3SIBA

Crystal structure of ure3-binding protein, wild-type
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
215
structure length
203
Chain Sequence
ANFCLWNLQPIMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNDRNRSGTLEPHEILPALQQLGFYINQRTSLLLHRLFARGMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-binding protein
rcsb
source organism Entamoeba histolytica
total genus 80
structure length 203
sequence length 215
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sibA00
2SASA 1M63B 4UPGA 2O60A 1XFYO 1E8AA 2LHIA 1WRKA 2JXCA 3D10A 1WDCC 1WRZA 3JTDC 1CB1A 4HSZA 2EC6C 1MQ1A 1CFFA 5HKWA 1SL7A 4DS7A 1ZUZA 1PULA 2ZKMX 2LV7A 3SIAA 5DKNA 1GGWA 1DJZA 2LP3A 4MZKA 1LVCD 3WHUB 1L2OB 1DTLA 2BE4A 3TS5C 5KTYA 2LHLA 3DVEA 3DF0B 3CS1A 1QIVA 1EG3A 2KAVA 4ICBA 1B1GA 2DOQA 1DGUA 2BKHB 2KHNA 2K7CA 2NCPA 1RK9A 1WLMA 4WRIA 1IKUA 3GK4X 1KSOA 1K96A 4GAOA 1SK6D 3TDZA 1AVSA 5CSJA 1DMOA 2MA2A 2JT0A 2JOJA 2I2RE 2LMVA 3BYAA 2LCPA 2WNDA 3MSEB 2F2PA 3OB1B 4HRGA 5I2LA 1C7WA 3NXAA 1IGVA 1TCOB 4CIDA 1LA3A 2IS9A 2L2EA 2M97A 2NCOA 1DJXA 1ALWA 1A2XA 2OS8B 3FWBA 5AFPA 1FPWA 3SG7A 5K89A 1F54A 3VROA 2BCAA 3QRXA 4GFTA 3M0WA 3NSKA 1GQMA 1WLZA 1JSAA 1MHOA 5CSNA 1B8CA 2JC2A 1NX1A 2L50A 3DVMA 1QV0A 1QV1A 1G8IA 1S3PA 2KI4B 1TIZA 1BU3A 3NSOA 1X02A 2HPSA 1BMOA 1M45A 2BBMA 2BKIB 4PE0A 2FOTA 3RM1A 1SR6C 3LL8B 1YRTB 1ZMZA 1A75B 3CWGA 2NZ0A 2M49B 3EVUA 1W7IB 2KBMA 3D0YA 1JF2A 1CDMA 4NDCA 5HLVA 1PK0D 2JT3A 1TN4A 4PCWA 2KQ6A 2Q91A 1NCZA 5AXIA 2GGZA 1K9PA 1QXPA 3I5FC 2F3ZA 1LXFC 3WHTB 4YGBB 1IG5A 4HREE 4DIRA 1DF0B 1SPYA 3FWCA 1CDLA 4M2QA 1NX3A 1KQMC 2M1KB 2O5GA 3WXAA 4AQJA 1SBJA 1SYMA 1XO5A 1TCFA 3NSLA 4YGEB 1ALVA 3A4UB 1TTXA 1KFUL 2LM5A 2ZN9A 2FCDA 2CXJA 4ETOA 4QJ5B 5KSZA 1IH0A 1XK4A 1OZOA 1D1OA 1KCYA 1QS7A 3BQ3A 2ZRSA 1TNQA 1DF0A 1PRWA 4XYNA 1KFXS 2KYCA 3FS7A 3O6BA 2PASA 2M1UA 1BR4B 2BL0C 1FBVA 1MUXA 3I5GB 3IF7A 3E3RA 4GUKA 1B47A 4I5LB 2JNFA 2LVVA 1R6PA 4PALA 2OTGC 4I5JA 1N2DA 2BBNA 3AKBA 1TRFA 3BUWB 3KO0A 1QJTA 1SCMC 4CPVA 4U8DA 2L4IA 2ISDA 5TNCA 3I5HB 4OCIA 1YX7A 1GJYA 4CLNA 1L7ZA 5IBWA 1LINA 2Y5IA 1AUIB 3SG4A 4AQIA 5HYDA 1FW4A 3LK0A 1NWDA 1XFWO 2ZNEA 3H4SE 2F33A 1V1FA 3SG5A 3EK7A 1NUBA 4MZJA 1IRJA 1KK8C 2MHHA 4C0LA 1J7QA 4F0ZB 4CFQA 2KGRA 3AAKA 2H61C 1JFKA 1KK7Y 1YUSA 3IQQA 1QVIY 1CFCA 2A4JA 3SJSA 1Q80A 4PHNA 1F70A 4YGCB 3ZNIA 1EJ3A 1WDCB 3AAJA 3JTDB 4HRHA 1KQVA 2LNKA 1YUTA 2EC6B 1RJVA 4GNKB 4YGAA 1F55A 1XFXO 3KEVA 1IJ6A 2ZNDA 2KOTA 2JZIA 3EVVA 2R2IA 3LK1A 5ER4X 3HX4A 1PVBA 5FYXA 2Q4UA 3CR5X 4ORBB 4ZCUA 1CTRA 1NX0A 3F45A 2LMTA 2L0PA 4C0KA 1CLLA 3TS5B 1H8BA 4MLWA 1RTP1 1JFJA 1DJYA 3VRNA 1BR1B 2RGIA 2MLEC 4AOMA 1YR5A 1NSHA 2LUXA 2Y4QA 4NDDA 1IQ5A 3O2PA 1TNWA 1SRAA 2KQYA 4MBEA 3SG6A 1NYAA 5JOLA 1MR8A 3LCPC 4NDBA 1OMVA 3DF0A 5KU1A 1QLKA 1BOCA 4OKHA 1SW8A 3BUMB 1B9AA 2FCEA 1ODBA 2JNXA 1HQVA 3PN7C 3GK2A 2NLNA 1BJFA 4DCKA 2PRUA 1U5IB 2K7OA 3VRQA 1TOPA 1AK8A 1QX7A 1JF0A 1VRKA 3TDUA 2GV5A 2CT9A 2WCBA 2L4HA 1J55A 2BCBA 2H2KA 4JPZB 1DJHA 2KDHA 2SCPA 1V1GA 1Y6WA 1KFXL 3ZWHA 1XVJA 1SY9A 4MEWA 1M39A 1CDNA 1NCXA 4YBHB 5DKRA 4DRWA 2F3YA 2WC8A 1CMFA 4XJKB 1AP4A 2LE9B 2MLFC 5J3XA 1AHRA 1SL9A 4MRYA 1NP8A 4MZLA 1DT7B 1J1EA 3WNXB 1SR6B 4GGFA 5CPVA 1CMGA 1S36A 1B4CA 1UHIA 1DJIA 1CFPA 1RWYA 1OMRA 2LLSA 3RLZA 1K90D 1M46A 2KBIA 2PVBA 1LA0A 2QPTA 4C0JA 1IJ5A 2LP2A 1DGVA 2KYFA 5ER5A 3TUYC 1FF1A 1M31A 2CBLA 1A75A 2L98A 1CDPA 4MVFA 1DVIA 1KK7Z 1XFVO 1QVIZ 1UHKA 2BCXA 3I5FB 3BOWB 1EH2A 4I5NB 5HLOA 3O78A 1QATA 3OX5A 3KPXA 4A4CA 1CM4A 1KWOC 2QACA 1KQMB 3I5IC 1W7JB 1SMGA 3CR4X 1BODA 2MBXA 2PALA 4PE4A 1B8RA 2KI6D 4P5OE 2EHBA 1OE9B 3BOWA 4MRXA 4A4BA 2WCFA 4FQOA 1MXEA 2TN4A 3VRPA 1ZFSA 3PM8A 3CR2A 3VRRA 2BL0B 5D7FA 2KGBC 2M3WA 2KI6C 2MRDA 2WOSA 1DJGA 1WY9A 2JQ6A 4ORAB 2M0RA 3OB2B 3KHEA 2VRGA 2F8PA 2I7AA 2G2BA 1LKJA 4PHMA 2K0JA 2CNPA 1B7TY 2OTGB 1PSRA 1J1DA 2M7NA 2LMUA 5F6TA 3OX6A 1A03A 1SCMB 2AUCA 1F4OA 1YUUA 1GGZA 2PSRA 3AKAA 4GBAA 4D1EA 1NCYA 2JWWA 4P2YB 3DVJA 4OV2A 4M2PA 1YURA 4PHJA 1J7PA 2G9BA 3OP0A 2LVJA 1XFUO 3GOFA 1KK8B 4WQ3A 4QJ4B 1SL8A 2KAYA 4USLA 4ZCVA 2KNEA 1YX8A 3TZ1A 2Y1NA 3C1VA 4Q04A 2M29A 2E30A 4PE1A 1CKKA 3PSRA 1BG1A 4FTGA 2LC5A 2K2AA 3JVTC 4BY5A 1K9KA 1UURA 4OVNF 1IQ3A 1NPQA 2P6BB 2KFHA 4JQ0D 1H4BA 4YI8A 5G08A 5BPJA 1K2HA 2L5XB 1RFJA 1ZOTB 2K7DA 4GPLB 1S1EA 1SCVA 3GK1A 1KFUS 5I2QA 5JJGA 1BF5A 1MF8B 2HQ8A 2K8MB 2V53A 5HKYA 1BT6A 5I2OA 1JC2A 2ZN8A 3EK8A 1L2OC 2CTNA 3PATA 1G4YR 4ORCB 3ICBA 2NXQA 1S6JA 1QX2A 4OR9B 3TDIA 1SKTA 3PN7B 1B8LA 1K93D 1JWDA 2EGDA 1CFDA 3BUNB 4WQ2A 1PSBA 1BLQA 2WCEA 1WRLA 4YGDB 1N65A 1Y1AA 1CNPA 4NQGA 2KFFA 3EKJA 1NIWA 1A29A 1PALA 1R2UA 1UHHA 1UUSA 3LLEA 4N1FA 1QASA 1OOJA 1U5IA 2LVIA 3NSIA 4JWQA 3SIBA 3CZTX 3OHMB 1CLBA 1N0YA 3PFVA 1PVAA 2LLUA 2KAXA 2OS8C 1B7TZ 4E68A 5D69A 1UHNA 1F71A 1Y0VH 2BE6A 3KF9A 2COLB 1JBAA 1F4QA 2F2OA 1S5GY 4M2OA 2LVKA 4R1EA 3IQOA 4GGFC 4GGNA 4N5XA 4PE7A 4PDZA 4XJKA 3SG3A 1CM1A 1QX5B 2KI4C 1FI6A 5AANA 2WORA 3EK4A 1TNXA 3D0YB 1C7VA 1EL4A 5DKQA 3TUYB 1DJWA 3PLFB 4PHKA 5CSIA 5I8NA 4I5KA 2AAOA 4TNCA 2L51A 1UP5A 3VGOA 3HCMA 1OQPA 1TNPA 2LLTA 2K7BA 1A4PA 1JUOA 1S6IA 3BUOB 3SG2A 1KWOB 1K8UA 1CLMA 2AMIA 1HT9A 2PMYA 1ZACA 2JULA 1SNLA 3I5IB 5GQQC 2M9GA 3O4YA 2JPTA 1J7OA 1XK4C 1XA5A 2D8NA 5AEQA 2JU0A 2JXLA 2KFGA 3EKHA 2GGMA 1OMDA 3BUXB 2K61A 2B1UA 2HF5A 4YI9A 2LAPA 2LUCA 1C07A 1IWQA 2JRFA 1RECA 1J7RA 2JT8A 2Y1MA 2JTZA 3DVKA 1AJ4A 2BECA 1EG4A 1S6CA 2CCMA 2FJUB 2OPOA 1XFZO 2I94A 3EVRA 2M8UA 5CSFA 4YRUA 1K9UA 1QLSA 1XYDA 3DD4A 4DUQA 4IL1A 3I5GC 4N1GA 1KSMA 1MXLC 1YRUB 1G33A 3CLNA 1F8HA 1OZSA 1NX2A 2HQWA 2ZRTA 4BY4A 1QTXA 1Y1UA 2LANA 3CTNA 1QIWA 3FIAA 2K2FA 4MSPA 1UHJA 1YVHA 2ZFDA 2M7LA 4CFRA 1AJ5A 1MWNA 1OSAA 4QJ3B 2I18A 5PALA 2E6WA 1EXRA 1K94A 3I5HC 5HKZA 1Y1XA 1FI5A 1RROA 5AERA 1S26D 2MJWB 4MN0A 2HETA 5B8IB 2JTTA 3K21A 3BXKA 3PALA 3A8RA 1S5GZ 2KSPA 1UWOA 4L9MA 2MAZA 1YTZC 3JVTB 2H61A 1YVLA 3CGAA 1K95A
chains in the Genus database with same CATH superfamily
2SASA 1M63B 4UPGA 2O60A 1XFYO 1E8AA 2LHIA 1WRKA 2JXCA 3D10A 1WDCC 1WRZA 3D78A 3JTDC 1CB1A 4HSZA 2EC6C 1MQ1A 1CFFA 5HKWA 1SL7A 3CYZA 4DS7A 1ZUZA 1PULA 2ZKMX 2LV7A 3SIAA 5DKNA 1GGWA 1DJZA 2LP3A 4MZKA 1LVCD 3WHUB 1L2OB 1DTLA 2BE4A 3TS5C 5KTYA 3N7HA 2LHLA 2PQLA 3DVEA 3PJIA 3DF0B 3CS1A 1QIVA 1EG3A 2KAVA 4ICBA 1B1GA 2DOQA 3O4XA 1DGUA 2BNXA 2BKHB 2KHNA 2K7CA 1OOGA 1RK9A 1WLMA 2NCPA 4WRIA 3S0DA 1IKUA 3GK4X 1KSOA 1K96A 4GAOA 1SK6D 3TDZA 1AVSA 5CSJA 5EL2A 1DMOA 2MA2A 2JT0A 2JOJA 2I2RE 2LMVA 3BYAA 2LCPA 3K1EA 2WNDA 3MSEB 2F2PA 3OB1B 4HRGA 5I2LA 1C7WA 3NXAA 1IGVA 1LS8A 1TCOB 1LA3A 2IS9A 2L2EA 2M97A 2NCOA 1DJXA 1ALWA 1A2XA 2OS8B 3FWBA 4INXA 3SS5A 1FPWA 3SG7A 5K89A 1F54A 3VROA 2BCAA 3QRXA 4GFTA 3M0WA 3NSKA 1GQMA 1WLZA 1JSAA 1MHOA 5CSNA 1B8CA 2JC2A 1NX1A 2ERBA 2L50A 1QV0A 3DVMA 1QV1A 1G8IA 1S3PA 3BFHA 2KI4B 1TIZA 1OOHA 5HL1A 1BU3A 3NSOA 1IIOA 2KLEA 3BFAA 4IJ7A 1X02A 2HPSA 1BMOA 2L5YA 1M45A 2BBMA 2BKIB 4PE0A 2FOTA 3RM1A 1SR6C 3S0EA 3LL8B 1YRTB 1ZMZA 1A75B 3CWGA 2NZ0A 2M49B 3EVUA 1W7IB 2KBMA 3D0YA 1JF2A 1CDMA 4NDCA 5HLVA 1PK0D 3S0GA 3B86A 2JT3A 1TN4A 3OBVA 4PCWA 2KQ6A 2Q91A 1NCZA 5AXIA 2GGZA 1K9PA 1OOFA 1QXPA 3I5FC 2F3ZA 1LXFC 3WHTB 4YGBB 1IG5A 4HREE 4DIRA 1DF0B 1SPYA 3FWCA 1CDLA 4M2QA 1NX3A 1DQEA 1KQMC 2M1KB 2O5GA 3WXAA 4AQJA 1SBJA 1SYMA 1XO5A 1TCFA 3NSLA 1C3YA 4YGEB 1ALVA 3A4UB 1TTXA 1KFUL 2LM5A 2ZN9A 3B7AA 2FCDA 2CXJA 4ETOA 4QJ5B 5KSZA 1IH0A 1XK4A 1OZOA 1D1OA 1KCYA 3DZTA 1QS7A 3BQ3A 2ZRSA 1TNQA 1DF0A 1PRWA 4XYNA 1KFXS 2KYCA 3FS7A 3O6BA 2PASA 2M1UA 1BR4B 2BL0C 1FBVA 1C3ZA 2WC6A 1MUXA 1Z4HA 3I5GB 2BAPA 3IF7A 3E3RA 4GUKA 1B47A 4I5LB 2JNFA 2LVVA 1R6PA 4PALA 2OTGC 4I5JA 1P28A 1N2DA 2WC5A 2BBNA 3AKBA 1TRFA 3BUWB 3KO0A 2QEHA 1QJTA 1SCMC 4CPVA 4U8DA 2L4IA 2ISDA 5TNCA 3I5HB 3DY9A 4OCIA 1YX7A 1GJYA 3CABA 4CLNA 1L7ZA 3CZ2A 5IBWA 1LINA 3SS3A 2Y5IA 1AUIB 3L4LA 3SG4A 4AQIA 5HYDA 1FW4A 3LK0A 1NWDA 1XFWO 1Z2CB 2ZNEA 3H4SE 2F33A 1V1FA 3SG5A 3EK7A 1NUBA 3FE9A 4MZJA 1IRJA 1KK8C 2MHHA 4C0LA 1J7QA 4F0ZB 5FI7A 2KGRA 3AAKA 4CFQA 2H61C 1JFKA 1KK7Y 1YUSA 2FJYA 1QVIY 3IQQA 3Q8IA 1CFCA 2A4JA 3SJSA 1Q80A 4PHNA 1F70A 4YGCB 3RZSA 3ZNIA 1EJ3A 1WDCB 2L2CA 3AAJA 3JTDB 4HRHA 1KQVA 2LNKA 1YUTA 2EC6B 1RJVA 4GNKB 4YGAA 1F55A 1XFXO 3KEVA 1IJ6A 2ZNDA 2KOTA 2JZIA 3EVVA 2R2IA 3LK1A 5ER4X 3HX4A 1PVBA 5FYXA 2Q4UA 3CR5X 4ORBB 4ZCUA 1CTRA 4CIDA 1NX0A 3F45A 5FI2A 2LMTA 2L0PA 3VB1A 1CLLA 3QMEA 3TS5B 4C0KA 4MLWA 1RTP1 1H8BA 3DXLA 1JFJA 1DJYA 3VRNA 1BR1B 2RGIA 2MLEC 4AOMA 1YR5A 3IVTA 1NSHA 2LUXA 2Y4QA 4NDDA 1IQ5A 3O2PA 1TNWA 1SRAA 2KQYA 4MBEA 3SG6A 1NYAA 5JOLA 1MR8A 3LCPC 4NDBA 1OMVA 3DF0A 5KU1A 1QLKA 1BOCA 4OKHA 1SW8A 3BUMB 1B9AA 2FCEA 1ODBA 2JNXA 1HQVA 2KPHA 3PN7C 1ORGA 3GK2A 2NLNA 1BJFA 4DCKA 2PRUA 1U5IB 2K7OA 2QDIA 1TOPA 3D77A 2WCMA 3VRQA 1AK8A 1QX7A 1JF0A 1VRKA 3TDUA 2GV5A 2CT9A 2WCBA 2L4HA 1J55A 2BCBA 2H2KA 4JPZB 1DJHA 2KDHA 2SCPA 1V1GA 1Y6WA 1KFXL 3ZWHA 1XVJA 1SY9A 4MEWA 1M39A 1CDNA 1NCXA 1TUJA 4YBHB 3B6XA 5DKRA 4DRWA 2F3YA 2WC8A 1CMFA 4XJKB 1AP4A 2LE9B 2MLFC 3FE8A 5J3XA 1AHRA 1SL9A 4MRYA 1NP8A 1T14A 4MZLA 1DT7B 1J1EA 3WNXB 1SR6B 4INWA 4GGFA 5CPVA 1CMGA 1S36A 1B4CA 1UHIA 1DJIA 1CFPA 1RWYA 1OMRA 2LLSA 3RLZA 1K90D 1M46A 2GTEA 2KBIA 1LA0A 2PVBA 2QPTA 1IJ5A 1QWVA 1DGVA 2LP2A 2KYFA 5ER5A 4C0JA 3TUYC 1M31A 1FF1A 2CBLA 1A75A 2L98A 2WCKA 1CDPA 4MVFA 1DVIA 1KK7Z 1DELA 1QVIZ 1UHKA 1XFVO 2BCXA 3I5FB 2QEVA 3BOWB 3OGNA 3R1VA 3BFBA 1EH2A 4I5NB 5HLOA 3O78A 1QATA 3OX5A 3KPXA 4A4CA 1CM4A 1KWOC 2QACA 1KQMB 3NGVA 3I5IC 1W7JB 1DC1A 1SMGA 1SSEB 3CR4X 1BODA 3S0FA 2MBXA 2PALA 4PE4A 1B8RA 2KI6D 3DYEA 4P5OE 2EHBA 1OE9B 3BOWA 4MRXA 3UNWA 4A4BA 2WCFA 4FQOA 3V2LA 1MXEA 2TN4A 3VRPA 3S0AA 1ZFSA 3PM8A 3CR2A 3VRRA 2BL0B 2P71A 3CZ1A 5D7FA 2KGBC 2M3WA 2KI6C 2MRDA 2QEOA 2WOSA 1DJGA 1WY9A 2JQ6A 4ORAB 2M0RA 3OB2B 3KHEA 2VRGA 3R1OA 2F8PA 2I7AA 2KLDA 2G2BA 1LKJA 4PHMA 3NHTA 3D76A 2K0JA 4JKTA 2CNPA 1B7TY 2OTGB 1PSRA 1J1DA 2M7NA 2LMUA 5F6TA 3OX6A 1A03A 1SCMB 2AUCA 3UO9A 1F4OA 1YUUA 1GGZA 2PSRA 3AKAA 4GBAA 4JD9A 1NCYA 5FI6A 2JWWA 4D1EA 4P2YB 3DVJA 4OV2A 2P70A 4M2PA 1YURA 4PHJA 1J7PA 2G9BA 3OP0A 2LVJA 2PYQA 1XFUO 3GOFA 1KK8B 4WQ3A 1OOIX 4QJ4B 1SL8A 2KAYA 4USLA 4ZCVA 2KNEA 3D75A 1YX8A 4F7FA 4KYNA 3CDNA 3TZ1A 2Y1NA 3C1VA 4Q04A 2M29A 5AFPA 2E30A 4PE1A 1CKKA 3PSRA 1BG1A 4FTGA 2LC5A 2K2AA 3JVTC 4BY5A 3L4AA 1K9KA 1UURA 4OVNF 2JPOA 1NPQA 2P6BB 2KFHA 4JQ0D 1IQ3A 4YI8A 5G08A 1H4BA 5BPJA 1K2HA 2L5XB 1RFJA 1ZOTB 2K7DA 3B87A 4GPLB 1S1EA 1SCVA 3GK1A 1KFUS 5I2QA 5JJGA 1BF5A 1MF8B 2HQ8A 1OW4A 2K8MB 2V53A 5HKYA 1BT6A 3SS4A 5I2OA 1JC2A 2ZN8A 3EK8A 1L2OC 2CTNA 3PATA 1G4YR 2QEBA 4ORCB 3ICBA 2NXQA 1S6JA 1QX2A 4OR9B 3TDIA 1SKTA 3PN7B 1B8LA 1K93D 1JWDA 2EGDA 1CFDA 3BUNB 4WQ2A 1PSBA 5I94A 1BLQA 2WCEA 3PM2A 1WRLA 4YGDB 1N65A 1Y1AA 3B88A 1CNPA 4NQGA 2KFFA 3EKJA 1NIWA 1A29A 1PALA 1R2UA 1UHHA 1UUSA 3LLEA 4N1FA 1QASA 1OOJA 1U5IA 2LVIA 3NSIA 4JWQA 3SIBA 3CZTX 3OHMB 1CLBA 1GM0A 1N0YA 3PFVA 1PVAA 3BJHA 2LLUA 2KAXA 2OS8C 1B7TZ 4E68A 5D69A 1TWOA 1UHNA 2WCJA 1F71A 1Y0VH 2BE6A 3KF9A 2COLB 1JBAA 1F4QA 2F2OA 1S5GY 4FQTA 4M2OA 2LVKA 4R1EA 3IQOA 4GGFC 4GGNA 3NHIA 5D3OA 2WCHA 4N5XA 4PE7A 4PDZA 4XJKA 3R72A 1CM1A 1QX5B 2KI4C 3SG3A 1FI6A 5AANA 2WORA 3EK4A 1TNXA 3D0YB 1C7VA 1EL4A 5DKQA 3S0BA 3TUYB 1DJWA 3PLFB 4PHKA 5CSIA 5I8NA 4I5KA 2AAOA 2YGUA 4TNCA 2L51A 1UP5A 3VGOA 3HCMA 1OQPA 3D74A 1TNPA 2LLTA 2K7BA 3FE6A 1A4PA 3L47A 1JUOA 1S6IA 3BUOB 2K60A 3SG2A 1KWOB 1K8UA 1CLMA 2AMIA 1HT9A 2PMYA 1ZACA 2JULA 1SNLA 2H8VA 3I5IB 5GQQC 2M9GA 3R1PA 1TUZA 3O4YA 2JPTA 1J7OA 1XK4C 1XA5A 2D8NA 5AEQA 1DEKA 2JU0A 2JXLA 2KFGA 3EKHA 2GGMA 1OMDA 3BUXB 1XFRA 2K61A 1W9ZA 2B1UA 2HF5A 4YI9A 2LAPA 2LUCA 1C07A 1IWQA 3EG5B 2JRFA 1RECA 1J7RA 2JT8A 2Y1MA 2JTZA 3DVKA 1AJ4A 2BECA 1EG4A 1S6CA 2CCMA 2FJUB 2OPOA 1XFZO 2I94A 3EVRA 2M8UA 5CSFA 4YRUA 1K9UA 1QLSA 1XYDA 3DD4A 4DUQA 4IL1A 3I5GC 4N1GA 1KSMA 1MXLC 1YRUB 5DICA 1G33A 3CLNA 3CZ0A 1F8HA 1OZSA 1NX2A 2HQWA 2ZRTA 4BY4A 1QTXA 1Y1UA 2LANA 3CTNA 1QIWA 3FIAA 4OZDA 2K2FA 4MSPA 1UHJA 1YVHA 2ZFDA 2M7LA 4CFRA 1AJ5A 1MWNA 1OSAA 4QJ3B 2I18A 5PALA 2WCLA 2E6WA 1EXRA 1K94A 3I5HC 5HKZA 1Y1XA 1FI5A 1RROA 5AERA 1S26D 2MJWB 4MN0A 2HETA 3D73A 2JTTA 3K21A 5B8IB 3BXKA 3PALA 3A8RA 1S5GZ 2KSPA 1UWOA 4PT1A 4L9MA 2MAZA 1YTZC 3JVTB 2H61A 1YVLA 3CGAA 1K95A
chains in the Genus database with same CATH topology
2SASA 1M63B 4UPGA 2O60A 1XFYO 1E8AA 2LHIA 1WRKA 2JXCA 3D10A 1WDCC 1WRZA 3JTDC 1CB1A 4HSZA 2EC6C 1MQ1A 1CFFA 5HKWA 1SL7A 4DS7A 1ZUZA 1PULA 2ZKMX 2LV7A 3SIAA 5DKNA 1GGWA 1DJZA 2LP3A 4MZKA 1LVCD 3WHUB 1L2OB 1DTLA 2BE4A 3TS5C 5KTYA 2LHLA 3DVEA 3DF0B 3CS1A 1QIVA 1EG3A 2KAVA 4ICBA 1B1GA 2DOQA 1DGUA 2BKHB 2KHNA 2K7CA 2NCPA 1RK9A 1WLMA 4WRIA 1IKUA 3GK4X 1KSOA 1K96A 4GAOA 1SK6D 3TDZA 1AVSA 5CSJA 1DMOA 2MA2A 2JT0A 2JOJA 2I2RE 2LMVA 3BYAA 2LCPA 2WNDA 3MSEB 2F2PA 3OB1B 4HRGA 5I2LA 1C7WA 3NXAA 1IGVA 1TCOB 4CIDA 1LA3A 2IS9A 2L2EA 2M97A 2NCOA 1DJXA 1ALWA 1A2XA 2OS8B 3FWBA 5AFPA 1FPWA 3SG7A 5K89A 1F54A 3VROA 2BCAA 3QRXA 4GFTA 3M0WA 3NSKA 1GQMA 1WLZA 1JSAA 1MHOA 5CSNA 1B8CA 2JC2A 1NX1A 2L50A 3DVMA 1QV0A 1QV1A 1G8IA 1S3PA 2KI4B 1TIZA 1BU3A 3NSOA 1X02A 2HPSA 1BMOA 1M45A 2BBMA 2BKIB 4PE0A 2FOTA 3RM1A 1SR6C 3LL8B 1YRTB 1ZMZA 1A75B 3CWGA 2NZ0A 2M49B 3EVUA 1W7IB 2KBMA 3D0YA 1JF2A 1CDMA 4NDCA 5HLVA 1PK0D 2JT3A 1TN4A 4PCWA 2KQ6A 2Q91A 1NCZA 5AXIA 2GGZA 1K9PA 1QXPA 3I5FC 2F3ZA 1LXFC 3WHTB 4YGBB 1IG5A 4HREE 4DIRA 1DF0B 1SPYA 3FWCA 1CDLA 4M2QA 1NX3A 1KQMC 2M1KB 2O5GA 3WXAA 4AQJA 1SBJA 1SYMA 1XO5A 1TCFA 3NSLA 4YGEB 1ALVA 3A4UB 1TTXA 1KFUL 2LM5A 2ZN9A 2FCDA 2CXJA 4ETOA 4QJ5B 5KSZA 1IH0A 1XK4A 1OZOA 1D1OA 1KCYA 1QS7A 3BQ3A 2ZRSA 1TNQA 1DF0A 1PRWA 4XYNA 1KFXS 2KYCA 3FS7A 3O6BA 2PASA 2M1UA 1BR4B 2BL0C 1FBVA 1MUXA 3I5GB 3IF7A 3E3RA 4GUKA 1B47A 4I5LB 2JNFA 2LVVA 1R6PA 4PALA 2OTGC 4I5JA 1N2DA 2BBNA 3AKBA 1TRFA 3BUWB 3KO0A 1QJTA 1SCMC 4CPVA 4U8DA 2L4IA 2ISDA 5TNCA 3I5HB 4OCIA 1YX7A 1GJYA 4CLNA 1L7ZA 5IBWA 1LINA 2Y5IA 1AUIB 3SG4A 4AQIA 5HYDA 1FW4A 3LK0A 1NWDA 1XFWO 2ZNEA 3H4SE 2F33A 1V1FA 3SG5A 3EK7A 1NUBA 4MZJA 1IRJA 1KK8C 2MHHA 4C0LA 1J7QA 4F0ZB 4CFQA 2KGRA 3AAKA 2H61C 1JFKA 1KK7Y 1YUSA 3IQQA 1QVIY 1CFCA 2A4JA 3SJSA 1Q80A 4PHNA 1F70A 4YGCB 3ZNIA 1EJ3A 1WDCB 3AAJA 3JTDB 4HRHA 1KQVA 2LNKA 1YUTA 2EC6B 1RJVA 4GNKB 4YGAA 1F55A 1XFXO 3KEVA 1IJ6A 2ZNDA 2KOTA 2JZIA 3EVVA 2R2IA 3LK1A 5ER4X 3HX4A 1PVBA 5FYXA 2Q4UA 3CR5X 4ORBB 4ZCUA 1CTRA 1NX0A 3F45A 2LMTA 2L0PA 4C0KA 1CLLA 3TS5B 1H8BA 4MLWA 1RTP1 1JFJA 1DJYA 3VRNA 1BR1B 2RGIA 2MLEC 4AOMA 1YR5A 1NSHA 2LUXA 2Y4QA 4NDDA 1IQ5A 3O2PA 1TNWA 1SRAA 2KQYA 4MBEA 3SG6A 1NYAA 5JOLA 1MR8A 3LCPC 4NDBA 1OMVA 3DF0A 5KU1A 1QLKA 1BOCA 4OKHA 1SW8A 3BUMB 1B9AA 2FCEA 1ODBA 2JNXA 1HQVA 3PN7C 3GK2A 2NLNA 1BJFA 4DCKA 2PRUA 1U5IB 2K7OA 3VRQA 1TOPA 1AK8A 1QX7A 1JF0A 1VRKA 3TDUA 2GV5A 2CT9A 2WCBA 2L4HA 1J55A 2BCBA 2H2KA 4JPZB 1DJHA 2KDHA 2SCPA 1V1GA 1Y6WA 1KFXL 3ZWHA 1XVJA 1SY9A 4MEWA 1M39A 1CDNA 1NCXA 4YBHB 5DKRA 4DRWA 2F3YA 2WC8A 1CMFA 4XJKB 1AP4A 2LE9B 2MLFC 5J3XA 1AHRA 1SL9A 4MRYA 1NP8A 4MZLA 1DT7B 1J1EA 3WNXB 1SR6B 4GGFA 5CPVA 1CMGA 1S36A 1B4CA 1UHIA 1DJIA 1CFPA 1RWYA 1OMRA 2LLSA 3RLZA 1K90D 1M46A 2KBIA 2PVBA 1LA0A 2QPTA 4C0JA 1IJ5A 2LP2A 1DGVA 2KYFA 5ER5A 3TUYC 1FF1A 1M31A 2CBLA 1A75A 2L98A 1CDPA 4MVFA 1DVIA 1KK7Z 1XFVO 1QVIZ 1UHKA 2BCXA 3I5FB 3BOWB 1EH2A 4I5NB 5HLOA 3O78A 1QATA 3OX5A 3KPXA 4A4CA 1CM4A 1KWOC 2QACA 1KQMB 3I5IC 1W7JB 1SMGA 3CR4X 1BODA 2MBXA 2PALA 4PE4A 1B8RA 2KI6D 4P5OE 2EHBA 1OE9B 3BOWA 4MRXA 4A4BA 2WCFA 4FQOA 1MXEA 2TN4A 3VRPA 1ZFSA 3PM8A 3CR2A 3VRRA 2BL0B 5D7FA 2KGBC 2M3WA 2KI6C 2MRDA 2WOSA 1DJGA 1WY9A 2JQ6A 4ORAB 2M0RA 3OB2B 3KHEA 2VRGA 2F8PA 2I7AA 2G2BA 1LKJA 4PHMA 2K0JA 2CNPA 1B7TY 2OTGB 1PSRA 1J1DA 2M7NA 2LMUA 5F6TA 3OX6A 1A03A 1SCMB 2AUCA 1F4OA 1YUUA 1GGZA 2PSRA 3AKAA 4GBAA 4D1EA 1NCYA 2JWWA 4P2YB 3DVJA 4OV2A 4M2PA 1YURA 4PHJA 1J7PA 2G9BA 3OP0A 2LVJA 1XFUO 3GOFA 1KK8B 4WQ3A 4QJ4B 1SL8A 2KAYA 4USLA 4ZCVA 2KNEA 1YX8A 3TZ1A 2Y1NA 3C1VA 4Q04A 2M29A 2E30A 4PE1A 1CKKA 3PSRA 1BG1A 4FTGA 2LC5A 2K2AA 3JVTC 4BY5A 1K9KA 1UURA 4OVNF 1IQ3A 1NPQA 2P6BB 2KFHA 4JQ0D 1H4BA 4YI8A 5G08A 5BPJA 1K2HA 2L5XB 1RFJA 1ZOTB 2K7DA 4GPLB 1S1EA 1SCVA 3GK1A 1KFUS 5I2QA 5JJGA 1BF5A 1MF8B 2HQ8A 2K8MB 2V53A 5HKYA 1BT6A 5I2OA 1JC2A 2ZN8A 3EK8A 1L2OC 2CTNA 3PATA 1G4YR 4ORCB 3ICBA 2NXQA 1S6JA 1QX2A 4OR9B 3TDIA 1SKTA 3PN7B 1B8LA 1K93D 1JWDA 2EGDA 1CFDA 3BUNB 4WQ2A 1PSBA 1BLQA 2WCEA 1WRLA 4YGDB 1N65A 1Y1AA 1CNPA 4NQGA 2KFFA 3EKJA 1NIWA 1A29A 1PALA 1R2UA 1UHHA 1UUSA 3LLEA 4N1FA 1QASA 1OOJA 1U5IA 2LVIA 3NSIA 4JWQA 3SIBA 3CZTX 3OHMB 1CLBA 1N0YA 3PFVA 1PVAA 2LLUA 2KAXA 2OS8C 1B7TZ 4E68A 5D69A 1UHNA 1F71A 1Y0VH 2BE6A 3KF9A 2COLB 1JBAA 1F4QA 2F2OA 1S5GY 4M2OA 2LVKA 4R1EA 3IQOA 4GGFC 4GGNA 4N5XA 4PE7A 4PDZA 4XJKA 3SG3A 1CM1A 1QX5B 2KI4C 1FI6A 5AANA 2WORA 3EK4A 1TNXA 3D0YB 1C7VA 1EL4A 5DKQA 3TUYB 1DJWA 3PLFB 4PHKA 5CSIA 5I8NA 4I5KA 2AAOA 4TNCA 2L51A 1UP5A 3VGOA 3HCMA 1OQPA 1TNPA 2LLTA 2K7BA 1A4PA 1JUOA 1S6IA 3BUOB 3SG2A 1KWOB 1K8UA 1CLMA 2AMIA 1HT9A 2PMYA 1ZACA 2JULA 1SNLA 3I5IB 5GQQC 2M9GA 3O4YA 2JPTA 1J7OA 1XK4C 1XA5A 2D8NA 5AEQA 2JU0A 2JXLA 2KFGA 3EKHA 2GGMA 1OMDA 3BUXB 2K61A 2B1UA 2HF5A 4YI9A 2LAPA 2LUCA 1C07A 1IWQA 2JRFA 1RECA 1J7RA 2JT8A 2Y1MA 2JTZA 3DVKA 1AJ4A 2BECA 1EG4A 1S6CA 2CCMA 2FJUB 2OPOA 1XFZO 2I94A 3EVRA 2M8UA 5CSFA 4YRUA 1K9UA 1QLSA 1XYDA 3DD4A 4DUQA 4IL1A 3I5GC 4N1GA 1KSMA 1MXLC 1YRUB 1G33A 3CLNA 1F8HA 1OZSA 1NX2A 2HQWA 2ZRTA 4BY4A 1QTXA 1Y1UA 2LANA 3CTNA 1QIWA 3FIAA 2K2FA 4MSPA 1UHJA 1YVHA 2ZFDA 2M7LA 4CFRA 1AJ5A 1MWNA 1OSAA 4QJ3B 2I18A 5PALA 2E6WA 1EXRA 1K94A 3I5HC 5HKZA 1Y1XA 1FI5A 1RROA 5AERA 1S26D 2MJWB 4MN0A 2HETA 5B8IB 2JTTA 3K21A 3BXKA 3PALA 3A8RA 1S5GZ 2KSPA 1UWOA 4L9MA 2MAZA 1YTZC 3JVTB 2H61A 1YVLA 3CGAA 1K95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SAS A;  1M63 B;  4UPG A;  2O60 A;  1XFY O;  1E8A A;  2LHI A;  1WRK A;  2JXC A;  3D10 A;  1WDC C;  1WRZ A;  3JTD C;  1CB1 A;  4HSZ A;  2EC6 C;  1MQ1 A;  1CFF A;  5HKW A;  1SL7 A;  4DS7 A;  1ZUZ A;  1PUL A;  2ZKM X;  2LV7 A;  3SIA A;  5DKN A;  1GGW A;  1DJZ A;  2LP3 A;  4MZK A;  1LVC D;  3WHU B;  1L2O B;  1DTL A;  2BE4 A;  3TS5 C;  5KTY A;  2LHL A;  3DVE A;  3DF0 B;  3CS1 A;  1QIV A;  1EG3 A;  2KAV A;  4ICB A;  1B1G A;  2DOQ A;  1DGU A;  2BKH B;  2KHN A;  2K7C A;  2NCP A;  1RK9 A;  1WLM A;  4WRI A;  1IKU A;  3GK4 X;  1KSO A;  1K96 A;  4GAO A;  1SK6 D;  3TDZ A;  1AVS A;  5CSJ A;  1DMO A;  2MA2 A;  2JT0 A;  2JOJ A;  2I2R E;  2LMV A;  3BYA A;  2LCP A;  2WND A;  3MSE B;  2F2P A;  3OB1 B;  4HRG A;  5I2L A;  1C7W A;  3NXA A;  1IGV A;  1TCO B;  4CID A;  1LA3 A;  2IS9 A;  2L2E A;  2M97 A;  2NCO A;  1DJX A;  1ALW A;  1A2X A;  2OS8 B;  3FWB A;  5AFP A;  1FPW A;  3SG7 A;  5K89 A;  1F54 A;  3VRO A;  2BCA A;  3QRX A;  4GFT A;  3M0W A;  3NSK A;  1GQM A;  1WLZ A;  1JSA A;  1MHO A;  5CSN A;  1B8C A;  2JC2 A;  1NX1 A;  2L50 A;  3DVM A;  1QV0 A;  1QV1 A;  1G8I A;  1S3P A;  2KI4 B;  1TIZ A;  1BU3 A;  3NSO A;  1X02 A;  2HPS A;  1BMO A;  1M45 A;  2BBM A;  2BKI B;  4PE0 A;  2FOT A;  3RM1 A;  1SR6 C;  3LL8 B;  1YRT B;  1ZMZ A;  1A75 B;  3CWG A;  2NZ0 A;  2M49 B;  3EVU A;  1W7I B;  2KBM A;  3D0Y A;  1JF2 A;  1CDM A;  4NDC A;  5HLV A;  1PK0 D;  2JT3 A;  1TN4 A;  4PCW A;  2KQ6 A;  2Q91 A;  1NCZ A;  5AXI A;  2GGZ A;  1K9P A;  1QXP A;  3I5F C;  2F3Z A;  1LXF C;  3WHT B;  4YGB B;  1IG5 A;  4HRE E;  4DIR A;  1DF0 B;  1SPY A;  3FWC A;  1CDL A;  4M2Q A;  1NX3 A;  1KQM C;  2M1K B;  2O5G A;  3WXA A;  4AQJ A;  1SBJ A;  1SYM A;  1XO5 A;  1TCF A;  3NSL A;  4YGE B;  1ALV A;  3A4U B;  1TTX A;  1KFU L;  2LM5 A;  2ZN9 A;  2FCD A;  2CXJ A;  4ETO A;  4QJ5 B;  5KSZ A;  1IH0 A;  1XK4 A;  1OZO A;  1D1O A;  1KCY A;  1QS7 A;  3BQ3 A;  2ZRS A;  1TNQ A;  1DF0 A;  1PRW A;  4XYN A;  1KFX S;  2KYC A;  3FS7 A;  3O6B A;  2PAS A;  2M1U A;  1BR4 B;  2BL0 C;  1FBV A;  1MUX A;  3I5G B;  3IF7 A;  3E3R A;  4GUK A;  1B47 A;  4I5L B;  2JNF A;  2LVV A;  1R6P A;  4PAL A;  2OTG C;  4I5J A;  1N2D A;  2BBN A;  3AKB A;  1TRF A;  3BUW B;  3KO0 A;  1QJT A;  1SCM C;  4CPV A;  4U8D A;  2L4I A;  2ISD A;  5TNC A;  3I5H B;  4OCI A;  1YX7 A;  1GJY A;  4CLN A;  1L7Z A;  5IBW A;  1LIN A;  2Y5I A;  1AUI B;  3SG4 A;  4AQI A;  5HYD A;  1FW4 A;  3LK0 A;  1NWD A;  1XFW O;  2ZNE A;  3H4S E;  2F33 A;  1V1F A;  3SG5 A;  3EK7 A;  1NUB A;  4MZJ A;  1IRJ A;  1KK8 C;  2MHH A;  4C0L A;  1J7Q A;  4F0Z B;  4CFQ A;  2KGR A;  3AAK A;  2H61 C;  1JFK A;  1KK7 Y;  1YUS A;  3IQQ A;  1QVI Y;  1CFC A;  2A4J A;  3SJS A;  1Q80 A;  4PHN A;  1F70 A;  4YGC B;  3ZNI A;  1EJ3 A;  1WDC B;  3AAJ A;  3JTD B;  4HRH A;  1KQV A;  2LNK A;  1YUT A;  2EC6 B;  1RJV A;  4GNK B;  4YGA A;  1F55 A;  1XFX O;  3KEV A;  1IJ6 A;  2ZND A;  2KOT A;  2JZI A;  3EVV A;  2R2I A;  3LK1 A;  5ER4 X;  3HX4 A;  1PVB A;  5FYX A;  2Q4U A;  3CR5 X;  4ORB B;  4ZCU A;  1CTR A;  1NX0 A;  3F45 A;  2LMT A;  2L0P A;  4C0K A;  1CLL A;  3TS5 B;  1H8B A;  4MLW A;  1RTP 1;  1JFJ A;  1DJY A;  3VRN A;  1BR1 B;  2RGI A;  2MLE C;  4AOM A;  1YR5 A;  1NSH A;  2LUX A;  2Y4Q A;  4NDD A;  1IQ5 A;  3O2P A;  1TNW A;  1SRA A;  2KQY A;  4MBE A;  3SG6 A;  1NYA A;  5JOL A;  1MR8 A;  3LCP C;  4NDB A;  1OMV A;  3DF0 A;  5KU1 A;  1QLK A;  1BOC A;  4OKH A;  1SW8 A;  3BUM B;  1B9A A;  2FCE A;  1ODB A;  2JNX A;  1HQV A;  3PN7 C;  3GK2 A;  2NLN A;  1BJF A;  4DCK A;  2PRU A;  1U5I B;  2K7O A;  3VRQ A;  1TOP A;  1AK8 A;  1QX7 A;  1JF0 A;  1VRK A;  3TDU A;  2GV5 A;  2CT9 A;  2WCB A;  2L4H A;  1J55 A;  2BCB A;  2H2K A;  4JPZ B;  1DJH A;  2KDH A;  2SCP A;  1V1G A;  1Y6W A;  1KFX L;  3ZWH A;  1XVJ A;  1SY9 A;  4MEW A;  1M39 A;  1CDN A;  1NCX A;  4YBH B;  5DKR A;  4DRW A;  2F3Y A;  2WC8 A;  1CMF A;  4XJK B;  1AP4 A;  2LE9 B;  2MLF C;  5J3X A;  1AHR A;  1SL9 A;  4MRY A;  1NP8 A;  4MZL A;  1DT7 B;  1J1E A;  3WNX B;  1SR6 B;  4GGF A;  5CPV A;  1CMG A;  1S36 A;  1B4C A;  1UHI A;  1DJI A;  1CFP A;  1RWY A;  1OMR A;  2LLS A;  3RLZ A;  1K90 D;  1M46 A;  2KBI A;  2PVB A;  1LA0 A;  2QPT A;  4C0J A;  1IJ5 A;  2LP2 A;  1DGV A;  2KYF A;  5ER5 A;  3TUY C;  1FF1 A;  1M31 A;  2CBL A;  1A75 A;  2L98 A;  1CDP A;  4MVF A;  1DVI A;  1KK7 Z;  1XFV O;  1QVI Z;  1UHK A;  2BCX A;  3I5F B;  3BOW B;  1EH2 A;  4I5N B;  5HLO A;  3O78 A;  1QAT A;  3OX5 A;  3KPX A;  4A4C A;  1CM4 A;  1KWO C;  2QAC A;  1KQM B;  3I5I C;  1W7J B;  1SMG A;  3CR4 X;  1BOD A;  2MBX A;  2PAL A;  4PE4 A;  1B8R A;  2KI6 D;  4P5O E;  2EHB A;  1OE9 B;  3BOW A;  4MRX A;  4A4B A;  2WCF A;  4FQO A;  1MXE A;  2TN4 A;  3VRP A;  1ZFS A;  3PM8 A;  3CR2 A;  3VRR A;  2BL0 B;  5D7F A;  2KGB C;  2M3W A;  2KI6 C;  2MRD A;  2WOS A;  1DJG A;  1WY9 A;  2JQ6 A;  4ORA B;  2M0R A;  3OB2 B;  3KHE A;  2VRG A;  2F8P A;  2I7A A;  2G2B A;  1LKJ A;  4PHM A;  2K0J A;  2CNP A;  1B7T Y;  2OTG B;  1PSR A;  1J1D A;  2M7N A;  2LMU A;  5F6T A;  3OX6 A;  1A03 A;  1SCM B;  2AUC A;  1F4O A;  1YUU A;  1GGZ A;  2PSR A;  3AKA A;  4GBA A;  4D1E A;  1NCY A;  2JWW A;  4P2Y B;  3DVJ A;  4OV2 A;  4M2P A;  1YUR A;  4PHJ A;  1J7P A;  2G9B A;  3OP0 A;  2LVJ A;  1XFU O;  3GOF A;  1KK8 B;  4WQ3 A;  4QJ4 B;  1SL8 A;  2KAY A;  4USL A;  4ZCV A;  2KNE A;  1YX8 A;  3TZ1 A;  2Y1N A;  3C1V A;  4Q04 A;  2M29 A;  2E30 A;  4PE1 A;  1CKK A;  3PSR A;  1BG1 A;  4FTG A;  2LC5 A;  2K2A A;  3JVT C;  4BY5 A;  1K9K A;  1UUR A;  4OVN F;  1IQ3 A;  1NPQ A;  2P6B B;  2KFH A;  4JQ0 D;  1H4B A;  4YI8 A;  5G08 A;  5BPJ A;  1K2H A;  2L5X B;  1RFJ A;  1ZOT B;  2K7D A;  4GPL B;  1S1E A;  1SCV A;  3GK1 A;  1KFU S;  5I2Q A;  5JJG A;  1BF5 A;  1MF8 B;  2HQ8 A;  2K8M B;  2V53 A;  5HKY A;  1BT6 A;  5I2O A;  1JC2 A;  2ZN8 A;  3EK8 A;  1L2O C;  2CTN A;  3PAT A;  1G4Y R;  4ORC B;  3ICB A;  2NXQ A;  1S6J A;  1QX2 A;  4OR9 B;  3TDI A;  1SKT A;  3PN7 B;  1B8L A;  1K93 D;  1JWD A;  2EGD A;  1CFD A;  3BUN B;  4WQ2 A;  1PSB A;  1BLQ A;  2WCE A;  1WRL A;  4YGD B;  1N65 A;  1Y1A A;  1CNP A;  4NQG A;  2KFF A;  3EKJ A;  1NIW A;  1A29 A;  1PAL A;  1R2U A;  1UHH A;  1UUS A;  3LLE A;  4N1F A;  1QAS A;  1OOJ A;  1U5I A;  2LVI A;  3NSI A;  4JWQ A;  3SIB A;  3CZT X;  3OHM B;  1CLB A;  1N0Y A;  3PFV A;  1PVA A;  2LLU A;  2KAX A;  2OS8 C;  1B7T Z;  4E68 A;  5D69 A;  1UHN A;  1F71 A;  1Y0V H;  2BE6 A;  3KF9 A;  2COL B;  1JBA A;  1F4Q A;  2F2O A;  1S5G Y;  4M2O A;  2LVK A;  4R1E A;  3IQO A;  4GGF C;  4GGN A;  4N5X A;  4PE7 A;  4PDZ A;  4XJK A;  3SG3 A;  1CM1 A;  1QX5 B;  2KI4 C;  1FI6 A;  5AAN A;  2WOR A;  3EK4 A;  1TNX A;  3D0Y B;  1C7V A;  1EL4 A;  5DKQ A;  3TUY B;  1DJW A;  3PLF B;  4PHK A;  5CSI A;  5I8N A;  4I5K A;  2AAO A;  4TNC A;  2L51 A;  1UP5 A;  3VGO A;  3HCM A;  1OQP A;  1TNP A;  2LLT A;  2K7B A;  1A4P A;  1JUO A;  1S6I A;  3BUO B;  3SG2 A;  1KWO B;  1K8U A;  1CLM A;  2AMI A;  1HT9 A;  2PMY A;  1ZAC A;  2JUL A;  1SNL A;  3I5I B;  5GQQ C;  2M9G A;  3O4Y A;  2JPT A;  1J7O A;  1XK4 C;  1XA5 A;  2D8N A;  5AEQ A;  2JU0 A;  2JXL A;  2KFG A;  3EKH A;  2GGM A;  1OMD A;  3BUX B;  2K61 A;  2B1U A;  2HF5 A;  4YI9 A;  2LAP A;  2LUC A;  1C07 A;  1IWQ A;  2JRF A;  1REC A;  1J7R A;  2JT8 A;  2Y1M A;  2JTZ A;  3DVK A;  1AJ4 A;  2BEC A;  1EG4 A;  1S6C A;  2CCM A;  2FJU B;  2OPO A;  1XFZ O;  2I94 A;  3EVR A;  2M8U A;  5CSF A;  4YRU A;  1K9U A;  1QLS A;  1XYD A;  3DD4 A;  4DUQ A;  4IL1 A;  3I5G C;  4N1G A;  1KSM A;  1MXL C;  1YRU B;  1G33 A;  3CLN A;  1F8H A;  1OZS A;  1NX2 A;  2HQW A;  2ZRT A;  4BY4 A;  1QTX A;  1Y1U A;  2LAN A;  3CTN A;  1QIW A;  3FIA A;  2K2F A;  4MSP A;  1UHJ A;  1YVH A;  2ZFD A;  2M7L A;  4CFR A;  1AJ5 A;  1MWN A;  1OSA A;  4QJ3 B;  2I18 A;  5PAL A;  2E6W A;  1EXR A;  1K94 A;  3I5H C;  5HKZ A;  1Y1X A;  1FI5 A;  1RRO A;  5AER A;  1S26 D;  2MJW B;  4MN0 A;  2HET A;  5B8I B;  2JTT A;  3K21 A;  3BXK A;  3PAL A;  3A8R A;  1S5G Z;  2KSP A;  1UWO A;  4L9M A;  2MAZ A;  1YTZ C;  3JVT B;  2H61 A;  1YVL A;  3CGA A;  1K95 A; 
#chains in the Genus database with same CATH topology
 2SAS A;  1M63 B;  4UPG A;  2O60 A;  1XFY O;  1E8A A;  2LHI A;  1WRK A;  2JXC A;  3D10 A;  1WDC C;  1WRZ A;  3D78 A;  3JTD C;  1CB1 A;  4HSZ A;  2EC6 C;  1MQ1 A;  1CFF A;  5HKW A;  1SL7 A;  3CYZ A;  4DS7 A;  1ZUZ A;  1PUL A;  2ZKM X;  2LV7 A;  3SIA A;  5DKN A;  1GGW A;  1DJZ A;  2LP3 A;  4MZK A;  1LVC D;  3WHU B;  1L2O B;  1DTL A;  2BE4 A;  3TS5 C;  5KTY A;  3N7H A;  2LHL A;  2PQL A;  3DVE A;  3PJI A;  3DF0 B;  3CS1 A;  1QIV A;  1EG3 A;  2KAV A;  4ICB A;  1B1G A;  2DOQ A;  3O4X A;  1DGU A;  2BNX A;  2BKH B;  2KHN A;  2K7C A;  1OOG A;  1RK9 A;  1WLM A;  2NCP A;  4WRI A;  3S0D A;  1IKU A;  3GK4 X;  1KSO A;  1K96 A;  4GAO A;  1SK6 D;  3TDZ A;  1AVS A;  5CSJ A;  5EL2 A;  1DMO A;  2MA2 A;  2JT0 A;  2JOJ A;  2I2R E;  2LMV A;  3BYA A;  2LCP A;  3K1E A;  2WND A;  3MSE B;  2F2P A;  3OB1 B;  4HRG A;  5I2L A;  1C7W A;  3NXA A;  1IGV A;  1LS8 A;  1TCO B;  1LA3 A;  2IS9 A;  2L2E A;  2M97 A;  2NCO A;  1DJX A;  1ALW A;  1A2X A;  2OS8 B;  3FWB A;  4INX A;  3SS5 A;  1FPW A;  3SG7 A;  5K89 A;  1F54 A;  3VRO A;  2BCA A;  3QRX A;  4GFT A;  3M0W A;  3NSK A;  1GQM A;  1WLZ A;  1JSA A;  1MHO A;  5CSN A;  1B8C A;  2JC2 A;  1NX1 A;  2ERB A;  2L50 A;  1QV0 A;  3DVM A;  1QV1 A;  1G8I A;  1S3P A;  3BFH A;  2KI4 B;  1TIZ A;  1OOH A;  5HL1 A;  1BU3 A;  3NSO A;  1IIO A;  2KLE A;  3BFA A;  4IJ7 A;  1X02 A;  2HPS A;  1BMO A;  2L5Y A;  1M45 A;  2BBM A;  2BKI B;  4PE0 A;  2FOT A;  3RM1 A;  1SR6 C;  3S0E A;  3LL8 B;  1YRT B;  1ZMZ A;  1A75 B;  3CWG A;  2NZ0 A;  2M49 B;  3EVU A;  1W7I B;  2KBM A;  3D0Y A;  1JF2 A;  1CDM A;  4NDC A;  5HLV A;  1PK0 D;  3S0G A;  3B86 A;  2JT3 A;  1TN4 A;  3OBV A;  4PCW A;  2KQ6 A;  2Q91 A;  1NCZ A;  5AXI A;  2GGZ A;  1K9P A;  1OOF A;  1QXP A;  3I5F C;  2F3Z A;  1LXF C;  3WHT B;  4YGB B;  1IG5 A;  4HRE E;  4DIR A;  1DF0 B;  1SPY A;  3FWC A;  1CDL A;  4M2Q A;  1NX3 A;  1DQE A;  1KQM C;  2M1K B;  2O5G A;  3WXA A;  4AQJ A;  1SBJ A;  1SYM A;  1XO5 A;  1TCF A;  3NSL A;  1C3Y A;  4YGE B;  1ALV A;  3A4U B;  1TTX A;  1KFU L;  2LM5 A;  2ZN9 A;  3B7A A;  2FCD A;  2CXJ A;  4ETO A;  4QJ5 B;  5KSZ A;  1IH0 A;  1XK4 A;  1OZO A;  1D1O A;  1KCY A;  3DZT A;  1QS7 A;  3BQ3 A;  2ZRS A;  1TNQ A;  1DF0 A;  1PRW A;  4XYN A;  1KFX S;  2KYC A;  3FS7 A;  3O6B A;  2PAS A;  2M1U A;  1BR4 B;  2BL0 C;  1FBV A;  1C3Z A;  2WC6 A;  1MUX A;  1Z4H A;  3I5G B;  2BAP A;  3IF7 A;  3E3R A;  4GUK A;  1B47 A;  4I5L B;  2JNF A;  2LVV A;  1R6P A;  4PAL A;  2OTG C;  4I5J A;  1P28 A;  1N2D A;  2WC5 A;  2BBN A;  3AKB A;  1TRF A;  3BUW B;  3KO0 A;  2QEH A;  1QJT A;  1SCM C;  4CPV A;  4U8D A;  2L4I A;  2ISD A;  5TNC A;  3I5H B;  3DY9 A;  4OCI A;  1YX7 A;  1GJY A;  3CAB A;  4CLN A;  1L7Z A;  3CZ2 A;  5IBW A;  1LIN A;  3SS3 A;  2Y5I A;  1AUI B;  3L4L A;  3SG4 A;  4AQI A;  5HYD A;  1FW4 A;  3LK0 A;  1NWD A;  1XFW O;  1Z2C B;  2ZNE A;  3H4S E;  2F33 A;  1V1F A;  3SG5 A;  3EK7 A;  1NUB A;  3FE9 A;  4MZJ A;  1IRJ A;  1KK8 C;  2MHH A;  4C0L A;  1J7Q A;  4F0Z B;  5FI7 A;  2KGR A;  3AAK A;  4CFQ A;  2H61 C;  1JFK A;  1KK7 Y;  1YUS A;  2FJY A;  1QVI Y;  3IQQ A;  3Q8I A;  1CFC A;  2A4J A;  3SJS A;  1Q80 A;  4PHN A;  1F70 A;  4YGC B;  3RZS A;  3ZNI A;  1EJ3 A;  1WDC B;  2L2C A;  3AAJ A;  3JTD B;  4HRH A;  1KQV A;  2LNK A;  1YUT A;  2EC6 B;  1RJV A;  4GNK B;  4YGA A;  1F55 A;  1XFX O;  3KEV A;  1IJ6 A;  2ZND A;  2KOT A;  2JZI A;  3EVV A;  2R2I A;  3LK1 A;  5ER4 X;  3HX4 A;  1PVB A;  5FYX A;  2Q4U A;  3CR5 X;  4ORB B;  4ZCU A;  1CTR A;  4CID A;  1NX0 A;  3F45 A;  5FI2 A;  2LMT A;  2L0P A;  3VB1 A;  1CLL A;  3QME A;  3TS5 B;  4C0K A;  4MLW A;  1RTP 1;  1H8B A;  3DXL A;  1JFJ A;  1DJY A;  3VRN A;  1BR1 B;  2RGI A;  2MLE C;  4AOM A;  1YR5 A;  3IVT A;  1NSH A;  2LUX A;  2Y4Q A;  4NDD A;  1IQ5 A;  3O2P A;  1TNW A;  1SRA A;  2KQY A;  4MBE A;  3SG6 A;  1NYA A;  5JOL A;  1MR8 A;  3LCP C;  4NDB A;  1OMV A;  3DF0 A;  5KU1 A;  1QLK A;  1BOC A;  4OKH A;  1SW8 A;  3BUM B;  1B9A A;  2FCE A;  1ODB A;  2JNX A;  1HQV A;  2KPH A;  3PN7 C;  1ORG A;  3GK2 A;  2NLN A;  1BJF A;  4DCK A;  2PRU A;  1U5I B;  2K7O A;  2QDI A;  1TOP A;  3D77 A;  2WCM A;  3VRQ A;  1AK8 A;  1QX7 A;  1JF0 A;  1VRK A;  3TDU A;  2GV5 A;  2CT9 A;  2WCB A;  2L4H A;  1J55 A;  2BCB A;  2H2K A;  4JPZ B;  1DJH A;  2KDH A;  2SCP A;  1V1G A;  1Y6W A;  1KFX L;  3ZWH A;  1XVJ A;  1SY9 A;  4MEW A;  1M39 A;  1CDN A;  1NCX A;  1TUJ A;  4YBH B;  3B6X A;  5DKR A;  4DRW A;  2F3Y A;  2WC8 A;  1CMF A;  4XJK B;  1AP4 A;  2LE9 B;  2MLF C;  3FE8 A;  5J3X A;  1AHR A;  1SL9 A;  4MRY A;  1NP8 A;  1T14 A;  4MZL A;  1DT7 B;  1J1E A;  3WNX B;  1SR6 B;  4INW A;  4GGF A;  5CPV A;  1CMG A;  1S36 A;  1B4C A;  1UHI A;  1DJI A;  1CFP A;  1RWY A;  1OMR A;  2LLS A;  3RLZ A;  1K90 D;  1M46 A;  2GTE A;  2KBI A;  1LA0 A;  2PVB A;  2QPT A;  1IJ5 A;  1QWV A;  1DGV A;  2LP2 A;  2KYF A;  5ER5 A;  4C0J A;  3TUY C;  1M31 A;  1FF1 A;  2CBL A;  1A75 A;  2L98 A;  2WCK A;  1CDP A;  4MVF A;  1DVI A;  1KK7 Z;  1DEL A;  1QVI Z;  1UHK A;  1XFV O;  2BCX A;  3I5F B;  2QEV A;  3BOW B;  3OGN A;  3R1V A;  3BFB A;  1EH2 A;  4I5N B;  5HLO A;  3O78 A;  1QAT A;  3OX5 A;  3KPX A;  4A4C A;  1CM4 A;  1KWO C;  2QAC A;  1KQM B;  3NGV A;  3I5I C;  1W7J B;  1DC1 A;  1SMG A;  1SSE B;  3CR4 X;  1BOD A;  3S0F A;  2MBX A;  2PAL A;  4PE4 A;  1B8R A;  2KI6 D;  3DYE A;  4P5O E;  2EHB A;  1OE9 B;  3BOW A;  4MRX A;  3UNW A;  4A4B A;  2WCF A;  4FQO A;  3V2L A;  1MXE A;  2TN4 A;  3VRP A;  3S0A A;  1ZFS A;  3PM8 A;  3CR2 A;  3VRR A;  2BL0 B;  2P71 A;  3CZ1 A;  5D7F A;  2KGB C;  2M3W A;  2KI6 C;  2MRD A;  2QEO A;  2WOS A;  1DJG A;  1WY9 A;  2JQ6 A;  4ORA B;  2M0R A;  3OB2 B;  3KHE A;  2VRG A;  3R1O A;  2F8P A;  2I7A A;  2KLD A;  2G2B A;  1LKJ A;  4PHM A;  3NHT A;  3D76 A;  2K0J A;  4JKT A;  2CNP A;  1B7T Y;  2OTG B;  1PSR A;  1J1D A;  2M7N A;  2LMU A;  5F6T A;  3OX6 A;  1A03 A;  1SCM B;  2AUC A;  3UO9 A;  1F4O A;  1YUU A;  1GGZ A;  2PSR A;  3AKA A;  4GBA A;  4JD9 A;  1NCY A;  5FI6 A;  2JWW A;  4D1E A;  4P2Y B;  3DVJ A;  4OV2 A;  2P70 A;  4M2P A;  1YUR A;  4PHJ A;  1J7P A;  2G9B A;  3OP0 A;  2LVJ A;  2PYQ A;  1XFU O;  3GOF A;  1KK8 B;  4WQ3 A;  1OOI X;  4QJ4 B;  1SL8 A;  2KAY A;  4USL A;  4ZCV A;  2KNE A;  3D75 A;  1YX8 A;  4F7F A;  4KYN A;  3CDN A;  3TZ1 A;  2Y1N A;  3C1V A;  4Q04 A;  2M29 A;  5AFP A;  2E30 A;  4PE1 A;  1CKK A;  3PSR A;  1BG1 A;  4FTG A;  2LC5 A;  2K2A A;  3JVT C;  4BY5 A;  3L4A A;  1K9K A;  1UUR A;  4OVN F;  2JPO A;  1NPQ A;  2P6B B;  2KFH A;  4JQ0 D;  1IQ3 A;  4YI8 A;  5G08 A;  1H4B A;  5BPJ A;  1K2H A;  2L5X B;  1RFJ A;  1ZOT B;  2K7D A;  3B87 A;  4GPL B;  1S1E A;  1SCV A;  3GK1 A;  1KFU S;  5I2Q A;  5JJG A;  1BF5 A;  1MF8 B;  2HQ8 A;  1OW4 A;  2K8M B;  2V53 A;  5HKY A;  1BT6 A;  3SS4 A;  5I2O A;  1JC2 A;  2ZN8 A;  3EK8 A;  1L2O C;  2CTN A;  3PAT A;  1G4Y R;  2QEB A;  4ORC B;  3ICB A;  2NXQ A;  1S6J A;  1QX2 A;  4OR9 B;  3TDI A;  1SKT A;  3PN7 B;  1B8L A;  1K93 D;  1JWD A;  2EGD A;  1CFD A;  3BUN B;  4WQ2 A;  1PSB A;  5I94 A;  1BLQ A;  2WCE A;  3PM2 A;  1WRL A;  4YGD B;  1N65 A;  1Y1A A;  3B88 A;  1CNP A;  4NQG A;  2KFF A;  3EKJ A;  1NIW A;  1A29 A;  1PAL A;  1R2U A;  1UHH A;  1UUS A;  3LLE A;  4N1F A;  1QAS A;  1OOJ A;  1U5I A;  2LVI A;  3NSI A;  4JWQ A;  3SIB A;  3CZT X;  3OHM B;  1CLB A;  1GM0 A;  1N0Y A;  3PFV A;  1PVA A;  3BJH A;  2LLU A;  2KAX A;  2OS8 C;  1B7T Z;  4E68 A;  5D69 A;  1TWO A;  1UHN A;  2WCJ A;  1F71 A;  1Y0V H;  2BE6 A;  3KF9 A;  2COL B;  1JBA A;  1F4Q A;  2F2O A;  1S5G Y;  4FQT A;  4M2O A;  2LVK A;  4R1E A;  3IQO A;  4GGF C;  4GGN A;  3NHI A;  5D3O A;  2WCH A;  4N5X A;  4PE7 A;  4PDZ A;  4XJK A;  3R72 A;  1CM1 A;  1QX5 B;  2KI4 C;  3SG3 A;  1FI6 A;  5AAN A;  2WOR A;  3EK4 A;  1TNX A;  3D0Y B;  1C7V A;  1EL4 A;  5DKQ A;  3S0B A;  3TUY B;  1DJW A;  3PLF B;  4PHK A;  5CSI A;  5I8N A;  4I5K A;  2AAO A;  2YGU A;  4TNC A;  2L51 A;  1UP5 A;  3VGO A;  3HCM A;  1OQP A;  3D74 A;  1TNP A;  2LLT A;  2K7B A;  3FE6 A;  1A4P A;  3L47 A;  1JUO A;  1S6I A;  3BUO B;  2K60 A;  3SG2 A;  1KWO B;  1K8U A;  1CLM A;  2AMI A;  1HT9 A;  2PMY A;  1ZAC A;  2JUL A;  1SNL A;  2H8V A;  3I5I B;  5GQQ C;  2M9G A;  3R1P A;  1TUZ A;  3O4Y A;  2JPT A;  1J7O A;  1XK4 C;  1XA5 A;  2D8N A;  5AEQ A;  1DEK A;  2JU0 A;  2JXL A;  2KFG A;  3EKH A;  2GGM A;  1OMD A;  3BUX B;  1XFR A;  2K61 A;  1W9Z A;  2B1U A;  2HF5 A;  4YI9 A;  2LAP A;  2LUC A;  1C07 A;  1IWQ A;  3EG5 B;  2JRF A;  1REC A;  1J7R A;  2JT8 A;  2Y1M A;  2JTZ A;  3DVK A;  1AJ4 A;  2BEC A;  1EG4 A;  1S6C A;  2CCM A;  2FJU B;  2OPO A;  1XFZ O;  2I94 A;  3EVR A;  2M8U A;  5CSF A;  4YRU A;  1K9U A;  1QLS A;  1XYD A;  3DD4 A;  4DUQ A;  4IL1 A;  3I5G C;  4N1G A;  1KSM A;  1MXL C;  1YRU B;  5DIC A;  1G33 A;  3CLN A;  3CZ0 A;  1F8H A;  1OZS A;  1NX2 A;  2HQW A;  2ZRT A;  4BY4 A;  1QTX A;  1Y1U A;  2LAN A;  3CTN A;  1QIW A;  3FIA A;  4OZD A;  2K2F A;  4MSP A;  1UHJ A;  1YVH A;  2ZFD A;  2M7L A;  4CFR A;  1AJ5 A;  1MWN A;  1OSA A;  4QJ3 B;  2I18 A;  5PAL A;  2WCL A;  2E6W A;  1EXR A;  1K94 A;  3I5H C;  5HKZ A;  1Y1X A;  1FI5 A;  1RRO A;  5AER A;  1S26 D;  2MJW B;  4MN0 A;  2HET A;  3D73 A;  2JTT A;  3K21 A;  5B8I B;  3BXK A;  3PAL A;  3A8R A;  1S5G Z;  2KSP A;  1UWO A;  4PT1 A;  4L9M A;  2MAZ A;  1YTZ C;  3JVT B;  2H61 A;  1YVL A;  3CGA A;  1K95 A; 
#chains in the Genus database with same CATH homology
 2SAS A;  1M63 B;  4UPG A;  2O60 A;  1XFY O;  1E8A A;  2LHI A;  1WRK A;  2JXC A;  3D10 A;  1WDC C;  1WRZ A;  3JTD C;  1CB1 A;  4HSZ A;  2EC6 C;  1MQ1 A;  1CFF A;  5HKW A;  1SL7 A;  4DS7 A;  1ZUZ A;  1PUL A;  2ZKM X;  2LV7 A;  3SIA A;  5DKN A;  1GGW A;  1DJZ A;  2LP3 A;  4MZK A;  1LVC D;  3WHU B;  1L2O B;  1DTL A;  2BE4 A;  3TS5 C;  5KTY A;  2LHL A;  3DVE A;  3DF0 B;  3CS1 A;  1QIV A;  1EG3 A;  2KAV A;  4ICB A;  1B1G A;  2DOQ A;  1DGU A;  2BKH B;  2KHN A;  2K7C A;  2NCP A;  1RK9 A;  1WLM A;  4WRI A;  1IKU A;  3GK4 X;  1KSO A;  1K96 A;  4GAO A;  1SK6 D;  3TDZ A;  1AVS A;  5CSJ A;  1DMO A;  2MA2 A;  2JT0 A;  2JOJ A;  2I2R E;  2LMV A;  3BYA A;  2LCP A;  2WND A;  3MSE B;  2F2P A;  3OB1 B;  4HRG A;  5I2L A;  1C7W A;  3NXA A;  1IGV A;  1TCO B;  4CID A;  1LA3 A;  2IS9 A;  2L2E A;  2M97 A;  2NCO A;  1DJX A;  1ALW A;  1A2X A;  2OS8 B;  3FWB A;  5AFP A;  1FPW A;  3SG7 A;  5K89 A;  1F54 A;  3VRO A;  2BCA A;  3QRX A;  4GFT A;  3M0W A;  3NSK A;  1GQM A;  1WLZ A;  1JSA A;  1MHO A;  5CSN A;  1B8C A;  2JC2 A;  1NX1 A;  2L50 A;  3DVM A;  1QV0 A;  1QV1 A;  1G8I A;  1S3P A;  2KI4 B;  1TIZ A;  1BU3 A;  3NSO A;  1X02 A;  2HPS A;  1BMO A;  1M45 A;  2BBM A;  2BKI B;  4PE0 A;  2FOT A;  3RM1 A;  1SR6 C;  3LL8 B;  1YRT B;  1ZMZ A;  1A75 B;  3CWG A;  2NZ0 A;  2M49 B;  3EVU A;  1W7I B;  2KBM A;  3D0Y A;  1JF2 A;  1CDM A;  4NDC A;  5HLV A;  1PK0 D;  2JT3 A;  1TN4 A;  4PCW A;  2KQ6 A;  2Q91 A;  1NCZ A;  5AXI A;  2GGZ A;  1K9P A;  1QXP A;  3I5F C;  2F3Z A;  1LXF C;  3WHT B;  4YGB B;  1IG5 A;  4HRE E;  4DIR A;  1DF0 B;  1SPY A;  3FWC A;  1CDL A;  4M2Q A;  1NX3 A;  1KQM C;  2M1K B;  2O5G A;  3WXA A;  4AQJ A;  1SBJ A;  1SYM A;  1XO5 A;  1TCF A;  3NSL A;  4YGE B;  1ALV A;  3A4U B;  1TTX A;  1KFU L;  2LM5 A;  2ZN9 A;  2FCD A;  2CXJ A;  4ETO A;  4QJ5 B;  5KSZ A;  1IH0 A;  1XK4 A;  1OZO A;  1D1O A;  1KCY A;  1QS7 A;  3BQ3 A;  2ZRS A;  1TNQ A;  1DF0 A;  1PRW A;  4XYN A;  1KFX S;  2KYC A;  3FS7 A;  3O6B A;  2PAS A;  2M1U A;  1BR4 B;  2BL0 C;  1FBV A;  1MUX A;  3I5G B;  3IF7 A;  3E3R A;  4GUK A;  1B47 A;  4I5L B;  2JNF A;  2LVV A;  1R6P A;  4PAL A;  2OTG C;  4I5J A;  1N2D A;  2BBN A;  3AKB A;  1TRF A;  3BUW B;  3KO0 A;  1QJT A;  1SCM C;  4CPV A;  4U8D A;  2L4I A;  2ISD A;  5TNC A;  3I5H B;  4OCI A;  1YX7 A;  1GJY A;  4CLN A;  1L7Z A;  5IBW A;  1LIN A;  2Y5I A;  1AUI B;  3SG4 A;  4AQI A;  5HYD A;  1FW4 A;  3LK0 A;  1NWD A;  1XFW O;  2ZNE A;  3H4S E;  2F33 A;  1V1F A;  3SG5 A;  3EK7 A;  1NUB A;  4MZJ A;  1IRJ A;  1KK8 C;  2MHH A;  4C0L A;  1J7Q A;  4F0Z B;  4CFQ A;  2KGR A;  3AAK A;  2H61 C;  1JFK A;  1KK7 Y;  1YUS A;  3IQQ A;  1QVI Y;  1CFC A;  2A4J A;  3SJS A;  1Q80 A;  4PHN A;  1F70 A;  4YGC B;  3ZNI A;  1EJ3 A;  1WDC B;  3AAJ A;  3JTD B;  4HRH A;  1KQV A;  2LNK A;  1YUT A;  2EC6 B;  1RJV A;  4GNK B;  4YGA A;  1F55 A;  1XFX O;  3KEV A;  1IJ6 A;  2ZND A;  2KOT A;  2JZI A;  3EVV A;  2R2I A;  3LK1 A;  5ER4 X;  3HX4 A;  1PVB A;  5FYX A;  2Q4U A;  3CR5 X;  4ORB B;  4ZCU A;  1CTR A;  1NX0 A;  3F45 A;  2LMT A;  2L0P A;  4C0K A;  1CLL A;  3TS5 B;  1H8B A;  4MLW A;  1RTP 1;  1JFJ A;  1DJY A;  3VRN A;  1BR1 B;  2RGI A;  2MLE C;  4AOM A;  1YR5 A;  1NSH A;  2LUX A;  2Y4Q A;  4NDD A;  1IQ5 A;  3O2P A;  1TNW A;  1SRA A;  2KQY A;  4MBE A;  3SG6 A;  1NYA A;  5JOL A;  1MR8 A;  3LCP C;  4NDB A;  1OMV A;  3DF0 A;  5KU1 A;  1QLK A;  1BOC A;  4OKH A;  1SW8 A;  3BUM B;  1B9A A;  2FCE A;  1ODB A;  2JNX A;  1HQV A;  3PN7 C;  3GK2 A;  2NLN A;  1BJF A;  4DCK A;  2PRU A;  1U5I B;  2K7O A;  3VRQ A;  1TOP A;  1AK8 A;  1QX7 A;  1JF0 A;  1VRK A;  3TDU A;  2GV5 A;  2CT9 A;  2WCB A;  2L4H A;  1J55 A;  2BCB A;  2H2K A;  4JPZ B;  1DJH A;  2KDH A;  2SCP A;  1V1G A;  1Y6W A;  1KFX L;  3ZWH A;  1XVJ A;  1SY9 A;  4MEW A;  1M39 A;  1CDN A;  1NCX A;  4YBH B;  5DKR A;  4DRW A;  2F3Y A;  2WC8 A;  1CMF A;  4XJK B;  1AP4 A;  2LE9 B;  2MLF C;  5J3X A;  1AHR A;  1SL9 A;  4MRY A;  1NP8 A;  4MZL A;  1DT7 B;  1J1E A;  3WNX B;  1SR6 B;  4GGF A;  5CPV A;  1CMG A;  1S36 A;  1B4C A;  1UHI A;  1DJI A;  1CFP A;  1RWY A;  1OMR A;  2LLS A;  3RLZ A;  1K90 D;  1M46 A;  2KBI A;  2PVB A;  1LA0 A;  2QPT A;  4C0J A;  1IJ5 A;  2LP2 A;  1DGV A;  2KYF A;  5ER5 A;  3TUY C;  1FF1 A;  1M31 A;  2CBL A;  1A75 A;  2L98 A;  1CDP A;  4MVF A;  1DVI A;  1KK7 Z;  1XFV O;  1QVI Z;  1UHK A;  2BCX A;  3I5F B;  3BOW B;  1EH2 A;  4I5N B;  5HLO A;  3O78 A;  1QAT A;  3OX5 A;  3KPX A;  4A4C A;  1CM4 A;  1KWO C;  2QAC A;  1KQM B;  3I5I C;  1W7J B;  1SMG A;  3CR4 X;  1BOD A;  2MBX A;  2PAL A;  4PE4 A;  1B8R A;  2KI6 D;  4P5O E;  2EHB A;  1OE9 B;  3BOW A;  4MRX A;  4A4B A;  2WCF A;  4FQO A;  1MXE A;  2TN4 A;  3VRP A;  1ZFS A;  3PM8 A;  3CR2 A;  3VRR A;  2BL0 B;  5D7F A;  2KGB C;  2M3W A;  2KI6 C;  2MRD A;  2WOS A;  1DJG A;  1WY9 A;  2JQ6 A;  4ORA B;  2M0R A;  3OB2 B;  3KHE A;  2VRG A;  2F8P A;  2I7A A;  2G2B A;  1LKJ A;  4PHM A;  2K0J A;  2CNP A;  1B7T Y;  2OTG B;  1PSR A;  1J1D A;  2M7N A;  2LMU A;  5F6T A;  3OX6 A;  1A03 A;  1SCM B;  2AUC A;  1F4O A;  1YUU A;  1GGZ A;  2PSR A;  3AKA A;  4GBA A;  4D1E A;  1NCY A;  2JWW A;  4P2Y B;  3DVJ A;  4OV2 A;  4M2P A;  1YUR A;  4PHJ A;  1J7P A;  2G9B A;  3OP0 A;  2LVJ A;  1XFU O;  3GOF A;  1KK8 B;  4WQ3 A;  4QJ4 B;  1SL8 A;  2KAY A;  4USL A;  4ZCV A;  2KNE A;  1YX8 A;  3TZ1 A;  2Y1N A;  3C1V A;  4Q04 A;  2M29 A;  2E30 A;  4PE1 A;  1CKK A;  3PSR A;  1BG1 A;  4FTG A;  2LC5 A;  2K2A A;  3JVT C;  4BY5 A;  1K9K A;  1UUR A;  4OVN F;  1IQ3 A;  1NPQ A;  2P6B B;  2KFH A;  4JQ0 D;  1H4B A;  4YI8 A;  5G08 A;  5BPJ A;  1K2H A;  2L5X B;  1RFJ A;  1ZOT B;  2K7D A;  4GPL B;  1S1E A;  1SCV A;  3GK1 A;  1KFU S;  5I2Q A;  5JJG A;  1BF5 A;  1MF8 B;  2HQ8 A;  2K8M B;  2V53 A;  5HKY A;  1BT6 A;  5I2O A;  1JC2 A;  2ZN8 A;  3EK8 A;  1L2O C;  2CTN A;  3PAT A;  1G4Y R;  4ORC B;  3ICB A;  2NXQ A;  1S6J A;  1QX2 A;  4OR9 B;  3TDI A;  1SKT A;  3PN7 B;  1B8L A;  1K93 D;  1JWD A;  2EGD A;  1CFD A;  3BUN B;  4WQ2 A;  1PSB A;  1BLQ A;  2WCE A;  1WRL A;  4YGD B;  1N65 A;  1Y1A A;  1CNP A;  4NQG A;  2KFF A;  3EKJ A;  1NIW A;  1A29 A;  1PAL A;  1R2U A;  1UHH A;  1UUS A;  3LLE A;  4N1F A;  1QAS A;  1OOJ A;  1U5I A;  2LVI A;  3NSI A;  4JWQ A;  3SIB A;  3CZT X;  3OHM B;  1CLB A;  1N0Y A;  3PFV A;  1PVA A;  2LLU A;  2KAX A;  2OS8 C;  1B7T Z;  4E68 A;  5D69 A;  1UHN A;  1F71 A;  1Y0V H;  2BE6 A;  3KF9 A;  2COL B;  1JBA A;  1F4Q A;  2F2O A;  1S5G Y;  4M2O A;  2LVK A;  4R1E A;  3IQO A;  4GGF C;  4GGN A;  4N5X A;  4PE7 A;  4PDZ A;  4XJK A;  3SG3 A;  1CM1 A;  1QX5 B;  2KI4 C;  1FI6 A;  5AAN A;  2WOR A;  3EK4 A;  1TNX A;  3D0Y B;  1C7V A;  1EL4 A;  5DKQ A;  3TUY B;  1DJW A;  3PLF B;  4PHK A;  5CSI A;  5I8N A;  4I5K A;  2AAO A;  4TNC A;  2L51 A;  1UP5 A;  3VGO A;  3HCM A;  1OQP A;  1TNP A;  2LLT A;  2K7B A;  1A4P A;  1JUO A;  1S6I A;  3BUO B;  3SG2 A;  1KWO B;  1K8U A;  1CLM A;  2AMI A;  1HT9 A;  2PMY A;  1ZAC A;  2JUL A;  1SNL A;  3I5I B;  5GQQ C;  2M9G A;  3O4Y A;  2JPT A;  1J7O A;  1XK4 C;  1XA5 A;  2D8N A;  5AEQ A;  2JU0 A;  2JXL A;  2KFG A;  3EKH A;  2GGM A;  1OMD A;  3BUX B;  2K61 A;  2B1U A;  2HF5 A;  4YI9 A;  2LAP A;  2LUC A;  1C07 A;  1IWQ A;  2JRF A;  1REC A;  1J7R A;  2JT8 A;  2Y1M A;  2JTZ A;  3DVK A;  1AJ4 A;  2BEC A;  1EG4 A;  1S6C A;  2CCM A;  2FJU B;  2OPO A;  1XFZ O;  2I94 A;  3EVR A;  2M8U A;  5CSF A;  4YRU A;  1K9U A;  1QLS A;  1XYD A;  3DD4 A;  4DUQ A;  4IL1 A;  3I5G C;  4N1G A;  1KSM A;  1MXL C;  1YRU B;  1G33 A;  3CLN A;  1F8H A;  1OZS A;  1NX2 A;  2HQW A;  2ZRT A;  4BY4 A;  1QTX A;  1Y1U A;  2LAN A;  3CTN A;  1QIW A;  3FIA A;  2K2F A;  4MSP A;  1UHJ A;  1YVH A;  2ZFD A;  2M7L A;  4CFR A;  1AJ5 A;  1MWN A;  1OSA A;  4QJ3 B;  2I18 A;  5PAL A;  2E6W A;  1EXR A;  1K94 A;  3I5H C;  5HKZ A;  1Y1X A;  1FI5 A;  1RRO A;  5AER A;  1S26 D;  2MJW B;  4MN0 A;  2HET A;  5B8I B;  2JTT A;  3K21 A;  3BXK A;  3PAL A;  3A8R A;  1S5G Z;  2KSP A;  1UWO A;  4L9M A;  2MAZ A;  1YTZ C;  3JVT B;  2H61 A;  1YVL A;  3CGA A;  1K95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...