3SIBA

Crystal structure of ure3-binding protein, wild-type
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
215
structure length
203
Chain Sequence
ANFCLWNLQPIMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNDRNRSGTLEPHEILPALQQLGFYINQRTSLLLHRLFARGMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-binding protein
rcsb
source organism Entamoeba histolytica
molecule tags Dna binding protein
total genus 80
structure length 203
sequence length 215
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sibA00
2PMYA 1WRKA 1QASA 2FCEA 2BECA 1PALA 2KAYA 2KYCA 1QV0A 3OB2B 5IBWA 1SNLA 1Y1XA 2BCAA 3GK2A 1ALWA 2K2FA 3HX4A 1XFZO 2M0RA 2JPTA 3FWBA 1Y1UA 2I2RE 4QJ3B 2BCXA 2I18A 1DJHA 2HQWA 4GGFA 2BE4A 2B1UA 4MSPA 1D1OA 1OQPA 5BPJA 3A8RA 3WNXB 2KQ6A 4JQ0D 2LVIA 1ZUZA 1IRJA 5CSNA 1CNPA 1SRAA 1LA0A 3EVUA 1JF2A 1Y6WA 3AKAA 2LVKA 1YR5A 4JPZB 1EJ3A 1YRUB 3TZ1A 1BG1A 4ICBA 5KSZA 2LMUA 2MLEC 1PRWA 3JVTB 4HRHA 1YRTB 4N1GA 1PK0D 1TNQA 2LANA 1F4OA 1U5IB 2MA2A 1JFKA 2WCFA 3I5IB 2BL0B 1XA5A 4OR9B 1S6CA 1LA3A 3PALA 3WHTB 3KEVA 1Y1AA 2NCOA 1KFUL 2MLFC 1S26D 4GGNA 2ZRTA 2K7BA 1S5GY 1K94A 1MHOA 1OE9B 1K93D 1QV1A 1TTXA 1UUSA 5CSIA 5J3XA 1SL7A 2KGRA 2F8PA 1J7QA 1C07A 2H61A 3BQ3A 4UPGA 1RFJA 2CCMA 2LE9B 1PULA 3CR2A 3CS1A 5F6TA 5ER4X 2BBMA 4MLWA 5HKWA 5KTYA 3VRPA 1DVIA 1PSRA 1CLMA 4OKHA 2COLB 3H4SE 4GUKA 1QXPA 1DGUA 4MVFA 3GK4X 1BLQA 1KQVA 3O78A 4MN0A 2JC2A 4YGAA 1BR1B 2L50A 4MRYA 2OPOA 1A75A 4CPVA 4PE7A 2KGBC 2CTNA 3BOWA 3DD4A 2BBNA 3CWGA 5AANA 1JC2A 1KSOA 1M31A 3LL8B 2M9GA 2LLSA 1GGWA 1BT6A 2KHNA 2M49B 4HRGA 3WXAA 2TN4A 4HSZA 3SIAA 4NDDA 3RM1A 1CFPA 3TS5C 2HPSA 3TUYC 1F8HA 3LK1A 2M1UA 3O2PA 3SG7A 2JTTA 2HETA 1J7PA 3IF7A 3DVMA 1K90D 1YVLA 3D10A 5CSJA 4DCKA 1WRZA 3PN7C 1OMVA 4R1EA 1MQ1A 1JWDA 1J7OA 1CFDA 3VRNA 1NX1A 1YURA 1K2HA 4MBEA 4MZJA 3RLZA 4XJKA 1DJXA 1B9AA 2L51A 2LM5A 4PDZA 1SKTA 2OS8B 1K95A 4E68A 1CDNA 1JSAA 1NP8A 1OMDA 4WQ2A 1EH2A 4M2PA 2FOTA 2CNPA 1K8UA 4GFTA 1WY9A 2WC8A 1NCYA 3TS5B 3TUYB 1KQMC 3OB1B 1QTXA 1VRKA 3AAJA 1XFWO 2KAVA 1ZFSA 3JVTC 1BF5A 1L7ZA 3PN7B 3I5FB 2LP2A 4TNCA 2A4JA 3GK1A 1FI5A 1B8RA 1UURA 2JU0A 2QACA 3K21A 1DJZA 1QIVA 2AMIA 2BKIB 3ZNIA 4OCIA 3DVKA 4MRXA 4BY5A 5I2QA 1FW4A 2KBMA 1N0YA 2KDHA 3AKBA 1K9UA 3BUNB 2G9BA 2KFHA 1KFXS 2H2KA 4M2OA 1M63B 2LVVA 1SR6C 1S5GZ 2G2BA 3EVRA 3LLEA 3HCMA 1XK4C 1LKJA 2KNEA 2K7CA 4DIRA 1LVCD 1XYDA 4DS7A 1AK8A 1QX5B 2M7NA 4YI8A 1MWNA 2E6WA 2O5GA 1TRFA 2LP3A 2I7AA 1OSAA 5CPVA 1KQMB 1NX3A 4L9MA 5HLOA 2LVJA 4N1FA 1DMOA 5JOLA 3IQOA 4CFQA 2PVBA 2BCBA 3LCPC 1A4PA 4AQJA 1YUSA 1SW8A 4ETOA 4MZKA 4IL1A 4PE0A 1KK7Y 5GQQC 2WCEA 2SASA 5HLVA 1M39A 2LLUA 4ORCB 2PSRA 3KO0A 1JUOA 3ICBA 2KI6D 2NCPA 4FQOA 1SR6B 2L98A 3WHUB 4PHNA 1QX7A 1SMGA 1UHJA 2EHBA 2ZRSA 2NLNA 1BOCA 1YX8A 1NCZA 1CM1A 3BXKA 4CIDA 3CR4X 1IGVA 3DF0B 3OX5A 4CLNA 1FF1A 4NDCA 4F0ZB 2R2IA 1ZMZA 1ZACA 1CLLA 2KI4C 3IQQA 1KCYA 2D8NA 2L4HA 2ZN8A 2JULA 5TNCA 1LXFC 1JF0A 5I2LA 1ZOTB 2KQYA 1U5IA 4D1EA 5AERA 1CLBA 2GGMA 1EG3A 4GAOA 2OS8C 3EK8A 1B47A 2LHIA 4MEWA 1SK6D 1SY9A 1QLKA 4FTGA 3OP0A 2CBLA 1HQVA 1QVIZ 1YVHA 1F54A 4I5LB 2JXCA 3NSKA 1ODBA 4NQGA 3QRXA 2K2AA 1Q80A 2JT3A 1YUUA 2F2OA 4P2YB 2EC6B 5AFPA 5DKRA 3O6BA 1NX2A 3TDIA 1R2UA 3VRRA 1IWQA 1QATA 2EGDA 2LLTA 2KI4B 3I5FC 3I5HC 1PVAA 4NDBA 3EKHA 2LNKA 4CFRA 4GGFC 1F70A 1RECA 3KHEA 1DF0B 2CT9A 4A4CA 1CMFA 1EG4A 2F33A 2HF5A 2JT0A 4WQ3A 1K9KA 2ZN9A 1RROA 1GQMA 1NYAA 1YUTA 2O60A 2FCDA 1AJ4A 1G8IA 1W7JB 2LAPA 4USLA 1WDCB 3E3RA 3I5GC 1K9PA 4BY4A 2OTGC 1UHKA 3BUOB 1IQ5A 1L2OC 1J1EA 3PLFB 2QPTA 3JTDC 1ALVA 1TIZA 3DVJA 4JWQA 1DT7B 1CFCA 3VGOA 1YX7A 2AAOA 2JTZA 5HKZA 1CKKA 2KAXA 3TDZA 1IG5A 2K8MB 2GGZA 2WNDA 1EL4A 1RJVA 3I5HB 1KK7Z 1FBVA 1IH0A 2M29A 1SBJA 4I5KA 1F71A 4PE1A 1NCXA 1JBAA 1TNPA 5AEQA 5JJGA 5DKNA 5I8NA 2PASA 1C7WA 2JQ6A 1GJYA 3DVEA 3EVVA 4YGBB 2FJUB 2IS9A 5KU1A 1TN4A 1UP5A 2K7OA 3A4UB 1Y0VH 3FIAA 1CB1A 3BUXB 4AOMA 4PHKA 1DJWA 1UHIA 5DKQA 1S1EA 1AHRA 1UHHA 1MXLC 4OVNF 2I94A 2KBIA 3I5GB 2OTGB 2MHHA 1XFUO 3PSRA 1B8LA 1L2OB 3CGAA 1F55A 3JTDB 1J1DA 2CXJA 2JT8A 4PHJA 3SG3A 1N2DA 1A2XA 1A03A 4ORAB 1KFXL 3MSEB 2KI6C 1NUBA 2L0PA 4C0JA 4HREE 2LUCA 3PM8A 1KWOC 1CM4A 4YGDB 1QIWA 1XFYO 2KFGA 2KSPA 1KSMA 1B1GA 2L5XB 1PSBA 2L4IA 3SIBA 3TDUA 2HQ8A 2K0JA 2M3WA 3NXAA 2WCBA 1X02A 1B7TY 4ZCVA 3SG2A 1SCVA 4XYNA 4C0LA 4AQIA 1HT9A 1SCMB 3EKJA 1KFUS 2JWWA 4MZLA 1RK9A 2JRFA 1BR4B 1QLSA 3GOFA 1YTZC 3NSLA 2MRDA 4WRIA 3D0YB 2EC6C 1B4CA 1FI6A 3M0WA 3CR5X 1A75B 4PALA 5G08A 1CMGA 2LUXA 1N65A 3BOWB 4YGEB 1EXRA 1QJTA 2AUCA 1TOPA 3KF9A 5I2OA 2LHLA 1DJIA 4GNKB 1BJFA 1QS7A 1TCOB 3SG4A 4YBHB 1KWOB 1WLMA 2SCPA 4M2QA 1OMRA 2Y1MA 1CFFA 1CTRA 1G33A 1MUXA 1UHNA 2V53A 4GBAA 1NIWA 3VROA 4QJ4B 1TNWA 2M7LA 1SL8A 1KK8C 2JOJA 1RWYA 4YGCB 1WRLA 3EK4A 5HYDA 1BODA 2F2PA 2DOQA 2PRUA 1K96A 2F3ZA 2KFFA 5CSFA 1OOJA 1XK4A 1MF8B 1WDCC 3BUMB 3CTNA 3OX6A 2LMVA 3CZTX 1DTLA 4ZCUA 2P6BB 1S36A 4OV2A 1LINA 1IJ5A 2BKHB 3D0YA 4YI9A 2JXLA 2ZFDA 4XJKB 3DF0A 1C7VA 1UWOA 2JNFA 2ZKMX 1R6PA 1S6JA 2F3YA 2MAZA 3CLNA 1XFXO 4GPLB 2Y5IA 3PFVA 1J55A 3O4YA 1DJYA 1IJ6A 4PE4A 5HKYA 2MJWB 2NXQA 1V1FA 1AUIB 2ZNEA 1CDPA 1E8AA 2Y4QA 2LC5A 1DGVA 4C0KA 2WOSA 1NPQA 3BUWB 2KOTA 1SYMA 3VRQA 1NX0A 1NSHA 2NZ0A 1KK8B 4QJ5B 1QX2A 2PALA 1G4YR 1AVSA 1H4BA 3SG5A 2M1KB 3C1VA 3AAKA 1BU3A 3SG6A 1AP4A 1OZOA 4PHMA 2KYFA 2LCPA 4P5OE 2ZNDA 1F4QA 3OHMB 1DJGA 5K89A 1PVBA 1JFJA 5AXIA 1M45A 2RGIA 4PCWA 3KPXA 2WORA 1SPYA 1GGZA 3BYAA 1H8BA 1IQ3A 1S6IA 2BE6A 1MR8A 1CDMA 1MXEA 2ISDA 1WLZA 1B8CA 4A4BA 2Q91A 1V1GA 3NSOA 2GV5A 3LK0A 3PATA 5D69A 4ORBB 1XFVO 1S3PA 2VRGA 1CDLA 1NWDA 1TCFA 2M8UA 2E30A 5PALA 3SJSA 1BMOA 2JNXA 5D7FA 4Q04A 1QVIY 2H61C 1IKUA 1DF0A 3ZWHA 1A29A 1J7RA 4N5XA 4DRWA 1M46A 1B7TZ 2M97A 1OZSA 2Y1NA 3F45A 3FWCA 1SCMC 5B8IB 3FS7A 2K61A 2LV7A 2MBXA 5FYXA 4YRUA 1SL9A 1XVJA 2LMTA 1W7IB 2Q4UA 3NSIA 4I5JA 1RTP1 4DUQA 4U8DA 1AJ5A 1XO5A 4I5NB 2K7DA 3EK7A 2JZIA 5ER5A 2L2EA 3I5IC 2BL0C 1FPWA 1TNXA
chains in the Genus database with same CATH superfamily
2PMYA 1WRKA 1QASA 2FCEA 2BECA 1PALA 2KAYA 2KYCA 1QV0A 3BFHA 3OB2B 5IBWA 2L5YA 1SNLA 1Y1XA 2BCAA 3GK2A 1ALWA 2K2FA 3HX4A 1XFZO 1GM0A 2M0RA 2JPTA 3FWBA 1Y1UA 2I2RE 4QJ3B 3CYZA 2BCXA 2I18A 1DJHA 2HQWA 4GGFA 2BE4A 2B1UA 4FQTA 4MSPA 1D1OA 1OQPA 5BPJA 3A8RA 3WNXB 2KQ6A 4JQ0D 2LVIA 1ZUZA 1IRJA 5CSNA 1CNPA 1SRAA 1LA0A 3EVUA 1JF2A 1Y6WA 3AKAA 2LVKA 3BFAA 1YR5A 4JPZB 1EJ3A 3R1PA 1YRUB 3TZ1A 1BG1A 2WC5A 4ICBA 5KSZA 2LMUA 2MLEC 1PRWA 3JVTB 4IJ7A 4HRHA 1QWVA 1YRTB 1Z2CB 4N1GA 1PK0D 1TNQA 2LANA 1F4OA 1U5IB 2KPHA 1JFKA 2MA2A 2WCFA 3I5IB 3FE8A 2BL0B 1XA5A 4OR9B 1S6CA 1LA3A 3PALA 3WHTB 3KEVA 1Y1AA 2NCOA 3S0DA 1KFUL 2MLFC 1S26D 4GGNA 2ZRTA 2K7BA 1S5GY 3O4XA 1K94A 1MHOA 1OE9B 1K93D 1QV1A 1TTXA 1UUSA 1DEKA 3BFBA 3DYEA 1SL7A 2KGRA 5CSIA 2F8PA 5J3XA 1J7QA 1C07A 1C3ZA 2H61A 3BQ3A 3IVTA 4UPGA 1RFJA 3S0GA 3D76A 2CCMA 2LE9B 1PULA 3CR2A 4KYNA 3CS1A 5F6TA 5ER4X 2BBMA 4MLWA 5HKWA 1OOFA 5KTYA 3VRPA 1P28A 1DVIA 1PSRA 1CLMA 4OKHA 2COLB 3H4SE 4GUKA 1QXPA 1DGUA 4MVFA 3GK4X 1BLQA 1KQVA 3D77A 3S0BA 3O78A 1DC1A 4MN0A 2BAPA 2JC2A 4YGAA 1BR1B 2L50A 4MRYA 2OPOA 1A75A 4CPVA 4PE7A 2KGBC 2CTNA 3BOWA 3DD4A 2BBNA 3CWGA 5AANA 1JC2A 1KSOA 1M31A 3LL8B 2M9GA 2LLSA 1GGWA 1BT6A 2KHNA 2M49B 4HRGA 3WXAA 2TN4A 3SS3A 4HSZA 2P71A 3SIAA 4NDDA 3RM1A 1CFPA 3TS5C 2HPSA 3TUYC 1F8HA 3LK1A 2M1UA 3O2PA 3SG7A 2JTTA 2HETA 1J7PA 3IF7A 3DVMA 3K1EA 1K90D 1YVLA 3D10A 5CSJA 4DCKA 1WRZA 3PN7C 1OMVA 4INXA 4R1EA 1MQ1A 2FJYA 1JWDA 1J7OA 1CFDA 3VRNA 1NX1A 1YURA 1K2HA 4MBEA 4MZJA 3RLZA 4XJKA 1DJXA 1B9AA 2QEHA 2L51A 4INWA 2LM5A 3PJIA 4PDZA 5I94A 2WCJA 1SKTA 2OS8B 1K95A 4E68A 1CDNA 1JSAA 1NP8A 1OMDA 3OBVA 4WQ2A 1EH2A 3D75A 4M2PA 2FOTA 1ORGA 2CNPA 1K8UA 4GFTA 1WY9A 2WC8A 1NCYA 3TS5B 3TUYB 1KQMC 2WCLA 1QTXA 3OB1B 3PM2A 3CABA 1VRKA 3AAJA 1XFWO 2KAVA 1ZFSA 3JVTC 1BF5A 1L7ZA 3PN7B 3DXLA 3I5FB 2LP2A 4TNCA 1T14A 2A4JA 3GK1A 1FI5A 1B8RA 1UURA 2JU0A 2QACA 3K21A 1DJZA 1QIVA 2AMIA 2BKIB 2JPOA 3ZNIA 4OCIA 3DVKA 4MRXA 4BY5A 5I2QA 1FW4A 2KBMA 1N0YA 3CDNA 2KDHA 3AKBA 1K9UA 3BUNB 2G9BA 2KFHA 1KFXS 2H2KA 4M2OA 1M63B 2LVVA 1SR6C 1S5GZ 2G2BA 3EVRA 3LLEA 4PT1A 1XFRA 1XK4C 1LKJA 2KNEA 2K7CA 3HCMA 4DIRA 1LVCD 1XYDA 4DS7A 4OZDA 1AK8A 1QX5B 2M7NA 4YI8A 1MWNA 2E6WA 2O5GA 1TRFA 2LP3A 2I7AA 1OSAA 3NHTA 1KQMB 1NX3A 4L9MA 5CPVA 5HLOA 2LVJA 4N1FA 1DMOA 3B87A 3IQOA 5JOLA 4CFQA 2PVBA 2BCBA 3LCPC 1A4PA 4AQJA 2L2CA 1YUSA 1SW8A 4ETOA 4MZKA 4IL1A 4PE0A 3UO9A 1KK7Y 5GQQC 2WCEA 2SASA 5HLVA 3B86A 1M39A 2LLUA 3OGNA 4ORCB 2PSRA 3KO0A 1JUOA 3ICBA 2KI6D 2NCPA 4FQOA 1SR6B 2L98A 3WHUB 4PHNA 1QX7A 1SMGA 1OOHA 1UHJA 2EHBA 2ZRSA 2NLNA 1BOCA 1YX8A 1NCZA 1CM1A 3BXKA 4CIDA 3CR4X 1IGVA 3DF0B 3OX5A 3CZ0A 4CLNA 1FF1A 4NDCA 4F0ZB 5EL2A 2R2IA 1ZMZA 1ZACA 1CLLA 2KI4C 3IQQA 3RZSA 2D8NA 1KCYA 2L4HA 2ZN8A 2JULA 3L4LA 5TNCA 1LXFC 1JF0A 3DZTA 5I2LA 1ZOTB 2KQYA 1U5IA 4D1EA 5AERA 1CLBA 2GGMA 1EG3A 4GAOA 2OS8C 3EK8A 1B47A 2LHIA 4MEWA 1SK6D 1SY9A 1QLKA 4FTGA 3OP0A 2CBLA 1HQVA 4F7FA 1QVIZ 1YVHA 1OOIX 2KLDA 1F54A 4I5LB 2JXCA 3NSKA 1ODBA 3D78A 3QRXA 4NQGA 2K2AA 1Q80A 2JT3A 1YUUA 2F2OA 4P2YB 2EC6B 3EG5B 5AFPA 5DKRA 3O6BA 1NX2A 2QDIA 3TDIA 1R2UA 3VRRA 1IWQA 1QATA 2EGDA 2LLTA 2KI4B 3I5FC 3I5HC 1PVAA 4NDBA 3EKHA 2LNKA 4CFRA 4GGFC 1F70A 1RECA 3KHEA 1DF0B 2GTEA 2QEOA 2CT9A 2WC6A 3B6XA 4A4CA 1CMFA 1EG4A 2F33A 1TUJA 2HF5A 2JT0A 4WQ3A 1K9KA 2ZN9A 5HL1A 1RROA 1GQMA 1NYAA 1YUTA 2O60A 3NHIA 2FCDA 1AJ4A 1G8IA 1W7JB 2LAPA 4USLA 1WDCB 3E3RA 3R72A 3I5GC 1K9PA 4BY4A 2OTGC 3S0AA 1UHKA 3BUOB 1IQ5A 1L2OC 2P70A 1J1EA 3PLFB 2QPTA 3JTDC 1ALVA 1TIZA 3DVJA 4JWQA 1DT7B 1CFCA 4JKTA 3VGOA 1YX7A 1SSEB 2AAOA 2JTZA 5HKZA 1CKKA 2KAXA 3TDZA 1IG5A 2K8MB 2GGZA 2WNDA 1EL4A 1RJVA 3I5HB 1KK7Z 3FE9A 1FBVA 3V2LA 1IH0A 2M29A 1SBJA 4I5KA 1F71A 4PE1A 1NCXA 1JBAA 1TNPA 2BNXA 5AEQA 5JJGA 5DKNA 3B88A 3QMEA 5I8NA 2PASA 1C7WA 2JQ6A 1GJYA 3DVEA 3EVVA 3NGVA 1TWOA 4YGBB 2FJUB 2IS9A 5KU1A 1TN4A 1UP5A 2K7OA 3A4UB 1Y0VH 3FIAA 1CB1A 3BUXB 4AOMA 4PHKA 1DJWA 1UHIA 5DKQA 1S1EA 1AHRA 1UHHA 1MXLC 4OVNF 2I94A 2KBIA 3I5GB 2OTGB 2MHHA 1XFUO 3PSRA 1B8LA 1L2OB 3CGAA 1F55A 3JTDB 1J1DA 2CXJA 2JT8A 4PHJA 3SG3A 3BJHA 1N2DA 1A2XA 1A03A 4ORAB 1KFXL 3MSEB 2KI6C 1NUBA 2L0PA 4C0JA 1OW4A 4HREE 2LUCA 3PM8A 1KWOC 1CM4A 4YGDB 3D74A 1QIWA 2WCHA 1XFYO 2KFGA 2WCKA 2YGUA 2KSPA 1KSMA 1TUZA 1B1GA 2L5XB 1PSBA 2L4IA 3L47A 4JD9A 3SIBA 2PQLA 3TDUA 2HQ8A 1W9ZA 2H8VA 2K0JA 2M3WA 3NXAA 2WCBA 1X02A 1B7TY 4ZCVA 3SG2A 1SCVA 4XYNA 4C0LA 4AQIA 1HT9A 1SCMB 3D73A 1KFUS 3EKJA 2JWWA 4MZLA 1RK9A 3S0FA 2JRFA 1BR4B 3L4AA 1QLSA 3GOFA 1YTZC 3NSLA 2MRDA 4WRIA 3D0YB 2EC6C 1B4CA 1FI6A 3M0WA 3CR5X 1A75B 4PALA 5G08A 1CMGA 2LUXA 1N65A 3BOWB 4YGEB 1EXRA 1QJTA 2AUCA 1TOPA 3KF9A 5I2OA 2LHLA 1DJIA 5FI7A 4GNKB 1BJFA 1QS7A 1TCOB 3SG4A 3VB1A 4YBHB 1KWOB 1WLMA 2SCPA 4M2QA 1OMRA 2Y1MA 1CFFA 1CTRA 1G33A 1MUXA 5DICA 1UHNA 2V53A 4GBAA 1NIWA 3VROA 4QJ4B 1TNWA 3FE6A 2M7LA 3Q8IA 3DY9A 1SL8A 1KK8C 2JOJA 1RWYA 4YGCB 1WRLA 2KLEA 3EK4A 5HYDA 1BODA 2F2PA 2DOQA 2PRUA 1K96A 2ERBA 2F3ZA 2KFFA 5CSFA 3R1VA 1OOJA 1XK4A 1MF8B 1WDCC 3BUMB 3CTNA 3OX6A 2LMVA 3CZTX 1DTLA 4ZCUA 2P6BB 1S36A 4OV2A 1LINA 3R1OA 1IJ5A 2BKHB 3D0YA 5FI6A 4YI9A 2JXLA 2ZFDA 4XJKB 3DF0A 1C7VA 1UWOA 2JNFA 2ZKMX 1R6PA 5D3OA 1S6JA 2F3YA 2MAZA 3CLNA 1XFXO 4GPLB 1Z4HA 2Y5IA 3PFVA 3UNWA 1J55A 3O4YA 1DJYA 1IJ6A 4PE4A 3B7AA 2MJWB 5HKYA 2NXQA 1V1FA 1AUIB 2ZNEA 1CDPA 1E8AA 2Y4QA 2LC5A 1DGVA 4C0KA 1C3YA 2WOSA 1NPQA 3BUWB 2KOTA 1SYMA 3S0EA 1NX0A 3VRQA 1NSHA 1OOGA 2NZ0A 1KK8B 4QJ5B 1QX2A 2PALA 2QEBA 1G4YR 5FI2A 1AVSA 1H4BA 3SG5A 2M1KB 3C1VA 3AAKA 1BU3A 3SG6A 1AP4A 1OZOA 4PHMA 2KYFA 2LCPA 4P5OE 2ZNDA 1F4QA 3OHMB 1DJGA 5K89A 1PVBA 1JFJA 5AXIA 1M45A 2RGIA 4PCWA 3KPXA 2WORA 1SPYA 1GGZA 2WCMA 3BYAA 1IQ3A 1S6IA 1H8BA 2BE6A 1MR8A 1CDMA 1MXEA 2ISDA 1WLZA 1B8CA 4A4BA 2Q91A 1V1GA 3NSOA 2GV5A 1LS8A 3LK0A 3PATA 4ORBB 1XFVO 5D69A 1S3PA 2VRGA 1IIOA 1CDLA 1NWDA 1TCFA 2M8UA 2E30A 2PYQA 5PALA 3SJSA 1BMOA 2JNXA 5D7FA 1DELA 4Q04A 1QVIY 2H61C 1IKUA 1DF0A 3ZWHA 1A29A 1J7RA 4N5XA 4DRWA 1M46A 1B7TZ 2M97A 3SS4A 2QEVA 3CZ2A 1OZSA 2Y1NA 2K60A 3F45A 3FWCA 1SCMC 5B8IB 3FS7A 2K61A 2LV7A 2MBXA 5FYXA 4YRUA 1SL9A 1XVJA 2LMTA 1W7IB 2Q4UA 1DQEA 3NSIA 4I5JA 3N7HA 1RTP1 3CZ1A 4DUQA 4U8DA 1AJ5A 1XO5A 4I5NB 2K7DA 3EK7A 2JZIA 3SS5A 5ER5A 2L2EA 3I5IC 2BL0C 1FPWA 1TNXA
chains in the Genus database with same CATH topology
2PMYA 1WRKA 1QASA 2FCEA 2BECA 1PALA 2KAYA 2KYCA 1QV0A 3OB2B 5IBWA 1SNLA 1Y1XA 2BCAA 3GK2A 1ALWA 2K2FA 3HX4A 1XFZO 2M0RA 2JPTA 3FWBA 1Y1UA 2I2RE 4QJ3B 2BCXA 2I18A 1DJHA 2HQWA 4GGFA 2BE4A 2B1UA 4MSPA 1D1OA 1OQPA 5BPJA 3A8RA 3WNXB 2KQ6A 4JQ0D 2LVIA 1ZUZA 1IRJA 5CSNA 1CNPA 1SRAA 1LA0A 3EVUA 1JF2A 1Y6WA 3AKAA 2LVKA 1YR5A 4JPZB 1EJ3A 1YRUB 3TZ1A 1BG1A 4ICBA 5KSZA 2LMUA 2MLEC 1PRWA 3JVTB 4HRHA 1YRTB 4N1GA 1PK0D 1TNQA 2LANA 1F4OA 1U5IB 2MA2A 1JFKA 2WCFA 3I5IB 2BL0B 1XA5A 4OR9B 1S6CA 1LA3A 3PALA 3WHTB 3KEVA 1Y1AA 2NCOA 1KFUL 2MLFC 1S26D 4GGNA 2ZRTA 2K7BA 1S5GY 1K94A 1MHOA 1OE9B 1K93D 1QV1A 1TTXA 1UUSA 5CSIA 5J3XA 1SL7A 2KGRA 2F8PA 1J7QA 1C07A 2H61A 3BQ3A 4UPGA 1RFJA 2CCMA 2LE9B 1PULA 3CR2A 3CS1A 5F6TA 5ER4X 2BBMA 4MLWA 5HKWA 5KTYA 3VRPA 1DVIA 1PSRA 1CLMA 4OKHA 2COLB 3H4SE 4GUKA 1QXPA 1DGUA 4MVFA 3GK4X 1BLQA 1KQVA 3O78A 4MN0A 2JC2A 4YGAA 1BR1B 2L50A 4MRYA 2OPOA 1A75A 4CPVA 4PE7A 2KGBC 2CTNA 3BOWA 3DD4A 2BBNA 3CWGA 5AANA 1JC2A 1KSOA 1M31A 3LL8B 2M9GA 2LLSA 1GGWA 1BT6A 2KHNA 2M49B 4HRGA 3WXAA 2TN4A 4HSZA 3SIAA 4NDDA 3RM1A 1CFPA 3TS5C 2HPSA 3TUYC 1F8HA 3LK1A 2M1UA 3O2PA 3SG7A 2JTTA 2HETA 1J7PA 3IF7A 3DVMA 1K90D 1YVLA 3D10A 5CSJA 4DCKA 1WRZA 3PN7C 1OMVA 4R1EA 1MQ1A 1JWDA 1J7OA 1CFDA 3VRNA 1NX1A 1YURA 1K2HA 4MBEA 4MZJA 3RLZA 4XJKA 1DJXA 1B9AA 2L51A 2LM5A 4PDZA 1SKTA 2OS8B 1K95A 4E68A 1CDNA 1JSAA 1NP8A 1OMDA 4WQ2A 1EH2A 4M2PA 2FOTA 2CNPA 1K8UA 4GFTA 1WY9A 2WC8A 1NCYA 3TS5B 3TUYB 1KQMC 3OB1B 1QTXA 1VRKA 3AAJA 1XFWO 2KAVA 1ZFSA 3JVTC 1BF5A 1L7ZA 3PN7B 3I5FB 2LP2A 4TNCA 2A4JA 3GK1A 1FI5A 1B8RA 1UURA 2JU0A 2QACA 3K21A 1DJZA 1QIVA 2AMIA 2BKIB 3ZNIA 4OCIA 3DVKA 4MRXA 4BY5A 5I2QA 1FW4A 2KBMA 1N0YA 2KDHA 3AKBA 1K9UA 3BUNB 2G9BA 2KFHA 1KFXS 2H2KA 4M2OA 1M63B 2LVVA 1SR6C 1S5GZ 2G2BA 3EVRA 3LLEA 3HCMA 1XK4C 1LKJA 2KNEA 2K7CA 4DIRA 1LVCD 1XYDA 4DS7A 1AK8A 1QX5B 2M7NA 4YI8A 1MWNA 2E6WA 2O5GA 1TRFA 2LP3A 2I7AA 1OSAA 5CPVA 1KQMB 1NX3A 4L9MA 5HLOA 2LVJA 4N1FA 1DMOA 5JOLA 3IQOA 4CFQA 2PVBA 2BCBA 3LCPC 1A4PA 4AQJA 1YUSA 1SW8A 4ETOA 4MZKA 4IL1A 4PE0A 1KK7Y 5GQQC 2WCEA 2SASA 5HLVA 1M39A 2LLUA 4ORCB 2PSRA 3KO0A 1JUOA 3ICBA 2KI6D 2NCPA 4FQOA 1SR6B 2L98A 3WHUB 4PHNA 1QX7A 1SMGA 1UHJA 2EHBA 2ZRSA 2NLNA 1BOCA 1YX8A 1NCZA 1CM1A 3BXKA 4CIDA 3CR4X 1IGVA 3DF0B 3OX5A 4CLNA 1FF1A 4NDCA 4F0ZB 2R2IA 1ZMZA 1ZACA 1CLLA 2KI4C 3IQQA 1KCYA 2D8NA 2L4HA 2ZN8A 2JULA 5TNCA 1LXFC 1JF0A 5I2LA 1ZOTB 2KQYA 1U5IA 4D1EA 5AERA 1CLBA 2GGMA 1EG3A 4GAOA 2OS8C 3EK8A 1B47A 2LHIA 4MEWA 1SK6D 1SY9A 1QLKA 4FTGA 3OP0A 2CBLA 1HQVA 1QVIZ 1YVHA 1F54A 4I5LB 2JXCA 3NSKA 1ODBA 4NQGA 3QRXA 2K2AA 1Q80A 2JT3A 1YUUA 2F2OA 4P2YB 2EC6B 5AFPA 5DKRA 3O6BA 1NX2A 3TDIA 1R2UA 3VRRA 1IWQA 1QATA 2EGDA 2LLTA 2KI4B 3I5FC 3I5HC 1PVAA 4NDBA 3EKHA 2LNKA 4CFRA 4GGFC 1F70A 1RECA 3KHEA 1DF0B 2CT9A 4A4CA 1CMFA 1EG4A 2F33A 2HF5A 2JT0A 4WQ3A 1K9KA 2ZN9A 1RROA 1GQMA 1NYAA 1YUTA 2O60A 2FCDA 1AJ4A 1G8IA 1W7JB 2LAPA 4USLA 1WDCB 3E3RA 3I5GC 1K9PA 4BY4A 2OTGC 1UHKA 3BUOB 1IQ5A 1L2OC 1J1EA 3PLFB 2QPTA 3JTDC 1ALVA 1TIZA 3DVJA 4JWQA 1DT7B 1CFCA 3VGOA 1YX7A 2AAOA 2JTZA 5HKZA 1CKKA 2KAXA 3TDZA 1IG5A 2K8MB 2GGZA 2WNDA 1EL4A 1RJVA 3I5HB 1KK7Z 1FBVA 1IH0A 2M29A 1SBJA 4I5KA 1F71A 4PE1A 1NCXA 1JBAA 1TNPA 5AEQA 5JJGA 5DKNA 5I8NA 2PASA 1C7WA 2JQ6A 1GJYA 3DVEA 3EVVA 4YGBB 2FJUB 2IS9A 5KU1A 1TN4A 1UP5A 2K7OA 3A4UB 1Y0VH 3FIAA 1CB1A 3BUXB 4AOMA 4PHKA 1DJWA 1UHIA 5DKQA 1S1EA 1AHRA 1UHHA 1MXLC 4OVNF 2I94A 2KBIA 3I5GB 2OTGB 2MHHA 1XFUO 3PSRA 1B8LA 1L2OB 3CGAA 1F55A 3JTDB 1J1DA 2CXJA 2JT8A 4PHJA 3SG3A 1N2DA 1A2XA 1A03A 4ORAB 1KFXL 3MSEB 2KI6C 1NUBA 2L0PA 4C0JA 4HREE 2LUCA 3PM8A 1KWOC 1CM4A 4YGDB 1QIWA 1XFYO 2KFGA 2KSPA 1KSMA 1B1GA 2L5XB 1PSBA 2L4IA 3SIBA 3TDUA 2HQ8A 2K0JA 2M3WA 3NXAA 2WCBA 1X02A 1B7TY 4ZCVA 3SG2A 1SCVA 4XYNA 4C0LA 4AQIA 1HT9A 1SCMB 3EKJA 1KFUS 2JWWA 4MZLA 1RK9A 2JRFA 1BR4B 1QLSA 3GOFA 1YTZC 3NSLA 2MRDA 4WRIA 3D0YB 2EC6C 1B4CA 1FI6A 3M0WA 3CR5X 1A75B 4PALA 5G08A 1CMGA 2LUXA 1N65A 3BOWB 4YGEB 1EXRA 1QJTA 2AUCA 1TOPA 3KF9A 5I2OA 2LHLA 1DJIA 4GNKB 1BJFA 1QS7A 1TCOB 3SG4A 4YBHB 1KWOB 1WLMA 2SCPA 4M2QA 1OMRA 2Y1MA 1CFFA 1CTRA 1G33A 1MUXA 1UHNA 2V53A 4GBAA 1NIWA 3VROA 4QJ4B 1TNWA 2M7LA 1SL8A 1KK8C 2JOJA 1RWYA 4YGCB 1WRLA 3EK4A 5HYDA 1BODA 2F2PA 2DOQA 2PRUA 1K96A 2F3ZA 2KFFA 5CSFA 1OOJA 1XK4A 1MF8B 1WDCC 3BUMB 3CTNA 3OX6A 2LMVA 3CZTX 1DTLA 4ZCUA 2P6BB 1S36A 4OV2A 1LINA 1IJ5A 2BKHB 3D0YA 4YI9A 2JXLA 2ZFDA 4XJKB 3DF0A 1C7VA 1UWOA 2JNFA 2ZKMX 1R6PA 1S6JA 2F3YA 2MAZA 3CLNA 1XFXO 4GPLB 2Y5IA 3PFVA 1J55A 3O4YA 1DJYA 1IJ6A 4PE4A 5HKYA 2MJWB 2NXQA 1V1FA 1AUIB 2ZNEA 1CDPA 1E8AA 2Y4QA 2LC5A 1DGVA 4C0KA 2WOSA 1NPQA 3BUWB 2KOTA 1SYMA 3VRQA 1NX0A 1NSHA 2NZ0A 1KK8B 4QJ5B 1QX2A 2PALA 1G4YR 1AVSA 1H4BA 3SG5A 2M1KB 3C1VA 3AAKA 1BU3A 3SG6A 1AP4A 1OZOA 4PHMA 2KYFA 2LCPA 4P5OE 2ZNDA 1F4QA 3OHMB 1DJGA 5K89A 1PVBA 1JFJA 5AXIA 1M45A 2RGIA 4PCWA 3KPXA 2WORA 1SPYA 1GGZA 3BYAA 1H8BA 1IQ3A 1S6IA 2BE6A 1MR8A 1CDMA 1MXEA 2ISDA 1WLZA 1B8CA 4A4BA 2Q91A 1V1GA 3NSOA 2GV5A 3LK0A 3PATA 5D69A 4ORBB 1XFVO 1S3PA 2VRGA 1CDLA 1NWDA 1TCFA 2M8UA 2E30A 5PALA 3SJSA 1BMOA 2JNXA 5D7FA 4Q04A 1QVIY 2H61C 1IKUA 1DF0A 3ZWHA 1A29A 1J7RA 4N5XA 4DRWA 1M46A 1B7TZ 2M97A 1OZSA 2Y1NA 3F45A 3FWCA 1SCMC 5B8IB 3FS7A 2K61A 2LV7A 2MBXA 5FYXA 4YRUA 1SL9A 1XVJA 2LMTA 1W7IB 2Q4UA 3NSIA 4I5JA 1RTP1 4DUQA 4U8DA 1AJ5A 1XO5A 4I5NB 2K7DA 3EK7A 2JZIA 5ER5A 2L2EA 3I5IC 2BL0C 1FPWA 1TNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMY A;  1WRK A;  1QAS A;  2FCE A;  2BEC A;  1PAL A;  2KAY A;  2KYC A;  1QV0 A;  3OB2 B;  5IBW A;  1SNL A;  1Y1X A;  2BCA A;  3GK2 A;  1ALW A;  2K2F A;  3HX4 A;  1XFZ O;  2M0R A;  2JPT A;  3FWB A;  1Y1U A;  2I2R E;  4QJ3 B;  2BCX A;  2I18 A;  1DJH A;  2HQW A;  4GGF A;  2BE4 A;  2B1U A;  4MSP A;  1D1O A;  1OQP A;  5BPJ A;  3A8R A;  3WNX B;  2KQ6 A;  4JQ0 D;  2LVI A;  1ZUZ A;  1IRJ A;  5CSN A;  1CNP A;  1SRA A;  1LA0 A;  3EVU A;  1JF2 A;  1Y6W A;  3AKA A;  2LVK A;  1YR5 A;  4JPZ B;  1EJ3 A;  1YRU B;  3TZ1 A;  1BG1 A;  4ICB A;  5KSZ A;  2LMU A;  2MLE C;  1PRW A;  3JVT B;  4HRH A;  1YRT B;  4N1G A;  1PK0 D;  1TNQ A;  2LAN A;  1F4O A;  1U5I B;  2MA2 A;  1JFK A;  2WCF A;  3I5I B;  2BL0 B;  1XA5 A;  4OR9 B;  1S6C A;  1LA3 A;  3PAL A;  3WHT B;  3KEV A;  1Y1A A;  2NCO A;  1KFU L;  2MLF C;  1S26 D;  4GGN A;  2ZRT A;  2K7B A;  1S5G Y;  1K94 A;  1MHO A;  1OE9 B;  1K93 D;  1QV1 A;  1TTX A;  1UUS A;  5CSI A;  5J3X A;  1SL7 A;  2KGR A;  2F8P A;  1J7Q A;  1C07 A;  2H61 A;  3BQ3 A;  4UPG A;  1RFJ A;  2CCM A;  2LE9 B;  1PUL A;  3CR2 A;  3CS1 A;  5F6T A;  5ER4 X;  2BBM A;  4MLW A;  5HKW A;  5KTY A;  3VRP A;  1DVI A;  1PSR A;  1CLM A;  4OKH A;  2COL B;  3H4S E;  4GUK A;  1QXP A;  1DGU A;  4MVF A;  3GK4 X;  1BLQ A;  1KQV A;  3O78 A;  4MN0 A;  2JC2 A;  4YGA A;  1BR1 B;  2L50 A;  4MRY A;  2OPO A;  1A75 A;  4CPV A;  4PE7 A;  2KGB C;  2CTN A;  3BOW A;  3DD4 A;  2BBN A;  3CWG A;  5AAN A;  1JC2 A;  1KSO A;  1M31 A;  3LL8 B;  2M9G A;  2LLS A;  1GGW A;  1BT6 A;  2KHN A;  2M49 B;  4HRG A;  3WXA A;  2TN4 A;  4HSZ A;  3SIA A;  4NDD A;  3RM1 A;  1CFP A;  3TS5 C;  2HPS A;  3TUY C;  1F8H A;  3LK1 A;  2M1U A;  3O2P A;  3SG7 A;  2JTT A;  2HET A;  1J7P A;  3IF7 A;  3DVM A;  1K90 D;  1YVL A;  3D10 A;  5CSJ A;  4DCK A;  1WRZ A;  3PN7 C;  1OMV A;  4R1E A;  1MQ1 A;  1JWD A;  1J7O A;  1CFD A;  3VRN A;  1NX1 A;  1YUR A;  1K2H A;  4MBE A;  4MZJ A;  3RLZ A;  4XJK A;  1DJX A;  1B9A A;  2L51 A;  2LM5 A;  4PDZ A;  1SKT A;  2OS8 B;  1K95 A;  4E68 A;  1CDN A;  1JSA A;  1NP8 A;  1OMD A;  4WQ2 A;  1EH2 A;  4M2P A;  2FOT A;  2CNP A;  1K8U A;  4GFT A;  1WY9 A;  2WC8 A;  1NCY A;  3TS5 B;  3TUY B;  1KQM C;  3OB1 B;  1QTX A;  1VRK A;  3AAJ A;  1XFW O;  2KAV A;  1ZFS A;  3JVT C;  1BF5 A;  1L7Z A;  3PN7 B;  3I5F B;  2LP2 A;  4TNC A;  2A4J A;  3GK1 A;  1FI5 A;  1B8R A;  1UUR A;  2JU0 A;  2QAC A;  3K21 A;  1DJZ A;  1QIV A;  2AMI A;  2BKI B;  3ZNI A;  4OCI A;  3DVK A;  4MRX A;  4BY5 A;  5I2Q A;  1FW4 A;  2KBM A;  1N0Y A;  2KDH A;  3AKB A;  1K9U A;  3BUN B;  2G9B A;  2KFH A;  1KFX S;  2H2K A;  4M2O A;  1M63 B;  2LVV A;  1SR6 C;  1S5G Z;  2G2B A;  3EVR A;  3LLE A;  3HCM A;  1XK4 C;  1LKJ A;  2KNE A;  2K7C A;  4DIR A;  1LVC D;  1XYD A;  4DS7 A;  1AK8 A;  1QX5 B;  2M7N A;  4YI8 A;  1MWN A;  2E6W A;  2O5G A;  1TRF A;  2LP3 A;  2I7A A;  1OSA A;  5CPV A;  1KQM B;  1NX3 A;  4L9M A;  5HLO A;  2LVJ A;  4N1F A;  1DMO A;  5JOL A;  3IQO A;  4CFQ A;  2PVB A;  2BCB A;  3LCP C;  1A4P A;  4AQJ A;  1YUS A;  1SW8 A;  4ETO A;  4MZK A;  4IL1 A;  4PE0 A;  1KK7 Y;  5GQQ C;  2WCE A;  2SAS A;  5HLV A;  1M39 A;  2LLU A;  4ORC B;  2PSR A;  3KO0 A;  1JUO A;  3ICB A;  2KI6 D;  2NCP A;  4FQO A;  1SR6 B;  2L98 A;  3WHU B;  4PHN A;  1QX7 A;  1SMG A;  1UHJ A;  2EHB A;  2ZRS A;  2NLN A;  1BOC A;  1YX8 A;  1NCZ A;  1CM1 A;  3BXK A;  4CID A;  3CR4 X;  1IGV A;  3DF0 B;  3OX5 A;  4CLN A;  1FF1 A;  4NDC A;  4F0Z B;  2R2I A;  1ZMZ A;  1ZAC A;  1CLL A;  2KI4 C;  3IQQ A;  1KCY A;  2D8N A;  2L4H A;  2ZN8 A;  2JUL A;  5TNC A;  1LXF C;  1JF0 A;  5I2L A;  1ZOT B;  2KQY A;  1U5I A;  4D1E A;  5AER A;  1CLB A;  2GGM A;  1EG3 A;  4GAO A;  2OS8 C;  3EK8 A;  1B47 A;  2LHI A;  4MEW A;  1SK6 D;  1SY9 A;  1QLK A;  4FTG A;  3OP0 A;  2CBL A;  1HQV A;  1QVI Z;  1YVH A;  1F54 A;  4I5L B;  2JXC A;  3NSK A;  1ODB A;  4NQG A;  3QRX A;  2K2A A;  1Q80 A;  2JT3 A;  1YUU A;  2F2O A;  4P2Y B;  2EC6 B;  5AFP A;  5DKR A;  3O6B A;  1NX2 A;  3TDI A;  1R2U A;  3VRR A;  1IWQ A;  1QAT A;  2EGD A;  2LLT A;  2KI4 B;  3I5F C;  3I5H C;  1PVA A;  4NDB A;  3EKH A;  2LNK A;  4CFR A;  4GGF C;  1F70 A;  1REC A;  3KHE A;  1DF0 B;  2CT9 A;  4A4C A;  1CMF A;  1EG4 A;  2F33 A;  2HF5 A;  2JT0 A;  4WQ3 A;  1K9K A;  2ZN9 A;  1RRO A;  1GQM A;  1NYA A;  1YUT A;  2O60 A;  2FCD A;  1AJ4 A;  1G8I A;  1W7J B;  2LAP A;  4USL A;  1WDC B;  3E3R A;  3I5G C;  1K9P A;  4BY4 A;  2OTG C;  1UHK A;  3BUO B;  1IQ5 A;  1L2O C;  1J1E A;  3PLF B;  2QPT A;  3JTD C;  1ALV A;  1TIZ A;  3DVJ A;  4JWQ A;  1DT7 B;  1CFC A;  3VGO A;  1YX7 A;  2AAO A;  2JTZ A;  5HKZ A;  1CKK A;  2KAX A;  3TDZ A;  1IG5 A;  2K8M B;  2GGZ A;  2WND A;  1EL4 A;  1RJV A;  3I5H B;  1KK7 Z;  1FBV A;  1IH0 A;  2M29 A;  1SBJ A;  4I5K A;  1F71 A;  4PE1 A;  1NCX A;  1JBA A;  1TNP A;  5AEQ A;  5JJG A;  5DKN A;  5I8N A;  2PAS A;  1C7W A;  2JQ6 A;  1GJY A;  3DVE A;  3EVV A;  4YGB B;  2FJU B;  2IS9 A;  5KU1 A;  1TN4 A;  1UP5 A;  2K7O A;  3A4U B;  1Y0V H;  3FIA A;  1CB1 A;  3BUX B;  4AOM A;  4PHK A;  1DJW A;  1UHI A;  5DKQ A;  1S1E A;  1AHR A;  1UHH A;  1MXL C;  4OVN F;  2I94 A;  2KBI A;  3I5G B;  2OTG B;  2MHH A;  1XFU O;  3PSR A;  1B8L A;  1L2O B;  3CGA A;  1F55 A;  3JTD B;  1J1D A;  2CXJ A;  2JT8 A;  4PHJ A;  3SG3 A;  1N2D A;  1A2X A;  1A03 A;  4ORA B;  1KFX L;  3MSE B;  2KI6 C;  1NUB A;  2L0P A;  4C0J A;  4HRE E;  2LUC A;  3PM8 A;  1KWO C;  1CM4 A;  4YGD B;  1QIW A;  1XFY O;  2KFG A;  2KSP A;  1KSM A;  1B1G A;  2L5X B;  1PSB A;  2L4I A;  3SIB A;  3TDU A;  2HQ8 A;  2K0J A;  2M3W A;  3NXA A;  2WCB A;  1X02 A;  1B7T Y;  4ZCV A;  3SG2 A;  1SCV A;  4XYN A;  4C0L A;  4AQI A;  1HT9 A;  1SCM B;  3EKJ A;  1KFU S;  2JWW A;  4MZL A;  1RK9 A;  2JRF A;  1BR4 B;  1QLS A;  3GOF A;  1YTZ C;  3NSL A;  2MRD A;  4WRI A;  3D0Y B;  2EC6 C;  1B4C A;  1FI6 A;  3M0W A;  3CR5 X;  1A75 B;  4PAL A;  5G08 A;  1CMG A;  2LUX A;  1N65 A;  3BOW B;  4YGE B;  1EXR A;  1QJT A;  2AUC A;  1TOP A;  3KF9 A;  5I2O A;  2LHL A;  1DJI A;  4GNK B;  1BJF A;  1QS7 A;  1TCO B;  3SG4 A;  4YBH B;  1KWO B;  1WLM A;  2SCP A;  4M2Q A;  1OMR A;  2Y1M A;  1CFF A;  1CTR A;  1G33 A;  1MUX A;  1UHN A;  2V53 A;  4GBA A;  1NIW A;  3VRO A;  4QJ4 B;  1TNW A;  2M7L A;  1SL8 A;  1KK8 C;  2JOJ A;  1RWY A;  4YGC B;  1WRL A;  3EK4 A;  5HYD A;  1BOD A;  2F2P A;  2DOQ A;  2PRU A;  1K96 A;  2F3Z A;  2KFF A;  5CSF A;  1OOJ A;  1XK4 A;  1MF8 B;  1WDC C;  3BUM B;  3CTN A;  3OX6 A;  2LMV A;  3CZT X;  1DTL A;  4ZCU A;  2P6B B;  1S36 A;  4OV2 A;  1LIN A;  1IJ5 A;  2BKH B;  3D0Y A;  4YI9 A;  2JXL A;  2ZFD A;  4XJK B;  3DF0 A;  1C7V A;  1UWO A;  2JNF A;  2ZKM X;  1R6P A;  1S6J A;  2F3Y A;  2MAZ A;  3CLN A;  1XFX O;  4GPL B;  2Y5I A;  3PFV A;  1J55 A;  3O4Y A;  1DJY A;  1IJ6 A;  4PE4 A;  5HKY A;  2MJW B;  2NXQ A;  1V1F A;  1AUI B;  2ZNE A;  1CDP A;  1E8A A;  2Y4Q A;  2LC5 A;  1DGV A;  4C0K A;  2WOS A;  1NPQ A;  3BUW B;  2KOT A;  1SYM A;  3VRQ A;  1NX0 A;  1NSH A;  2NZ0 A;  1KK8 B;  4QJ5 B;  1QX2 A;  2PAL A;  1G4Y R;  1AVS A;  1H4B A;  3SG5 A;  2M1K B;  3C1V A;  3AAK A;  1BU3 A;  3SG6 A;  1AP4 A;  1OZO A;  4PHM A;  2KYF A;  2LCP A;  4P5O E;  2ZND A;  1F4Q A;  3OHM B;  1DJG A;  5K89 A;  1PVB A;  1JFJ A;  5AXI A;  1M45 A;  2RGI A;  4PCW A;  3KPX A;  2WOR A;  1SPY A;  1GGZ A;  3BYA A;  1H8B A;  1IQ3 A;  1S6I A;  2BE6 A;  1MR8 A;  1CDM A;  1MXE A;  2ISD A;  1WLZ A;  1B8C A;  4A4B A;  2Q91 A;  1V1G A;  3NSO A;  2GV5 A;  3LK0 A;  3PAT A;  5D69 A;  4ORB B;  1XFV O;  1S3P A;  2VRG A;  1CDL A;  1NWD A;  1TCF A;  2M8U A;  2E30 A;  5PAL A;  3SJS A;  1BMO A;  2JNX A;  5D7F A;  4Q04 A;  1QVI Y;  2H61 C;  1IKU A;  1DF0 A;  3ZWH A;  1A29 A;  1J7R A;  4N5X A;  4DRW A;  1M46 A;  1B7T Z;  2M97 A;  1OZS A;  2Y1N A;  3F45 A;  3FWC A;  1SCM C;  5B8I B;  3FS7 A;  2K61 A;  2LV7 A;  2MBX A;  5FYX A;  4YRU A;  1SL9 A;  1XVJ A;  2LMT A;  1W7I B;  2Q4U A;  3NSI A;  4I5J A;  1RTP 1;  4DUQ A;  4U8D A;  1AJ5 A;  1XO5 A;  4I5N B;  2K7D A;  3EK7 A;  2JZI A;  5ER5 A;  2L2E A;  3I5I C;  2BL0 C;  1FPW A;  1TNX A; 
#chains in the Genus database with same CATH topology
 2PMY A;  1WRK A;  1QAS A;  2FCE A;  2BEC A;  1PAL A;  2KAY A;  2KYC A;  1QV0 A;  3BFH A;  3OB2 B;  5IBW A;  2L5Y A;  1SNL A;  1Y1X A;  2BCA A;  3GK2 A;  1ALW A;  2K2F A;  3HX4 A;  1XFZ O;  1GM0 A;  2M0R A;  2JPT A;  3FWB A;  1Y1U A;  2I2R E;  4QJ3 B;  3CYZ A;  2BCX A;  2I18 A;  1DJH A;  2HQW A;  4GGF A;  2BE4 A;  2B1U A;  4FQT A;  4MSP A;  1D1O A;  1OQP A;  5BPJ A;  3A8R A;  3WNX B;  2KQ6 A;  4JQ0 D;  2LVI A;  1ZUZ A;  1IRJ A;  5CSN A;  1CNP A;  1SRA A;  1LA0 A;  3EVU A;  1JF2 A;  1Y6W A;  3AKA A;  2LVK A;  3BFA A;  1YR5 A;  4JPZ B;  1EJ3 A;  3R1P A;  1YRU B;  3TZ1 A;  1BG1 A;  2WC5 A;  4ICB A;  5KSZ A;  2LMU A;  2MLE C;  1PRW A;  3JVT B;  4IJ7 A;  4HRH A;  1QWV A;  1YRT B;  1Z2C B;  4N1G A;  1PK0 D;  1TNQ A;  2LAN A;  1F4O A;  1U5I B;  2KPH A;  1JFK A;  2MA2 A;  2WCF A;  3I5I B;  3FE8 A;  2BL0 B;  1XA5 A;  4OR9 B;  1S6C A;  1LA3 A;  3PAL A;  3WHT B;  3KEV A;  1Y1A A;  2NCO A;  3S0D A;  1KFU L;  2MLF C;  1S26 D;  4GGN A;  2ZRT A;  2K7B A;  1S5G Y;  3O4X A;  1K94 A;  1MHO A;  1OE9 B;  1K93 D;  1QV1 A;  1TTX A;  1UUS A;  1DEK A;  3BFB A;  3DYE A;  1SL7 A;  2KGR A;  5CSI A;  2F8P A;  5J3X A;  1J7Q A;  1C07 A;  1C3Z A;  2H61 A;  3BQ3 A;  3IVT A;  4UPG A;  1RFJ A;  3S0G A;  3D76 A;  2CCM A;  2LE9 B;  1PUL A;  3CR2 A;  4KYN A;  3CS1 A;  5F6T A;  5ER4 X;  2BBM A;  4MLW A;  5HKW A;  1OOF A;  5KTY A;  3VRP A;  1P28 A;  1DVI A;  1PSR A;  1CLM A;  4OKH A;  2COL B;  3H4S E;  4GUK A;  1QXP A;  1DGU A;  4MVF A;  3GK4 X;  1BLQ A;  1KQV A;  3D77 A;  3S0B A;  3O78 A;  1DC1 A;  4MN0 A;  2BAP A;  2JC2 A;  4YGA A;  1BR1 B;  2L50 A;  4MRY A;  2OPO A;  1A75 A;  4CPV A;  4PE7 A;  2KGB C;  2CTN A;  3BOW A;  3DD4 A;  2BBN A;  3CWG A;  5AAN A;  1JC2 A;  1KSO A;  1M31 A;  3LL8 B;  2M9G A;  2LLS A;  1GGW A;  1BT6 A;  2KHN A;  2M49 B;  4HRG A;  3WXA A;  2TN4 A;  3SS3 A;  4HSZ A;  2P71 A;  3SIA A;  4NDD A;  3RM1 A;  1CFP A;  3TS5 C;  2HPS A;  3TUY C;  1F8H A;  3LK1 A;  2M1U A;  3O2P A;  3SG7 A;  2JTT A;  2HET A;  1J7P A;  3IF7 A;  3DVM A;  3K1E A;  1K90 D;  1YVL A;  3D10 A;  5CSJ A;  4DCK A;  1WRZ A;  3PN7 C;  1OMV A;  4INX A;  4R1E A;  1MQ1 A;  2FJY A;  1JWD A;  1J7O A;  1CFD A;  3VRN A;  1NX1 A;  1YUR A;  1K2H A;  4MBE A;  4MZJ A;  3RLZ A;  4XJK A;  1DJX A;  1B9A A;  2QEH A;  2L51 A;  4INW A;  2LM5 A;  3PJI A;  4PDZ A;  5I94 A;  2WCJ A;  1SKT A;  2OS8 B;  1K95 A;  4E68 A;  1CDN A;  1JSA A;  1NP8 A;  1OMD A;  3OBV A;  4WQ2 A;  1EH2 A;  3D75 A;  4M2P A;  2FOT A;  1ORG A;  2CNP A;  1K8U A;  4GFT A;  1WY9 A;  2WC8 A;  1NCY A;  3TS5 B;  3TUY B;  1KQM C;  2WCL A;  1QTX A;  3OB1 B;  3PM2 A;  3CAB A;  1VRK A;  3AAJ A;  1XFW O;  2KAV A;  1ZFS A;  3JVT C;  1BF5 A;  1L7Z A;  3PN7 B;  3DXL A;  3I5F B;  2LP2 A;  4TNC A;  1T14 A;  2A4J A;  3GK1 A;  1FI5 A;  1B8R A;  1UUR A;  2JU0 A;  2QAC A;  3K21 A;  1DJZ A;  1QIV A;  2AMI A;  2BKI B;  2JPO A;  3ZNI A;  4OCI A;  3DVK A;  4MRX A;  4BY5 A;  5I2Q A;  1FW4 A;  2KBM A;  1N0Y A;  3CDN A;  2KDH A;  3AKB A;  1K9U A;  3BUN B;  2G9B A;  2KFH A;  1KFX S;  2H2K A;  4M2O A;  1M63 B;  2LVV A;  1SR6 C;  1S5G Z;  2G2B A;  3EVR A;  3LLE A;  4PT1 A;  1XFR A;  1XK4 C;  1LKJ A;  2KNE A;  2K7C A;  3HCM A;  4DIR A;  1LVC D;  1XYD A;  4DS7 A;  4OZD A;  1AK8 A;  1QX5 B;  2M7N A;  4YI8 A;  1MWN A;  2E6W A;  2O5G A;  1TRF A;  2LP3 A;  2I7A A;  1OSA A;  3NHT A;  1KQM B;  1NX3 A;  4L9M A;  5CPV A;  5HLO A;  2LVJ A;  4N1F A;  1DMO A;  3B87 A;  3IQO A;  5JOL A;  4CFQ A;  2PVB A;  2BCB A;  3LCP C;  1A4P A;  4AQJ A;  2L2C A;  1YUS A;  1SW8 A;  4ETO A;  4MZK A;  4IL1 A;  4PE0 A;  3UO9 A;  1KK7 Y;  5GQQ C;  2WCE A;  2SAS A;  5HLV A;  3B86 A;  1M39 A;  2LLU A;  3OGN A;  4ORC B;  2PSR A;  3KO0 A;  1JUO A;  3ICB A;  2KI6 D;  2NCP A;  4FQO A;  1SR6 B;  2L98 A;  3WHU B;  4PHN A;  1QX7 A;  1SMG A;  1OOH A;  1UHJ A;  2EHB A;  2ZRS A;  2NLN A;  1BOC A;  1YX8 A;  1NCZ A;  1CM1 A;  3BXK A;  4CID A;  3CR4 X;  1IGV A;  3DF0 B;  3OX5 A;  3CZ0 A;  4CLN A;  1FF1 A;  4NDC A;  4F0Z B;  5EL2 A;  2R2I A;  1ZMZ A;  1ZAC A;  1CLL A;  2KI4 C;  3IQQ A;  3RZS A;  2D8N A;  1KCY A;  2L4H A;  2ZN8 A;  2JUL A;  3L4L A;  5TNC A;  1LXF C;  1JF0 A;  3DZT A;  5I2L A;  1ZOT B;  2KQY A;  1U5I A;  4D1E A;  5AER A;  1CLB A;  2GGM A;  1EG3 A;  4GAO A;  2OS8 C;  3EK8 A;  1B47 A;  2LHI A;  4MEW A;  1SK6 D;  1SY9 A;  1QLK A;  4FTG A;  3OP0 A;  2CBL A;  1HQV A;  4F7F A;  1QVI Z;  1YVH A;  1OOI X;  2KLD A;  1F54 A;  4I5L B;  2JXC A;  3NSK A;  1ODB A;  3D78 A;  3QRX A;  4NQG A;  2K2A A;  1Q80 A;  2JT3 A;  1YUU A;  2F2O A;  4P2Y B;  2EC6 B;  3EG5 B;  5AFP A;  5DKR A;  3O6B A;  1NX2 A;  2QDI A;  3TDI A;  1R2U A;  3VRR A;  1IWQ A;  1QAT A;  2EGD A;  2LLT A;  2KI4 B;  3I5F C;  3I5H C;  1PVA A;  4NDB A;  3EKH A;  2LNK A;  4CFR A;  4GGF C;  1F70 A;  1REC A;  3KHE A;  1DF0 B;  2GTE A;  2QEO A;  2CT9 A;  2WC6 A;  3B6X A;  4A4C A;  1CMF A;  1EG4 A;  2F33 A;  1TUJ A;  2HF5 A;  2JT0 A;  4WQ3 A;  1K9K A;  2ZN9 A;  5HL1 A;  1RRO A;  1GQM A;  1NYA A;  1YUT A;  2O60 A;  3NHI A;  2FCD A;  1AJ4 A;  1G8I A;  1W7J B;  2LAP A;  4USL A;  1WDC B;  3E3R A;  3R72 A;  3I5G C;  1K9P A;  4BY4 A;  2OTG C;  3S0A A;  1UHK A;  3BUO B;  1IQ5 A;  1L2O C;  2P70 A;  1J1E A;  3PLF B;  2QPT A;  3JTD C;  1ALV A;  1TIZ A;  3DVJ A;  4JWQ A;  1DT7 B;  1CFC A;  4JKT A;  3VGO A;  1YX7 A;  1SSE B;  2AAO A;  2JTZ A;  5HKZ A;  1CKK A;  2KAX A;  3TDZ A;  1IG5 A;  2K8M B;  2GGZ A;  2WND A;  1EL4 A;  1RJV A;  3I5H B;  1KK7 Z;  3FE9 A;  1FBV A;  3V2L A;  1IH0 A;  2M29 A;  1SBJ A;  4I5K A;  1F71 A;  4PE1 A;  1NCX A;  1JBA A;  1TNP A;  2BNX A;  5AEQ A;  5JJG A;  5DKN A;  3B88 A;  3QME A;  5I8N A;  2PAS A;  1C7W A;  2JQ6 A;  1GJY A;  3DVE A;  3EVV A;  3NGV A;  1TWO A;  4YGB B;  2FJU B;  2IS9 A;  5KU1 A;  1TN4 A;  1UP5 A;  2K7O A;  3A4U B;  1Y0V H;  3FIA A;  1CB1 A;  3BUX B;  4AOM A;  4PHK A;  1DJW A;  1UHI A;  5DKQ A;  1S1E A;  1AHR A;  1UHH A;  1MXL C;  4OVN F;  2I94 A;  2KBI A;  3I5G B;  2OTG B;  2MHH A;  1XFU O;  3PSR A;  1B8L A;  1L2O B;  3CGA A;  1F55 A;  3JTD B;  1J1D A;  2CXJ A;  2JT8 A;  4PHJ A;  3SG3 A;  3BJH A;  1N2D A;  1A2X A;  1A03 A;  4ORA B;  1KFX L;  3MSE B;  2KI6 C;  1NUB A;  2L0P A;  4C0J A;  1OW4 A;  4HRE E;  2LUC A;  3PM8 A;  1KWO C;  1CM4 A;  4YGD B;  3D74 A;  1QIW A;  2WCH A;  1XFY O;  2KFG A;  2WCK A;  2YGU A;  2KSP A;  1KSM A;  1TUZ A;  1B1G A;  2L5X B;  1PSB A;  2L4I A;  3L47 A;  4JD9 A;  3SIB A;  2PQL A;  3TDU A;  2HQ8 A;  1W9Z A;  2H8V A;  2K0J A;  2M3W A;  3NXA A;  2WCB A;  1X02 A;  1B7T Y;  4ZCV A;  3SG2 A;  1SCV A;  4XYN A;  4C0L A;  4AQI A;  1HT9 A;  1SCM B;  3D73 A;  1KFU S;  3EKJ A;  2JWW A;  4MZL A;  1RK9 A;  3S0F A;  2JRF A;  1BR4 B;  3L4A A;  1QLS A;  3GOF A;  1YTZ C;  3NSL A;  2MRD A;  4WRI A;  3D0Y B;  2EC6 C;  1B4C A;  1FI6 A;  3M0W A;  3CR5 X;  1A75 B;  4PAL A;  5G08 A;  1CMG A;  2LUX A;  1N65 A;  3BOW B;  4YGE B;  1EXR A;  1QJT A;  2AUC A;  1TOP A;  3KF9 A;  5I2O A;  2LHL A;  1DJI A;  5FI7 A;  4GNK B;  1BJF A;  1QS7 A;  1TCO B;  3SG4 A;  3VB1 A;  4YBH B;  1KWO B;  1WLM A;  2SCP A;  4M2Q A;  1OMR A;  2Y1M A;  1CFF A;  1CTR A;  1G33 A;  1MUX A;  5DIC A;  1UHN A;  2V53 A;  4GBA A;  1NIW A;  3VRO A;  4QJ4 B;  1TNW A;  3FE6 A;  2M7L A;  3Q8I A;  3DY9 A;  1SL8 A;  1KK8 C;  2JOJ A;  1RWY A;  4YGC B;  1WRL A;  2KLE A;  3EK4 A;  5HYD A;  1BOD A;  2F2P A;  2DOQ A;  2PRU A;  1K96 A;  2ERB A;  2F3Z A;  2KFF A;  5CSF A;  3R1V A;  1OOJ A;  1XK4 A;  1MF8 B;  1WDC C;  3BUM B;  3CTN A;  3OX6 A;  2LMV A;  3CZT X;  1DTL A;  4ZCU A;  2P6B B;  1S36 A;  4OV2 A;  1LIN A;  3R1O A;  1IJ5 A;  2BKH B;  3D0Y A;  5FI6 A;  4YI9 A;  2JXL A;  2ZFD A;  4XJK B;  3DF0 A;  1C7V A;  1UWO A;  2JNF A;  2ZKM X;  1R6P A;  5D3O A;  1S6J A;  2F3Y A;  2MAZ A;  3CLN A;  1XFX O;  4GPL B;  1Z4H A;  2Y5I A;  3PFV A;  3UNW A;  1J55 A;  3O4Y A;  1DJY A;  1IJ6 A;  4PE4 A;  3B7A A;  2MJW B;  5HKY A;  2NXQ A;  1V1F A;  1AUI B;  2ZNE A;  1CDP A;  1E8A A;  2Y4Q A;  2LC5 A;  1DGV A;  4C0K A;  1C3Y A;  2WOS A;  1NPQ A;  3BUW B;  2KOT A;  1SYM A;  3S0E A;  1NX0 A;  3VRQ A;  1NSH A;  1OOG A;  2NZ0 A;  1KK8 B;  4QJ5 B;  1QX2 A;  2PAL A;  2QEB A;  1G4Y R;  5FI2 A;  1AVS A;  1H4B A;  3SG5 A;  2M1K B;  3C1V A;  3AAK A;  1BU3 A;  3SG6 A;  1AP4 A;  1OZO A;  4PHM A;  2KYF A;  2LCP A;  4P5O E;  2ZND A;  1F4Q A;  3OHM B;  1DJG A;  5K89 A;  1PVB A;  1JFJ A;  5AXI A;  1M45 A;  2RGI A;  4PCW A;  3KPX A;  2WOR A;  1SPY A;  1GGZ A;  2WCM A;  3BYA A;  1IQ3 A;  1S6I A;  1H8B A;  2BE6 A;  1MR8 A;  1CDM A;  1MXE A;  2ISD A;  1WLZ A;  1B8C A;  4A4B A;  2Q91 A;  1V1G A;  3NSO A;  2GV5 A;  1LS8 A;  3LK0 A;  3PAT A;  4ORB B;  1XFV O;  5D69 A;  1S3P A;  2VRG A;  1IIO A;  1CDL A;  1NWD A;  1TCF A;  2M8U A;  2E30 A;  2PYQ A;  5PAL A;  3SJS A;  1BMO A;  2JNX A;  5D7F A;  1DEL A;  4Q04 A;  1QVI Y;  2H61 C;  1IKU A;  1DF0 A;  3ZWH A;  1A29 A;  1J7R A;  4N5X A;  4DRW A;  1M46 A;  1B7T Z;  2M97 A;  3SS4 A;  2QEV A;  3CZ2 A;  1OZS A;  2Y1N A;  2K60 A;  3F45 A;  3FWC A;  1SCM C;  5B8I B;  3FS7 A;  2K61 A;  2LV7 A;  2MBX A;  5FYX A;  4YRU A;  1SL9 A;  1XVJ A;  2LMT A;  1W7I B;  2Q4U A;  1DQE A;  3NSI A;  4I5J A;  3N7H A;  1RTP 1;  3CZ1 A;  4DUQ A;  4U8D A;  1AJ5 A;  1XO5 A;  4I5N B;  2K7D A;  3EK7 A;  2JZI A;  3SS5 A;  5ER5 A;  2L2E A;  3I5I C;  2BL0 C;  1FPW A;  1TNX A; 
#chains in the Genus database with same CATH homology
 2PMY A;  1WRK A;  1QAS A;  2FCE A;  2BEC A;  1PAL A;  2KAY A;  2KYC A;  1QV0 A;  3OB2 B;  5IBW A;  1SNL A;  1Y1X A;  2BCA A;  3GK2 A;  1ALW A;  2K2F A;  3HX4 A;  1XFZ O;  2M0R A;  2JPT A;  3FWB A;  1Y1U A;  2I2R E;  4QJ3 B;  2BCX A;  2I18 A;  1DJH A;  2HQW A;  4GGF A;  2BE4 A;  2B1U A;  4MSP A;  1D1O A;  1OQP A;  5BPJ A;  3A8R A;  3WNX B;  2KQ6 A;  4JQ0 D;  2LVI A;  1ZUZ A;  1IRJ A;  5CSN A;  1CNP A;  1SRA A;  1LA0 A;  3EVU A;  1JF2 A;  1Y6W A;  3AKA A;  2LVK A;  1YR5 A;  4JPZ B;  1EJ3 A;  1YRU B;  3TZ1 A;  1BG1 A;  4ICB A;  5KSZ A;  2LMU A;  2MLE C;  1PRW A;  3JVT B;  4HRH A;  1YRT B;  4N1G A;  1PK0 D;  1TNQ A;  2LAN A;  1F4O A;  1U5I B;  2MA2 A;  1JFK A;  2WCF A;  3I5I B;  2BL0 B;  1XA5 A;  4OR9 B;  1S6C A;  1LA3 A;  3PAL A;  3WHT B;  3KEV A;  1Y1A A;  2NCO A;  1KFU L;  2MLF C;  1S26 D;  4GGN A;  2ZRT A;  2K7B A;  1S5G Y;  1K94 A;  1MHO A;  1OE9 B;  1K93 D;  1QV1 A;  1TTX A;  1UUS A;  5CSI A;  5J3X A;  1SL7 A;  2KGR A;  2F8P A;  1J7Q A;  1C07 A;  2H61 A;  3BQ3 A;  4UPG A;  1RFJ A;  2CCM A;  2LE9 B;  1PUL A;  3CR2 A;  3CS1 A;  5F6T A;  5ER4 X;  2BBM A;  4MLW A;  5HKW A;  5KTY A;  3VRP A;  1DVI A;  1PSR A;  1CLM A;  4OKH A;  2COL B;  3H4S E;  4GUK A;  1QXP A;  1DGU A;  4MVF A;  3GK4 X;  1BLQ A;  1KQV A;  3O78 A;  4MN0 A;  2JC2 A;  4YGA A;  1BR1 B;  2L50 A;  4MRY A;  2OPO A;  1A75 A;  4CPV A;  4PE7 A;  2KGB C;  2CTN A;  3BOW A;  3DD4 A;  2BBN A;  3CWG A;  5AAN A;  1JC2 A;  1KSO A;  1M31 A;  3LL8 B;  2M9G A;  2LLS A;  1GGW A;  1BT6 A;  2KHN A;  2M49 B;  4HRG A;  3WXA A;  2TN4 A;  4HSZ A;  3SIA A;  4NDD A;  3RM1 A;  1CFP A;  3TS5 C;  2HPS A;  3TUY C;  1F8H A;  3LK1 A;  2M1U A;  3O2P A;  3SG7 A;  2JTT A;  2HET A;  1J7P A;  3IF7 A;  3DVM A;  1K90 D;  1YVL A;  3D10 A;  5CSJ A;  4DCK A;  1WRZ A;  3PN7 C;  1OMV A;  4R1E A;  1MQ1 A;  1JWD A;  1J7O A;  1CFD A;  3VRN A;  1NX1 A;  1YUR A;  1K2H A;  4MBE A;  4MZJ A;  3RLZ A;  4XJK A;  1DJX A;  1B9A A;  2L51 A;  2LM5 A;  4PDZ A;  1SKT A;  2OS8 B;  1K95 A;  4E68 A;  1CDN A;  1JSA A;  1NP8 A;  1OMD A;  4WQ2 A;  1EH2 A;  4M2P A;  2FOT A;  2CNP A;  1K8U A;  4GFT A;  1WY9 A;  2WC8 A;  1NCY A;  3TS5 B;  3TUY B;  1KQM C;  3OB1 B;  1QTX A;  1VRK A;  3AAJ A;  1XFW O;  2KAV A;  1ZFS A;  3JVT C;  1BF5 A;  1L7Z A;  3PN7 B;  3I5F B;  2LP2 A;  4TNC A;  2A4J A;  3GK1 A;  1FI5 A;  1B8R A;  1UUR A;  2JU0 A;  2QAC A;  3K21 A;  1DJZ A;  1QIV A;  2AMI A;  2BKI B;  3ZNI A;  4OCI A;  3DVK A;  4MRX A;  4BY5 A;  5I2Q A;  1FW4 A;  2KBM A;  1N0Y A;  2KDH A;  3AKB A;  1K9U A;  3BUN B;  2G9B A;  2KFH A;  1KFX S;  2H2K A;  4M2O A;  1M63 B;  2LVV A;  1SR6 C;  1S5G Z;  2G2B A;  3EVR A;  3LLE A;  3HCM A;  1XK4 C;  1LKJ A;  2KNE A;  2K7C A;  4DIR A;  1LVC D;  1XYD A;  4DS7 A;  1AK8 A;  1QX5 B;  2M7N A;  4YI8 A;  1MWN A;  2E6W A;  2O5G A;  1TRF A;  2LP3 A;  2I7A A;  1OSA A;  5CPV A;  1KQM B;  1NX3 A;  4L9M A;  5HLO A;  2LVJ A;  4N1F A;  1DMO A;  5JOL A;  3IQO A;  4CFQ A;  2PVB A;  2BCB A;  3LCP C;  1A4P A;  4AQJ A;  1YUS A;  1SW8 A;  4ETO A;  4MZK A;  4IL1 A;  4PE0 A;  1KK7 Y;  5GQQ C;  2WCE A;  2SAS A;  5HLV A;  1M39 A;  2LLU A;  4ORC B;  2PSR A;  3KO0 A;  1JUO A;  3ICB A;  2KI6 D;  2NCP A;  4FQO A;  1SR6 B;  2L98 A;  3WHU B;  4PHN A;  1QX7 A;  1SMG A;  1UHJ A;  2EHB A;  2ZRS A;  2NLN A;  1BOC A;  1YX8 A;  1NCZ A;  1CM1 A;  3BXK A;  4CID A;  3CR4 X;  1IGV A;  3DF0 B;  3OX5 A;  4CLN A;  1FF1 A;  4NDC A;  4F0Z B;  2R2I A;  1ZMZ A;  1ZAC A;  1CLL A;  2KI4 C;  3IQQ A;  1KCY A;  2D8N A;  2L4H A;  2ZN8 A;  2JUL A;  5TNC A;  1LXF C;  1JF0 A;  5I2L A;  1ZOT B;  2KQY A;  1U5I A;  4D1E A;  5AER A;  1CLB A;  2GGM A;  1EG3 A;  4GAO A;  2OS8 C;  3EK8 A;  1B47 A;  2LHI A;  4MEW A;  1SK6 D;  1SY9 A;  1QLK A;  4FTG A;  3OP0 A;  2CBL A;  1HQV A;  1QVI Z;  1YVH A;  1F54 A;  4I5L B;  2JXC A;  3NSK A;  1ODB A;  4NQG A;  3QRX A;  2K2A A;  1Q80 A;  2JT3 A;  1YUU A;  2F2O A;  4P2Y B;  2EC6 B;  5AFP A;  5DKR A;  3O6B A;  1NX2 A;  3TDI A;  1R2U A;  3VRR A;  1IWQ A;  1QAT A;  2EGD A;  2LLT A;  2KI4 B;  3I5F C;  3I5H C;  1PVA A;  4NDB A;  3EKH A;  2LNK A;  4CFR A;  4GGF C;  1F70 A;  1REC A;  3KHE A;  1DF0 B;  2CT9 A;  4A4C A;  1CMF A;  1EG4 A;  2F33 A;  2HF5 A;  2JT0 A;  4WQ3 A;  1K9K A;  2ZN9 A;  1RRO A;  1GQM A;  1NYA A;  1YUT A;  2O60 A;  2FCD A;  1AJ4 A;  1G8I A;  1W7J B;  2LAP A;  4USL A;  1WDC B;  3E3R A;  3I5G C;  1K9P A;  4BY4 A;  2OTG C;  1UHK A;  3BUO B;  1IQ5 A;  1L2O C;  1J1E A;  3PLF B;  2QPT A;  3JTD C;  1ALV A;  1TIZ A;  3DVJ A;  4JWQ A;  1DT7 B;  1CFC A;  3VGO A;  1YX7 A;  2AAO A;  2JTZ A;  5HKZ A;  1CKK A;  2KAX A;  3TDZ A;  1IG5 A;  2K8M B;  2GGZ A;  2WND A;  1EL4 A;  1RJV A;  3I5H B;  1KK7 Z;  1FBV A;  1IH0 A;  2M29 A;  1SBJ A;  4I5K A;  1F71 A;  4PE1 A;  1NCX A;  1JBA A;  1TNP A;  5AEQ A;  5JJG A;  5DKN A;  5I8N A;  2PAS A;  1C7W A;  2JQ6 A;  1GJY A;  3DVE A;  3EVV A;  4YGB B;  2FJU B;  2IS9 A;  5KU1 A;  1TN4 A;  1UP5 A;  2K7O A;  3A4U B;  1Y0V H;  3FIA A;  1CB1 A;  3BUX B;  4AOM A;  4PHK A;  1DJW A;  1UHI A;  5DKQ A;  1S1E A;  1AHR A;  1UHH A;  1MXL C;  4OVN F;  2I94 A;  2KBI A;  3I5G B;  2OTG B;  2MHH A;  1XFU O;  3PSR A;  1B8L A;  1L2O B;  3CGA A;  1F55 A;  3JTD B;  1J1D A;  2CXJ A;  2JT8 A;  4PHJ A;  3SG3 A;  1N2D A;  1A2X A;  1A03 A;  4ORA B;  1KFX L;  3MSE B;  2KI6 C;  1NUB A;  2L0P A;  4C0J A;  4HRE E;  2LUC A;  3PM8 A;  1KWO C;  1CM4 A;  4YGD B;  1QIW A;  1XFY O;  2KFG A;  2KSP A;  1KSM A;  1B1G A;  2L5X B;  1PSB A;  2L4I A;  3SIB A;  3TDU A;  2HQ8 A;  2K0J A;  2M3W A;  3NXA A;  2WCB A;  1X02 A;  1B7T Y;  4ZCV A;  3SG2 A;  1SCV A;  4XYN A;  4C0L A;  4AQI A;  1HT9 A;  1SCM B;  3EKJ A;  1KFU S;  2JWW A;  4MZL A;  1RK9 A;  2JRF A;  1BR4 B;  1QLS A;  3GOF A;  1YTZ C;  3NSL A;  2MRD A;  4WRI A;  3D0Y B;  2EC6 C;  1B4C A;  1FI6 A;  3M0W A;  3CR5 X;  1A75 B;  4PAL A;  5G08 A;  1CMG A;  2LUX A;  1N65 A;  3BOW B;  4YGE B;  1EXR A;  1QJT A;  2AUC A;  1TOP A;  3KF9 A;  5I2O A;  2LHL A;  1DJI A;  4GNK B;  1BJF A;  1QS7 A;  1TCO B;  3SG4 A;  4YBH B;  1KWO B;  1WLM A;  2SCP A;  4M2Q A;  1OMR A;  2Y1M A;  1CFF A;  1CTR A;  1G33 A;  1MUX A;  1UHN A;  2V53 A;  4GBA A;  1NIW A;  3VRO A;  4QJ4 B;  1TNW A;  2M7L A;  1SL8 A;  1KK8 C;  2JOJ A;  1RWY A;  4YGC B;  1WRL A;  3EK4 A;  5HYD A;  1BOD A;  2F2P A;  2DOQ A;  2PRU A;  1K96 A;  2F3Z A;  2KFF A;  5CSF A;  1OOJ A;  1XK4 A;  1MF8 B;  1WDC C;  3BUM B;  3CTN A;  3OX6 A;  2LMV A;  3CZT X;  1DTL A;  4ZCU A;  2P6B B;  1S36 A;  4OV2 A;  1LIN A;  1IJ5 A;  2BKH B;  3D0Y A;  4YI9 A;  2JXL A;  2ZFD A;  4XJK B;  3DF0 A;  1C7V A;  1UWO A;  2JNF A;  2ZKM X;  1R6P A;  1S6J A;  2F3Y A;  2MAZ A;  3CLN A;  1XFX O;  4GPL B;  2Y5I A;  3PFV A;  1J55 A;  3O4Y A;  1DJY A;  1IJ6 A;  4PE4 A;  5HKY A;  2MJW B;  2NXQ A;  1V1F A;  1AUI B;  2ZNE A;  1CDP A;  1E8A A;  2Y4Q A;  2LC5 A;  1DGV A;  4C0K A;  2WOS A;  1NPQ A;  3BUW B;  2KOT A;  1SYM A;  3VRQ A;  1NX0 A;  1NSH A;  2NZ0 A;  1KK8 B;  4QJ5 B;  1QX2 A;  2PAL A;  1G4Y R;  1AVS A;  1H4B A;  3SG5 A;  2M1K B;  3C1V A;  3AAK A;  1BU3 A;  3SG6 A;  1AP4 A;  1OZO A;  4PHM A;  2KYF A;  2LCP A;  4P5O E;  2ZND A;  1F4Q A;  3OHM B;  1DJG A;  5K89 A;  1PVB A;  1JFJ A;  5AXI A;  1M45 A;  2RGI A;  4PCW A;  3KPX A;  2WOR A;  1SPY A;  1GGZ A;  3BYA A;  1H8B A;  1IQ3 A;  1S6I A;  2BE6 A;  1MR8 A;  1CDM A;  1MXE A;  2ISD A;  1WLZ A;  1B8C A;  4A4B A;  2Q91 A;  1V1G A;  3NSO A;  2GV5 A;  3LK0 A;  3PAT A;  5D69 A;  4ORB B;  1XFV O;  1S3P A;  2VRG A;  1CDL A;  1NWD A;  1TCF A;  2M8U A;  2E30 A;  5PAL A;  3SJS A;  1BMO A;  2JNX A;  5D7F A;  4Q04 A;  1QVI Y;  2H61 C;  1IKU A;  1DF0 A;  3ZWH A;  1A29 A;  1J7R A;  4N5X A;  4DRW A;  1M46 A;  1B7T Z;  2M97 A;  1OZS A;  2Y1N A;  3F45 A;  3FWC A;  1SCM C;  5B8I B;  3FS7 A;  2K61 A;  2LV7 A;  2MBX A;  5FYX A;  4YRU A;  1SL9 A;  1XVJ A;  2LMT A;  1W7I B;  2Q4U A;  3NSI A;  4I5J A;  1RTP 1;  4DUQ A;  4U8D A;  1AJ5 A;  1XO5 A;  4I5N B;  2K7D A;  3EK7 A;  2JZI A;  5ER5 A;  2L2E A;  3I5I C;  2BL0 C;  1FPW A;  1TNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...