3SIBA

Crystal structure of ure3-binding protein, wild-type
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
215
structure length
203
Chain Sequence
ANFCLWNLQPIMPPSVRNTWWFPLLNTIPLDQYTRIYQWFMGVDRDRSGTLEINELMMGQFPGGIRLSPQTALRMMRIFDTDFNGHISFYEFMAMYKFMELAYNLFVMNDRNRSGTLEPHEILPALQQLGFYINQRTSLLLHRLFARGMAFCDLNCWIAICAFAAQTRSAYQMIFMNPYYGPMKPFNPMEFGKFLDVVTSLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URE3-BP sequence specific DNA binding protein
publication title Crystal structure of URE3-binding protein
rcsb
source organism Entamoeba histolytica
molecule tags Dna binding protein
total genus 80
structure length 203
sequence length 215
ec nomenclature
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sibA00
1CFPA 4L9MA 3VRQA 1XFYO 3F45A 2LLTA 1NIWA 4GAOA 1IGVA 3GK1A 3I5HB 1B1GA 5D69A 2MRDA 2BE6A 2LVVA 4YRUA 4QJ4B 2M9GA 4PCWA 2EGDA 1MHOA 1OMDA 1KSOA 2PALA 3JVTC 1FI6A 2LM5A 1SR6C 2Q91A 1QX5B 3BOWB 3DVJA 2PRUA 1PK0D 2JOJA 4FQOA 2KQ6A 2CCMA 2LVIA 2KFGA 2KOTA 1ZFSA 1C07A 2JNFA 1K94A 1N65A 2JTZA 3BUWB 4PHNA 1RROA 4N5XA 4GNKB 3IQOA 2OS8B 1CNPA 4USLA 4PHMA 3I5HC 5B8IB 1IQ5A 1OZOA 3VRNA 3EVUA 2IS9A 3I5GB 3CR4X 1DVIA 1QATA 1EG3A 4WQ3A 1NCZA 1G8IA 1BG1A 1UHHA 3RLZA 3ZWHA 2CTNA 5HYDA 5JOLA 1H8BA 1Q80A 1YUSA 1UUSA 2K2AA 4YI9A 3VRPA 1KFUS 1YX8A 2JZIA 3OX6A 4C0KA 4DCKA 1CLBA 2JRFA 4YGDB 1XFUO 3O2PA 4PE1A 2L50A 2OS8C 4CFQA 3M0WA 1K9KA 4XYNA 3LLEA 2BL0B 3I5GC 3BXKA 2CBLA 1W7IB 3SG3A 1IJ5A 1ZOTB 1C7VA 1WLMA 3CR2A 2LVJA 1F70A 1ODBA 1S5GZ 1DJGA 1Y1XA 3SG2A 1IWQA 1CLLA 2L5XB 2FCDA 1NX3A 4P5OE 3BOWA 1UHNA 1XA5A 2KAYA 3DVKA 1BU3A 1QVIZ 1B7TZ 2FOTA 4JPZB 1DJYA 2K7OA 1BR1B 1NX2A 2K7DA 4YGAA 1SL7A 1BMOA 2BL0C 3OX5A 2BBMA 3A4UB 1F71A 1MF8B 3A8RA 3K21A 2M3WA 4C0JA 1CFFA 5K89A 4I5KA 1F8HA 5ER4X 2KI4B 1B47A 2JXCA 1YVHA 1QJTA 4NDBA 4MZKA 3D10A 3TDUA 1LVCD 1JWDA 2NXQA 2JXLA 1PSRA 1S1EA 1TRFA 2LHLA 1XFXO 2KSPA 3DD4A 2L0PA 4MLWA 2AMIA 2LE9B 1PVBA 3I5FC 1TN4A 4IL1A 1QS7A 1M63B 2WC8A 3CS1A 1EH2A 1QIVA 1UWOA 4WRIA 1TOPA 2Y5IA 5JJGA 1RFJA 2KI4C 4GFTA 1IQ3A 4ORCB 3OB2B 3KO0A 1YRTB 1V1FA 1B8LA 3BUOB 2R2IA 4GPLB 1JFJA 1XFVO 1CDNA 2CXJA 4DS7A 3E3RA 2LP3A 2PVBA 1EJ3A 5BPJA 1XK4C 2VRGA 1SL9A 5ER5A 1SYMA 1SMGA 1J1EA 1ALWA 1S3PA 2K7CA 3SJSA 2Q4UA 1GJYA 2BCXA 4ORBB 1XO5A 2ZRSA 4ICBA 1FPWA 2NCOA 1J7QA 2M7NA 3EVRA 3VRRA 1F4OA 1N2DA 1M39A 2JQ6A 1OQPA 2F3YA 1SKTA 1IKUA 3EK4A 2KFFA 3FWBA 2O60A 3PALA 3ZNIA 2COLB 2LNKA 1ALVA 4WQ2A 5GQQC 1QLKA 1KFUL 4UPGA 1BR4B 1NX0A 1XK4A 2QPTA 1YVLA 2FCEA 1DGUA 1ZACA 1KK8B 1S36A 5J3XA 5AERA 2MAZA 4U8DA 4E68A 1BT6A 3EK7A 2KHNA 1AJ5A 4D1EA 2KBMA 2NZ0A 3QRXA 2KYFA 3NXAA 2KQYA 3H4SE 2K61A 3O4YA 3GOFA 2OTGB 1A4PA 2JU0A 1MQ1A 1TNPA 1DJXA 2I94A 2ZRTA 1TTXA 1G33A 4MRYA 4CPVA 1BLQA 1V1GA 1CDPA 2WCEA 4ORAB 3EVVA 3SG7A 1F55A 5HKZA 1JFKA 1VRKA 4FTGA 3PATA 1K96A 4CFRA 1CMFA 3LK1A 1CFDA 1EL4A 5KTYA 1KK8C 1QV1A 5I2OA 1A29A 1KQMB 1IG5A 2F2OA 4AQIA 3JTDB 2HQWA 1RECA 3AKBA 1QX7A 4ZCVA 4Q04A 2ZN9A 1CB1A 1UURA 2OTGC 2EC6B 1NCXA 3BQ3A 1NWDA 1YRUB 2M29A 1XFZO 3LK0A 1BOCA 1M46A 2BCAA 1JC2A 4F0ZB 1U5IB 1UP5A 1YR5A 4MBEA 4OCIA 2RGIA 3SIAA 1AJ4A 2Y1NA 3GK2A 4OV2A 2LC5A 1QX2A 1J7PA 4ETOA 2JT8A 2B1UA 1AHRA 3PSRA 1KQMC 1BODA 2BKIB 1QTXA 2MLEC 3JTDC 2ISDA 2QACA 2WOSA 1CM1A 1RJVA 1OMVA 1QVIY 5FYXA 1MXEA 1E8AA 2EC6C 1DJIA 4DUQA 3I5FB 2CNPA 1XVJA 2KGRA 2D8NA 1DF0B 2G9BA 4XJKB 2V53A 1WLZA 1TNQA 2GGMA 5AFPA 5CSJA 1CM4A 2L4HA 1S6CA 2KAXA 2L51A 1MR8A 1S6IA 4PE4A 2ZKMX 1WRKA 1Y1UA 1JBAA 4PE7A 5F6TA 1YUUA 2KDHA 2M1KB 1NUBA 5CSFA 1LA3A 2DOQA 1F4QA 1SPYA 2K7BA 4GGFC 1ZMZA 4YGBB 1DT7B 1M31A 1TCFA 3C1VA 4NQGA 1A03A 3DF0B 1BJFA 5HLOA 3OHMB 4OVNF 1B8RA 3DVMA 1KCYA 3TS5B 2LHIA 4MRXA 1YTZC 1K95A 3WXAA 4DRWA 1L2OB 2NLNA 1DGVA 1FW4A 5CPVA 2ZFDA 2Y4QA 3OP0A 1U5IA 2H2KA 1GQMA 4JWQA 3FS7A 2PSRA 2A4JA 2KI6D 1PULA 2E30A 2KI6C 1SW8A 3AAKA 2HPSA 2NCPA 1J7RA 3BYAA 1IH0A 3EKJA 3FWCA 5AXIA 1R2UA 1QASA 1LKJA 3EKHA 4GGFA 2M0RA 1CFCA 4DIRA 3MSEB 2CT9A 4MSPA 3TS5C 2JC2A 1JUOA 1TNWA 1RTP1 2MHHA 1DMOA 1L2OC 2HF5A 1TNXA 2M1UA 1KQVA 1SK6D 1KK7Y 1SCMB 3IQQA 4I5LB 1B8CA 2LMUA 1C7WA 2FJUB 4N1GA 4C0LA 1NPQA 2L4IA 1WDCB 1SRAA 4AQJA 1JF0A 4MZJA 1HT9A 1W7JB 1N0YA 3TDIA 4A4BA 2L98A 1SY9A 5KU1A 1LINA 1ZUZA 3I5IB 1DJWA 1K8UA 2Y1MA 5I2LA 3WNXB 1YX7A 4QJ3B 2HQ8A 5DKQA 2LV7A 2E6WA 3SG4A 4OKHA 1XYDA 2AUCA 2LUCA 3PLFB 1YURA 3KHEA 1AK8A 2JWWA 1EG4A 4R1EA 4HSZA 1B9AA 2JPTA 1QXPA 1WY9A 3DF0A 3SG5A 1EXRA 1CDMA 1M45A 3WHUB 4YGCB 4BY5A 4CLNA 1SCMC 2JULA 1UHIA 4HRHA 1WDCC 3BUXB 2KGBC 2I18A 4PHKA 3KEVA 3RM1A 1NX1A 2MBXA 3I5IC 1CDLA 4HREE 1DJZA 1QLSA 1OMRA 5CSIA 3ICBA 4M2OA 2LAPA 2LANA 5G08A 1GGWA 1KFXL 3EK8A 2BECA 3TUYC 3WHTB 3LCPC 2H61C 4I5JA 3PM8A 1OSAA 2M97A 1J1DA 2F8PA 5I2QA 2LMVA 4NDDA 3SIBA 1NCYA 1X02A 2K0JA 2M8UA 1JF2A 3TDZA 2GGZA 1R6PA 3CWGA 2LP2A 3NSIA 4HRGA 2F2PA 1WRZA 1XFWO 1YUTA 4M2PA 5DKRA 2LVKA 5PALA 1AVSA 5HKWA 2LMTA 2I2RE 2F3ZA 3AKAA 1Y6WA 2AAOA 1K90D 4ZCUA 1KFXS 5DKNA 1KWOB 3OB1B 2JNXA 5AANA 4QJ5B 2G2BA 1FI5A 2BCBA 2ZNEA 4PDZA 1CTRA 2I7AA 4MEWA 2GV5A 1SCVA 1S5GY 4I5NB 2H61A 3KF9A 2HETA 1IJ6A 2WCBA 4GUKA 2M49B 2PMYA 1SL8A 3O78A 4A4CA 4JQ0D 2BBNA 1B7TY 3CR5X 2SASA 4PE0A 1UHJA 1S6JA 2JT3A 1A2XA 1IRJA 1PVAA 1MWNA 1DTLA 1SBJA 1TCOB 1H4BA 1LXFC 2LLSA 1KWOC 1RK9A 1A75B 1NP8A 1DJHA 2LCPA 1SNLA 2BKHB 3NSKA 3O6BA 4N1FA 3CGAA 1CKKA 4TNCA 4MVFA 5HKYA 4YGEB 1OZSA 1F54A 5CSNA 1KSMA 1QIWA 2F33A 4MN0A 1LA0A 2SCPA 1OOJA 3D0YB 2LUXA 1J55A 4GBAA 2PASA 4NDCA 2LLUA 2KNEA 2TN4A 3NSLA 5HLVA 2KYCA 1MXLC 3CTNA 4AOMA 3SG6A 5IBWA 5TNCA 2WCFA 4MZLA 2OPOA 1MUXA 1WRLA 3PN7B 2K2FA 3TZ1A 5KSZA 1FF1A 3AAJA 3IF7A 3GK4X 3VROA 1AP4A 2KAVA 1PSBA 1AUIB 2BE4A 3CZTX 2JT0A 2P6BB 3PFVA 4OR9B 2K8MB 1QV0A 1FBVA 1L7ZA 2L2EA 4PALA 1J7OA 4CIDA 4M2QA 1OE9B 1JSAA 1BF5A 3NSOA 4PHJA 2M7LA 3HCMA 2MLFC 4GGNA 4YI8A 5I8NA 2ZN8A 1B4CA 1Y1AA 1RWYA 2O5GA 3PN7C 1NYAA 1PRWA 4BY4A 1K9UA 2WORA 1PALA 3BUMB 3CLNA 1K2HA 1DF0A 1K93D 4XJKA 2MJWB 1CLMA 1A75A 1NSHA 1D1OA 1UHKA 3HX4A 4YBHB 3KPXA 3JVTB 3LL8B 1TIZA 3VGOA 1GGZA 1SR6B 3BUNB 3DVEA 5AEQA 2KBIA 2EHBA 2JTTA 3FIAA 2KFHA 1S26D 3D0YA 1Y0VH 1KK7Z 2MA2A 2WNDA 1HQVA 2ZNDA 4P2YB 1G4YR 3TUYB 1CMGA 5D7FA 1K9PA
chains in the Genus database with same CATH superfamily
1CFPA 4L9MA 3VRQA 1Z2CB 1XFYO 3F45A 2LLTA 1NIWA 2WCLA 4GAOA 1IGVA 3GK1A 3I5HB 1B1GA 5D69A 2MRDA 2BE6A 2LVVA 4YRUA 3Q8IA 4QJ4B 2M9GA 4PCWA 2EGDA 1MHOA 1OMDA 1KSOA 2PALA 3JVTC 1FI6A 2LM5A 1SR6C 2Q91A 1QX5B 3BOWB 3DVJA 4F7FA 2PRUA 1PK0D 2JOJA 4FQOA 2KQ6A 2CCMA 2LVIA 2KFGA 2KOTA 1ZFSA 1C07A 2JNFA 1K94A 1N65A 2JTZA 3BUWB 2WC6A 4PHNA 1RROA 1DELA 4N5XA 4GNKB 3IQOA 2OS8B 1CNPA 4USLA 4PHMA 3I5HC 5B8IB 1IQ5A 1OZOA 3VRNA 3EVUA 2IS9A 3I5GB 3CR4X 3NGVA 1DVIA 3S0BA 1QATA 3D74A 1EG3A 3FE9A 4WQ3A 1NCZA 1G8IA 1BG1A 1UHHA 3RLZA 3ZWHA 2CTNA 5HYDA 5JOLA 1H8BA 1Q80A 1YUSA 1UUSA 2K2AA 4YI9A 3VRPA 1GM0A 1KFUS 1YX8A 2JZIA 3OX6A 4C0KA 4DCKA 1CLBA 2JRFA 4YGDB 1XFUO 3O2PA 4PE1A 2L50A 2OS8C 4CFQA 3M0WA 1K9KA 4XYNA 3UNWA 3LLEA 2BL0B 3I5GC 3BXKA 2CBLA 2WCHA 1W7IB 3SG3A 1IJ5A 3CZ2A 1ZOTB 1C7VA 1WLMA 2BAPA 3CR2A 2LVJA 1F70A 1ODBA 1S5GZ 1DJGA 1Y1XA 3SG2A 1IWQA 1CLLA 2L5XB 2FCDA 1NX3A 3DZTA 3BOWA 4P5OE 1UHNA 3B87A 1XA5A 2KAYA 3DVKA 1BU3A 1QVIZ 1B7TZ 2FOTA 4JPZB 1DJYA 2K7OA 1BR1B 1NX2A 2K7DA 4YGAA 1SL7A 1BMOA 2BL0C 3D75A 3OX5A 2L2CA 2BBMA 3A4UB 1F71A 1MF8B 3A8RA 3K21A 2M3WA 4C0JA 1CFFA 5K89A 4I5KA 1F8HA 5ER4X 2KI4B 1B47A 3CZ0A 2JXCA 1YVHA 1QJTA 4NDBA 2QEOA 3D10A 4MZKA 1LVCD 3TDUA 1JWDA 2NXQA 2JXLA 1PSRA 1S1EA 1TRFA 2LHLA 1XFXO 2KSPA 3DD4A 2JPOA 2L0PA 4MLWA 2AMIA 2LE9B 1PVBA 3I5FC 1TN4A 4IL1A 1QS7A 1M63B 2WC8A 1SSEB 3CS1A 1EH2A 1QIVA 1UWOA 4WRIA 5EL2A 1TOPA 2Y5IA 5JJGA 3VB1A 1RFJA 2KI4C 4GFTA 1IQ3A 4ORCB 3OB2B 3KO0A 1YRTB 1V1FA 1B8LA 3BFBA 2H8VA 2P71A 2R2IA 3BUOB 4GPLB 3L4LA 1JFJA 3EG5B 1XFVO 2L5YA 1CDNA 2KLDA 2CXJA 4DS7A 1IIOA 3E3RA 2LP3A 2PVBA 2K60A 5I94A 1EJ3A 5BPJA 1XK4C 2VRGA 1SL9A 3IVTA 5ER5A 1SYMA 1SMGA 1J1EA 1ALWA 1S3PA 2K7CA 3FE6A 3SJSA 3CYZA 2Q4UA 1GJYA 2QDIA 2BCXA 4ORBB 1XO5A 2ZRSA 4ICBA 1FPWA 2NCOA 1J7QA 2M7NA 2WCJA 3EVRA 3VRRA 1F4OA 3BFHA 3BFAA 2WCMA 1N2DA 1M39A 2JQ6A 1OQPA 2F3YA 1SKTA 1IKUA 3EK4A 2KFFA 3FWBA 2O60A 3PALA 3CDNA 3ZNIA 3NHIA 2COLB 2LNKA 1ALVA 4WQ2A 5GQQC 1QLKA 1KFUL 4UPGA 1BR4B 1NX0A 1XK4A 2QPTA 1YVLA 3O4XA 3S0EA 2FCEA 5HL1A 2WCKA 1DGUA 1ZACA 1KK8B 1S36A 5J3XA 5AERA 2MAZA 4U8DA 4E68A 3S0AA 1BT6A 3EK7A 3V2LA 2KHNA 2QEHA 1AJ5A 4D1EA 4JD9A 2KBMA 2NZ0A 3QRXA 2KYFA 3NXAA 2KQYA 3H4SE 2K61A 3O4YA 3GOFA 2OTGB 3S0FA 1A4PA 2JU0A 1MQ1A 1TNPA 1DJXA 2I94A 3UO9A 2ZRTA 1TTXA 1G33A 4MRYA 4CPVA 1BLQA 1V1GA 1CDPA 2WCEA 4ORAB 3EVVA 2PYQA 2GTEA 3SG7A 5HKZA 1F55A 1JFKA 1VRKA 4FTGA 3PATA 1K96A 2WC5A 3D78A 4CFRA 1CMFA 3LK1A 1CFDA 1EL4A 5KTYA 1KK8C 1QV1A 5I2OA 2ERBA 1A29A 1KQMB 1IG5A 1QWVA 2F2OA 4AQIA 3JTDB 2HQWA 1RECA 3AKBA 1QX7A 4ZCVA 1DC1A 4Q04A 2ZN9A 1CB1A 1UURA 2OTGC 5DICA 2EC6B 1NCXA 3BQ3A 1NWDA 1YRUB 2M29A 1XFZO 3LK0A 1BOCA 1M46A 2BCAA 3DY9A 1JC2A 4F0ZB 1U5IB 1UP5A 1YR5A 4MBEA 3D73A 4OCIA 2RGIA 3SIAA 3K1EA 1AJ4A 2Y1NA 3GK2A 4OV2A 2LC5A 1QX2A 1J7PA 4ETOA 2JT8A 2B1UA 1AHRA 3PSRA 1KQMC 3OBVA 1BODA 2BKIB 1QTXA 2MLEC 3JTDC 3B86A 5FI7A 2ISDA 1LS8A 2QACA 2WOSA 1CM1A 1RJVA 1OMVA 3D76A 1QVIY 5FYXA 1MXEA 2QEVA 1E8AA 2EC6C 1DJIA 3CABA 3I5FB 4DUQA 2CNPA 1XVJA 2KGRA 2D8NA 1DF0B 2G9BA 4XJKB 1TUZA 2V53A 1WLZA 1TNQA 2GGMA 5AFPA 5CSJA 1CM4A 2L4HA 1S6CA 2KAXA 2L51A 1MR8A 1S6IA 4PE4A 1Z4HA 1WRKA 2ZKMX 1Y1UA 1JBAA 4PE7A 5F6TA 1YUUA 2KDHA 2M1KB 3DXLA 1NUBA 5CSFA 1LA3A 2DOQA 1F4QA 1SPYA 2K7BA 4GGFC 1C3YA 1W9ZA 1ZMZA 4YGBB 1DT7B 1M31A 1TCFA 3C1VA 4NQGA 1A03A 3DF0B 1BJFA 3NHTA 5HLOA 3OHMB 4OVNF 1B8RA 3DVMA 1KCYA 3S0DA 3TS5B 3L4AA 4INXA 2LHIA 4MRXA 1YTZC 1K95A 3WXAA 4DRWA 1L2OB 2NLNA 1DGVA 2KPHA 1FW4A 3SS5A 5CPVA 2ZFDA 2Y4QA 1OOIX 3OP0A 1U5IA 2H2KA 1GQMA 1OOFA 4JWQA 3FS7A 2PSRA 2A4JA 2KI6D 1PULA 2E30A 2KI6C 1SW8A 3AAKA 2HPSA 2NCPA 1J7RA 3BYAA 1IH0A 3EKJA 3FWCA 5AXIA 1R2UA 3DYEA 1QASA 1LKJA 3EKHA 4GGFA 2M0RA 1CFCA 4DIRA 3PM2A 3MSEB 2BNXA 2CT9A 4MSPA 3TS5C 2JC2A 1JUOA 1TNWA 1RTP1 2MHHA 1DMOA 1L2OC 2HF5A 1TNXA 2M1UA 1KQVA 1SK6D 1KK7Y 1SCMB 3IQQA 4I5LB 1B8CA 4JKTA 2LMUA 1C7WA 1OOGA 2FJUB 4N1GA 4C0LA 1NPQA 2L4IA 1WDCB 1SRAA 4AQJA 1JF0A 4MZJA 5FI2A 1HT9A 1W7JB 1N0YA 3TDIA 4A4BA 2L98A 1SY9A 5KU1A 1LINA 1ZUZA 3B7AA 3I5IB 1DJWA 1K8UA 2Y1MA 5I2LA 3WNXB 1YX7A 4QJ3B 2HQ8A 3PJIA 5DKQA 2LV7A 2E6WA 4FQTA 2PQLA 3SG4A 4OKHA 1XYDA 2AUCA 2LUCA 3PLFB 3R1OA 1YURA 3KHEA 1AK8A 2JWWA 3B88A 1EG4A 4R1EA 4HSZA 1B9AA 2JPTA 1QXPA 1WY9A 3DF0A 3N7HA 1EXRA 1CDMA 1M45A 4KYNA 4YGCB 3SG5A 3WHUB 4BY5A 1SCMC 4CLNA 2JULA 1UHIA 4HRHA 2FJYA 3SS4A 1WDCC 3BUXB 2KGBC 2I18A 4PHKA 3KEVA 1TWOA 3RM1A 1NX1A 2MBXA 3I5IC 1CDLA 4HREE 1DJZA 1QLSA 1OMRA 5CSIA 3ICBA 4M2OA 2LAPA 1DEKA 1TUJA 2LANA 5G08A 1GGWA 1KFXL 3RZSA 3EK8A 2BECA 3CZ1A 3TUYC 3WHTB 3LCPC 2H61C 4I5JA 3PM8A 1OSAA 2M97A 1J1DA 2F8PA 4IJ7A 2LMVA 4NDDA 5I2QA 3SIBA 1NCYA 1X02A 2K0JA 2M8UA 1JF2A 3TDZA 2GGZA 3SS3A 1R6PA 3CWGA 2LP2A 3FE8A 3NSIA 4HRGA 2F2PA 1WRZA 1XFWO 1YUTA 4M2PA 5DKRA 2LVKA 5PALA 1AVSA 5HKWA 2LMTA 2I2RE 1XFRA 2F3ZA 3AKAA 1Y6WA 2AAOA 1K90D 4ZCUA 1KFXS 5DKNA 1KWOB 3OB1B 2JNXA 5AANA 4QJ5B 2G2BA 1FI5A 2BCBA 2ZNEA 4PDZA 1CTRA 1OW4A 2I7AA 3BJHA 4MEWA 2GV5A 1SCVA 1S5GY 5D3OA 4I5NB 2H61A 3KF9A 2HETA 1IJ6A 2WCBA 4GUKA 2M49B 2PMYA 1SL8A 3O78A 3S0GA 4PT1A 4A4CA 4JQ0D 2BBNA 1B7TY 3CR5X 2SASA 4PE0A 1UHJA 1S6JA 3B6XA 2JT3A 1A2XA 1IRJA 1PVAA 3TUYB 1MWNA 1DTLA 1SBJA 1TCOB 1H4BA 1DQEA 1LXFC 2LLSA 1KWOC 1RK9A 1A75B 1NP8A 1DJHA 1ORGA 1SNLA 2BKHB 2LCPA 3NSKA 3O6BA 4N1FA 3CGAA 1CKKA 4TNCA 4MVFA 5HKYA 4YGEB 1OZSA 1F54A 5CSNA 1KSMA 1QIWA 2F33A 4MN0A 1LA0A 2SCPA 1OOJA 3D0YB 2KLEA 2LUXA 1J55A 4GBAA 2PASA 4NDCA 2LLUA 3R1PA 2KNEA 2YGUA 2TN4A 3NSLA 5HLVA 2KYCA 1MXLC 3CTNA 4AOMA 3SG6A 5IBWA 5TNCA 2WCFA 5FI6A 4MZLA 2P70A 2OPOA 1MUXA 1WRLA 3PN7B 2K2FA 3TZ1A 5KSZA 1FF1A 1C3ZA 3AAJA 3IF7A 3GK4X 3QMEA 3VROA 1AP4A 2KAVA 1PSBA 1AUIB 2BE4A 3CZTX 2QEBA 3R72A 2JT0A 2P6BB 4INWA 3PFVA 4OR9B 2K8MB 1QV0A 1FBVA 1L7ZA 2L2EA 4PALA 1J7OA 4CIDA 4M2QA 1OE9B 1JSAA 1BF5A 3NSOA 4PHJA 2M7LA 3HCMA 2MLFC 4GGNA 4YI8A 5I8NA 2ZN8A 1B4CA 1Y1AA 1RWYA 2O5GA 3PN7C 1NYAA 1PRWA 4BY4A 1K9UA 1T14A 2WORA 1PALA 3BUMB 3CLNA 1K2HA 1DF0A 1K93D 4XJKA 1P28A 1CLMA 2MJWB 1A75A 1NSHA 1D1OA 1UHKA 3HX4A 4YBHB 3KPXA 3JVTB 3LL8B 1TIZA 3VGOA 1GGZA 1SR6B 3BUNB 3DVEA 5AEQA 2KBIA 3OGNA 2EHBA 2JTTA 3FIAA 2KFHA 1S26D 3D0YA 1Y0VH 1KK7Z 2MA2A 2WNDA 1HQVA 2ZNDA 3D77A 1G4YR 3L47A 1OOHA 4P2YB 4OZDA 3R1VA 1CMGA 5D7FA 1K9PA
chains in the Genus database with same CATH topology
1CFPA 4L9MA 3VRQA 1XFYO 3F45A 2LLTA 1NIWA 4GAOA 1IGVA 3GK1A 3I5HB 1B1GA 5D69A 2MRDA 2BE6A 2LVVA 4YRUA 4QJ4B 2M9GA 4PCWA 2EGDA 1MHOA 1OMDA 1KSOA 2PALA 3JVTC 1FI6A 2LM5A 1SR6C 2Q91A 1QX5B 3BOWB 3DVJA 2PRUA 1PK0D 2JOJA 4FQOA 2KQ6A 2CCMA 2LVIA 2KFGA 2KOTA 1ZFSA 1C07A 2JNFA 1K94A 1N65A 2JTZA 3BUWB 4PHNA 1RROA 4N5XA 4GNKB 3IQOA 2OS8B 1CNPA 4USLA 4PHMA 3I5HC 5B8IB 1IQ5A 1OZOA 3VRNA 3EVUA 2IS9A 3I5GB 3CR4X 1DVIA 1QATA 1EG3A 4WQ3A 1NCZA 1G8IA 1BG1A 1UHHA 3RLZA 3ZWHA 2CTNA 5HYDA 5JOLA 1H8BA 1Q80A 1YUSA 1UUSA 2K2AA 4YI9A 3VRPA 1KFUS 1YX8A 2JZIA 3OX6A 4C0KA 4DCKA 1CLBA 2JRFA 4YGDB 1XFUO 3O2PA 4PE1A 2L50A 2OS8C 4CFQA 3M0WA 1K9KA 4XYNA 3LLEA 2BL0B 3I5GC 3BXKA 2CBLA 1W7IB 3SG3A 1IJ5A 1ZOTB 1C7VA 1WLMA 3CR2A 2LVJA 1F70A 1ODBA 1S5GZ 1DJGA 1Y1XA 3SG2A 1IWQA 1CLLA 2L5XB 2FCDA 1NX3A 4P5OE 3BOWA 1UHNA 1XA5A 2KAYA 3DVKA 1BU3A 1QVIZ 1B7TZ 2FOTA 4JPZB 1DJYA 2K7OA 1BR1B 1NX2A 2K7DA 4YGAA 1SL7A 1BMOA 2BL0C 3OX5A 2BBMA 3A4UB 1F71A 1MF8B 3A8RA 3K21A 2M3WA 4C0JA 1CFFA 5K89A 4I5KA 1F8HA 5ER4X 2KI4B 1B47A 2JXCA 1YVHA 1QJTA 4NDBA 4MZKA 3D10A 3TDUA 1LVCD 1JWDA 2NXQA 2JXLA 1PSRA 1S1EA 1TRFA 2LHLA 1XFXO 2KSPA 3DD4A 2L0PA 4MLWA 2AMIA 2LE9B 1PVBA 3I5FC 1TN4A 4IL1A 1QS7A 1M63B 2WC8A 3CS1A 1EH2A 1QIVA 1UWOA 4WRIA 1TOPA 2Y5IA 5JJGA 1RFJA 2KI4C 4GFTA 1IQ3A 4ORCB 3OB2B 3KO0A 1YRTB 1V1FA 1B8LA 3BUOB 2R2IA 4GPLB 1JFJA 1XFVO 1CDNA 2CXJA 4DS7A 3E3RA 2LP3A 2PVBA 1EJ3A 5BPJA 1XK4C 2VRGA 1SL9A 5ER5A 1SYMA 1SMGA 1J1EA 1ALWA 1S3PA 2K7CA 3SJSA 2Q4UA 1GJYA 2BCXA 4ORBB 1XO5A 2ZRSA 4ICBA 1FPWA 2NCOA 1J7QA 2M7NA 3EVRA 3VRRA 1F4OA 1N2DA 1M39A 2JQ6A 1OQPA 2F3YA 1SKTA 1IKUA 3EK4A 2KFFA 3FWBA 2O60A 3PALA 3ZNIA 2COLB 2LNKA 1ALVA 4WQ2A 5GQQC 1QLKA 1KFUL 4UPGA 1BR4B 1NX0A 1XK4A 2QPTA 1YVLA 2FCEA 1DGUA 1ZACA 1KK8B 1S36A 5J3XA 5AERA 2MAZA 4U8DA 4E68A 1BT6A 3EK7A 2KHNA 1AJ5A 4D1EA 2KBMA 2NZ0A 3QRXA 2KYFA 3NXAA 2KQYA 3H4SE 2K61A 3O4YA 3GOFA 2OTGB 1A4PA 2JU0A 1MQ1A 1TNPA 1DJXA 2I94A 2ZRTA 1TTXA 1G33A 4MRYA 4CPVA 1BLQA 1V1GA 1CDPA 2WCEA 4ORAB 3EVVA 3SG7A 1F55A 5HKZA 1JFKA 1VRKA 4FTGA 3PATA 1K96A 4CFRA 1CMFA 3LK1A 1CFDA 1EL4A 5KTYA 1KK8C 1QV1A 5I2OA 1A29A 1KQMB 1IG5A 2F2OA 4AQIA 3JTDB 2HQWA 1RECA 3AKBA 1QX7A 4ZCVA 4Q04A 2ZN9A 1CB1A 1UURA 2OTGC 2EC6B 1NCXA 3BQ3A 1NWDA 1YRUB 2M29A 1XFZO 3LK0A 1BOCA 1M46A 2BCAA 1JC2A 4F0ZB 1U5IB 1UP5A 1YR5A 4MBEA 4OCIA 2RGIA 3SIAA 1AJ4A 2Y1NA 3GK2A 4OV2A 2LC5A 1QX2A 1J7PA 4ETOA 2JT8A 2B1UA 1AHRA 3PSRA 1KQMC 1BODA 2BKIB 1QTXA 2MLEC 3JTDC 2ISDA 2QACA 2WOSA 1CM1A 1RJVA 1OMVA 1QVIY 5FYXA 1MXEA 1E8AA 2EC6C 1DJIA 4DUQA 3I5FB 2CNPA 1XVJA 2KGRA 2D8NA 1DF0B 2G9BA 4XJKB 2V53A 1WLZA 1TNQA 2GGMA 5AFPA 5CSJA 1CM4A 2L4HA 1S6CA 2KAXA 2L51A 1MR8A 1S6IA 4PE4A 2ZKMX 1WRKA 1Y1UA 1JBAA 4PE7A 5F6TA 1YUUA 2KDHA 2M1KB 1NUBA 5CSFA 1LA3A 2DOQA 1F4QA 1SPYA 2K7BA 4GGFC 1ZMZA 4YGBB 1DT7B 1M31A 1TCFA 3C1VA 4NQGA 1A03A 3DF0B 1BJFA 5HLOA 3OHMB 4OVNF 1B8RA 3DVMA 1KCYA 3TS5B 2LHIA 4MRXA 1YTZC 1K95A 3WXAA 4DRWA 1L2OB 2NLNA 1DGVA 1FW4A 5CPVA 2ZFDA 2Y4QA 3OP0A 1U5IA 2H2KA 1GQMA 4JWQA 3FS7A 2PSRA 2A4JA 2KI6D 1PULA 2E30A 2KI6C 1SW8A 3AAKA 2HPSA 2NCPA 1J7RA 3BYAA 1IH0A 3EKJA 3FWCA 5AXIA 1R2UA 1QASA 1LKJA 3EKHA 4GGFA 2M0RA 1CFCA 4DIRA 3MSEB 2CT9A 4MSPA 3TS5C 2JC2A 1JUOA 1TNWA 1RTP1 2MHHA 1DMOA 1L2OC 2HF5A 1TNXA 2M1UA 1KQVA 1SK6D 1KK7Y 1SCMB 3IQQA 4I5LB 1B8CA 2LMUA 1C7WA 2FJUB 4N1GA 4C0LA 1NPQA 2L4IA 1WDCB 1SRAA 4AQJA 1JF0A 4MZJA 1HT9A 1W7JB 1N0YA 3TDIA 4A4BA 2L98A 1SY9A 5KU1A 1LINA 1ZUZA 3I5IB 1DJWA 1K8UA 2Y1MA 5I2LA 3WNXB 1YX7A 4QJ3B 2HQ8A 5DKQA 2LV7A 2E6WA 3SG4A 4OKHA 1XYDA 2AUCA 2LUCA 3PLFB 1YURA 3KHEA 1AK8A 2JWWA 1EG4A 4R1EA 4HSZA 1B9AA 2JPTA 1QXPA 1WY9A 3DF0A 3SG5A 1EXRA 1CDMA 1M45A 3WHUB 4YGCB 4BY5A 4CLNA 1SCMC 2JULA 1UHIA 4HRHA 1WDCC 3BUXB 2KGBC 2I18A 4PHKA 3KEVA 3RM1A 1NX1A 2MBXA 3I5IC 1CDLA 4HREE 1DJZA 1QLSA 1OMRA 5CSIA 3ICBA 4M2OA 2LAPA 2LANA 5G08A 1GGWA 1KFXL 3EK8A 2BECA 3TUYC 3WHTB 3LCPC 2H61C 4I5JA 3PM8A 1OSAA 2M97A 1J1DA 2F8PA 5I2QA 2LMVA 4NDDA 3SIBA 1NCYA 1X02A 2K0JA 2M8UA 1JF2A 3TDZA 2GGZA 1R6PA 3CWGA 2LP2A 3NSIA 4HRGA 2F2PA 1WRZA 1XFWO 1YUTA 4M2PA 5DKRA 2LVKA 5PALA 1AVSA 5HKWA 2LMTA 2I2RE 2F3ZA 3AKAA 1Y6WA 2AAOA 1K90D 4ZCUA 1KFXS 5DKNA 1KWOB 3OB1B 2JNXA 5AANA 4QJ5B 2G2BA 1FI5A 2BCBA 2ZNEA 4PDZA 1CTRA 2I7AA 4MEWA 2GV5A 1SCVA 1S5GY 4I5NB 2H61A 3KF9A 2HETA 1IJ6A 2WCBA 4GUKA 2M49B 2PMYA 1SL8A 3O78A 4A4CA 4JQ0D 2BBNA 1B7TY 3CR5X 2SASA 4PE0A 1UHJA 1S6JA 2JT3A 1A2XA 1IRJA 1PVAA 1MWNA 1DTLA 1SBJA 1TCOB 1H4BA 1LXFC 2LLSA 1KWOC 1RK9A 1A75B 1NP8A 1DJHA 2LCPA 1SNLA 2BKHB 3NSKA 3O6BA 4N1FA 3CGAA 1CKKA 4TNCA 4MVFA 5HKYA 4YGEB 1OZSA 1F54A 5CSNA 1KSMA 1QIWA 2F33A 4MN0A 1LA0A 2SCPA 1OOJA 3D0YB 2LUXA 1J55A 4GBAA 2PASA 4NDCA 2LLUA 2KNEA 2TN4A 3NSLA 5HLVA 2KYCA 1MXLC 3CTNA 4AOMA 3SG6A 5IBWA 5TNCA 2WCFA 4MZLA 2OPOA 1MUXA 1WRLA 3PN7B 2K2FA 3TZ1A 5KSZA 1FF1A 3AAJA 3IF7A 3GK4X 3VROA 1AP4A 2KAVA 1PSBA 1AUIB 2BE4A 3CZTX 2JT0A 2P6BB 3PFVA 4OR9B 2K8MB 1QV0A 1FBVA 1L7ZA 2L2EA 4PALA 1J7OA 4CIDA 4M2QA 1OE9B 1JSAA 1BF5A 3NSOA 4PHJA 2M7LA 3HCMA 2MLFC 4GGNA 4YI8A 5I8NA 2ZN8A 1B4CA 1Y1AA 1RWYA 2O5GA 3PN7C 1NYAA 1PRWA 4BY4A 1K9UA 2WORA 1PALA 3BUMB 3CLNA 1K2HA 1DF0A 1K93D 4XJKA 2MJWB 1CLMA 1A75A 1NSHA 1D1OA 1UHKA 3HX4A 4YBHB 3KPXA 3JVTB 3LL8B 1TIZA 3VGOA 1GGZA 1SR6B 3BUNB 3DVEA 5AEQA 2KBIA 2EHBA 2JTTA 3FIAA 2KFHA 1S26D 3D0YA 1Y0VH 1KK7Z 2MA2A 2WNDA 1HQVA 2ZNDA 4P2YB 1G4YR 3TUYB 1CMGA 5D7FA 1K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFP A;  4L9M A;  3VRQ A;  1XFY O;  3F45 A;  2LLT A;  1NIW A;  4GAO A;  1IGV A;  3GK1 A;  3I5H B;  1B1G A;  5D69 A;  2MRD A;  2BE6 A;  2LVV A;  4YRU A;  4QJ4 B;  2M9G A;  4PCW A;  2EGD A;  1MHO A;  1OMD A;  1KSO A;  2PAL A;  3JVT C;  1FI6 A;  2LM5 A;  1SR6 C;  2Q91 A;  1QX5 B;  3BOW B;  3DVJ A;  2PRU A;  1PK0 D;  2JOJ A;  4FQO A;  2KQ6 A;  2CCM A;  2LVI A;  2KFG A;  2KOT A;  1ZFS A;  1C07 A;  2JNF A;  1K94 A;  1N65 A;  2JTZ A;  3BUW B;  4PHN A;  1RRO A;  4N5X A;  4GNK B;  3IQO A;  2OS8 B;  1CNP A;  4USL A;  4PHM A;  3I5H C;  5B8I B;  1IQ5 A;  1OZO A;  3VRN A;  3EVU A;  2IS9 A;  3I5G B;  3CR4 X;  1DVI A;  1QAT A;  1EG3 A;  4WQ3 A;  1NCZ A;  1G8I A;  1BG1 A;  1UHH A;  3RLZ A;  3ZWH A;  2CTN A;  5HYD A;  5JOL A;  1H8B A;  1Q80 A;  1YUS A;  1UUS A;  2K2A A;  4YI9 A;  3VRP A;  1KFU S;  1YX8 A;  2JZI A;  3OX6 A;  4C0K A;  4DCK A;  1CLB A;  2JRF A;  4YGD B;  1XFU O;  3O2P A;  4PE1 A;  2L50 A;  2OS8 C;  4CFQ A;  3M0W A;  1K9K A;  4XYN A;  3LLE A;  2BL0 B;  3I5G C;  3BXK A;  2CBL A;  1W7I B;  3SG3 A;  1IJ5 A;  1ZOT B;  1C7V A;  1WLM A;  3CR2 A;  2LVJ A;  1F70 A;  1ODB A;  1S5G Z;  1DJG A;  1Y1X A;  3SG2 A;  1IWQ A;  1CLL A;  2L5X B;  2FCD A;  1NX3 A;  4P5O E;  3BOW A;  1UHN A;  1XA5 A;  2KAY A;  3DVK A;  1BU3 A;  1QVI Z;  1B7T Z;  2FOT A;  4JPZ B;  1DJY A;  2K7O A;  1BR1 B;  1NX2 A;  2K7D A;  4YGA A;  1SL7 A;  1BMO A;  2BL0 C;  3OX5 A;  2BBM A;  3A4U B;  1F71 A;  1MF8 B;  3A8R A;  3K21 A;  2M3W A;  4C0J A;  1CFF A;  5K89 A;  4I5K A;  1F8H A;  5ER4 X;  2KI4 B;  1B47 A;  2JXC A;  1YVH A;  1QJT A;  4NDB A;  4MZK A;  3D10 A;  3TDU A;  1LVC D;  1JWD A;  2NXQ A;  2JXL A;  1PSR A;  1S1E A;  1TRF A;  2LHL A;  1XFX O;  2KSP A;  3DD4 A;  2L0P A;  4MLW A;  2AMI A;  2LE9 B;  1PVB A;  3I5F C;  1TN4 A;  4IL1 A;  1QS7 A;  1M63 B;  2WC8 A;  3CS1 A;  1EH2 A;  1QIV A;  1UWO A;  4WRI A;  1TOP A;  2Y5I A;  5JJG A;  1RFJ A;  2KI4 C;  4GFT A;  1IQ3 A;  4ORC B;  3OB2 B;  3KO0 A;  1YRT B;  1V1F A;  1B8L A;  3BUO B;  2R2I A;  4GPL B;  1JFJ A;  1XFV O;  1CDN A;  2CXJ A;  4DS7 A;  3E3R A;  2LP3 A;  2PVB A;  1EJ3 A;  5BPJ A;  1XK4 C;  2VRG A;  1SL9 A;  5ER5 A;  1SYM A;  1SMG A;  1J1E A;  1ALW A;  1S3P A;  2K7C A;  3SJS A;  2Q4U A;  1GJY A;  2BCX A;  4ORB B;  1XO5 A;  2ZRS A;  4ICB A;  1FPW A;  2NCO A;  1J7Q A;  2M7N A;  3EVR A;  3VRR A;  1F4O A;  1N2D A;  1M39 A;  2JQ6 A;  1OQP A;  2F3Y A;  1SKT A;  1IKU A;  3EK4 A;  2KFF A;  3FWB A;  2O60 A;  3PAL A;  3ZNI A;  2COL B;  2LNK A;  1ALV A;  4WQ2 A;  5GQQ C;  1QLK A;  1KFU L;  4UPG A;  1BR4 B;  1NX0 A;  1XK4 A;  2QPT A;  1YVL A;  2FCE A;  1DGU A;  1ZAC A;  1KK8 B;  1S36 A;  5J3X A;  5AER A;  2MAZ A;  4U8D A;  4E68 A;  1BT6 A;  3EK7 A;  2KHN A;  1AJ5 A;  4D1E A;  2KBM A;  2NZ0 A;  3QRX A;  2KYF A;  3NXA A;  2KQY A;  3H4S E;  2K61 A;  3O4Y A;  3GOF A;  2OTG B;  1A4P A;  2JU0 A;  1MQ1 A;  1TNP A;  1DJX A;  2I94 A;  2ZRT A;  1TTX A;  1G33 A;  4MRY A;  4CPV A;  1BLQ A;  1V1G A;  1CDP A;  2WCE A;  4ORA B;  3EVV A;  3SG7 A;  1F55 A;  5HKZ A;  1JFK A;  1VRK A;  4FTG A;  3PAT A;  1K96 A;  4CFR A;  1CMF A;  3LK1 A;  1CFD A;  1EL4 A;  5KTY A;  1KK8 C;  1QV1 A;  5I2O A;  1A29 A;  1KQM B;  1IG5 A;  2F2O A;  4AQI A;  3JTD B;  2HQW A;  1REC A;  3AKB A;  1QX7 A;  4ZCV A;  4Q04 A;  2ZN9 A;  1CB1 A;  1UUR A;  2OTG C;  2EC6 B;  1NCX A;  3BQ3 A;  1NWD A;  1YRU B;  2M29 A;  1XFZ O;  3LK0 A;  1BOC A;  1M46 A;  2BCA A;  1JC2 A;  4F0Z B;  1U5I B;  1UP5 A;  1YR5 A;  4MBE A;  4OCI A;  2RGI A;  3SIA A;  1AJ4 A;  2Y1N A;  3GK2 A;  4OV2 A;  2LC5 A;  1QX2 A;  1J7P A;  4ETO A;  2JT8 A;  2B1U A;  1AHR A;  3PSR A;  1KQM C;  1BOD A;  2BKI B;  1QTX A;  2MLE C;  3JTD C;  2ISD A;  2QAC A;  2WOS A;  1CM1 A;  1RJV A;  1OMV A;  1QVI Y;  5FYX A;  1MXE A;  1E8A A;  2EC6 C;  1DJI A;  4DUQ A;  3I5F B;  2CNP A;  1XVJ A;  2KGR A;  2D8N A;  1DF0 B;  2G9B A;  4XJK B;  2V53 A;  1WLZ A;  1TNQ A;  2GGM A;  5AFP A;  5CSJ A;  1CM4 A;  2L4H A;  1S6C A;  2KAX A;  2L51 A;  1MR8 A;  1S6I A;  4PE4 A;  2ZKM X;  1WRK A;  1Y1U A;  1JBA A;  4PE7 A;  5F6T A;  1YUU A;  2KDH A;  2M1K B;  1NUB A;  5CSF A;  1LA3 A;  2DOQ A;  1F4Q A;  1SPY A;  2K7B A;  4GGF C;  1ZMZ A;  4YGB B;  1DT7 B;  1M31 A;  1TCF A;  3C1V A;  4NQG A;  1A03 A;  3DF0 B;  1BJF A;  5HLO A;  3OHM B;  4OVN F;  1B8R A;  3DVM A;  1KCY A;  3TS5 B;  2LHI A;  4MRX A;  1YTZ C;  1K95 A;  3WXA A;  4DRW A;  1L2O B;  2NLN A;  1DGV A;  1FW4 A;  5CPV A;  2ZFD A;  2Y4Q A;  3OP0 A;  1U5I A;  2H2K A;  1GQM A;  4JWQ A;  3FS7 A;  2PSR A;  2A4J A;  2KI6 D;  1PUL A;  2E30 A;  2KI6 C;  1SW8 A;  3AAK A;  2HPS A;  2NCP A;  1J7R A;  3BYA A;  1IH0 A;  3EKJ A;  3FWC A;  5AXI A;  1R2U A;  1QAS A;  1LKJ A;  3EKH A;  4GGF A;  2M0R A;  1CFC A;  4DIR A;  3MSE B;  2CT9 A;  4MSP A;  3TS5 C;  2JC2 A;  1JUO A;  1TNW A;  1RTP 1;  2MHH A;  1DMO A;  1L2O C;  2HF5 A;  1TNX A;  2M1U A;  1KQV A;  1SK6 D;  1KK7 Y;  1SCM B;  3IQQ A;  4I5L B;  1B8C A;  2LMU A;  1C7W A;  2FJU B;  4N1G A;  4C0L A;  1NPQ A;  2L4I A;  1WDC B;  1SRA A;  4AQJ A;  1JF0 A;  4MZJ A;  1HT9 A;  1W7J B;  1N0Y A;  3TDI A;  4A4B A;  2L98 A;  1SY9 A;  5KU1 A;  1LIN A;  1ZUZ A;  3I5I B;  1DJW A;  1K8U A;  2Y1M A;  5I2L A;  3WNX B;  1YX7 A;  4QJ3 B;  2HQ8 A;  5DKQ A;  2LV7 A;  2E6W A;  3SG4 A;  4OKH A;  1XYD A;  2AUC A;  2LUC A;  3PLF B;  1YUR A;  3KHE A;  1AK8 A;  2JWW A;  1EG4 A;  4R1E A;  4HSZ A;  1B9A A;  2JPT A;  1QXP A;  1WY9 A;  3DF0 A;  3SG5 A;  1EXR A;  1CDM A;  1M45 A;  3WHU B;  4YGC B;  4BY5 A;  4CLN A;  1SCM C;  2JUL A;  1UHI A;  4HRH A;  1WDC C;  3BUX B;  2KGB C;  2I18 A;  4PHK A;  3KEV A;  3RM1 A;  1NX1 A;  2MBX A;  3I5I C;  1CDL A;  4HRE E;  1DJZ A;  1QLS A;  1OMR A;  5CSI A;  3ICB A;  4M2O A;  2LAP A;  2LAN A;  5G08 A;  1GGW A;  1KFX L;  3EK8 A;  2BEC A;  3TUY C;  3WHT B;  3LCP C;  2H61 C;  4I5J A;  3PM8 A;  1OSA A;  2M97 A;  1J1D A;  2F8P A;  5I2Q A;  2LMV A;  4NDD A;  3SIB A;  1NCY A;  1X02 A;  2K0J A;  2M8U A;  1JF2 A;  3TDZ A;  2GGZ A;  1R6P A;  3CWG A;  2LP2 A;  3NSI A;  4HRG A;  2F2P A;  1WRZ A;  1XFW O;  1YUT A;  4M2P A;  5DKR A;  2LVK A;  5PAL A;  1AVS A;  5HKW A;  2LMT A;  2I2R E;  2F3Z A;  3AKA A;  1Y6W A;  2AAO A;  1K90 D;  4ZCU A;  1KFX S;  5DKN A;  1KWO B;  3OB1 B;  2JNX A;  5AAN A;  4QJ5 B;  2G2B A;  1FI5 A;  2BCB A;  2ZNE A;  4PDZ A;  1CTR A;  2I7A A;  4MEW A;  2GV5 A;  1SCV A;  1S5G Y;  4I5N B;  2H61 A;  3KF9 A;  2HET A;  1IJ6 A;  2WCB A;  4GUK A;  2M49 B;  2PMY A;  1SL8 A;  3O78 A;  4A4C A;  4JQ0 D;  2BBN A;  1B7T Y;  3CR5 X;  2SAS A;  4PE0 A;  1UHJ A;  1S6J A;  2JT3 A;  1A2X A;  1IRJ A;  1PVA A;  1MWN A;  1DTL A;  1SBJ A;  1TCO B;  1H4B A;  1LXF C;  2LLS A;  1KWO C;  1RK9 A;  1A75 B;  1NP8 A;  1DJH A;  2LCP A;  1SNL A;  2BKH B;  3NSK A;  3O6B A;  4N1F A;  3CGA A;  1CKK A;  4TNC A;  4MVF A;  5HKY A;  4YGE B;  1OZS A;  1F54 A;  5CSN A;  1KSM A;  1QIW A;  2F33 A;  4MN0 A;  1LA0 A;  2SCP A;  1OOJ A;  3D0Y B;  2LUX A;  1J55 A;  4GBA A;  2PAS A;  4NDC A;  2LLU A;  2KNE A;  2TN4 A;  3NSL A;  5HLV A;  2KYC A;  1MXL C;  3CTN A;  4AOM A;  3SG6 A;  5IBW A;  5TNC A;  2WCF A;  4MZL A;  2OPO A;  1MUX A;  1WRL A;  3PN7 B;  2K2F A;  3TZ1 A;  5KSZ A;  1FF1 A;  3AAJ A;  3IF7 A;  3GK4 X;  3VRO A;  1AP4 A;  2KAV A;  1PSB A;  1AUI B;  2BE4 A;  3CZT X;  2JT0 A;  2P6B B;  3PFV A;  4OR9 B;  2K8M B;  1QV0 A;  1FBV A;  1L7Z A;  2L2E A;  4PAL A;  1J7O A;  4CID A;  4M2Q A;  1OE9 B;  1JSA A;  1BF5 A;  3NSO A;  4PHJ A;  2M7L A;  3HCM A;  2MLF C;  4GGN A;  4YI8 A;  5I8N A;  2ZN8 A;  1B4C A;  1Y1A A;  1RWY A;  2O5G A;  3PN7 C;  1NYA A;  1PRW A;  4BY4 A;  1K9U A;  2WOR A;  1PAL A;  3BUM B;  3CLN A;  1K2H A;  1DF0 A;  1K93 D;  4XJK A;  2MJW B;  1CLM A;  1A75 A;  1NSH A;  1D1O A;  1UHK A;  3HX4 A;  4YBH B;  3KPX A;  3JVT B;  3LL8 B;  1TIZ A;  3VGO A;  1GGZ A;  1SR6 B;  3BUN B;  3DVE A;  5AEQ A;  2KBI A;  2EHB A;  2JTT A;  3FIA A;  2KFH A;  1S26 D;  3D0Y A;  1Y0V H;  1KK7 Z;  2MA2 A;  2WND A;  1HQV A;  2ZND A;  4P2Y B;  1G4Y R;  3TUY B;  1CMG A;  5D7F A;  1K9P A; 
#chains in the Genus database with same CATH topology
 1CFP A;  4L9M A;  3VRQ A;  1Z2C B;  1XFY O;  3F45 A;  2LLT A;  1NIW A;  2WCL A;  4GAO A;  1IGV A;  3GK1 A;  3I5H B;  1B1G A;  5D69 A;  2MRD A;  2BE6 A;  2LVV A;  4YRU A;  3Q8I A;  4QJ4 B;  2M9G A;  4PCW A;  2EGD A;  1MHO A;  1OMD A;  1KSO A;  2PAL A;  3JVT C;  1FI6 A;  2LM5 A;  1SR6 C;  2Q91 A;  1QX5 B;  3BOW B;  3DVJ A;  4F7F A;  2PRU A;  1PK0 D;  2JOJ A;  4FQO A;  2KQ6 A;  2CCM A;  2LVI A;  2KFG A;  2KOT A;  1ZFS A;  1C07 A;  2JNF A;  1K94 A;  1N65 A;  2JTZ A;  3BUW B;  2WC6 A;  4PHN A;  1RRO A;  1DEL A;  4N5X A;  4GNK B;  3IQO A;  2OS8 B;  1CNP A;  4USL A;  4PHM A;  3I5H C;  5B8I B;  1IQ5 A;  1OZO A;  3VRN A;  3EVU A;  2IS9 A;  3I5G B;  3CR4 X;  3NGV A;  1DVI A;  3S0B A;  1QAT A;  3D74 A;  1EG3 A;  3FE9 A;  4WQ3 A;  1NCZ A;  1G8I A;  1BG1 A;  1UHH A;  3RLZ A;  3ZWH A;  2CTN A;  5HYD A;  5JOL A;  1H8B A;  1Q80 A;  1YUS A;  1UUS A;  2K2A A;  4YI9 A;  3VRP A;  1GM0 A;  1KFU S;  1YX8 A;  2JZI A;  3OX6 A;  4C0K A;  4DCK A;  1CLB A;  2JRF A;  4YGD B;  1XFU O;  3O2P A;  4PE1 A;  2L50 A;  2OS8 C;  4CFQ A;  3M0W A;  1K9K A;  4XYN A;  3UNW A;  3LLE A;  2BL0 B;  3I5G C;  3BXK A;  2CBL A;  2WCH A;  1W7I B;  3SG3 A;  1IJ5 A;  3CZ2 A;  1ZOT B;  1C7V A;  1WLM A;  2BAP A;  3CR2 A;  2LVJ A;  1F70 A;  1ODB A;  1S5G Z;  1DJG A;  1Y1X A;  3SG2 A;  1IWQ A;  1CLL A;  2L5X B;  2FCD A;  1NX3 A;  3DZT A;  3BOW A;  4P5O E;  1UHN A;  3B87 A;  1XA5 A;  2KAY A;  3DVK A;  1BU3 A;  1QVI Z;  1B7T Z;  2FOT A;  4JPZ B;  1DJY A;  2K7O A;  1BR1 B;  1NX2 A;  2K7D A;  4YGA A;  1SL7 A;  1BMO A;  2BL0 C;  3D75 A;  3OX5 A;  2L2C A;  2BBM A;  3A4U B;  1F71 A;  1MF8 B;  3A8R A;  3K21 A;  2M3W A;  4C0J A;  1CFF A;  5K89 A;  4I5K A;  1F8H A;  5ER4 X;  2KI4 B;  1B47 A;  3CZ0 A;  2JXC A;  1YVH A;  1QJT A;  4NDB A;  2QEO A;  3D10 A;  4MZK A;  1LVC D;  3TDU A;  1JWD A;  2NXQ A;  2JXL A;  1PSR A;  1S1E A;  1TRF A;  2LHL A;  1XFX O;  2KSP A;  3DD4 A;  2JPO A;  2L0P A;  4MLW A;  2AMI A;  2LE9 B;  1PVB A;  3I5F C;  1TN4 A;  4IL1 A;  1QS7 A;  1M63 B;  2WC8 A;  1SSE B;  3CS1 A;  1EH2 A;  1QIV A;  1UWO A;  4WRI A;  5EL2 A;  1TOP A;  2Y5I A;  5JJG A;  3VB1 A;  1RFJ A;  2KI4 C;  4GFT A;  1IQ3 A;  4ORC B;  3OB2 B;  3KO0 A;  1YRT B;  1V1F A;  1B8L A;  3BFB A;  2H8V A;  2P71 A;  2R2I A;  3BUO B;  4GPL B;  3L4L A;  1JFJ A;  3EG5 B;  1XFV O;  2L5Y A;  1CDN A;  2KLD A;  2CXJ A;  4DS7 A;  1IIO A;  3E3R A;  2LP3 A;  2PVB A;  2K60 A;  5I94 A;  1EJ3 A;  5BPJ A;  1XK4 C;  2VRG A;  1SL9 A;  3IVT A;  5ER5 A;  1SYM A;  1SMG A;  1J1E A;  1ALW A;  1S3P A;  2K7C A;  3FE6 A;  3SJS A;  3CYZ A;  2Q4U A;  1GJY A;  2QDI A;  2BCX A;  4ORB B;  1XO5 A;  2ZRS A;  4ICB A;  1FPW A;  2NCO A;  1J7Q A;  2M7N A;  2WCJ A;  3EVR A;  3VRR A;  1F4O A;  3BFH A;  3BFA A;  2WCM A;  1N2D A;  1M39 A;  2JQ6 A;  1OQP A;  2F3Y A;  1SKT A;  1IKU A;  3EK4 A;  2KFF A;  3FWB A;  2O60 A;  3PAL A;  3CDN A;  3ZNI A;  3NHI A;  2COL B;  2LNK A;  1ALV A;  4WQ2 A;  5GQQ C;  1QLK A;  1KFU L;  4UPG A;  1BR4 B;  1NX0 A;  1XK4 A;  2QPT A;  1YVL A;  3O4X A;  3S0E A;  2FCE A;  5HL1 A;  2WCK A;  1DGU A;  1ZAC A;  1KK8 B;  1S36 A;  5J3X A;  5AER A;  2MAZ A;  4U8D A;  4E68 A;  3S0A A;  1BT6 A;  3EK7 A;  3V2L A;  2KHN A;  2QEH A;  1AJ5 A;  4D1E A;  4JD9 A;  2KBM A;  2NZ0 A;  3QRX A;  2KYF A;  3NXA A;  2KQY A;  3H4S E;  2K61 A;  3O4Y A;  3GOF A;  2OTG B;  3S0F A;  1A4P A;  2JU0 A;  1MQ1 A;  1TNP A;  1DJX A;  2I94 A;  3UO9 A;  2ZRT A;  1TTX A;  1G33 A;  4MRY A;  4CPV A;  1BLQ A;  1V1G A;  1CDP A;  2WCE A;  4ORA B;  3EVV A;  2PYQ A;  2GTE A;  3SG7 A;  5HKZ A;  1F55 A;  1JFK A;  1VRK A;  4FTG A;  3PAT A;  1K96 A;  2WC5 A;  3D78 A;  4CFR A;  1CMF A;  3LK1 A;  1CFD A;  1EL4 A;  5KTY A;  1KK8 C;  1QV1 A;  5I2O A;  2ERB A;  1A29 A;  1KQM B;  1IG5 A;  1QWV A;  2F2O A;  4AQI A;  3JTD B;  2HQW A;  1REC A;  3AKB A;  1QX7 A;  4ZCV A;  1DC1 A;  4Q04 A;  2ZN9 A;  1CB1 A;  1UUR A;  2OTG C;  5DIC A;  2EC6 B;  1NCX A;  3BQ3 A;  1NWD A;  1YRU B;  2M29 A;  1XFZ O;  3LK0 A;  1BOC A;  1M46 A;  2BCA A;  3DY9 A;  1JC2 A;  4F0Z B;  1U5I B;  1UP5 A;  1YR5 A;  4MBE A;  3D73 A;  4OCI A;  2RGI A;  3SIA A;  3K1E A;  1AJ4 A;  2Y1N A;  3GK2 A;  4OV2 A;  2LC5 A;  1QX2 A;  1J7P A;  4ETO A;  2JT8 A;  2B1U A;  1AHR A;  3PSR A;  1KQM C;  3OBV A;  1BOD A;  2BKI B;  1QTX A;  2MLE C;  3JTD C;  3B86 A;  5FI7 A;  2ISD A;  1LS8 A;  2QAC A;  2WOS A;  1CM1 A;  1RJV A;  1OMV A;  3D76 A;  1QVI Y;  5FYX A;  1MXE A;  2QEV A;  1E8A A;  2EC6 C;  1DJI A;  3CAB A;  3I5F B;  4DUQ A;  2CNP A;  1XVJ A;  2KGR A;  2D8N A;  1DF0 B;  2G9B A;  4XJK B;  1TUZ A;  2V53 A;  1WLZ A;  1TNQ A;  2GGM A;  5AFP A;  5CSJ A;  1CM4 A;  2L4H A;  1S6C A;  2KAX A;  2L51 A;  1MR8 A;  1S6I A;  4PE4 A;  1Z4H A;  1WRK A;  2ZKM X;  1Y1U A;  1JBA A;  4PE7 A;  5F6T A;  1YUU A;  2KDH A;  2M1K B;  3DXL A;  1NUB A;  5CSF A;  1LA3 A;  2DOQ A;  1F4Q A;  1SPY A;  2K7B A;  4GGF C;  1C3Y A;  1W9Z A;  1ZMZ A;  4YGB B;  1DT7 B;  1M31 A;  1TCF A;  3C1V A;  4NQG A;  1A03 A;  3DF0 B;  1BJF A;  3NHT A;  5HLO A;  3OHM B;  4OVN F;  1B8R A;  3DVM A;  1KCY A;  3S0D A;  3TS5 B;  3L4A A;  4INX A;  2LHI A;  4MRX A;  1YTZ C;  1K95 A;  3WXA A;  4DRW A;  1L2O B;  2NLN A;  1DGV A;  2KPH A;  1FW4 A;  3SS5 A;  5CPV A;  2ZFD A;  2Y4Q A;  1OOI X;  3OP0 A;  1U5I A;  2H2K A;  1GQM A;  1OOF A;  4JWQ A;  3FS7 A;  2PSR A;  2A4J A;  2KI6 D;  1PUL A;  2E30 A;  2KI6 C;  1SW8 A;  3AAK A;  2HPS A;  2NCP A;  1J7R A;  3BYA A;  1IH0 A;  3EKJ A;  3FWC A;  5AXI A;  1R2U A;  3DYE A;  1QAS A;  1LKJ A;  3EKH A;  4GGF A;  2M0R A;  1CFC A;  4DIR A;  3PM2 A;  3MSE B;  2BNX A;  2CT9 A;  4MSP A;  3TS5 C;  2JC2 A;  1JUO A;  1TNW A;  1RTP 1;  2MHH A;  1DMO A;  1L2O C;  2HF5 A;  1TNX A;  2M1U A;  1KQV A;  1SK6 D;  1KK7 Y;  1SCM B;  3IQQ A;  4I5L B;  1B8C A;  4JKT A;  2LMU A;  1C7W A;  1OOG A;  2FJU B;  4N1G A;  4C0L A;  1NPQ A;  2L4I A;  1WDC B;  1SRA A;  4AQJ A;  1JF0 A;  4MZJ A;  5FI2 A;  1HT9 A;  1W7J B;  1N0Y A;  3TDI A;  4A4B A;  2L98 A;  1SY9 A;  5KU1 A;  1LIN A;  1ZUZ A;  3B7A A;  3I5I B;  1DJW A;  1K8U A;  2Y1M A;  5I2L A;  3WNX B;  1YX7 A;  4QJ3 B;  2HQ8 A;  3PJI A;  5DKQ A;  2LV7 A;  2E6W A;  4FQT A;  2PQL A;  3SG4 A;  4OKH A;  1XYD A;  2AUC A;  2LUC A;  3PLF B;  3R1O A;  1YUR A;  3KHE A;  1AK8 A;  2JWW A;  3B88 A;  1EG4 A;  4R1E A;  4HSZ A;  1B9A A;  2JPT A;  1QXP A;  1WY9 A;  3DF0 A;  3N7H A;  1EXR A;  1CDM A;  1M45 A;  4KYN A;  4YGC B;  3SG5 A;  3WHU B;  4BY5 A;  1SCM C;  4CLN A;  2JUL A;  1UHI A;  4HRH A;  2FJY A;  3SS4 A;  1WDC C;  3BUX B;  2KGB C;  2I18 A;  4PHK A;  3KEV A;  1TWO A;  3RM1 A;  1NX1 A;  2MBX A;  3I5I C;  1CDL A;  4HRE E;  1DJZ A;  1QLS A;  1OMR A;  5CSI A;  3ICB A;  4M2O A;  2LAP A;  1DEK A;  1TUJ A;  2LAN A;  5G08 A;  1GGW A;  1KFX L;  3RZS A;  3EK8 A;  2BEC A;  3CZ1 A;  3TUY C;  3WHT B;  3LCP C;  2H61 C;  4I5J A;  3PM8 A;  1OSA A;  2M97 A;  1J1D A;  2F8P A;  4IJ7 A;  2LMV A;  4NDD A;  5I2Q A;  3SIB A;  1NCY A;  1X02 A;  2K0J A;  2M8U A;  1JF2 A;  3TDZ A;  2GGZ A;  3SS3 A;  1R6P A;  3CWG A;  2LP2 A;  3FE8 A;  3NSI A;  4HRG A;  2F2P A;  1WRZ A;  1XFW O;  1YUT A;  4M2P A;  5DKR A;  2LVK A;  5PAL A;  1AVS A;  5HKW A;  2LMT A;  2I2R E;  1XFR A;  2F3Z A;  3AKA A;  1Y6W A;  2AAO A;  1K90 D;  4ZCU A;  1KFX S;  5DKN A;  1KWO B;  3OB1 B;  2JNX A;  5AAN A;  4QJ5 B;  2G2B A;  1FI5 A;  2BCB A;  2ZNE A;  4PDZ A;  1CTR A;  1OW4 A;  2I7A A;  3BJH A;  4MEW A;  2GV5 A;  1SCV A;  1S5G Y;  5D3O A;  4I5N B;  2H61 A;  3KF9 A;  2HET A;  1IJ6 A;  2WCB A;  4GUK A;  2M49 B;  2PMY A;  1SL8 A;  3O78 A;  3S0G A;  4PT1 A;  4A4C A;  4JQ0 D;  2BBN A;  1B7T Y;  3CR5 X;  2SAS A;  4PE0 A;  1UHJ A;  1S6J A;  3B6X A;  2JT3 A;  1A2X A;  1IRJ A;  1PVA A;  3TUY B;  1MWN A;  1DTL A;  1SBJ A;  1TCO B;  1H4B A;  1DQE A;  1LXF C;  2LLS A;  1KWO C;  1RK9 A;  1A75 B;  1NP8 A;  1DJH A;  1ORG A;  1SNL A;  2BKH B;  2LCP A;  3NSK A;  3O6B A;  4N1F A;  3CGA A;  1CKK A;  4TNC A;  4MVF A;  5HKY A;  4YGE B;  1OZS A;  1F54 A;  5CSN A;  1KSM A;  1QIW A;  2F33 A;  4MN0 A;  1LA0 A;  2SCP A;  1OOJ A;  3D0Y B;  2KLE A;  2LUX A;  1J55 A;  4GBA A;  2PAS A;  4NDC A;  2LLU A;  3R1P A;  2KNE A;  2YGU A;  2TN4 A;  3NSL A;  5HLV A;  2KYC A;  1MXL C;  3CTN A;  4AOM A;  3SG6 A;  5IBW A;  5TNC A;  2WCF A;  5FI6 A;  4MZL A;  2P70 A;  2OPO A;  1MUX A;  1WRL A;  3PN7 B;  2K2F A;  3TZ1 A;  5KSZ A;  1FF1 A;  1C3Z A;  3AAJ A;  3IF7 A;  3GK4 X;  3QME A;  3VRO A;  1AP4 A;  2KAV A;  1PSB A;  1AUI B;  2BE4 A;  3CZT X;  2QEB A;  3R72 A;  2JT0 A;  2P6B B;  4INW A;  3PFV A;  4OR9 B;  2K8M B;  1QV0 A;  1FBV A;  1L7Z A;  2L2E A;  4PAL A;  1J7O A;  4CID A;  4M2Q A;  1OE9 B;  1JSA A;  1BF5 A;  3NSO A;  4PHJ A;  2M7L A;  3HCM A;  2MLF C;  4GGN A;  4YI8 A;  5I8N A;  2ZN8 A;  1B4C A;  1Y1A A;  1RWY A;  2O5G A;  3PN7 C;  1NYA A;  1PRW A;  4BY4 A;  1K9U A;  1T14 A;  2WOR A;  1PAL A;  3BUM B;  3CLN A;  1K2H A;  1DF0 A;  1K93 D;  4XJK A;  1P28 A;  1CLM A;  2MJW B;  1A75 A;  1NSH A;  1D1O A;  1UHK A;  3HX4 A;  4YBH B;  3KPX A;  3JVT B;  3LL8 B;  1TIZ A;  3VGO A;  1GGZ A;  1SR6 B;  3BUN B;  3DVE A;  5AEQ A;  2KBI A;  3OGN A;  2EHB A;  2JTT A;  3FIA A;  2KFH A;  1S26 D;  3D0Y A;  1Y0V H;  1KK7 Z;  2MA2 A;  2WND A;  1HQV A;  2ZND A;  3D77 A;  1G4Y R;  3L47 A;  1OOH A;  4P2Y B;  4OZD A;  3R1V A;  1CMG A;  5D7F A;  1K9P A; 
#chains in the Genus database with same CATH homology
 1CFP A;  4L9M A;  3VRQ A;  1XFY O;  3F45 A;  2LLT A;  1NIW A;  4GAO A;  1IGV A;  3GK1 A;  3I5H B;  1B1G A;  5D69 A;  2MRD A;  2BE6 A;  2LVV A;  4YRU A;  4QJ4 B;  2M9G A;  4PCW A;  2EGD A;  1MHO A;  1OMD A;  1KSO A;  2PAL A;  3JVT C;  1FI6 A;  2LM5 A;  1SR6 C;  2Q91 A;  1QX5 B;  3BOW B;  3DVJ A;  2PRU A;  1PK0 D;  2JOJ A;  4FQO A;  2KQ6 A;  2CCM A;  2LVI A;  2KFG A;  2KOT A;  1ZFS A;  1C07 A;  2JNF A;  1K94 A;  1N65 A;  2JTZ A;  3BUW B;  4PHN A;  1RRO A;  4N5X A;  4GNK B;  3IQO A;  2OS8 B;  1CNP A;  4USL A;  4PHM A;  3I5H C;  5B8I B;  1IQ5 A;  1OZO A;  3VRN A;  3EVU A;  2IS9 A;  3I5G B;  3CR4 X;  1DVI A;  1QAT A;  1EG3 A;  4WQ3 A;  1NCZ A;  1G8I A;  1BG1 A;  1UHH A;  3RLZ A;  3ZWH A;  2CTN A;  5HYD A;  5JOL A;  1H8B A;  1Q80 A;  1YUS A;  1UUS A;  2K2A A;  4YI9 A;  3VRP A;  1KFU S;  1YX8 A;  2JZI A;  3OX6 A;  4C0K A;  4DCK A;  1CLB A;  2JRF A;  4YGD B;  1XFU O;  3O2P A;  4PE1 A;  2L50 A;  2OS8 C;  4CFQ A;  3M0W A;  1K9K A;  4XYN A;  3LLE A;  2BL0 B;  3I5G C;  3BXK A;  2CBL A;  1W7I B;  3SG3 A;  1IJ5 A;  1ZOT B;  1C7V A;  1WLM A;  3CR2 A;  2LVJ A;  1F70 A;  1ODB A;  1S5G Z;  1DJG A;  1Y1X A;  3SG2 A;  1IWQ A;  1CLL A;  2L5X B;  2FCD A;  1NX3 A;  4P5O E;  3BOW A;  1UHN A;  1XA5 A;  2KAY A;  3DVK A;  1BU3 A;  1QVI Z;  1B7T Z;  2FOT A;  4JPZ B;  1DJY A;  2K7O A;  1BR1 B;  1NX2 A;  2K7D A;  4YGA A;  1SL7 A;  1BMO A;  2BL0 C;  3OX5 A;  2BBM A;  3A4U B;  1F71 A;  1MF8 B;  3A8R A;  3K21 A;  2M3W A;  4C0J A;  1CFF A;  5K89 A;  4I5K A;  1F8H A;  5ER4 X;  2KI4 B;  1B47 A;  2JXC A;  1YVH A;  1QJT A;  4NDB A;  4MZK A;  3D10 A;  3TDU A;  1LVC D;  1JWD A;  2NXQ A;  2JXL A;  1PSR A;  1S1E A;  1TRF A;  2LHL A;  1XFX O;  2KSP A;  3DD4 A;  2L0P A;  4MLW A;  2AMI A;  2LE9 B;  1PVB A;  3I5F C;  1TN4 A;  4IL1 A;  1QS7 A;  1M63 B;  2WC8 A;  3CS1 A;  1EH2 A;  1QIV A;  1UWO A;  4WRI A;  1TOP A;  2Y5I A;  5JJG A;  1RFJ A;  2KI4 C;  4GFT A;  1IQ3 A;  4ORC B;  3OB2 B;  3KO0 A;  1YRT B;  1V1F A;  1B8L A;  3BUO B;  2R2I A;  4GPL B;  1JFJ A;  1XFV O;  1CDN A;  2CXJ A;  4DS7 A;  3E3R A;  2LP3 A;  2PVB A;  1EJ3 A;  5BPJ A;  1XK4 C;  2VRG A;  1SL9 A;  5ER5 A;  1SYM A;  1SMG A;  1J1E A;  1ALW A;  1S3P A;  2K7C A;  3SJS A;  2Q4U A;  1GJY A;  2BCX A;  4ORB B;  1XO5 A;  2ZRS A;  4ICB A;  1FPW A;  2NCO A;  1J7Q A;  2M7N A;  3EVR A;  3VRR A;  1F4O A;  1N2D A;  1M39 A;  2JQ6 A;  1OQP A;  2F3Y A;  1SKT A;  1IKU A;  3EK4 A;  2KFF A;  3FWB A;  2O60 A;  3PAL A;  3ZNI A;  2COL B;  2LNK A;  1ALV A;  4WQ2 A;  5GQQ C;  1QLK A;  1KFU L;  4UPG A;  1BR4 B;  1NX0 A;  1XK4 A;  2QPT A;  1YVL A;  2FCE A;  1DGU A;  1ZAC A;  1KK8 B;  1S36 A;  5J3X A;  5AER A;  2MAZ A;  4U8D A;  4E68 A;  1BT6 A;  3EK7 A;  2KHN A;  1AJ5 A;  4D1E A;  2KBM A;  2NZ0 A;  3QRX A;  2KYF A;  3NXA A;  2KQY A;  3H4S E;  2K61 A;  3O4Y A;  3GOF A;  2OTG B;  1A4P A;  2JU0 A;  1MQ1 A;  1TNP A;  1DJX A;  2I94 A;  2ZRT A;  1TTX A;  1G33 A;  4MRY A;  4CPV A;  1BLQ A;  1V1G A;  1CDP A;  2WCE A;  4ORA B;  3EVV A;  3SG7 A;  1F55 A;  5HKZ A;  1JFK A;  1VRK A;  4FTG A;  3PAT A;  1K96 A;  4CFR A;  1CMF A;  3LK1 A;  1CFD A;  1EL4 A;  5KTY A;  1KK8 C;  1QV1 A;  5I2O A;  1A29 A;  1KQM B;  1IG5 A;  2F2O A;  4AQI A;  3JTD B;  2HQW A;  1REC A;  3AKB A;  1QX7 A;  4ZCV A;  4Q04 A;  2ZN9 A;  1CB1 A;  1UUR A;  2OTG C;  2EC6 B;  1NCX A;  3BQ3 A;  1NWD A;  1YRU B;  2M29 A;  1XFZ O;  3LK0 A;  1BOC A;  1M46 A;  2BCA A;  1JC2 A;  4F0Z B;  1U5I B;  1UP5 A;  1YR5 A;  4MBE A;  4OCI A;  2RGI A;  3SIA A;  1AJ4 A;  2Y1N A;  3GK2 A;  4OV2 A;  2LC5 A;  1QX2 A;  1J7P A;  4ETO A;  2JT8 A;  2B1U A;  1AHR A;  3PSR A;  1KQM C;  1BOD A;  2BKI B;  1QTX A;  2MLE C;  3JTD C;  2ISD A;  2QAC A;  2WOS A;  1CM1 A;  1RJV A;  1OMV A;  1QVI Y;  5FYX A;  1MXE A;  1E8A A;  2EC6 C;  1DJI A;  4DUQ A;  3I5F B;  2CNP A;  1XVJ A;  2KGR A;  2D8N A;  1DF0 B;  2G9B A;  4XJK B;  2V53 A;  1WLZ A;  1TNQ A;  2GGM A;  5AFP A;  5CSJ A;  1CM4 A;  2L4H A;  1S6C A;  2KAX A;  2L51 A;  1MR8 A;  1S6I A;  4PE4 A;  2ZKM X;  1WRK A;  1Y1U A;  1JBA A;  4PE7 A;  5F6T A;  1YUU A;  2KDH A;  2M1K B;  1NUB A;  5CSF A;  1LA3 A;  2DOQ A;  1F4Q A;  1SPY A;  2K7B A;  4GGF C;  1ZMZ A;  4YGB B;  1DT7 B;  1M31 A;  1TCF A;  3C1V A;  4NQG A;  1A03 A;  3DF0 B;  1BJF A;  5HLO A;  3OHM B;  4OVN F;  1B8R A;  3DVM A;  1KCY A;  3TS5 B;  2LHI A;  4MRX A;  1YTZ C;  1K95 A;  3WXA A;  4DRW A;  1L2O B;  2NLN A;  1DGV A;  1FW4 A;  5CPV A;  2ZFD A;  2Y4Q A;  3OP0 A;  1U5I A;  2H2K A;  1GQM A;  4JWQ A;  3FS7 A;  2PSR A;  2A4J A;  2KI6 D;  1PUL A;  2E30 A;  2KI6 C;  1SW8 A;  3AAK A;  2HPS A;  2NCP A;  1J7R A;  3BYA A;  1IH0 A;  3EKJ A;  3FWC A;  5AXI A;  1R2U A;  1QAS A;  1LKJ A;  3EKH A;  4GGF A;  2M0R A;  1CFC A;  4DIR A;  3MSE B;  2CT9 A;  4MSP A;  3TS5 C;  2JC2 A;  1JUO A;  1TNW A;  1RTP 1;  2MHH A;  1DMO A;  1L2O C;  2HF5 A;  1TNX A;  2M1U A;  1KQV A;  1SK6 D;  1KK7 Y;  1SCM B;  3IQQ A;  4I5L B;  1B8C A;  2LMU A;  1C7W A;  2FJU B;  4N1G A;  4C0L A;  1NPQ A;  2L4I A;  1WDC B;  1SRA A;  4AQJ A;  1JF0 A;  4MZJ A;  1HT9 A;  1W7J B;  1N0Y A;  3TDI A;  4A4B A;  2L98 A;  1SY9 A;  5KU1 A;  1LIN A;  1ZUZ A;  3I5I B;  1DJW A;  1K8U A;  2Y1M A;  5I2L A;  3WNX B;  1YX7 A;  4QJ3 B;  2HQ8 A;  5DKQ A;  2LV7 A;  2E6W A;  3SG4 A;  4OKH A;  1XYD A;  2AUC A;  2LUC A;  3PLF B;  1YUR A;  3KHE A;  1AK8 A;  2JWW A;  1EG4 A;  4R1E A;  4HSZ A;  1B9A A;  2JPT A;  1QXP A;  1WY9 A;  3DF0 A;  3SG5 A;  1EXR A;  1CDM A;  1M45 A;  3WHU B;  4YGC B;  4BY5 A;  4CLN A;  1SCM C;  2JUL A;  1UHI A;  4HRH A;  1WDC C;  3BUX B;  2KGB C;  2I18 A;  4PHK A;  3KEV A;  3RM1 A;  1NX1 A;  2MBX A;  3I5I C;  1CDL A;  4HRE E;  1DJZ A;  1QLS A;  1OMR A;  5CSI A;  3ICB A;  4M2O A;  2LAP A;  2LAN A;  5G08 A;  1GGW A;  1KFX L;  3EK8 A;  2BEC A;  3TUY C;  3WHT B;  3LCP C;  2H61 C;  4I5J A;  3PM8 A;  1OSA A;  2M97 A;  1J1D A;  2F8P A;  5I2Q A;  2LMV A;  4NDD A;  3SIB A;  1NCY A;  1X02 A;  2K0J A;  2M8U A;  1JF2 A;  3TDZ A;  2GGZ A;  1R6P A;  3CWG A;  2LP2 A;  3NSI A;  4HRG A;  2F2P A;  1WRZ A;  1XFW O;  1YUT A;  4M2P A;  5DKR A;  2LVK A;  5PAL A;  1AVS A;  5HKW A;  2LMT A;  2I2R E;  2F3Z A;  3AKA A;  1Y6W A;  2AAO A;  1K90 D;  4ZCU A;  1KFX S;  5DKN A;  1KWO B;  3OB1 B;  2JNX A;  5AAN A;  4QJ5 B;  2G2B A;  1FI5 A;  2BCB A;  2ZNE A;  4PDZ A;  1CTR A;  2I7A A;  4MEW A;  2GV5 A;  1SCV A;  1S5G Y;  4I5N B;  2H61 A;  3KF9 A;  2HET A;  1IJ6 A;  2WCB A;  4GUK A;  2M49 B;  2PMY A;  1SL8 A;  3O78 A;  4A4C A;  4JQ0 D;  2BBN A;  1B7T Y;  3CR5 X;  2SAS A;  4PE0 A;  1UHJ A;  1S6J A;  2JT3 A;  1A2X A;  1IRJ A;  1PVA A;  1MWN A;  1DTL A;  1SBJ A;  1TCO B;  1H4B A;  1LXF C;  2LLS A;  1KWO C;  1RK9 A;  1A75 B;  1NP8 A;  1DJH A;  2LCP A;  1SNL A;  2BKH B;  3NSK A;  3O6B A;  4N1F A;  3CGA A;  1CKK A;  4TNC A;  4MVF A;  5HKY A;  4YGE B;  1OZS A;  1F54 A;  5CSN A;  1KSM A;  1QIW A;  2F33 A;  4MN0 A;  1LA0 A;  2SCP A;  1OOJ A;  3D0Y B;  2LUX A;  1J55 A;  4GBA A;  2PAS A;  4NDC A;  2LLU A;  2KNE A;  2TN4 A;  3NSL A;  5HLV A;  2KYC A;  1MXL C;  3CTN A;  4AOM A;  3SG6 A;  5IBW A;  5TNC A;  2WCF A;  4MZL A;  2OPO A;  1MUX A;  1WRL A;  3PN7 B;  2K2F A;  3TZ1 A;  5KSZ A;  1FF1 A;  3AAJ A;  3IF7 A;  3GK4 X;  3VRO A;  1AP4 A;  2KAV A;  1PSB A;  1AUI B;  2BE4 A;  3CZT X;  2JT0 A;  2P6B B;  3PFV A;  4OR9 B;  2K8M B;  1QV0 A;  1FBV A;  1L7Z A;  2L2E A;  4PAL A;  1J7O A;  4CID A;  4M2Q A;  1OE9 B;  1JSA A;  1BF5 A;  3NSO A;  4PHJ A;  2M7L A;  3HCM A;  2MLF C;  4GGN A;  4YI8 A;  5I8N A;  2ZN8 A;  1B4C A;  1Y1A A;  1RWY A;  2O5G A;  3PN7 C;  1NYA A;  1PRW A;  4BY4 A;  1K9U A;  2WOR A;  1PAL A;  3BUM B;  3CLN A;  1K2H A;  1DF0 A;  1K93 D;  4XJK A;  2MJW B;  1CLM A;  1A75 A;  1NSH A;  1D1O A;  1UHK A;  3HX4 A;  4YBH B;  3KPX A;  3JVT B;  3LL8 B;  1TIZ A;  3VGO A;  1GGZ A;  1SR6 B;  3BUN B;  3DVE A;  5AEQ A;  2KBI A;  2EHB A;  2JTT A;  3FIA A;  2KFH A;  1S26 D;  3D0Y A;  1Y0V H;  1KK7 Z;  2MA2 A;  2WND A;  1HQV A;  2ZND A;  4P2Y B;  1G4Y R;  3TUY B;  1CMG A;  5D7F A;  1K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...