 1FW4A 2LCPA 1Q80A 3NSIA 1CFCA 2CXJA 3LK1A 1A75A 1BJFA 3GK2A 3I5IC 2R2IA 1CNPA 2CTNA 2WORA 1M45A 2KGRA 4M2OA 1J1DA 1KFXL 1YUTA 1SCMB 1QV0A 1YTZC 3SG3A 1BR1B 2KAXA 4ORBB 4FQOA 3TS5C 4PE0A 1ZUZA 1XVJA 3VRNA 1QLSA 4I5KA 4OV2A 1S5GZ 5TNCA 2FJUB 3VRQA 1CM4A 4GFTA 2Y5IA 4MEWA 5HLOA 2LLTA 4A4CA 2LHIA 2ZN8A 1QS7A 1SL7A 1UHNA 1PSBA 2AUCA 5AEQA 1BODA 1YX8A 4GGFC 4NQGA 1F71A 1K9PA 1XFXO 2FCEA 1LXFC 2M49B 1KFXS 4OR9B 1DT7B 1YUSA 1UHJA 4JPZB 3TUYB 1BU3A 3SG6A 2LM5A 2V53A 1WDCC 2MJWB 2HQWA 1PK0D 1RJVA 5JJGA 2H2KA 1QX2A 3TS5B 3KF9A 1B8RA 1K9UA 1KSMA 1TRFA 2B1UA 1MR8A 2JWWA 4PALA 4PHKA 1NPQA 2MHHA 3BUXB 4C0JA 3A4UB 1EG4A 3BOWB 5I2LA 1UURA 3OP0A 5HKZA 5K89A 3SIBA 2I94A 1WDCB 2KDHA 2K7DA 2BBMA 1K9KA 3MSEB 4OVNF 4USLA 2KFFA 1F4OA 1CDPA 2PVBA 1IH0A 2BECA 2KFHA 2LANA 1CDMA 2KBIA 2M97A 1YRUB 4MZKA 3EK8A 1QASA 2K0JA
chains in the Genus database with same CATH superfamily
2AAOA 1BF5A 1Z2CB 1QJTA 5HLVA 1UUSA 2LE9B 2M3WA 5PALA 2FCDA 3BQ3A 1XK4C 5F6TA 1J7QA 1OE9B 4NDDA 2I7AA 1IQ5A 2F3YA 4GAOA 1NWDA 3L4LA 4INXA 2I18A 2F2PA 1HQVA 2M7NA 4P2YB 2BL0B 2LMUA 2NCOA 2RGIA 2WCBA 1LA3A 1QIVA 2KAVA 3NXAA 1T14A 2JT0A 4ZCVA 2QEVA 1SCVA 1K90D 1EXRA 1WRZA 1KQMC 2F2OA 3CZ1A 1TNWA 2LP3A 4OCIA 5DKQA 4PE4A 1KSOA 1JF0A 1QWVA 4JWQA 4UPGA 5ER4X 1OMRA 2BL0C 2KNEA 1IKUA 1JSAA 2K61A 2LNKA 4JD9A 3EVVA 1SNLA 4MZJA 3KPXA 4ETOA 2LUCA 2F3ZA 1ZOTB 1XYDA 2KOTA 3TUYC 5AXIA 2PSRA 4NDBA 1NCXA 1Y1UA 2GGMA 3CYZA 3OB2B 2L2CA 2O60A 2Y1NA 2LVKA 1A75B 1SMGA 1G4YR 1CDLA 1X02A 3BFHA 2KSPA 1DJZA 2F33A 4GNKB 1A03A 1Y1AA 3BUWB 3PLFB 2BE4A 5JOLA 1SKTA 2DOQA 1WRLA 2GV5A 3IQOA 1NCYA 2CBLA 3D75A 1YURA 2M7LA 2JT8A 1J7PA 3OGNA 3CR2A 3EKHA 5HYDA 1GGWA 2JPOA 2K8MB 2ZN9A 1KQMB 2ISDA 1OSAA 2F8PA 3R72A 2Q4UA 4R1EA 1BG1A 1UWOA 4USLA 2WNDA 1MXLC 3TDZA 3BUOB 5FYXA 1XFUO 1EL4A 1S6JA 3B86A 1J7RA 2AMIA 2L51A 3PJIA 3V2LA 3EG5B 1XK4A 4GGFA 3S0DA 1DF0A 4GUKA 2JOJA 5DKRA 2L4HA 3DYEA 4YRUA 2SASA 2NCPA 2O5GA 4HRGA 3RLZA 5I2QA 1F8HA 4HREE 5KSZA 2E30A 1SL9A 2JXCA 1IWQA 3KHEA 2ZNDA 1NCZA 3BFBA 2WCLA 3PN7C 1YVLA 1NX1A 1ALWA 1C07A 2JZIA 1SSEB 1K95A 5CPVA 3TDUA 1QV1A 3O2PA 3EVRA 3NSOA 3D0YA 1XFVO 1NX2A 2ERBA 3NSKA 1RTP1 1CLLA 3S0EA 1OOJA 1J1EA 2LVVA 1DGVA 2BCBA 2JULA 3CGAA 2L5YA 4MZLA 1S1EA 4YI8A 1A29A 1RWYA 3CZTX 1SR6B 3S0GA 3NGVA 1F55A 1TNQA 3EK7A 1JWDA 1S3PA 2KYCA 4MRXA 3H4SE 4OZDA 4YGAA 1TTXA 2K7CA 1OQPA 1DGUA 3DZTA 4MBEA 2D8NA 2WCKA 3AKAA 4AQJA 3FIAA 4JQ0D 1S5GY 1YX7A 2L0PA 3WXAA 3K21A 2EHBA 3LL8B 1H4BA 2JXLA 2PMYA 4Q04A 2WCEA 3TDIA 1CTRA 4HSZA 4E68A 4IJ7A 1DF0B 1R6PA 2KQYA 4ORCB 4QJ4B 1CLBA 3EKJA 1AVSA 1L2OC 2KI6C 3HX4A 2KHNA 2HPSA 5FI7A 1EG3A 1IGVA 5KU1A 1LVCD 2Q91A 4A4BA 4F7FA 1B47A 1SW8A 2LMTA 3AAKA 2IS9A 1DJGA 5AFPA 5CSIA 3NHTA 1EH2A 1RFJA 2EC6B 4PHMA 1JC2A 2MA2A 2M0RA 4FQTA 4CLNA 1U5IB 3OBVA 2E6WA 1BR4B 3R1VA 4PHJA 4N1GA 3FE8A 1B4CA 3BYAA 2K7OA 4DRWA 2A4JA 1JF2A 1KFUS 4PCWA 3WHUB 4YGCB 2CT9A 1KK8B 1F70A 1RK9A 1GM0A 3D76A 3K1EA 2MLFC 2L5XB 3O78A 2H61C 5KTYA 4ICBA 2M8UA 5HL1A 3BXKA 1SR6C 1UHKA 3BFAA 3WHTB 3S0AA 2COLB 1QTXA 2JNXA 1C7VA 1SPYA 4JKTA 1CDNA 2Y4QA 3HCMA 5D7FA 4INWA 2HF5A 1ZACA 4DCKA 1WRKA 1ZMZA 2NXQA 2LMVA 3D77A 3GK4X 2JPTA 2WC6A 4YGEB 4MSPA 4MRYA 1G33A 4MVFA 4ORAB 3LK0A 1L2OB 2BCXA 5D3OA 1OW4A 4C0LA 1PVBA 1SY9A 3DVEA 3S0BA 5IBWA 1JFKA 1ZFSA 2OS8C 3DY9A 1RECA 2JU0A 1BMOA 3C1VA 3KO0A 1PULA 4NDCA 4L9MA 3EVUA 1M46A 4CFQA 3FE6A 2QEOA 2LAPA 1CFDA 3NSLA 1JUOA 2EGDA 1DJYA 3PATA 1N2DA 2PASA 3I5HC 1K93D 3FWCA 1J7OA 3CTNA 1V1GA 2LV7A 1TNPA 1WLMA 3B7AA 3EK4A 5DKNA 1DVIA 1B9AA 1ALVA 3DD4A 1NYAA 1BLQA 2KYFA 1L7ZA 1MXEA 2G9BA 2Y1MA 3BUNB 3SJSA 1B1GA 1IJ5A 4QJ3B 3OHMB 1Y1XA 1TUJA 4N5XA 3CLNA 1DQEA 1S6IA 2H61A 5J3XA 1F54A 2LLUA 5I8NA 1XFRA 1OMDA 4M2PA 3LCPC 1C3ZA 3LLEA 1KK7Y 1W7IB 2WC8A 3SS5A 1C3YA 1AJ4A 2JNFA 5G08A 2KGBC 2YGUA 3Q8IA 1NSHA 2K60A 2LP2A 3I5FC 4YGBB 1DJIA 2KI4C 4CFRA 1AUIB 5AERA 1N65A 5CSNA 3DVMA 1KK8C 1GQMA 2I2RE 1CFPA 4GBAA 1SYMA 2MRDA 1PRWA 2P71A 1W9ZA 2K2AA 2QEBA 2M1UA 1QLKA 2ZRTA 1B8CA 2JRFA 1WY9A 2PYQA 4KYNA 1XFZO 1KFUL 1OZOA 3AAJA 1B7TZ 3GOFA 2G2BA 1DMOA 4XYNA 4ZCUA 5HKYA 1NP8A 4IL1A 1GJYA 5I2OA 3R1PA 1M63B 5GQQC 1KQVA 3JTDB 3I5FB 1FI5A 2FJYA 2KI4B 2WCHA 3O4XA 2HETA 1CM1A 3PM8A 2KBMA 2OS8B 2QDIA 3PSRA 1WLZA 3F45A 1QATA 3VB1A 1OOFA 4C0KA 1YVHA 3JTDC 2VRGA 1DEKA 1Y0VH 3SG2A 3E3RA 3TZ1A 3VRPA 2JT3A 3R1OA 4I5LB 1SL8A 1GGZA 1QIWA 1TNXA 2K2FA 1QVIY 1DJXA 1A2XA 2TN4A 1KWOC 4BY5A 3OX5A 1K2HA 1TWOA 4HRHA 2LVJA 5D69A 3D0YB 2LHLA 4YGDB 3VGOA 2BCAA 1ORGA 1MQ1A 3I5HB 1DTLA 4OKHA 1K96A 2OTGB 2WC5A 5HKWA 1MF8B 1YRTB 2L4IA 2M1KB 2BNXA 3DF0A 2M9GA 3BUMB 3D78A 1BOCA 1H8BA 1CLMA 1UHHA 5FI6A 3BOWA 3JVTB 3CWGA 1K94A 3DVJA 3FE9A 5DICA 1J55A 1LA0A 1CKKA 4WRIA 2BKHB 1TOPA 4QJ5B 2ZKMX 5B8IB 1ODBA 2P6BB 4WQ2A 1QX5B 5CSFA 3FWBA 5EL2A 4P5OE 2GGZA 3CR4X 1TCFA 1M39A 3AKBA 3IVTA 2JQ6A 3CR5X 3ICBA 2BKIB 4FTGA 1MUXA 1S6CA 2PQLA 1W7JB 2K7BA 2BAPA 3B6XA 1CMFA 1F4QA 3UNWA 1DJHA 3WNXB 1BT6A 3M0WA 3OB1B 3L47A 5CSJA 1C7WA 4MN0A 1VRKA 2L2EA 3OX6A 4XJKA 1CMGA 5BPJA 2OTGC 1AP4A 3D10A 1FBVA 1OZSA 2EC6C 1E8AA 2KI6D 3VROA 3I5GB 1YUUA 4XJKB 2JTTA 2WCJA 1KK7Z 3ZWHA 1NX3A 1FI6A 3S0FA 1IJ6A 2LUXA 2CCMA 2BE6A 2JTZA 2LVIA 3BJHA 3SG7A 3VRRA 3ZNIA 1SBJA 1MWNA 1XA5A 1KWOB 4I5NB 1PALA 2FOTA 2LLSA 3O6BA 4GGNA 2BBNA 4N1FA 4TNCA 1TCOB 3O4YA 2M29A 1FF1A 1SRAA 1IRJA 3DVKA 1AHRA 2NLNA 2ZFDA 3RM1A 1A4PA 3QMEA 1RROA 4U8DA 4PDZA 1LS8A 1S26D 1OOGA 4YI9A 4DUQA 4GPLB 1QVIZ 1IG5A 1QX7A 3JVTC 3SS4A 1LINA 2NZ0A 3SG4A 1AJ5A 1B8LA 2KPHA 4WQ3A 2MLEC 3QRXA 1QXPA 2KAYA 2MBXA 3PM2A 3SG5A 2PALA 4BY4A 4I5JA 1UP5A 2ZRSA 1CB1A 1SK6D 3IQQA 1DJWA 4DS7A 1S36A 1NUBA 1SCMC 1TIZA 3SS3A 3CS1A 2CNPA 4CPVA 4D1EA 1JBAA 4AQIA 3FS7A 2WCFA 2JC2A 2SCPA 3CABA 2QACA 1K8UA 3L4AA 1LKJA 1JFJA 3PN7B 3GK1A 3DF0B 2MAZA 4MLWA 1MHOA 1B7TY 1R2UA 1CFFA 1XFYO 3I5GC 4PE1A 1DELA 1XFWO 3PALA 4PE7A 3IF7A 1FPWA 1NIWA 3KEVA 5AANA 1XO5A 1V1FA 1OOIX 1PSRA 2L98A 3B87A 3D73A 3SIAA 3B88A 4F0ZB 4YBHB 1AK8A 2KLDA 2L50A 5ER5A 1YR5A 3A8RA 4CIDA 1IQ3A 1D1OA 3CZ2A 2LC5A 2OPOA 2KQ6A 2WOSA 1UHIA 4PHNA 2PRUA 4AOMA 3D74A 1PVAA 3UO9A 2ZNEA 3CDNA 1TN4A 1Y6WA 5FI2A 1HT9A 2P70A 1EJ3A 1NX0A 1U5IA 3I5IB 1G8IA 4DIRA 1M31A 2KFGA 1KCYA 2QPTA 2HQ8A 3PFVA 4M2QA 1OMVA 1N0YA 1FW4A 2LCPA 1Q80A 3NSIA 1CFCA 2CXJA 3LK1A 1A75A 1BJFA 3GK2A 3I5IC 1Z4HA 2R2IA 1CNPA 2CTNA 2WORA 1M45A 2KGRA 4M2OA 1J1DA 1KFXL 1YUTA 4PT1A 1SCMB 1QV0A 1YTZC 2KLEA 3SG3A 1BR1B 2KAXA 1DC1A 1IIOA 4ORBB 5I94A 4FQOA 3TS5C 3RZSA 4PE0A 1ZUZA 1XVJA 3DXLA 3VRNA 1QLSA 4I5KA 4OV2A 1S5GZ 5TNCA 2FJUB 3VRQA 1CM4A 2WCMA 4GFTA 2Y5IA 2GTEA 4MEWA 5HLOA 2LLTA 4A4CA 2H8VA 2LHIA 1QS7A 1SL7A 1UHNA 1PSBA 2ZN8A 2AUCA 5AEQA 1BODA 1YX8A 2QEHA 4GGFC 4NQGA 1F71A 1K9PA 1XFXO 2FCEA 1LXFC 2M49B 1KFXS 4OR9B 1DT7B 1P28A 1YUSA 1UHJA 4JPZB 3TUYB 1BU3A 3SG6A 2LM5A 2V53A 1WDCC 2MJWB 1OOHA 2HQWA 1PK0D 1RJVA 5JJGA 1TUZA 2H2KA 1QX2A 3CZ0A 3TS5B 3KF9A 1B8RA 1K9UA 1KSMA 1TRFA 2B1UA 1MR8A 2JWWA 4PALA 4PHKA 1NPQA 2MHHA 3BUXB 4C0JA 3A4UB 1EG4A 3BOWB 5I2LA 1UURA 3OP0A 5HKZA 5K89A 3SIBA 2I94A 1WDCB 2KDHA 2K7DA 2BBMA 1K9KA 3MSEB 3N7HA 4OVNF 2KFFA 1F4OA 1CDPA 2PVBA 3NHIA 1IH0A 2BECA 2KFHA 2LANA 1CDMA 2KBIA 2M97A 1YRUB 4MZKA 3EK8A 1QASA 2K0JA
chains in the Genus database with same CATH topology
2AAOA 1BF5A 1QJTA 5HLVA 1UUSA 2LE9B 2M3WA 5PALA 2FCDA 3BQ3A 1XK4C 5F6TA 1J7QA 1OE9B 4NDDA 2I7AA 1IQ5A 2F3YA 4GAOA 1NWDA 2I18A 2F2PA 1HQVA 2M7NA 4P2YB 2BL0B 2LMUA 2NCOA 2RGIA 2WCBA 1LA3A 1QIVA 2KAVA 3NXAA 2JT0A 4ZCVA 1SCVA 1K90D 1EXRA 1WRZA 1KQMC 2F2OA 4F0ZB 1TNWA 2LP3A 4OCIA 5DKQA 4PE4A 1KSOA 1JF0A 4JWQA 4UPGA 1JSAA 5ER4X 1OMRA 2BL0C 2KNEA 1IKUA 2K61A 2LNKA 3EVVA 1SNLA 4MZJA 3KPXA 4ETOA 2LUCA 2F3ZA 1ZOTB 1XYDA 2KOTA 3TUYC 5AXIA 2PSRA 4NDBA 1NCXA 1Y1UA 2GGMA 3OB2B 2O60A 2Y1NA 2LVKA 1A75B 1SMGA 1G4YR 1CDLA 1X02A 4GNKB 2KSPA 1DJZA 2F33A 1A03A 1Y1AA 3BUWB 3PLFB 2BE4A 5JOLA 1SKTA 2DOQA 1WRLA 2GV5A 3IQOA 1NCYA 2CBLA 1YURA 2M7LA 2JT8A 1J7PA 3CR2A 3EKHA 5HYDA 1GGWA 2K8MB 2ZN9A 1KQMB 2ISDA 1OSAA 2F8PA 2Q4UA 4R1EA 1BG1A 1UWOA 2WNDA 1MXLC 3TDZA 3BUOB 5FYXA 1XFUO 1EL4A 1S6JA 1J7RA 2AMIA 2L51A 1XK4A 4GGFA 1DF0A 4GUKA 2JOJA 5DKRA 2L4HA 4YRUA 2SASA 2NCPA 2O5GA 4HRGA 3RLZA 5I2QA 1F8HA 4HREE 5KSZA 2E30A 1SL9A 2JXCA 1IWQA 3KHEA 2ZNDA 1NCZA 3PN7C 1YVLA 1NX1A 1ALWA 1C07A 2JZIA 1K95A 5CPVA 3TDUA 1QV1A 3O2PA 3EVRA 3NSOA 3D0YA 1XFVO 1NX2A 3NSKA 1RTP1 1CLLA 1OOJA 1J1EA 2LVVA 1DGVA 2BCBA 2JULA 3CGAA 4MZLA 1S1EA 4YI8A 1A29A 1RWYA 3CZTX 1SR6B 1F55A 1TNQA 3EK7A 1JWDA 1S3PA 2KYCA 4MRXA 3H4SE 4YGAA 1TTXA 2K7CA 1OQPA 1DGUA 4MBEA 2D8NA 3AKAA 4AQJA 3FIAA 4JQ0D 1S5GY 1YX7A 2L0PA 3WXAA 3K21A 2EHBA 3LL8B 1H4BA 2JXLA 2PMYA 4Q04A 2WCEA 3TDIA 1CTRA 4HSZA 4E68A 1DF0B 1R6PA 2KQYA 4ORCB 4QJ4B 1CLBA 3EKJA 1AVSA 1L2OC 2KI6C 3HX4A 2KHNA 2HPSA 1EG3A 1IGVA 5KU1A 1LVCD 2Q91A 4A4BA 1B47A 1SW8A 2LMTA 3AAKA 2IS9A 1DJGA 5AFPA 5CSIA 1EH2A 1RFJA 2EC6B 4PHMA 1JC2A 2MA2A 2M0RA 4CLNA 1U5IB 2E6WA 1BR4B 4PHJA 4N1GA 1B4CA 3BYAA 2K7OA 4DRWA 2A4JA 1JF2A 1KFUS 4PCWA 3WHUB 4YGCB 2CT9A 1KK8B 1F70A 1RK9A 2MLFC 2L5XB 3O78A 2H61C 5KTYA 4ICBA 2M8UA 3BXKA 1SR6C 1UHKA 3WHTB 2COLB 1QTXA 2JNXA 1C7VA 1SPYA 1CDNA 2Y4QA 3HCMA 5D7FA 2HF5A 1ZACA 4DCKA 1WRKA 1ZMZA 2NXQA 2LMVA 3GK4X 2JPTA 4YGEB 4MSPA 4MRYA 1G33A 4MVFA 4ORAB 3LK0A 1L2OB 2BCXA 4C0LA 1PVBA 1SY9A 3DVEA 5IBWA 1JFKA 1ZFSA 2OS8C 1RECA 2JU0A 1BMOA 3C1VA 3KO0A 1PULA 4NDCA 4L9MA 3EVUA 1M46A 4CFQA 2LAPA 1CFDA 3NSLA 1JUOA 2EGDA 1DJYA 3PATA 1N2DA 2PASA 3I5HC 1K93D 3FWCA 1J7OA 3CTNA 1V1GA 2LV7A 1TNPA 1WLMA 3EK4A 5DKNA 1DVIA 1B9AA 1ALVA 3DD4A 1NYAA 1BLQA 2KYFA 2G9BA 1L7ZA 1MXEA 2Y1MA 3BUNB 3SJSA 1B1GA 1IJ5A 4QJ3B 3OHMB 1Y1XA 4N5XA 3CLNA 1S6IA 2H61A 5J3XA 1F54A 2LLUA 5I8NA 1OMDA 4M2PA 3LCPC 3LLEA 1KK7Y 1W7IB 2WC8A 1AJ4A 2JNFA 5G08A 2KGBC 1NSHA 2LP2A 3I5FC 4YGBB 1DJIA 2KI4C 4CFRA 1AUIB 5AERA 1N65A 5CSNA 3DVMA 1KK8C 1GQMA 2I2RE 1CFPA 4GBAA 1SYMA 2MRDA 1PRWA 2K2AA 2M1UA 1QLKA 2ZRTA 1B8CA 2JRFA 1WY9A 1XFZO 1KFUL 1OZOA 3AAJA 1B7TZ 3GOFA 2G2BA 1DMOA 4XYNA 4ZCUA 5HKYA 1NP8A 4IL1A 1GJYA 5I2OA 1M63B 5GQQC 1KQVA 3JTDB 3I5FB 1FI5A 2KI4B 2HETA 1CM1A 3PM8A 2KBMA 2OS8B 3PSRA 4C0KA 1WLZA 3F45A 1QATA 1YVHA 3JTDC 2VRGA 1Y0VH 3SG2A 3E3RA 3TZ1A 3VRPA 2JT3A 4I5LB 1SL8A 1GGZA 1QIWA 1TNXA 2K2FA 1QVIY 1DJXA 1A2XA 2TN4A 1KWOC 4BY5A 3OX5A 1K2HA 4HRHA 2LVJA 5D69A 3D0YB 2LHLA 4YGDB 3VGOA 2BCAA 1MQ1A 3I5HB 1DTLA 4OKHA 1K96A 2OTGB 5HKWA 1MF8B 1YRTB 2L4IA 2M1KB 3DF0A 2M9GA 3BUMB 1BOCA 1H8BA 1CLMA 1UHHA 3BOWA 3JVTB 3CWGA 1K94A 3DVJA 1J55A 1LA0A 1CKKA 4WRIA 2BKHB 1TOPA 4QJ5B 2ZKMX 5B8IB 1ODBA 2P6BB 4WQ2A 1QX5B 5CSFA 3FWBA 4P5OE 2GGZA 3CR4X 1TCFA 1M39A 3AKBA 2JQ6A 3CR5X 3ICBA 2BKIB 4FTGA 1MUXA 1S6CA 1W7JB 2K7BA 1CMFA 1F4QA 1DJHA 3WNXB 1BT6A 3M0WA 3OB1B 5CSJA 1C7WA 4MN0A 1VRKA 2L2EA 3OX6A 4XJKA 1CMGA 5BPJA 2OTGC 1AP4A 3D10A 1FBVA 1OZSA 2EC6C 1E8AA 2KI6D 3VROA 3I5GB 1YUUA 4XJKB 2JTTA 1KK7Z 3ZWHA 1NX3A 1FI6A 1IJ6A 2LUXA 2CCMA 2BE6A 2JTZA 2LVIA 3SG7A 3ZNIA 3VRRA 1SBJA 1MWNA 1XA5A 1KWOB 4I5NB 1PALA 2FOTA 2LLSA 3O6BA 4GGNA 2BBNA 4N1FA 4TNCA 1TCOB 3O4YA 2M29A 1FF1A 1SRAA 1IRJA 3DVKA 1AHRA 2NLNA 2ZFDA 3RM1A 1A4PA 1RROA 4U8DA 4PDZA 1S26D 4YI9A 4DUQA 4GPLB 1QVIZ 1IG5A 1QX7A 3JVTC 1LINA 2NZ0A 3SG4A 1AJ5A 1B8LA 4WQ3A 2MLEC 3QRXA 1QXPA 2KAYA 2MBXA 3SG5A 2PALA 4BY4A 4I5JA 1UP5A 2ZRSA 1CB1A 1SK6D 3IQQA 1DJWA 4DS7A 1S36A 1NUBA 1SCMC 1TIZA 3CS1A 2CNPA 4CPVA 4D1EA 1JBAA 4AQIA 3FS7A 2WCFA 2JC2A 2SCPA 2QACA 1K8UA 1LKJA 1JFJA 3PN7B 3GK1A 3DF0B 2MAZA 4MLWA 1MHOA 1B7TY 1R2UA 1CFFA 1XFYO 3I5GC 4PE1A 1XFWO 3PALA 4PE7A 3IF7A 1FPWA 1NIWA 3KEVA 5AANA 1XO5A 1V1FA 1PSRA 2L98A 3SIAA 4YBHB 1AK8A 2L50A 5ER5A 1YR5A 3A8RA 4CIDA 1IQ3A 1D1OA 2LC5A 2OPOA 2KQ6A 2WOSA 1UHIA 4PHNA 2PRUA 4AOMA 1PVAA 2ZNEA 1TN4A 1Y6WA 1HT9A 1EJ3A 1NX0A 1U5IA 3I5IB 1G8IA 4DIRA 1M31A 2KFGA 1KCYA 2QPTA 2HQ8A 3PFVA 4M2QA 1OMVA 1N0YA 1FW4A 2LCPA 1Q80A 3NSIA 1CFCA 2CXJA 3LK1A 1A75A 1BJFA 3GK2A 3I5IC 2R2IA 1CNPA 2CTNA 2WORA 1M45A 2KGRA 4M2OA 1J1DA 1KFXL 1YUTA 1SCMB 1QV0A 1YTZC 3SG3A 1BR1B 2KAXA 4ORBB 4FQOA 3TS5C 4PE0A 1ZUZA 1XVJA 3VRNA 1QLSA 4I5KA 4OV2A 1S5GZ 5TNCA 2FJUB 3VRQA 1CM4A 4GFTA 2Y5IA 4MEWA 5HLOA 2LLTA 4A4CA 2LHIA 2ZN8A 1QS7A 1SL7A 1UHNA 1PSBA 2AUCA 5AEQA 1BODA 1YX8A 4GGFC 4NQGA 1F71A 1K9PA 1XFXO 2FCEA 1LXFC 2M49B 1KFXS 4OR9B 1DT7B 1YUSA 1UHJA 4JPZB 3TUYB 1BU3A 3SG6A 2LM5A 2V53A 1WDCC 2MJWB 2HQWA 1PK0D 1RJVA 5JJGA 2H2KA 1QX2A 3TS5B 3KF9A 1B8RA 1K9UA 1KSMA 1TRFA 2B1UA 1MR8A 2JWWA 4PALA 4PHKA 1NPQA 2MHHA 3BUXB 4C0JA 3A4UB 1EG4A 3BOWB 5I2LA 1UURA 3OP0A 5HKZA 5K89A 3SIBA 2I94A 1WDCB 2KDHA 2K7DA 2BBMA 1K9KA 3MSEB 4OVNF 4USLA 2KFFA 1F4OA 1CDPA 2PVBA 1IH0A 2BECA 2KFHA 2LANA 1CDMA 2KBIA 2M97A 1YRUB 4MZKA 3EK8A 1QASA 2K0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAO A;  1BF5 A;  1QJT A;  5HLV A;  1UUS A;  2LE9 B;  2M3W A;  5PAL A;  2FCD A;  3BQ3 A;  1XK4 C;  5F6T A;  1J7Q A;  1OE9 B;  4NDD A;  2I7A A;  1IQ5 A;  2F3Y A;  4GAO A;  1NWD A;  2I18 A;  2F2P A;  1HQV A;  2M7N A;  4P2Y B;  2BL0 B;  2LMU A;  2NCO A;  2RGI A;  2WCB A;  1LA3 A;  1QIV A;  2KAV A;  3NXA A;  2JT0 A;  4ZCV A;  1SCV A;  1K90 D;  1EXR A;  1WRZ A;  1KQM C;  2F2O A;  4F0Z B;  1TNW A;  2LP3 A;  4OCI A;  5DKQ A;  4PE4 A;  1KSO A;  1JF0 A;  4JWQ A;  4UPG A;  1JSA A;  5ER4 X;  1OMR A;  2BL0 C;  2KNE A;  1IKU A;  2K61 A;  2LNK A;  3EVV A;  1SNL A;  4MZJ A;  3KPX A;  4ETO A;  2LUC A;  2F3Z A;  1ZOT B;  1XYD A;  2KOT A;  3TUY C;  5AXI A;  2PSR A;  4NDB A;  1NCX A;  1Y1U A;  2GGM A;  3OB2 B;  2O60 A;  2Y1N A;  2LVK A;  1A75 B;  1SMG A;  1G4Y R;  1CDL A;  1X02 A;  4GNK B;  2KSP A;  1DJZ A;  2F33 A;  1A03 A;  1Y1A A;  3BUW B;  3PLF B;  2BE4 A;  5JOL A;  1SKT A;  2DOQ A;  1WRL A;  2GV5 A;  3IQO A;  1NCY A;  2CBL A;  1YUR A;  2M7L A;  2JT8 A;  1J7P A;  3CR2 A;  3EKH A;  5HYD A;  1GGW A;  2K8M B;  2ZN9 A;  1KQM B;  2ISD A;  1OSA A;  2F8P A;  2Q4U A;  4R1E A;  1BG1 A;  1UWO A;  2WND A;  1MXL C;  3TDZ A;  3BUO B;  5FYX A;  1XFU O;  1EL4 A;  1S6J A;  1J7R A;  2AMI A;  2L51 A;  1XK4 A;  4GGF A;  1DF0 A;  4GUK A;  2JOJ A;  5DKR A;  2L4H A;  4YRU A;  2SAS A;  2NCP A;  2O5G A;  4HRG A;  3RLZ A;  5I2Q A;  1F8H A;  4HRE E;  5KSZ A;  2E30 A;  1SL9 A;  2JXC A;  1IWQ A;  3KHE A;  2ZND A;  1NCZ A;  3PN7 C;  1YVL A;  1NX1 A;  1ALW A;  1C07 A;  2JZI A;  1K95 A;  5CPV A;  3TDU A;  1QV1 A;  3O2P A;  3EVR A;  3NSO A;  3D0Y A;  1XFV O;  1NX2 A;  3NSK A;  1RTP 1;  1CLL A;  1OOJ A;  1J1E A;  2LVV A;  1DGV A;  2BCB A;  2JUL A;  3CGA A;  4MZL A;  1S1E A;  4YI8 A;  1A29 A;  1RWY A;  3CZT X;  1SR6 B;  1F55 A;  1TNQ A;  3EK7 A;  1JWD A;  1S3P A;  2KYC A;  4MRX A;  3H4S E;  4YGA A;  1TTX A;  2K7C A;  1OQP A;  1DGU A;  4MBE A;  2D8N A;  3AKA A;  4AQJ A;  3FIA A;  4JQ0 D;  1S5G Y;  1YX7 A;  2L0P A;  3WXA A;  3K21 A;  2EHB A;  3LL8 B;  1H4B A;  2JXL A;  2PMY A;  4Q04 A;  2WCE A;  3TDI A;  1CTR A;  4HSZ A;  4E68 A;  1DF0 B;  1R6P A;  2KQY A;  4ORC B;  4QJ4 B;  1CLB A;  3EKJ A;  1AVS A;  1L2O C;  2KI6 C;  3HX4 A;  2KHN A;  2HPS A;  1EG3 A;  1IGV A;  5KU1 A;  1LVC D;  2Q91 A;  4A4B A;  1B47 A;  1SW8 A;  2LMT A;  3AAK A;  2IS9 A;  1DJG A;  5AFP A;  5CSI A;  1EH2 A;  1RFJ A;  2EC6 B;  4PHM A;  1JC2 A;  2MA2 A;  2M0R A;  4CLN A;  1U5I B;  2E6W A;  1BR4 B;  4PHJ A;  4N1G A;  1B4C A;  3BYA A;  2K7O A;  4DRW A;  2A4J A;  1JF2 A;  1KFU S;  4PCW A;  3WHU B;  4YGC B;  2CT9 A;  1KK8 B;  1F70 A;  1RK9 A;  2MLF C;  2L5X B;  3O78 A;  2H61 C;  5KTY A;  4ICB A;  2M8U A;  3BXK A;  1SR6 C;  1UHK A;  3WHT B;  2COL B;  1QTX A;  2JNX A;  1C7V A;  1SPY A;  1CDN A;  2Y4Q A;  3HCM A;  5D7F A;  2HF5 A;  1ZAC A;  4DCK A;  1WRK A;  1ZMZ A;  2NXQ A;  2LMV A;  3GK4 X;  2JPT A;  4YGE B;  4MSP A;  4MRY A;  1G33 A;  4MVF A;  4ORA B;  3LK0 A;  1L2O B;  2BCX A;  4C0L A;  1PVB A;  1SY9 A;  3DVE A;  5IBW A;  1JFK A;  1ZFS A;  2OS8 C;  1REC A;  2JU0 A;  1BMO A;  3C1V A;  3KO0 A;  1PUL A;  4NDC A;  4L9M A;  3EVU A;  1M46 A;  4CFQ A;  2LAP A;  1CFD A;  3NSL A;  1JUO A;  2EGD A;  1DJY A;  3PAT A;  1N2D A;  2PAS A;  3I5H C;  1K93 D;  3FWC A;  1J7O A;  3CTN A;  1V1G A;  2LV7 A;  1TNP A;  1WLM A;  3EK4 A;  5DKN A;  1DVI A;  1B9A A;  1ALV A;  3DD4 A;  1NYA A;  1BLQ A;  2KYF A;  2G9B A;  1L7Z A;  1MXE A;  2Y1M A;  3BUN B;  3SJS A;  1B1G A;  1IJ5 A;  4QJ3 B;  3OHM B;  1Y1X A;  4N5X A;  3CLN A;  1S6I A;  2H61 A;  5J3X A;  1F54 A;  2LLU A;  5I8N A;  1OMD A;  4M2P A;  3LCP C;  3LLE A;  1KK7 Y;  1W7I B;  2WC8 A;  1AJ4 A;  2JNF A;  5G08 A;  2KGB C;  1NSH A;  2LP2 A;  3I5F C;  4YGB B;  1DJI A;  2KI4 C;  4CFR A;  1AUI B;  5AER A;  1N65 A;  5CSN A;  3DVM A;  1KK8 C;  1GQM A;  2I2R E;  1CFP A;  4GBA A;  1SYM A;  2MRD A;  1PRW A;  2K2A A;  2M1U A;  1QLK A;  2ZRT A;  1B8C A;  2JRF A;  1WY9 A;  1XFZ O;  1KFU L;  1OZO A;  3AAJ A;  1B7T Z;  3GOF A;  2G2B A;  1DMO A;  4XYN A;  4ZCU A;  5HKY A;  1NP8 A;  4IL1 A;  1GJY A;  5I2O A;  1M63 B;  5GQQ C;  1KQV A;  3JTD B;  3I5F B;  1FI5 A;  2KI4 B;  2HET A;  1CM1 A;  3PM8 A;  2KBM A;  2OS8 B;  3PSR A;  4C0K A;  1WLZ A;  3F45 A;  1QAT A;  1YVH A;  3JTD C;  2VRG A;  1Y0V H;  3SG2 A;  3E3R A;  3TZ1 A;  3VRP A;  2JT3 A;  4I5L B;  1SL8 A;  1GGZ A;  1QIW A;  1TNX A;  2K2F A;  1QVI Y;  1DJX A;  1A2X A;  2TN4 A;  1KWO C;  4BY5 A;  3OX5 A;  1K2H A;  4HRH A;  2LVJ A;  5D69 A;  3D0Y B;  2LHL A;  4YGD B;  3VGO A;  2BCA A;  1MQ1 A;  3I5H B;  1DTL A;  4OKH A;  1K96 A;  2OTG B;  5HKW A;  1MF8 B;  1YRT B;  2L4I A;  2M1K B;  3DF0 A;  2M9G A;  3BUM B;  1BOC A;  1H8B A;  1CLM A;  1UHH A;  3BOW A;  3JVT B;  3CWG A;  1K94 A;  3DVJ A;  1J55 A;  1LA0 A;  1CKK A;  4WRI A;  2BKH B;  1TOP A;  4QJ5 B;  2ZKM X;  5B8I B;  1ODB A;  2P6B B;  4WQ2 A;  1QX5 B;  5CSF A;  3FWB A;  4P5O E;  2GGZ A;  3CR4 X;  1TCF A;  1M39 A;  3AKB A;  2JQ6 A;  3CR5 X;  3ICB A;  2BKI B;  4FTG A;  1MUX A;  1S6C A;  1W7J B;  2K7B A;  1CMF A;  1F4Q A;  1DJH A;  3WNX B;  1BT6 A;  3M0W A;  3OB1 B;  5CSJ A;  1C7W A;  4MN0 A;  1VRK A;  2L2E A;  3OX6 A;  4XJK A;  1CMG A;  5BPJ A;  2OTG C;  1AP4 A;  3D10 A;  1FBV A;  1OZS A;  2EC6 C;  1E8A A;  2KI6 D;  3VRO A;  3I5G B;  1YUU A;  4XJK B;  2JTT A;  1KK7 Z;  3ZWH A;  1NX3 A;  1FI6 A;  1IJ6 A;  2LUX A;  2CCM A;  2BE6 A;  2JTZ A;  2LVI A;  3SG7 A;  3ZNI A;  3VRR A;  1SBJ A;  1MWN A;  1XA5 A;  1KWO B;  4I5N B;  1PAL A;  2FOT A;  2LLS A;  3O6B A;  4GGN A;  2BBN A;  4N1F A;  4TNC A;  1TCO B;  3O4Y A;  2M29 A;  1FF1 A;  1SRA A;  1IRJ A;  3DVK A;  1AHR A;  2NLN A;  2ZFD A;  3RM1 A;  1A4P A;  1RRO A;  4U8D A;  4PDZ A;  1S26 D;  4YI9 A;  4DUQ A;  4GPL B;  1QVI Z;  1IG5 A;  1QX7 A;  3JVT C;  1LIN A;  2NZ0 A;  3SG4 A;  1AJ5 A;  1B8L A;  4WQ3 A;  2MLE C;  3QRX A;  1QXP A;  2KAY A;  2MBX A;  3SG5 A;  2PAL A;  4BY4 A;  4I5J A;  1UP5 A;  2ZRS A;  1CB1 A;  1SK6 D;  3IQQ A;  1DJW A;  4DS7 A;  1S36 A;  1NUB A;  1SCM C;  1TIZ A;  3CS1 A;  2CNP A;  4CPV A;  4D1E A;  1JBA A;  4AQI A;  3FS7 A;  2WCF A;  2JC2 A;  2SCP A;  2QAC A;  1K8U A;  1LKJ A;  1JFJ A;  3PN7 B;  3GK1 A;  3DF0 B;  2MAZ A;  4MLW A;  1MHO A;  1B7T Y;  1R2U A;  1CFF A;  1XFY O;  3I5G C;  4PE1 A;  1XFW O;  3PAL A;  4PE7 A;  3IF7 A;  1FPW A;  1NIW A;  3KEV A;  5AAN A;  1XO5 A;  1V1F A;  1PSR A;  2L98 A;  3SIA A;  4YBH B;  1AK8 A;  2L50 A;  5ER5 A;  1YR5 A;  3A8R A;  4CID A;  1IQ3 A;  1D1O A;  2LC5 A;  2OPO A;  2KQ6 A;  2WOS A;  1UHI A;  4PHN A;  2PRU A;  4AOM A;  1PVA A;  2ZNE A;  1TN4 A;  1Y6W A;  1HT9 A;  1EJ3 A;  1NX0 A;  1U5I A;  3I5I B;  1G8I A;  4DIR A;  1M31 A;  2KFG A;  1KCY A;  2QPT A;  2HQ8 A;  3PFV A;  4M2Q A;  1OMV A;  1N0Y A;  1FW4 A;  2LCP A;  1Q80 A;  3NSI A;  1CFC A;  2CXJ A;  3LK1 A;  1A75 A;  1BJF A;  3GK2 A;  3I5I C;  2R2I A;  1CNP A;  2CTN A;  2WOR A;  1M45 A;  2KGR A;  4M2O A;  1J1D A;  1KFX L;  1YUT A;  1SCM B;  1QV0 A;  1YTZ C;  3SG3 A;  1BR1 B;  2KAX A;  4ORB B;  4FQO A;  3TS5 C;  4PE0 A;  1ZUZ A;  1XVJ A;  3VRN A;  1QLS A;  4I5K A;  4OV2 A;  1S5G Z;  5TNC A;  2FJU B;  3VRQ A;  1CM4 A;  4GFT A;  2Y5I A;  4MEW A;  5HLO A;  2LLT A;  4A4C A;  2LHI A;  2ZN8 A;  1QS7 A;  1SL7 A;  1UHN A;  1PSB A;  2AUC A;  5AEQ A;  1BOD A;  1YX8 A;  4GGF C;  4NQG A;  1F71 A;  1K9P A;  1XFX O;  2FCE A;  1LXF C;  2M49 B;  1KFX S;  4OR9 B;  1DT7 B;  1YUS A;  1UHJ A;  4JPZ B;  3TUY B;  1BU3 A;  3SG6 A;  2LM5 A;  2V53 A;  1WDC C;  2MJW B;  2HQW A;  1PK0 D;  1RJV A;  5JJG A;  2H2K A;  1QX2 A;  3TS5 B;  3KF9 A;  1B8R A;  1K9U A;  1KSM A;  1TRF A;  2B1U A;  1MR8 A;  2JWW A;  4PAL A;  4PHK A;  1NPQ A;  2MHH A;  3BUX B;  4C0J A;  3A4U B;  1EG4 A;  3BOW B;  5I2L A;  1UUR A;  3OP0 A;  5HKZ A;  5K89 A;  3SIB A;  2I94 A;  1WDC B;  2KDH A;  2K7D A;  2BBM A;  1K9K A;  3MSE B;  4OVN F;  4USL A;  2KFF A;  1F4O A;  1CDP A;  2PVB A;  1IH0 A;  2BEC A;  2KFH A;  2LAN A;  1CDM A;  2KBI A;  2M97 A;  1YRU B;  4MZK A;  3EK8 A;  1QAS A;  2K0J A; 
#chains in the Genus database with same CATH topology
 2AAO A;  1BF5 A;  1Z2C B;  1QJT A;  5HLV A;  1UUS A;  2LE9 B;  2M3W A;  5PAL A;  2FCD A;  3BQ3 A;  1XK4 C;  5F6T A;  1J7Q A;  1OE9 B;  4NDD A;  2I7A A;  1IQ5 A;  2F3Y A;  4GAO A;  1NWD A;  3L4L A;  4INX A;  2I18 A;  2F2P A;  1HQV A;  2M7N A;  4P2Y B;  2BL0 B;  2LMU A;  2NCO A;  2RGI A;  2WCB A;  1LA3 A;  1QIV A;  2KAV A;  3NXA A;  1T14 A;  2JT0 A;  4ZCV A;  2QEV A;  1SCV A;  1K90 D;  1EXR A;  1WRZ A;  1KQM C;  2F2O A;  3CZ1 A;  1TNW A;  2LP3 A;  4OCI A;  5DKQ A;  4PE4 A;  1KSO A;  1JF0 A;  1QWV A;  4JWQ A;  4UPG A;  5ER4 X;  1OMR A;  2BL0 C;  2KNE A;  1IKU A;  1JSA A;  2K61 A;  2LNK A;  4JD9 A;  3EVV A;  1SNL A;  4MZJ A;  3KPX A;  4ETO A;  2LUC A;  2F3Z A;  1ZOT B;  1XYD A;  2KOT A;  3TUY C;  5AXI A;  2PSR A;  4NDB A;  1NCX A;  1Y1U A;  2GGM A;  3CYZ A;  3OB2 B;  2L2C A;  2O60 A;  2Y1N A;  2LVK A;  1A75 B;  1SMG A;  1G4Y R;  1CDL A;  1X02 A;  3BFH A;  2KSP A;  1DJZ A;  2F33 A;  4GNK B;  1A03 A;  1Y1A A;  3BUW B;  3PLF B;  2BE4 A;  5JOL A;  1SKT A;  2DOQ A;  1WRL A;  2GV5 A;  3IQO A;  1NCY A;  2CBL A;  3D75 A;  1YUR A;  2M7L A;  2JT8 A;  1J7P A;  3OGN A;  3CR2 A;  3EKH A;  5HYD A;  1GGW A;  2JPO A;  2K8M B;  2ZN9 A;  1KQM B;  2ISD A;  1OSA A;  2F8P A;  3R72 A;  2Q4U A;  4R1E A;  1BG1 A;  1UWO A;  4USL A;  2WND A;  1MXL C;  3TDZ A;  3BUO B;  5FYX A;  1XFU O;  1EL4 A;  1S6J A;  3B86 A;  1J7R A;  2AMI A;  2L51 A;  3PJI A;  3V2L A;  3EG5 B;  1XK4 A;  4GGF A;  3S0D A;  1DF0 A;  4GUK A;  2JOJ A;  5DKR A;  2L4H A;  3DYE A;  4YRU A;  2SAS A;  2NCP A;  2O5G A;  4HRG A;  3RLZ A;  5I2Q A;  1F8H A;  4HRE E;  5KSZ A;  2E30 A;  1SL9 A;  2JXC A;  1IWQ A;  3KHE A;  2ZND A;  1NCZ A;  3BFB A;  2WCL A;  3PN7 C;  1YVL A;  1NX1 A;  1ALW A;  1C07 A;  2JZI A;  1SSE B;  1K95 A;  5CPV A;  3TDU A;  1QV1 A;  3O2P A;  3EVR A;  3NSO A;  3D0Y A;  1XFV O;  1NX2 A;  2ERB A;  3NSK A;  1RTP 1;  1CLL A;  3S0E A;  1OOJ A;  1J1E A;  2LVV A;  1DGV A;  2BCB A;  2JUL A;  3CGA A;  2L5Y A;  4MZL A;  1S1E A;  4YI8 A;  1A29 A;  1RWY A;  3CZT X;  1SR6 B;  3S0G A;  3NGV A;  1F55 A;  1TNQ A;  3EK7 A;  1JWD A;  1S3P A;  2KYC A;  4MRX A;  3H4S E;  4OZD A;  4YGA A;  1TTX A;  2K7C A;  1OQP A;  1DGU A;  3DZT A;  4MBE A;  2D8N A;  2WCK A;  3AKA A;  4AQJ A;  3FIA A;  4JQ0 D;  1S5G Y;  1YX7 A;  2L0P A;  3WXA A;  3K21 A;  2EHB A;  3LL8 B;  1H4B A;  2JXL A;  2PMY A;  4Q04 A;  2WCE A;  3TDI A;  1CTR A;  4HSZ A;  4E68 A;  4IJ7 A;  1DF0 B;  1R6P A;  2KQY A;  4ORC B;  4QJ4 B;  1CLB A;  3EKJ A;  1AVS A;  1L2O C;  2KI6 C;  3HX4 A;  2KHN A;  2HPS A;  5FI7 A;  1EG3 A;  1IGV A;  5KU1 A;  1LVC D;  2Q91 A;  4A4B A;  4F7F A;  1B47 A;  1SW8 A;  2LMT A;  3AAK A;  2IS9 A;  1DJG A;  5AFP A;  5CSI A;  3NHT A;  1EH2 A;  1RFJ A;  2EC6 B;  4PHM A;  1JC2 A;  2MA2 A;  2M0R A;  4FQT A;  4CLN A;  1U5I B;  3OBV A;  2E6W A;  1BR4 B;  3R1V A;  4PHJ A;  4N1G A;  3FE8 A;  1B4C A;  3BYA A;  2K7O A;  4DRW A;  2A4J A;  1JF2 A;  1KFU S;  4PCW A;  3WHU B;  4YGC B;  2CT9 A;  1KK8 B;  1F70 A;  1RK9 A;  1GM0 A;  3D76 A;  3K1E A;  2MLF C;  2L5X B;  3O78 A;  2H61 C;  5KTY A;  4ICB A;  2M8U A;  5HL1 A;  3BXK A;  1SR6 C;  1UHK A;  3BFA A;  3WHT B;  3S0A A;  2COL B;  1QTX A;  2JNX A;  1C7V A;  1SPY A;  4JKT A;  1CDN A;  2Y4Q A;  3HCM A;  5D7F A;  4INW A;  2HF5 A;  1ZAC A;  4DCK A;  1WRK A;  1ZMZ A;  2NXQ A;  2LMV A;  3D77 A;  3GK4 X;  2JPT A;  2WC6 A;  4YGE B;  4MSP A;  4MRY A;  1G33 A;  4MVF A;  4ORA B;  3LK0 A;  1L2O B;  2BCX A;  5D3O A;  1OW4 A;  4C0L A;  1PVB A;  1SY9 A;  3DVE A;  3S0B A;  5IBW A;  1JFK A;  1ZFS A;  2OS8 C;  3DY9 A;  1REC A;  2JU0 A;  1BMO A;  3C1V A;  3KO0 A;  1PUL A;  4NDC A;  4L9M A;  3EVU A;  1M46 A;  4CFQ A;  3FE6 A;  2QEO A;  2LAP A;  1CFD A;  3NSL A;  1JUO A;  2EGD A;  1DJY A;  3PAT A;  1N2D A;  2PAS A;  3I5H C;  1K93 D;  3FWC A;  1J7O A;  3CTN A;  1V1G A;  2LV7 A;  1TNP A;  1WLM A;  3B7A A;  3EK4 A;  5DKN A;  1DVI A;  1B9A A;  1ALV A;  3DD4 A;  1NYA A;  1BLQ A;  2KYF A;  1L7Z A;  1MXE A;  2G9B A;  2Y1M A;  3BUN B;  3SJS A;  1B1G A;  1IJ5 A;  4QJ3 B;  3OHM B;  1Y1X A;  1TUJ A;  4N5X A;  3CLN A;  1DQE A;  1S6I A;  2H61 A;  5J3X A;  1F54 A;  2LLU A;  5I8N A;  1XFR A;  1OMD A;  4M2P A;  3LCP C;  1C3Z A;  3LLE A;  1KK7 Y;  1W7I B;  2WC8 A;  3SS5 A;  1C3Y A;  1AJ4 A;  2JNF A;  5G08 A;  2KGB C;  2YGU A;  3Q8I A;  1NSH A;  2K60 A;  2LP2 A;  3I5F C;  4YGB B;  1DJI A;  2KI4 C;  4CFR A;  1AUI B;  5AER A;  1N65 A;  5CSN A;  3DVM A;  1KK8 C;  1GQM A;  2I2R E;  1CFP A;  4GBA A;  1SYM A;  2MRD A;  1PRW A;  2P71 A;  1W9Z A;  2K2A A;  2QEB A;  2M1U A;  1QLK A;  2ZRT A;  1B8C A;  2JRF A;  1WY9 A;  2PYQ A;  4KYN A;  1XFZ O;  1KFU L;  1OZO A;  3AAJ A;  1B7T Z;  3GOF A;  2G2B A;  1DMO A;  4XYN A;  4ZCU A;  5HKY A;  1NP8 A;  4IL1 A;  1GJY A;  5I2O A;  3R1P A;  1M63 B;  5GQQ C;  1KQV A;  3JTD B;  3I5F B;  1FI5 A;  2FJY A;  2KI4 B;  2WCH A;  3O4X A;  2HET A;  1CM1 A;  3PM8 A;  2KBM A;  2OS8 B;  2QDI A;  3PSR A;  1WLZ A;  3F45 A;  1QAT A;  3VB1 A;  1OOF A;  4C0K A;  1YVH A;  3JTD C;  2VRG A;  1DEK A;  1Y0V H;  3SG2 A;  3E3R A;  3TZ1 A;  3VRP A;  2JT3 A;  3R1O A;  4I5L B;  1SL8 A;  1GGZ A;  1QIW A;  1TNX A;  2K2F A;  1QVI Y;  1DJX A;  1A2X A;  2TN4 A;  1KWO C;  4BY5 A;  3OX5 A;  1K2H A;  1TWO A;  4HRH A;  2LVJ A;  5D69 A;  3D0Y B;  2LHL A;  4YGD B;  3VGO A;  2BCA A;  1ORG A;  1MQ1 A;  3I5H B;  1DTL A;  4OKH A;  1K96 A;  2OTG B;  2WC5 A;  5HKW A;  1MF8 B;  1YRT B;  2L4I A;  2M1K B;  2BNX A;  3DF0 A;  2M9G A;  3BUM B;  3D78 A;  1BOC A;  1H8B A;  1CLM A;  1UHH A;  5FI6 A;  3BOW A;  3JVT B;  3CWG A;  1K94 A;  3DVJ A;  3FE9 A;  5DIC A;  1J55 A;  1LA0 A;  1CKK A;  4WRI A;  2BKH B;  1TOP A;  4QJ5 B;  2ZKM X;  5B8I B;  1ODB A;  2P6B B;  4WQ2 A;  1QX5 B;  5CSF A;  3FWB A;  5EL2 A;  4P5O E;  2GGZ A;  3CR4 X;  1TCF A;  1M39 A;  3AKB A;  3IVT A;  2JQ6 A;  3CR5 X;  3ICB A;  2BKI B;  4FTG A;  1MUX A;  1S6C A;  2PQL A;  1W7J B;  2K7B A;  2BAP A;  3B6X A;  1CMF A;  1F4Q A;  3UNW A;  1DJH A;  3WNX B;  1BT6 A;  3M0W A;  3OB1 B;  3L47 A;  5CSJ A;  1C7W A;  4MN0 A;  1VRK A;  2L2E A;  3OX6 A;  4XJK A;  1CMG A;  5BPJ A;  2OTG C;  1AP4 A;  3D10 A;  1FBV A;  1OZS A;  2EC6 C;  1E8A A;  2KI6 D;  3VRO A;  3I5G B;  1YUU A;  4XJK B;  2JTT A;  2WCJ A;  1KK7 Z;  3ZWH A;  1NX3 A;  1FI6 A;  3S0F A;  1IJ6 A;  2LUX A;  2CCM A;  2BE6 A;  2JTZ A;  2LVI A;  3BJH A;  3SG7 A;  3VRR A;  3ZNI A;  1SBJ A;  1MWN A;  1XA5 A;  1KWO B;  4I5N B;  1PAL A;  2FOT A;  2LLS A;  3O6B A;  4GGN A;  2BBN A;  4N1F A;  4TNC A;  1TCO B;  3O4Y A;  2M29 A;  1FF1 A;  1SRA A;  1IRJ A;  3DVK A;  1AHR A;  2NLN A;  2ZFD A;  3RM1 A;  1A4P A;  3QME A;  1RRO A;  4U8D A;  4PDZ A;  1LS8 A;  1S26 D;  1OOG A;  4YI9 A;  4DUQ A;  4GPL B;  1QVI Z;  1IG5 A;  1QX7 A;  3JVT C;  3SS4 A;  1LIN A;  2NZ0 A;  3SG4 A;  1AJ5 A;  1B8L A;  2KPH A;  4WQ3 A;  2MLE C;  3QRX A;  1QXP A;  2KAY A;  2MBX A;  3PM2 A;  3SG5 A;  2PAL A;  4BY4 A;  4I5J A;  1UP5 A;  2ZRS A;  1CB1 A;  1SK6 D;  3IQQ A;  1DJW A;  4DS7 A;  1S36 A;  1NUB A;  1SCM C;  1TIZ A;  3SS3 A;  3CS1 A;  2CNP A;  4CPV A;  4D1E A;  1JBA A;  4AQI A;  3FS7 A;  2WCF A;  2JC2 A;  2SCP A;  3CAB A;  2QAC A;  1K8U A;  3L4A A;  1LKJ A;  1JFJ A;  3PN7 B;  3GK1 A;  3DF0 B;  2MAZ A;  4MLW A;  1MHO A;  1B7T Y;  1R2U A;  1CFF A;  1XFY O;  3I5G C;  4PE1 A;  1DEL A;  1XFW O;  3PAL A;  4PE7 A;  3IF7 A;  1FPW A;  1NIW A;  3KEV A;  5AAN A;  1XO5 A;  1V1F A;  1OOI X;  1PSR A;  2L98 A;  3B87 A;  3D73 A;  3SIA A;  3B88 A;  4F0Z B;  4YBH B;  1AK8 A;  2KLD A;  2L50 A;  5ER5 A;  1YR5 A;  3A8R A;  4CID A;  1IQ3 A;  1D1O A;  3CZ2 A;  2LC5 A;  2OPO A;  2KQ6 A;  2WOS A;  1UHI A;  4PHN A;  2PRU A;  4AOM A;  3D74 A;  1PVA A;  3UO9 A;  2ZNE A;  3CDN A;  1TN4 A;  1Y6W A;  5FI2 A;  1HT9 A;  2P70 A;  1EJ3 A;  1NX0 A;  1U5I A;  3I5I B;  1G8I A;  4DIR A;  1M31 A;  2KFG A;  1KCY A;  2QPT A;  2HQ8 A;  3PFV A;  4M2Q A;  1OMV A;  1N0Y A;  1FW4 A;  2LCP A;  1Q80 A;  3NSI A;  1CFC A;  2CXJ A;  3LK1 A;  1A75 A;  1BJF A;  3GK2 A;  3I5I C;  1Z4H A;  2R2I A;  1CNP A;  2CTN A;  2WOR A;  1M45 A;  2KGR A;  4M2O A;  1J1D A;  1KFX L;  1YUT A;  4PT1 A;  1SCM B;  1QV0 A;  1YTZ C;  2KLE A;  3SG3 A;  1BR1 B;  2KAX A;  1DC1 A;  1IIO A;  4ORB B;  5I94 A;  4FQO A;  3TS5 C;  3RZS A;  4PE0 A;  1ZUZ A;  1XVJ A;  3DXL A;  3VRN A;  1QLS A;  4I5K A;  4OV2 A;  1S5G Z;  5TNC A;  2FJU B;  3VRQ A;  1CM4 A;  2WCM A;  4GFT A;  2Y5I A;  2GTE A;  4MEW A;  5HLO A;  2LLT A;  4A4C A;  2H8V A;  2LHI A;  1QS7 A;  1SL7 A;  1UHN A;  1PSB A;  2ZN8 A;  2AUC A;  5AEQ A;  1BOD A;  1YX8 A;  2QEH A;  4GGF C;  4NQG A;  1F71 A;  1K9P A;  1XFX O;  2FCE A;  1LXF C;  2M49 B;  1KFX S;  4OR9 B;  1DT7 B;  1P28 A;  1YUS A;  1UHJ A;  4JPZ B;  3TUY B;  1BU3 A;  3SG6 A;  2LM5 A;  2V53 A;  1WDC C;  2MJW B;  1OOH A;  2HQW A;  1PK0 D;  1RJV A;  5JJG A;  1TUZ A;  2H2K A;  1QX2 A;  3CZ0 A;  3TS5 B;  3KF9 A;  1B8R A;  1K9U A;  1KSM A;  1TRF A;  2B1U A;  1MR8 A;  2JWW A;  4PAL A;  4PHK A;  1NPQ A;  2MHH A;  3BUX B;  4C0J A;  3A4U B;  1EG4 A;  3BOW B;  5I2L A;  1UUR A;  3OP0 A;  5HKZ A;  5K89 A;  3SIB A;  2I94 A;  1WDC B;  2KDH A;  2K7D A;  2BBM A;  1K9K A;  3MSE B;  3N7H A;  4OVN F;  2KFF A;  1F4O A;  1CDP A;  2PVB A;  3NHI A;  1IH0 A;  2BEC A;  2KFH A;  2LAN A;  1CDM A;  2KBI A;  2M97 A;  1YRU B;  4MZK A;  3EK8 A;  1QAS A;  2K0J A; 
#chains in the Genus database with same CATH homology
 2AAO A;  1BF5 A;  1QJT A;  5HLV A;  1UUS A;  2LE9 B;  2M3W A;  5PAL A;  2FCD A;  3BQ3 A;  1XK4 C;  5F6T A;  1J7Q A;  1OE9 B;  4NDD A;  2I7A A;  1IQ5 A;  2F3Y A;  4GAO A;  1NWD A;  2I18 A;  2F2P A;  1HQV A;  2M7N A;  4P2Y B;  2BL0 B;  2LMU A;  2NCO A;  2RGI A;  2WCB A;  1LA3 A;  1QIV A;  2KAV A;  3NXA A;  2JT0 A;  4ZCV A;  1SCV A;  1K90 D;  1EXR A;  1WRZ A;  1KQM C;  2F2O A;  4F0Z B;  1TNW A;  2LP3 A;  4OCI A;  5DKQ A;  4PE4 A;  1KSO A;  1JF0 A;  4JWQ A;  4UPG A;  1JSA A;  5ER4 X;  1OMR A;  2BL0 C;  2KNE A;  1IKU A;  2K61 A;  2LNK A;  3EVV A;  1SNL A;  4MZJ A;  3KPX A;  4ETO A;  2LUC A;  2F3Z A;  1ZOT B;  1XYD A;  2KOT A;  3TUY C;  5AXI A;  2PSR A;  4NDB A;  1NCX A;  1Y1U A;  2GGM A;  3OB2 B;  2O60 A;  2Y1N A;  2LVK A;  1A75 B;  1SMG A;  1G4Y R;  1CDL A;  1X02 A;  4GNK B;  2KSP A;  1DJZ A;  2F33 A;  1A03 A;  1Y1A A;  3BUW B;  3PLF B;  2BE4 A;  5JOL A;  1SKT A;  2DOQ A;  1WRL A;  2GV5 A;  3IQO A;  1NCY A;  2CBL A;  1YUR A;  2M7L A;  2JT8 A;  1J7P A;  3CR2 A;  3EKH A;  5HYD A;  1GGW A;  2K8M B;  2ZN9 A;  1KQM B;  2ISD A;  1OSA A;  2F8P A;  2Q4U A;  4R1E A;  1BG1 A;  1UWO A;  2WND A;  1MXL C;  3TDZ A;  3BUO B;  5FYX A;  1XFU O;  1EL4 A;  1S6J A;  1J7R A;  2AMI A;  2L51 A;  1XK4 A;  4GGF A;  1DF0 A;  4GUK A;  2JOJ A;  5DKR A;  2L4H A;  4YRU A;  2SAS A;  2NCP A;  2O5G A;  4HRG A;  3RLZ A;  5I2Q A;  1F8H A;  4HRE E;  5KSZ A;  2E30 A;  1SL9 A;  2JXC A;  1IWQ A;  3KHE A;  2ZND A;  1NCZ A;  3PN7 C;  1YVL A;  1NX1 A;  1ALW A;  1C07 A;  2JZI A;  1K95 A;  5CPV A;  3TDU A;  1QV1 A;  3O2P A;  3EVR A;  3NSO A;  3D0Y A;  1XFV O;  1NX2 A;  3NSK A;  1RTP 1;  1CLL A;  1OOJ A;  1J1E A;  2LVV A;  1DGV A;  2BCB A;  2JUL A;  3CGA A;  4MZL A;  1S1E A;  4YI8 A;  1A29 A;  1RWY A;  3CZT X;  1SR6 B;  1F55 A;  1TNQ A;  3EK7 A;  1JWD A;  1S3P A;  2KYC A;  4MRX A;  3H4S E;  4YGA A;  1TTX A;  2K7C A;  1OQP A;  1DGU A;  4MBE A;  2D8N A;  3AKA A;  4AQJ A;  3FIA A;  4JQ0 D;  1S5G Y;  1YX7 A;  2L0P A;  3WXA A;  3K21 A;  2EHB A;  3LL8 B;  1H4B A;  2JXL A;  2PMY A;  4Q04 A;  2WCE A;  3TDI A;  1CTR A;  4HSZ A;  4E68 A;  1DF0 B;  1R6P A;  2KQY A;  4ORC B;  4QJ4 B;  1CLB A;  3EKJ A;  1AVS A;  1L2O C;  2KI6 C;  3HX4 A;  2KHN A;  2HPS A;  1EG3 A;  1IGV A;  5KU1 A;  1LVC D;  2Q91 A;  4A4B A;  1B47 A;  1SW8 A;  2LMT A;  3AAK A;  2IS9 A;  1DJG A;  5AFP A;  5CSI A;  1EH2 A;  1RFJ A;  2EC6 B;  4PHM A;  1JC2 A;  2MA2 A;  2M0R A;  4CLN A;  1U5I B;  2E6W A;  1BR4 B;  4PHJ A;  4N1G A;  1B4C A;  3BYA A;  2K7O A;  4DRW A;  2A4J A;  1JF2 A;  1KFU S;  4PCW A;  3WHU B;  4YGC B;  2CT9 A;  1KK8 B;  1F70 A;  1RK9 A;  2MLF C;  2L5X B;  3O78 A;  2H61 C;  5KTY A;  4ICB A;  2M8U A;  3BXK A;  1SR6 C;  1UHK A;  3WHT B;  2COL B;  1QTX A;  2JNX A;  1C7V A;  1SPY A;  1CDN A;  2Y4Q A;  3HCM A;  5D7F A;  2HF5 A;  1ZAC A;  4DCK A;  1WRK A;  1ZMZ A;  2NXQ A;  2LMV A;  3GK4 X;  2JPT A;  4YGE B;  4MSP A;  4MRY A;  1G33 A;  4MVF A;  4ORA B;  3LK0 A;  1L2O B;  2BCX A;  4C0L A;  1PVB A;  1SY9 A;  3DVE A;  5IBW A;  1JFK A;  1ZFS A;  2OS8 C;  1REC A;  2JU0 A;  1BMO A;  3C1V A;  3KO0 A;  1PUL A;  4NDC A;  4L9M A;  3EVU A;  1M46 A;  4CFQ A;  2LAP A;  1CFD A;  3NSL A;  1JUO A;  2EGD A;  1DJY A;  3PAT A;  1N2D A;  2PAS A;  3I5H C;  1K93 D;  3FWC A;  1J7O A;  3CTN A;  1V1G A;  2LV7 A;  1TNP A;  1WLM A;  3EK4 A;  5DKN A;  1DVI A;  1B9A A;  1ALV A;  3DD4 A;  1NYA A;  1BLQ A;  2KYF A;  2G9B A;  1L7Z A;  1MXE A;  2Y1M A;  3BUN B;  3SJS A;  1B1G A;  1IJ5 A;  4QJ3 B;  3OHM B;  1Y1X A;  4N5X A;  3CLN A;  1S6I A;  2H61 A;  5J3X A;  1F54 A;  2LLU A;  5I8N A;  1OMD A;  4M2P A;  3LCP C;  3LLE A;  1KK7 Y;  1W7I B;  2WC8 A;  1AJ4 A;  2JNF A;  5G08 A;  2KGB C;  1NSH A;  2LP2 A;  3I5F C;  4YGB B;  1DJI A;  2KI4 C;  4CFR A;  1AUI B;  5AER A;  1N65 A;  5CSN A;  3DVM A;  1KK8 C;  1GQM A;  2I2R E;  1CFP A;  4GBA A;  1SYM A;  2MRD A;  1PRW A;  2K2A A;  2M1U A;  1QLK A;  2ZRT A;  1B8C A;  2JRF A;  1WY9 A;  1XFZ O;  1KFU L;  1OZO A;  3AAJ A;  1B7T Z;  3GOF A;  2G2B A;  1DMO A;  4XYN A;  4ZCU A;  5HKY A;  1NP8 A;  4IL1 A;  1GJY A;  5I2O A;  1M63 B;  5GQQ C;  1KQV A;  3JTD B;  3I5F B;  1FI5 A;  2KI4 B;  2HET A;  1CM1 A;  3PM8 A;  2KBM A;  2OS8 B;  3PSR A;  4C0K A;  1WLZ A;  3F45 A;  1QAT A;  1YVH A;  3JTD C;  2VRG A;  1Y0V H;  3SG2 A;  3E3R A;  3TZ1 A;  3VRP A;  2JT3 A;  4I5L B;  1SL8 A;  1GGZ A;  1QIW A;  1TNX A;  2K2F A;  1QVI Y;  1DJX A;  1A2X A;  2TN4 A;  1KWO C;  4BY5 A;  3OX5 A;  1K2H A;  4HRH A;  2LVJ A;  5D69 A;  3D0Y B;  2LHL A;  4YGD B;  3VGO A;  2BCA A;  1MQ1 A;  3I5H B;  1DTL A;  4OKH A;  1K96 A;  2OTG B;  5HKW A;  1MF8 B;  1YRT B;  2L4I A;  2M1K B;  3DF0 A;  2M9G A;  3BUM B;  1BOC A;  1H8B A;  1CLM A;  1UHH A;  3BOW A;  3JVT B;  3CWG A;  1K94 A;  3DVJ A;  1J55 A;  1LA0 A;  1CKK A;  4WRI A;  2BKH B;  1TOP A;  4QJ5 B;  2ZKM X;  5B8I B;  1ODB A;  2P6B B;  4WQ2 A;  1QX5 B;  5CSF A;  3FWB A;  4P5O E;  2GGZ A;  3CR4 X;  1TCF A;  1M39 A;  3AKB A;  2JQ6 A;  3CR5 X;  3ICB A;  2BKI B;  4FTG A;  1MUX A;  1S6C A;  1W7J B;  2K7B A;  1CMF A;  1F4Q A;  1DJH A;  3WNX B;  1BT6 A;  3M0W A;  3OB1 B;  5CSJ A;  1C7W A;  4MN0 A;  1VRK A;  2L2E A;  3OX6 A;  4XJK A;  1CMG A;  5BPJ A;  2OTG C;  1AP4 A;  3D10 A;  1FBV A;  1OZS A;  2EC6 C;  1E8A A;  2KI6 D;  3VRO A;  3I5G B;  1YUU A;  4XJK B;  2JTT A;  1KK7 Z;  3ZWH A;  1NX3 A;  1FI6 A;  1IJ6 A;  2LUX A;  2CCM A;  2BE6 A;  2JTZ A;  2LVI A;  3SG7 A;  3ZNI A;  3VRR A;  1SBJ A;  1MWN A;  1XA5 A;  1KWO B;  4I5N B;  1PAL A;  2FOT A;  2LLS A;  3O6B A;  4GGN A;  2BBN A;  4N1F A;  4TNC A;  1TCO B;  3O4Y A;  2M29 A;  1FF1 A;  1SRA A;  1IRJ A;  3DVK A;  1AHR A;  2NLN A;  2ZFD A;  3RM1 A;  1A4P A;  1RRO A;  4U8D A;  4PDZ A;  1S26 D;  4YI9 A;  4DUQ A;  4GPL B;  1QVI Z;  1IG5 A;  1QX7 A;  3JVT C;  1LIN A;  2NZ0 A;  3SG4 A;  1AJ5 A;  1B8L A;  4WQ3 A;  2MLE C;  3QRX A;  1QXP A;  2KAY A;  2MBX A;  3SG5 A;  2PAL A;  4BY4 A;  4I5J A;  1UP5 A;  2ZRS A;  1CB1 A;  1SK6 D;  3IQQ A;  1DJW A;  4DS7 A;  1S36 A;  1NUB A;  1SCM C;  1TIZ A;  3CS1 A;  2CNP A;  4CPV A;  4D1E A;  1JBA A;  4AQI A;  3FS7 A;  2WCF A;  2JC2 A;  2SCP A;  2QAC A;  1K8U A;  1LKJ A;  1JFJ A;  3PN7 B;  3GK1 A;  3DF0 B;  2MAZ A;  4MLW A;  1MHO A;  1B7T Y;  1R2U A;  1CFF A;  1XFY O;  3I5G C;  4PE1 A;  1XFW O;  3PAL A;  4PE7 A;  3IF7 A;  1FPW A;  1NIW A;  3KEV A;  5AAN A;  1XO5 A;  1V1F A;  1PSR A;  2L98 A;  3SIA A;  4YBH B;  1AK8 A;  2L50 A;  5ER5 A;  1YR5 A;  3A8R A;  4CID A;  1IQ3 A;  1D1O A;  2LC5 A;  2OPO A;  2KQ6 A;  2WOS A;  1UHI A;  4PHN A;  2PRU A;  4AOM A;  1PVA A;  2ZNE A;  1TN4 A;  1Y6W A;  1HT9 A;  1EJ3 A;  1NX0 A;  1U5I A;  3I5I B;  1G8I A;  4DIR A;  1M31 A;  2KFG A;  1KCY A;  2QPT A;  2HQ8 A;  3PFV A;  4M2Q A;  1OMV A;  1N0Y A;  1FW4 A;  2LCP A;  1Q80 A;  3NSI A;  1CFC A;  2CXJ A;  3LK1 A;  1A75 A;  1BJF A;  3GK2 A;  3I5I C;  2R2I A;  1CNP A;  2CTN A;  2WOR A;  1M45 A;  2KGR A;  4M2O A;  1J1D A;  1KFX L;  1YUT A;  1SCM B;  1QV0 A;  1YTZ C;  3SG3 A;  1BR1 B;  2KAX A;  4ORB B;  4FQO A;  3TS5 C;  4PE0 A;  1ZUZ A;  1XVJ A;  3VRN A;  1QLS A;  4I5K A;  4OV2 A;  1S5G Z;  5TNC A;  2FJU B;  3VRQ A;  1CM4 A;  4GFT A;  2Y5I A;  4MEW A;  5HLO A;  2LLT A;  4A4C A;  2LHI A;  2ZN8 A;  1QS7 A;  1SL7 A;  1UHN A;  1PSB A;  2AUC A;  5AEQ A;  1BOD A;  1YX8 A;  4GGF C;  4NQG A;  1F71 A;  1K9P A;  1XFX O;  2FCE A;  1LXF C;  2M49 B;  1KFX S;  4OR9 B;  1DT7 B;  1YUS A;  1UHJ A;  4JPZ B;  3TUY B;  1BU3 A;  3SG6 A;  2LM5 A;  2V53 A;  1WDC C;  2MJW B;  2HQW A;  1PK0 D;  1RJV A;  5JJG A;  2H2K A;  1QX2 A;  3TS5 B;  3KF9 A;  1B8R A;  1K9U A;  1KSM A;  1TRF A;  2B1U A;  1MR8 A;  2JWW A;  4PAL A;  4PHK A;  1NPQ A;  2MHH A;  3BUX B;  4C0J A;  3A4U B;  1EG4 A;  3BOW B;  5I2L A;  1UUR A;  3OP0 A;  5HKZ A;  5K89 A;  3SIB A;  2I94 A;  1WDC B;  2KDH A;  2K7D A;  2BBM A;  1K9K A;  3MSE B;  4OVN F;  4USL A;  2KFF A;  1F4O A;  1CDP A;  2PVB A;  1IH0 A;  2BEC A;  2KFH A;  2LAN A;  1CDM A;  2KBI A;  2M97 A;  1YRU B;  4MZK A;  3EK8 A;  1QAS A;  2K0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...