4DS7A

Crystal structure of yeast calmodulin bound to the c-terminal fragment of spindle pole body protein spc110
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
144
structure length
144
Chain Sequence
NLTEEQIAEFKEAFALFDKDNSGSISASELATVMRSLGLSPSEAEVADLMNEIDVDGNHAIEFSEFLALMSRQLKCNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIKQFAALLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title The molecular architecture of the yeast spindle pole body core determined by Bayesian integrative modeling.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Protein binding
total genus 50
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ds7A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ds7A01
1CB1A 1AUIB 4PE4A 2K0JA 4FTGA 1WRZA 4L9MA 4YGEB 1AK8A 3SG3A 3CR4X 2BE4A 3PN7C 2HQWA 1DT7B 4MBEA 5ER5A 2IS9A 1F70A 2HQ8A 2WC8A 2KSPA 2NCOA 1ZUZA 3WHTB 1L2OB 1Q80A 1TCFA 2NZ0A 1A75B 1QX2A 2JXCA 1F71A 1J7PA 2V53A 4P5OE 2KAVA 1SCVA 1LKJA 3O78A 4A4CA 4OR9B 5G08A 1G33A 1S6CA 2NXQA 2CXJA 5AEQA 4PCWA 1NWDA 5I2OA 4CFQA 3EK8A 2WORA 1XA5A 2PSRA 1S1EA 1J1EA 2LVJA 1DGUA 2KYCA 3I5IC 2ZNEA 4PE0A 1NCXA 3O4YA 2KI6D 2M8UA 1KQMB 3CZTX 2Y1MA 3EKJA 4FQOA 2MAZA 1K96A 2LUXA 3SG2A 1HQVA 1K9UA 1S36A 3EVVA 2FOTA 1B8LA 1DMOA 3NSKA 2JU0A 2H61A 3WHUB 2LC5A 1QX7A 1OE9B 2CNPA 1QV1A 2GGMA 1BOCA 3CR2A 1MQ1A 1C07A 1G4YR 4PHNA 1EG3A 1FI6A 3EK4A 2LMUA 2L4IA 1YRTB 2BECA 1Y1UA 4NDCA 1SK6D 2M1KB 1N65A 2AUCA 2M97A 2RGIA 2ZRSA 3DVKA 1D1OA 1KWOC 2ISDA 1SRAA 1CLBA 1U5IA 1BT6A 3LK0A 1K93D 1M46A 1XFXO 1QJTA 4M2PA 4CFRA 1YR5A 1JFJA 2GV5A 1AHRA 3ICBA 1XFUO 2KI4B 3GK1A 2CCMA 1PSRA 1MWNA 4GFTA 4QJ3B 1PVBA 4GGNA 2R2IA 1M39A 1XFWO 4I5KA 1JFKA 2TN4A 3JTDC 1XK4A 4M2QA 1EJ3A 1B4CA 3O2PA 1MXLC 1SW8A 3GK2A 1IJ5A 2AAOA 3GK4X 2Y1NA 4C0JA 4XYNA 1WRLA 3BXKA 1M31A 3DF0A 2H2KA 4DIRA 1WDCB 1ALWA 3VROA 2KFGA 5CSFA 1R2UA 4GNKB 2Y4QA 1MXEA 3OX5A 2SASA 5AFPA 1K2HA 4GGFC 3EKHA 5DKQA 1JC2A 1NX0A 1H8BA 3CLNA 1QLSA 3TUYC 1F4OA 2LUCA 1AVSA 1CFPA 1YX8A 4CLNA 2PALA 3KEVA 5I2QA 1S6IA 1RJVA 2K61A 1BR1B 3EK7A 2JT8A 2E30A 4GBAA 1NUBA 1TTXA 5HKZA 5HKYA 3CWGA 2LVIA 1YVLA 3CTNA 5TNCA 4ZCVA 2KYFA 3CR5X 3OB1B 1Y1AA 1J7RA 1TNWA 3SJSA 2KI6C 1LA3A 4NDBA 2PMYA 1M45A 1OMVA 1LVCD 1RWYA 5I8NA 2Q91A 3LL8B 3VRRA 4HSZA 1IRJA 1K9KA 4ORBB 1SR6B 2BL0B 4YBHB 1B8RA 4C0KA 4XJKA 5D7FA 2KAXA 1CFDA 4XJKB 2PASA 1BMOA 2LNKA 2WCEA 1BF5A 1TN4A 1IG5A 5ER4X 1KK8B 5CSJA 3AKAA 1AP4A 1XFVO 1CDPA 4GAOA 1LXFC 5DKNA 1NP8A 1KFUS 2ZNDA 4M2OA 1A75A 4N1FA 1CDNA 3NXAA 3GOFA 1CM1A 3I5HB 1KSOA 1RK9A 1FBVA 3JVTC 2JOJA 2KGRA 4BY4A 4DUQA 1YUSA 1DGVA 3KF9A 4HRGA 1MR8A 2BCXA 3I5GB 2JULA 5CSIA 2WCFA 2MBXA 1J55A 2LVKA 3TS5B 1YURA 3OX6A 5B8IB 4PE7A 3DVMA 2L0PA 1NCYA 1DF0B 4I5LB 3MSEB 1UHHA 1OOJA 1ZOTB 2JT0A 2JXLA 2FJUB 4QJ5B 1K8UA 1PULA 3OB2B 2MLEC 3PN7B 1DTLA 2BKHB 2H61C 1MF8B 2K7OA 1YTZC 2GGZA 1CMGA 2L98A 2E6WA 2MA2A 2P6BB 1GJYA 2PVBA 2BBMA 1Y1XA 1BG1A 1TCOB 1WLMA 3ZWHA 1CNPA 1B9AA 5KSZA 1ZACA 3HCMA 5FYXA 4AOMA 1CFFA 5AERA 3TDIA 1KK7Z 1QVIZ 1MHOA 3D0YA 3TDZA 3D0YB 3FIAA 1KFXS 1JF2A 1SCMB 1QATA 1JUOA 3IF7A 4ETOA 2BKIB 1R6PA 1CKKA 2MRDA 1CM4A 3VGOA 4HRHA 1VRKA 2O60A 3BUOB 1B8CA 2I7AA 2F2OA 1Y0VH 1V1GA 2KQ6A 3WNXB 2L51A 4N5XA 4R1EA 4OVNF 4MVFA 1IH0A 2L50A 2CTNA 2OTGC 2LCPA 3QRXA 4WRIA 1GGZA 3SG4A 4F0ZB 1GQMA 2L5XB 3FWCA 3KHEA 5GQQC 4YGCB 3D10A 2LLSA 2EC6B 1S3PA 1WDCC 1SNLA 3I5FC 3NSOA 1BLQA 1KWOB 1NSHA 1QIVA 3E3RA 1UURA 4DS7A 4IL1A 4YGDB 1SL7A 3BOWA 1QASA 4MSPA 1YRUB 3BOWB 1ODBA 1NYAA 1XO5A 2KFFA 5AANA 4C0LA 1DJHA 3VRQA 3PLFB 4NQGA 4D1EA 1CTRA 1B7TZ 1RFJA 2M9GA 4DRWA 4A4BA 4HREE 1XFZO 3F45A 5HLVA 2ZN8A 2AMIA 1W7IB 1G8IA 2D8NA 2F3ZA 1AJ5A 1A2XA 1XFYO 3NSIA 4JQ0D 1PVAA 5IBWA 1LA0A 1QXPA 2LHLA 3JTDB 1WRKA 2JTZA 4PE1A 1SPYA 4WQ3A 1CDLA 4OKHA 1B47A 1DJZA 3BQ3A 4MLWA 4ICBA 5HYDA 2M0RA 2BE6A 1F4QA 2MHHA 2JNFA 1A4PA 2LP2A 2NCPA 3H4SE 1OMDA 4U8DA 3CGAA 2OS8B 1DJWA 1SR6C 3SG7A 1RROA 3K21A 4GGFA 2M49B 3LK1A 3PSRA 2KGBC 1Y6WA 3SIBA 1OZSA 1TNXA 2LMVA 1DJGA 2G2BA 2FCEA 4MEWA 4YRUA 1J7OA 4YGBB 3EVRA 1KK8C 2LM5A 1JF0A 2KDHA 4Q04A 1L7ZA 2K7DA 2MLFC 2CBLA 5K89A 2JWWA 2K7CA 3SG6A 1FPWA 1L2OC 1K9PA 1S5GZ 2KBIA 3PM8A 1SBJA 5D69A 1X02A 5J3XA 2EHBA 2JZIA 2LVVA 1IWQA 1QIWA 2WOSA 2KQYA 3IQQA 1YUTA 2NLNA 2LANA 1CMFA 4MRYA 2BBNA 1EL4A 1BJFA 1NIWA 4AQIA 3BUMB 2JNXA 1OQPA 2JPTA 3RLZA 1DVIA 2JQ6A 1WLZA 1CLMA 1IKUA 5JJGA 1UHIA 1OZOA 3SG5A 1C7WA 1KQMC 1KFUL 4E68A 1DF0A 4GUKA 2KAYA 2G9BA 3TZ1A 2PRUA 1EG4A 2F3YA 4P2YB 3FWBA 1PALA 4ORAB 5F6TA 1TRFA 4UPGA 2MJWB 5AXIA 1K90D 1JSAA 3AKBA 2Y5IA 1GGWA 1KQVA 3JVTB 1UWOA 2HPSA 2WCBA 1SYMA 2B1UA 1DJXA 1KK7Y 1QVIY 5KTYA 2L4HA 4MN0A 1TNPA 2F33A 2QACA 1NCZA 1V1FA 3A8RA 1SCMC 1QTXA 1N0YA 1TNQA 1UUSA 1BR4B 3BUXB 4OCIA 1WY9A 2VRGA 2ZFDA 3KO0A 2KOTA 4USLA 2LAPA 1QS7A 3BUNB 2JC2A 3I5IB 2BCBA 3M0WA 1IGVA 2M7NA 3PATA 3ZNIA 2KI4C 1CDMA 2LLTA 4PHJA 1IQ3A 5KU1A 1IJ6A 2K2AA 2FCDA 2K2FA 3LLEA 4TNCA 4CPVA 3DVJA 1UP5A 1FW4A 4I5JA 4PHMA 3O6BA 1XVJA 3BUWB 1BU3A 1KFXL 3OP0A 2M29A 3IQOA 2EC6C 1XK4C 5CPVA 3VRPA 3C1VA 3RM1A 4JWQA 3CS1A 2F2PA 3PALA 3OHMB 2JRFA 2ZN9A 3EVUA 4PHKA 1U5IB 4ZCUA 1BODA 2M7LA 3AAKA 4PALA 1SMGA 2I2RE 1B7TY 1K94A 1EXRA 1MUXA 1SY9A 1UHNA 1N2DA 1C7VA 4YGAA 1JWDA 2ZRTA 4MZKA 1ALVA 5HLOA 4GPLB 4MZLA 1NX3A 1HT9A 4OV2A 2M3WA 1TIZA 1FF1A 2COLB 2LHIA 1FI5A 2JTTA 1ZFSA 2JT3A 1KCYA 5I2LA 2I18A 1NPQA 4MZJA 1S6JA 1RECA 3BYAA 1SL9A 1ZMZA 1DJIA 4I5NB 1PSBA 2OTGB 2LE9B 1AJ4A 1EH2A 4NDDA 1M63B 2HETA 2F8PA 1CLLA 1S26D 2KFHA 5PALA 1SKTA 1YVHA 1NX2A 1QLKA 2QPTA 1OSAA 2Q4UA 1DJYA 1A29A 3DF0B 1A03A 1RTP1 3I5FB 2HF5A 2OS8C 2WNDA 1UHJA 4ORCB 4PDZA 1H4BA 2OPOA 1K95A 3AAJA 3HX4A 2SCPA 1UHKA 1TOPA 1J1DA 2K8MB 1B1GA 3WXAA 1IQ5A 1YX7A 5JOLA 1F54A 2BL0C 2LP3A 3FS7A 2KBMA 5CSNA 4BY5A 4YI9A 2I94A 4MRXA 3NSLA 2LMTA 3LCPC 2DOQA 2LV7A 5DKRA 4CIDA 1QV0A 2O5GA 3DVEA 3TUYB 1S5GY 2KNEA 4DCKA 1YUUA 2L2EA 4YI8A 4JPZB 1W7JB 4WQ2A 2K7BA 1PK0D 3SIAA 2LLUA 3VRNA 1KSMA 1E8AA 2KHNA 3TDUA 1NX1A 3I5HC 3KPXA 1CFCA 2ZKMX 2CT9A 3A4UB 1F8HA 1SL8A 1PRWA 2BCAA 2A4JA 3I5GC 4N1GA 4QJ4B 5BPJA 1J7QA 3PFVA 2M1UA 1LINA 3DD4A 1F55A 1JBAA 5HKWA 1OMRA 1XYDA 2EGDA 3TS5C 4AQJA 1QX5B
chains in the Genus database with same CATH superfamily
1CB1A 1AUIB 4PE4A 3S0AA 2K0JA 4FTGA 1WRZA 4L9MA 4YGEB 2KLDA 1AK8A 3SG3A 3CR4X 2BE4A 3PN7C 2HQWA 1DT7B 4MBEA 5ER5A 2IS9A 1DC1A 1F70A 2HQ8A 2WC8A 2KSPA 2NCOA 1ZUZA 3WHTB 1L2OB 1Q80A 1TCFA 2NZ0A 5EL2A 1A75B 1QX2A 2JXCA 1F71A 2BNXA 1J7PA 2V53A 4P5OE 2KAVA 1SCVA 1LKJA 3O78A 4A4CA 4OR9B 5G08A 1G33A 4PT1A 1S6CA 1OOIX 2NXQA 2CXJA 5AEQA 1C3ZA 4PCWA 1NWDA 5I2OA 4CFQA 3EK8A 2WORA 1XA5A 2PSRA 1S1EA 1J1EA 3L4LA 2LVJA 1LS8A 3SS4A 1DGUA 2KYCA 3I5IC 2ZNEA 4PE0A 1NCXA 3O4YA 2KI6D 2M8UA 1OW4A 1KQMB 3CZTX 2Y1MA 3EKJA 4FQOA 2MAZA 1K96A 2LUXA 3SG2A 1HQVA 1K9UA 1S36A 3EVVA 2FOTA 1B8LA 1DMOA 3NSKA 2JU0A 2H61A 3WHUB 2LC5A 1QX7A 1OE9B 2CNPA 1QV1A 2GGMA 1BOCA 3FE8A 3CR2A 1MQ1A 1C07A 1Z4HA 1G4YR 4PHNA 1EG3A 1FI6A 3EK4A 2LMUA 2L4IA 1YRTB 2BECA 1P28A 1Y1UA 2H8VA 4NDCA 1SK6D 2M1KB 4F7FA 1N65A 2AUCA 2M97A 2RGIA 2ZRSA 3DVKA 1D1OA 1KWOC 2ISDA 1SRAA 1CLBA 1U5IA 1BT6A 3LK0A 1K93D 1M46A 4INWA 1XFXO 1QJTA 4M2PA 4CFRA 1YR5A 1JFJA 2GV5A 3O4XA 1AHRA 3ICBA 1XFUO 2KI4B 3GK1A 2CCMA 1PSRA 1MWNA 3PM2A 1C3YA 4GFTA 4QJ3B 1PVBA 3R1VA 4GGNA 2R2IA 5D3OA 1M39A 1XFWO 4I5KA 1JFKA 2TN4A 3JTDC 3VB1A 4JD9A 1XK4A 2QEBA 1EJ3A 4M2QA 1B4CA 3O2PA 1MXLC 1SW8A 3GK2A 1IJ5A 2AAOA 3GK4X 2WCHA 2Y1NA 3K1EA 3V2LA 4XYNA 4C0JA 1WRLA 3OBVA 3CABA 3BXKA 1M31A 3DF0A 2H2KA 4DIRA 1WDCB 1ALWA 3VROA 3S0FA 2KFGA 5CSFA 1R2UA 4GNKB 2Y4QA 1ORGA 1MXEA 3OX5A 3UNWA 2SASA 2WC6A 5AFPA 1K2HA 4GGFC 3EKHA 5DKQA 1JC2A 1NX0A 1H8BA 3CLNA 1QLSA 3BJHA 3TUYC 1F4OA 2LUCA 1AVSA 1CFPA 1YX8A 4IJ7A 4CLNA 2PALA 3KEVA 5FI2A 5I2QA 3CDNA 1S6IA 1RJVA 2K61A 1BR1B 3EK7A 2JT8A 2E30A 4GBAA 1NUBA 1TTXA 5HKZA 5HKYA 3CWGA 3DY9A 2LVIA 1YVLA 3CTNA 5TNCA 4ZCVA 2KYFA 3CR5X 3OB1B 1Y1AA 1J7RA 1TNWA 3SJSA 2KI6C 1LA3A 2WCKA 4NDBA 1QWVA 2PMYA 1M45A 2L5YA 1OMVA 1LVCD 3PJIA 1RWYA 5I8NA 2Q91A 3LL8B 3VRRA 1DELA 4HSZA 1IRJA 1K9KA 4ORBB 1SR6B 2BL0B 4YBHB 1B8RA 4C0KA 4XJKA 5D7FA 2KAXA 1CFDA 4XJKB 2PASA 1BMOA 2LNKA 2WCEA 1BF5A 1TN4A 1IG5A 5ER4X 4INXA 1H4BA 1KK8B 5CSJA 3AKAA 1AP4A 1XFVO 1CDPA 4GAOA 1LXFC 5DKNA 1NP8A 1KFUS 1IIOA 2ZNDA 4M2OA 1A75A 3Q8IA 4N1FA 1CDNA 3NXAA 3GOFA 1CM1A 3I5HB 1KSOA 1RK9A 1FBVA 1TUZA 2JOJA 2KGRA 3JVTC 4BY4A 4DUQA 1YUSA 1DGVA 3KF9A 4HRGA 1MR8A 1TWOA 2BCXA 2JULA 3I5GB 5CSIA 2WCFA 2MBXA 3EG5B 1J55A 2LVKA 3TS5B 1YURA 3OX6A 5B8IB 3B86A 4PE7A 3DVMA 2L0PA 1NCYA 3QMEA 1DF0B 4I5LB 3MSEB 1UHHA 1OOJA 1ZOTB 2JT0A 2JXLA 2FJUB 4QJ5B 1K8UA 1PULA 3OB2B 2MLEC 3PN7B 1DTLA 2BKHB 2H61C 2FJYA 1MF8B 1W9ZA 2K7OA 1YTZC 2GGZA 1CMGA 2L98A 2E6WA 2MA2A 2P6BB 2JPOA 2YGUA 1GJYA 2PVBA 2BBMA 1Y1XA 1BG1A 1TCOB 1WLMA 1OOGA 3IVTA 3ZWHA 1CNPA 1B9AA 5KSZA 1ZACA 3HCMA 5FYXA 4AOMA 2QEOA 1CFFA 5AERA 3TDIA 1KK7Z 1QVIZ 1MHOA 3D0YA 3TDZA 4OZDA 3D0YB 3FIAA 1KFXS 1JF2A 1SCMB 1QATA 1JUOA 3IF7A 4ETOA 2BKIB 1R6PA 1CKKA 2MRDA 1CM4A 3VGOA 4HRHA 3L47A 1VRKA 2O60A 3BUOB 1B8CA 2WCMA 3BFBA 2I7AA 2F2OA 1Y0VH 1V1GA 2KQ6A 3WNXB 4JKTA 2L51A 4N5XA 4R1EA 4OVNF 4MVFA 1IH0A 2L50A 2WCLA 2CTNA 2OTGC 2LCPA 3B88A 3QRXA 4WRIA 1GGZA 3SG4A 2KPHA 4F0ZB 1GQMA 2L5XB 3FWCA 3KHEA 5GQQC 4YGCB 3D10A 2LLSA 2EC6B 1S3PA 1WDCC 1SNLA 3I5FC 3NSOA 1BLQA 1KWOB 1NSHA 1QIVA 3E3RA 1UURA 4DS7A 4IL1A 4YGDB 1SL7A 3BOWA 1QASA 3N7HA 4MSPA 1YRUB 3BOWB 1ODBA 1NYAA 1XO5A 2KFFA 5AANA 4C0LA 1DJHA 3VRQA 3PLFB 4NQGA 4D1EA 1CTRA 1B7TZ 3D76A 1RFJA 2M9GA 4DRWA 4A4BA 4HREE 1OOFA 1XFZO 3D77A 3F45A 2ZN8A 5FI7A 2AMIA 5HLVA 1W7IB 1G8IA 2D8NA 2F3ZA 1AJ5A 1A2XA 1XFYO 2QEHA 3NSIA 4JQ0D 1PVAA 3B87A 5IBWA 1LA0A 1QXPA 2LHLA 3JTDB 1WRKA 2JTZA 3S0EA 4PE1A 1SPYA 4WQ3A 1CDLA 4OKHA 1B47A 1DJZA 2PQLA 3BQ3A 3NHTA 4MLWA 4ICBA 5HYDA 2M0RA 2BE6A 1DEKA 1F4QA 2MHHA 2JNFA 1A4PA 1Z2CB 2LP2A 2NCPA 3H4SE 1OMDA 4U8DA 1T14A 3CGAA 2OS8B 1DJWA 1SR6C 3UO9A 3SG7A 1RROA 3K21A 4GGFA 2M49B 3LK1A 3PSRA 3D74A 2KGBC 1Y6WA 3SIBA 1OZSA 1TNXA 2LMVA 1DJGA 2G2BA 2FCEA 4MEWA 4YRUA 1J7OA 4YGBB 3EVRA 1KK8C 2LM5A 1JF0A 2KDHA 4Q04A 1L7ZA 2K7DA 2MLFC 2P70A 3DYEA 3CZ2A 2CBLA 5K89A 2JWWA 2K7CA 3SG6A 1FPWA 1L2OC 2ERBA 3D73A 1K9PA 1S5GZ 2KBIA 3PM8A 1SBJA 5D69A 1X02A 5J3XA 1OOHA 2EHBA 2JZIA 2LVVA 1IWQA 1QIWA 2PYQA 2WOSA 2KQYA 3IQQA 1YUTA 2NLNA 1XFRA 2LANA 1CMFA 4MRYA 2BBNA 1EL4A 1BJFA 2QEVA 1NIWA 4AQIA 3BUMB 2JNXA 1OQPA 2JPTA 3RLZA 1DVIA 2JQ6A 1WLZA 1CLMA 1IKUA 5JJGA 1UHIA 1OZOA 3SG5A 1GM0A 2BAPA 1C7WA 1KQMC 1KFUL 4E68A 1DF0A 4GUKA 2KAYA 2G9BA 3TZ1A 2PRUA 2P71A 3NGVA 1EG4A 2F3YA 4P2YB 3FWBA 1PALA 4ORAB 5F6TA 1TRFA 4UPGA 2MJWB 5AXIA 1K90D 3DXLA 1JSAA 3AKBA 2Y5IA 1GGWA 2WC5A 1KQVA 3JVTB 4USLA 1UWOA 2HPSA 2WCBA 1SYMA 2B1UA 1DJXA 1KK7Y 1QVIY 5KTYA 2L4HA 4MN0A 1SSEB 1TNPA 2F33A 3L4AA 2QACA 1NCZA 1V1FA 5DICA 3A8RA 1SCMC 1QTXA 1N0YA 1TNQA 1UUSA 2L2CA 3DZTA 1BR4B 3BUXB 4OCIA 1WY9A 3CYZA 2VRGA 2ZFDA 3KO0A 2KOTA 3D75A 2LAPA 3NHIA 1QS7A 3BUNB 2JC2A 3I5IB 2BCBA 3S0BA 3R1OA 3M0WA 1IGVA 2M7NA 3PATA 3ZNIA 2KI4C 1CDMA 2LLTA 4PHJA 1IQ3A 5KU1A 1IJ6A 2K2AA 2FCDA 2K2FA 3LLEA 4TNCA 4CPVA 3DVJA 4KYNA 1UP5A 1FW4A 4I5JA 3S0GA 4PHMA 3O6BA 3RZSA 1XVJA 3BUWB 3FE6A 1BU3A 1KFXL 2GTEA 2M29A 3IQOA 2EC6C 3OP0A 1XK4C 5CPVA 3VRPA 3C1VA 3RM1A 4JWQA 3CS1A 2F2PA 3PALA 3OHMB 2JRFA 2ZN9A 3EVUA 4PHKA 1U5IB 4ZCUA 1BODA 2M7LA 3AAKA 4PALA 1SMGA 2I2RE 1B7TY 5FI6A 3S0DA 1K94A 1EXRA 1MUXA 1SY9A 1UHNA 1N2DA 4FQTA 4YGAA 1C7VA 1JWDA 2ZRTA 4MZKA 1ALVA 5HLOA 4GPLB 4MZLA 5HL1A 3R72A 1NX3A 1HT9A 3CZ0A 2M3WA 4OV2A 1TIZA 3R1PA 1FF1A 2COLB 2LHIA 1FI5A 2JTTA 1ZFSA 2JT3A 1KCYA 5I2LA 1TUJA 2I18A 1NPQA 4MZJA 1S6JA 1RECA 3BFHA 3BYAA 1SL9A 2KLEA 1ZMZA 1DJIA 3B6XA 1PSBA 4I5NB 2OTGB 2LE9B 1AJ4A 1EH2A 4NDDA 1M63B 2HETA 2F8PA 1CLLA 1S26D 2KFHA 5PALA 1SKTA 1YVHA 1NX2A 1QLKA 2QPTA 3SS5A 1OSAA 2Q4UA 1DJYA 1A29A 3DF0B 3OGNA 1A03A 1RTP1 3I5FB 2HF5A 2OS8C 2WNDA 1UHJA 2WCJA 4ORCB 4PDZA 5I94A 2OPOA 1K95A 3AAJA 3HX4A 2SCPA 1UHKA 1TOPA 1J1DA 2K8MB 1B1GA 3WXAA 1IQ5A 1YX7A 5JOLA 1F54A 2BL0C 2LP3A 3FS7A 2KBMA 5CSNA 4BY5A 4YI9A 3FE9A 2I94A 3B7AA 4MRXA 3NSLA 2LMTA 3LCPC 2DOQA 2LV7A 2QDIA 5DKRA 4CIDA 1QV0A 2O5GA 3DVEA 3TUYB 1S5GY 2KNEA 4DCKA 1YUUA 2L2EA 1DQEA 4JPZB 4YI8A 1W7JB 4WQ2A 2K7BA 1PK0D 3SIAA 2K60A 3SS3A 2LLUA 3VRNA 1KSMA 1E8AA 2KHNA 3TDUA 1NX1A 3I5HC 3KPXA 1CFCA 3BFAA 2ZKMX 2CT9A 3A4UB 1F8HA 1SL8A 1PRWA 2BCAA 2A4JA 3I5GC 4N1GA 4QJ4B 3CZ1A 5BPJA 3PFVA 2M1UA 1J7QA 1LINA 3DD4A 1F55A 1JBAA 5HKWA 1OMRA 1XYDA 2EGDA 3TS5C 4AQJA 1QX5B 3D78A
chains in the Genus database with same CATH topology
1CB1A 1AUIB 4PE4A 2K0JA 4FTGA 1WRZA 4L9MA 4YGEB 1AK8A 3SG3A 3CR4X 2BE4A 3PN7C 2HQWA 1DT7B 4MBEA 5ER5A 2IS9A 1F70A 2HQ8A 2WC8A 2KSPA 2NCOA 1ZUZA 3WHTB 1L2OB 1Q80A 1TCFA 2NZ0A 1A75B 1QX2A 2JXCA 1F71A 1J7PA 2V53A 4P5OE 2KAVA 1SCVA 1LKJA 3O78A 4A4CA 4OR9B 5G08A 1G33A 1S6CA 2NXQA 2CXJA 5AEQA 4PCWA 1NWDA 5I2OA 4CFQA 3EK8A 2WORA 1XA5A 2PSRA 1S1EA 1J1EA 2LVJA 1DGUA 2KYCA 3I5IC 2ZNEA 4PE0A 1NCXA 3O4YA 2KI6D 2M8UA 1KQMB 3CZTX 2Y1MA 3EKJA 4FQOA 2MAZA 1K96A 2LUXA 3SG2A 1HQVA 1K9UA 1S36A 3EVVA 2FOTA 1B8LA 1DMOA 3NSKA 2JU0A 2H61A 3WHUB 2LC5A 1QX7A 1OE9B 2CNPA 1QV1A 2GGMA 1BOCA 3CR2A 1MQ1A 1C07A 1G4YR 4PHNA 1EG3A 1FI6A 3EK4A 2LMUA 2L4IA 1YRTB 2BECA 1Y1UA 4NDCA 1SK6D 2M1KB 1N65A 2AUCA 2M97A 2RGIA 2ZRSA 3DVKA 1D1OA 1KWOC 2ISDA 1SRAA 1CLBA 1U5IA 1BT6A 3LK0A 1K93D 1M46A 1XFXO 1QJTA 4M2PA 4CFRA 1YR5A 1JFJA 2GV5A 1AHRA 3ICBA 1XFUO 2KI4B 3GK1A 2CCMA 1PSRA 1MWNA 4GFTA 4QJ3B 1PVBA 4GGNA 2R2IA 1M39A 1XFWO 4I5KA 1JFKA 2TN4A 3JTDC 1XK4A 4M2QA 1EJ3A 1B4CA 3O2PA 1MXLC 1SW8A 3GK2A 1IJ5A 2AAOA 3GK4X 2Y1NA 4C0JA 4XYNA 1WRLA 3BXKA 1M31A 3DF0A 2H2KA 4DIRA 1WDCB 1ALWA 3VROA 2KFGA 5CSFA 1R2UA 4GNKB 2Y4QA 1MXEA 3OX5A 2SASA 5AFPA 1K2HA 4GGFC 3EKHA 5DKQA 1JC2A 1NX0A 1H8BA 3CLNA 1QLSA 3TUYC 1F4OA 2LUCA 1AVSA 1CFPA 1YX8A 4CLNA 2PALA 3KEVA 5I2QA 1S6IA 1RJVA 2K61A 1BR1B 3EK7A 2JT8A 2E30A 4GBAA 1NUBA 1TTXA 5HKZA 5HKYA 3CWGA 2LVIA 1YVLA 3CTNA 5TNCA 4ZCVA 2KYFA 3CR5X 3OB1B 1Y1AA 1J7RA 1TNWA 3SJSA 2KI6C 1LA3A 4NDBA 2PMYA 1M45A 1OMVA 1LVCD 1RWYA 5I8NA 2Q91A 3LL8B 3VRRA 4HSZA 1IRJA 1K9KA 4ORBB 1SR6B 2BL0B 4YBHB 1B8RA 4C0KA 4XJKA 5D7FA 2KAXA 1CFDA 4XJKB 2PASA 1BMOA 2LNKA 2WCEA 1BF5A 1TN4A 1IG5A 5ER4X 1KK8B 5CSJA 3AKAA 1AP4A 1XFVO 1CDPA 4GAOA 1LXFC 5DKNA 1NP8A 1KFUS 2ZNDA 4M2OA 1A75A 4N1FA 1CDNA 3NXAA 3GOFA 1CM1A 3I5HB 1KSOA 1RK9A 1FBVA 3JVTC 2JOJA 2KGRA 4BY4A 4DUQA 1YUSA 1DGVA 3KF9A 4HRGA 1MR8A 2BCXA 3I5GB 2JULA 5CSIA 2WCFA 2MBXA 1J55A 2LVKA 3TS5B 1YURA 3OX6A 5B8IB 4PE7A 3DVMA 2L0PA 1NCYA 1DF0B 4I5LB 3MSEB 1UHHA 1OOJA 1ZOTB 2JT0A 2JXLA 2FJUB 4QJ5B 1K8UA 1PULA 3OB2B 2MLEC 3PN7B 1DTLA 2BKHB 2H61C 1MF8B 2K7OA 1YTZC 2GGZA 1CMGA 2L98A 2E6WA 2MA2A 2P6BB 1GJYA 2PVBA 2BBMA 1Y1XA 1BG1A 1TCOB 1WLMA 3ZWHA 1CNPA 1B9AA 5KSZA 1ZACA 3HCMA 5FYXA 4AOMA 1CFFA 5AERA 3TDIA 1KK7Z 1QVIZ 1MHOA 3D0YA 3TDZA 3D0YB 3FIAA 1KFXS 1JF2A 1SCMB 1QATA 1JUOA 3IF7A 4ETOA 2BKIB 1R6PA 1CKKA 2MRDA 1CM4A 3VGOA 4HRHA 1VRKA 2O60A 3BUOB 1B8CA 2I7AA 2F2OA 1Y0VH 1V1GA 2KQ6A 3WNXB 2L51A 4N5XA 4R1EA 4OVNF 4MVFA 1IH0A 2L50A 2CTNA 2OTGC 2LCPA 3QRXA 4WRIA 1GGZA 3SG4A 4F0ZB 1GQMA 2L5XB 3FWCA 3KHEA 5GQQC 4YGCB 3D10A 2LLSA 2EC6B 1S3PA 1WDCC 1SNLA 3I5FC 3NSOA 1BLQA 1KWOB 1NSHA 1QIVA 3E3RA 1UURA 4DS7A 4IL1A 4YGDB 1SL7A 3BOWA 1QASA 4MSPA 1YRUB 3BOWB 1ODBA 1NYAA 1XO5A 2KFFA 5AANA 4C0LA 1DJHA 3VRQA 3PLFB 4NQGA 4D1EA 1CTRA 1B7TZ 1RFJA 2M9GA 4DRWA 4A4BA 4HREE 1XFZO 3F45A 5HLVA 2ZN8A 2AMIA 1W7IB 1G8IA 2D8NA 2F3ZA 1AJ5A 1A2XA 1XFYO 3NSIA 4JQ0D 1PVAA 5IBWA 1LA0A 1QXPA 2LHLA 3JTDB 1WRKA 2JTZA 4PE1A 1SPYA 4WQ3A 1CDLA 4OKHA 1B47A 1DJZA 3BQ3A 4MLWA 4ICBA 5HYDA 2M0RA 2BE6A 1F4QA 2MHHA 2JNFA 1A4PA 2LP2A 2NCPA 3H4SE 1OMDA 4U8DA 3CGAA 2OS8B 1DJWA 1SR6C 3SG7A 1RROA 3K21A 4GGFA 2M49B 3LK1A 3PSRA 2KGBC 1Y6WA 3SIBA 1OZSA 1TNXA 2LMVA 1DJGA 2G2BA 2FCEA 4MEWA 4YRUA 1J7OA 4YGBB 3EVRA 1KK8C 2LM5A 1JF0A 2KDHA 4Q04A 1L7ZA 2K7DA 2MLFC 2CBLA 5K89A 2JWWA 2K7CA 3SG6A 1FPWA 1L2OC 1K9PA 1S5GZ 2KBIA 3PM8A 1SBJA 5D69A 1X02A 5J3XA 2EHBA 2JZIA 2LVVA 1IWQA 1QIWA 2WOSA 2KQYA 3IQQA 1YUTA 2NLNA 2LANA 1CMFA 4MRYA 2BBNA 1EL4A 1BJFA 1NIWA 4AQIA 3BUMB 2JNXA 1OQPA 2JPTA 3RLZA 1DVIA 2JQ6A 1WLZA 1CLMA 1IKUA 5JJGA 1UHIA 1OZOA 3SG5A 1C7WA 1KQMC 1KFUL 4E68A 1DF0A 4GUKA 2KAYA 2G9BA 3TZ1A 2PRUA 1EG4A 2F3YA 4P2YB 3FWBA 1PALA 4ORAB 5F6TA 1TRFA 4UPGA 2MJWB 5AXIA 1K90D 1JSAA 3AKBA 2Y5IA 1GGWA 1KQVA 3JVTB 1UWOA 2HPSA 2WCBA 1SYMA 2B1UA 1DJXA 1KK7Y 1QVIY 5KTYA 2L4HA 4MN0A 1TNPA 2F33A 2QACA 1NCZA 1V1FA 3A8RA 1SCMC 1QTXA 1N0YA 1TNQA 1UUSA 1BR4B 3BUXB 4OCIA 1WY9A 2VRGA 2ZFDA 3KO0A 2KOTA 4USLA 2LAPA 1QS7A 3BUNB 2JC2A 3I5IB 2BCBA 3M0WA 1IGVA 2M7NA 3PATA 3ZNIA 2KI4C 1CDMA 2LLTA 4PHJA 1IQ3A 5KU1A 1IJ6A 2K2AA 2FCDA 2K2FA 3LLEA 4TNCA 4CPVA 3DVJA 1UP5A 1FW4A 4I5JA 4PHMA 3O6BA 1XVJA 3BUWB 1BU3A 1KFXL 3OP0A 2M29A 3IQOA 2EC6C 1XK4C 5CPVA 3VRPA 3C1VA 3RM1A 4JWQA 3CS1A 2F2PA 3PALA 3OHMB 2JRFA 2ZN9A 3EVUA 4PHKA 1U5IB 4ZCUA 1BODA 2M7LA 3AAKA 4PALA 1SMGA 2I2RE 1B7TY 1K94A 1EXRA 1MUXA 1SY9A 1UHNA 1N2DA 1C7VA 4YGAA 1JWDA 2ZRTA 4MZKA 1ALVA 5HLOA 4GPLB 4MZLA 1NX3A 1HT9A 4OV2A 2M3WA 1TIZA 1FF1A 2COLB 2LHIA 1FI5A 2JTTA 1ZFSA 2JT3A 1KCYA 5I2LA 2I18A 1NPQA 4MZJA 1S6JA 1RECA 3BYAA 1SL9A 1ZMZA 1DJIA 4I5NB 1PSBA 2OTGB 2LE9B 1AJ4A 1EH2A 4NDDA 1M63B 2HETA 2F8PA 1CLLA 1S26D 2KFHA 5PALA 1SKTA 1YVHA 1NX2A 1QLKA 2QPTA 1OSAA 2Q4UA 1DJYA 1A29A 3DF0B 1A03A 1RTP1 3I5FB 2HF5A 2OS8C 2WNDA 1UHJA 4ORCB 4PDZA 1H4BA 2OPOA 1K95A 3AAJA 3HX4A 2SCPA 1UHKA 1TOPA 1J1DA 2K8MB 1B1GA 3WXAA 1IQ5A 1YX7A 5JOLA 1F54A 2BL0C 2LP3A 3FS7A 2KBMA 5CSNA 4BY5A 4YI9A 2I94A 4MRXA 3NSLA 2LMTA 3LCPC 2DOQA 2LV7A 5DKRA 4CIDA 1QV0A 2O5GA 3DVEA 3TUYB 1S5GY 2KNEA 4DCKA 1YUUA 2L2EA 4YI8A 4JPZB 1W7JB 4WQ2A 2K7BA 1PK0D 3SIAA 2LLUA 3VRNA 1KSMA 1E8AA 2KHNA 3TDUA 1NX1A 3I5HC 3KPXA 1CFCA 2ZKMX 2CT9A 3A4UB 1F8HA 1SL8A 1PRWA 2BCAA 2A4JA 3I5GC 4N1GA 4QJ4B 5BPJA 1J7QA 3PFVA 2M1UA 1LINA 3DD4A 1F55A 1JBAA 5HKWA 1OMRA 1XYDA 2EGDA 3TS5C 4AQJA 1QX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CB1 A;  1AUI B;  4PE4 A;  2K0J A;  4FTG A;  1WRZ A;  4L9M A;  4YGE B;  1AK8 A;  3SG3 A;  3CR4 X;  2BE4 A;  3PN7 C;  2HQW A;  1DT7 B;  4MBE A;  5ER5 A;  2IS9 A;  1F70 A;  2HQ8 A;  2WC8 A;  2KSP A;  2NCO A;  1ZUZ A;  3WHT B;  1L2O B;  1Q80 A;  1TCF A;  2NZ0 A;  1A75 B;  1QX2 A;  2JXC A;  1F71 A;  1J7P A;  2V53 A;  4P5O E;  2KAV A;  1SCV A;  1LKJ A;  3O78 A;  4A4C A;  4OR9 B;  5G08 A;  1G33 A;  1S6C A;  2NXQ A;  2CXJ A;  5AEQ A;  4PCW A;  1NWD A;  5I2O A;  4CFQ A;  3EK8 A;  2WOR A;  1XA5 A;  2PSR A;  1S1E A;  1J1E A;  2LVJ A;  1DGU A;  2KYC A;  3I5I C;  2ZNE A;  4PE0 A;  1NCX A;  3O4Y A;  2KI6 D;  2M8U A;  1KQM B;  3CZT X;  2Y1M A;  3EKJ A;  4FQO A;  2MAZ A;  1K96 A;  2LUX A;  3SG2 A;  1HQV A;  1K9U A;  1S36 A;  3EVV A;  2FOT A;  1B8L A;  1DMO A;  3NSK A;  2JU0 A;  2H61 A;  3WHU B;  2LC5 A;  1QX7 A;  1OE9 B;  2CNP A;  1QV1 A;  2GGM A;  1BOC A;  3CR2 A;  1MQ1 A;  1C07 A;  1G4Y R;  4PHN A;  1EG3 A;  1FI6 A;  3EK4 A;  2LMU A;  2L4I A;  1YRT B;  2BEC A;  1Y1U A;  4NDC A;  1SK6 D;  2M1K B;  1N65 A;  2AUC A;  2M97 A;  2RGI A;  2ZRS A;  3DVK A;  1D1O A;  1KWO C;  2ISD A;  1SRA A;  1CLB A;  1U5I A;  1BT6 A;  3LK0 A;  1K93 D;  1M46 A;  1XFX O;  1QJT A;  4M2P A;  4CFR A;  1YR5 A;  1JFJ A;  2GV5 A;  1AHR A;  3ICB A;  1XFU O;  2KI4 B;  3GK1 A;  2CCM A;  1PSR A;  1MWN A;  4GFT A;  4QJ3 B;  1PVB A;  4GGN A;  2R2I A;  1M39 A;  1XFW O;  4I5K A;  1JFK A;  2TN4 A;  3JTD C;  1XK4 A;  4M2Q A;  1EJ3 A;  1B4C A;  3O2P A;  1MXL C;  1SW8 A;  3GK2 A;  1IJ5 A;  2AAO A;  3GK4 X;  2Y1N A;  4C0J A;  4XYN A;  1WRL A;  3BXK A;  1M31 A;  3DF0 A;  2H2K A;  4DIR A;  1WDC B;  1ALW A;  3VRO A;  2KFG A;  5CSF A;  1R2U A;  4GNK B;  2Y4Q A;  1MXE A;  3OX5 A;  2SAS A;  5AFP A;  1K2H A;  4GGF C;  3EKH A;  5DKQ A;  1JC2 A;  1NX0 A;  1H8B A;  3CLN A;  1QLS A;  3TUY C;  1F4O A;  2LUC A;  1AVS A;  1CFP A;  1YX8 A;  4CLN A;  2PAL A;  3KEV A;  5I2Q A;  1S6I A;  1RJV A;  2K61 A;  1BR1 B;  3EK7 A;  2JT8 A;  2E30 A;  4GBA A;  1NUB A;  1TTX A;  5HKZ A;  5HKY A;  3CWG A;  2LVI A;  1YVL A;  3CTN A;  5TNC A;  4ZCV A;  2KYF A;  3CR5 X;  3OB1 B;  1Y1A A;  1J7R A;  1TNW A;  3SJS A;  2KI6 C;  1LA3 A;  4NDB A;  2PMY A;  1M45 A;  1OMV A;  1LVC D;  1RWY A;  5I8N A;  2Q91 A;  3LL8 B;  3VRR A;  4HSZ A;  1IRJ A;  1K9K A;  4ORB B;  1SR6 B;  2BL0 B;  4YBH B;  1B8R A;  4C0K A;  4XJK A;  5D7F A;  2KAX A;  1CFD A;  4XJK B;  2PAS A;  1BMO A;  2LNK A;  2WCE A;  1BF5 A;  1TN4 A;  1IG5 A;  5ER4 X;  1KK8 B;  5CSJ A;  3AKA A;  1AP4 A;  1XFV O;  1CDP A;  4GAO A;  1LXF C;  5DKN A;  1NP8 A;  1KFU S;  2ZND A;  4M2O A;  1A75 A;  4N1F A;  1CDN A;  3NXA A;  3GOF A;  1CM1 A;  3I5H B;  1KSO A;  1RK9 A;  1FBV A;  3JVT C;  2JOJ A;  2KGR A;  4BY4 A;  4DUQ A;  1YUS A;  1DGV A;  3KF9 A;  4HRG A;  1MR8 A;  2BCX A;  3I5G B;  2JUL A;  5CSI A;  2WCF A;  2MBX A;  1J55 A;  2LVK A;  3TS5 B;  1YUR A;  3OX6 A;  5B8I B;  4PE7 A;  3DVM A;  2L0P A;  1NCY A;  1DF0 B;  4I5L B;  3MSE B;  1UHH A;  1OOJ A;  1ZOT B;  2JT0 A;  2JXL A;  2FJU B;  4QJ5 B;  1K8U A;  1PUL A;  3OB2 B;  2MLE C;  3PN7 B;  1DTL A;  2BKH B;  2H61 C;  1MF8 B;  2K7O A;  1YTZ C;  2GGZ A;  1CMG A;  2L98 A;  2E6W A;  2MA2 A;  2P6B B;  1GJY A;  2PVB A;  2BBM A;  1Y1X A;  1BG1 A;  1TCO B;  1WLM A;  3ZWH A;  1CNP A;  1B9A A;  5KSZ A;  1ZAC A;  3HCM A;  5FYX A;  4AOM A;  1CFF A;  5AER A;  3TDI A;  1KK7 Z;  1QVI Z;  1MHO A;  3D0Y A;  3TDZ A;  3D0Y B;  3FIA A;  1KFX S;  1JF2 A;  1SCM B;  1QAT A;  1JUO A;  3IF7 A;  4ETO A;  2BKI B;  1R6P A;  1CKK A;  2MRD A;  1CM4 A;  3VGO A;  4HRH A;  1VRK A;  2O60 A;  3BUO B;  1B8C A;  2I7A A;  2F2O A;  1Y0V H;  1V1G A;  2KQ6 A;  3WNX B;  2L51 A;  4N5X A;  4R1E A;  4OVN F;  4MVF A;  1IH0 A;  2L50 A;  2CTN A;  2OTG C;  2LCP A;  3QRX A;  4WRI A;  1GGZ A;  3SG4 A;  4F0Z B;  1GQM A;  2L5X B;  3FWC A;  3KHE A;  5GQQ C;  4YGC B;  3D10 A;  2LLS A;  2EC6 B;  1S3P A;  1WDC C;  1SNL A;  3I5F C;  3NSO A;  1BLQ A;  1KWO B;  1NSH A;  1QIV A;  3E3R A;  1UUR A;  4DS7 A;  4IL1 A;  4YGD B;  1SL7 A;  3BOW A;  1QAS A;  4MSP A;  1YRU B;  3BOW B;  1ODB A;  1NYA A;  1XO5 A;  2KFF A;  5AAN A;  4C0L A;  1DJH A;  3VRQ A;  3PLF B;  4NQG A;  4D1E A;  1CTR A;  1B7T Z;  1RFJ A;  2M9G A;  4DRW A;  4A4B A;  4HRE E;  1XFZ O;  3F45 A;  5HLV A;  2ZN8 A;  2AMI A;  1W7I B;  1G8I A;  2D8N A;  2F3Z A;  1AJ5 A;  1A2X A;  1XFY O;  3NSI A;  4JQ0 D;  1PVA A;  5IBW A;  1LA0 A;  1QXP A;  2LHL A;  3JTD B;  1WRK A;  2JTZ A;  4PE1 A;  1SPY A;  4WQ3 A;  1CDL A;  4OKH A;  1B47 A;  1DJZ A;  3BQ3 A;  4MLW A;  4ICB A;  5HYD A;  2M0R A;  2BE6 A;  1F4Q A;  2MHH A;  2JNF A;  1A4P A;  2LP2 A;  2NCP A;  3H4S E;  1OMD A;  4U8D A;  3CGA A;  2OS8 B;  1DJW A;  1SR6 C;  3SG7 A;  1RRO A;  3K21 A;  4GGF A;  2M49 B;  3LK1 A;  3PSR A;  2KGB C;  1Y6W A;  3SIB A;  1OZS A;  1TNX A;  2LMV A;  1DJG A;  2G2B A;  2FCE A;  4MEW A;  4YRU A;  1J7O A;  4YGB B;  3EVR A;  1KK8 C;  2LM5 A;  1JF0 A;  2KDH A;  4Q04 A;  1L7Z A;  2K7D A;  2MLF C;  2CBL A;  5K89 A;  2JWW A;  2K7C A;  3SG6 A;  1FPW A;  1L2O C;  1K9P A;  1S5G Z;  2KBI A;  3PM8 A;  1SBJ A;  5D69 A;  1X02 A;  5J3X A;  2EHB A;  2JZI A;  2LVV A;  1IWQ A;  1QIW A;  2WOS A;  2KQY A;  3IQQ A;  1YUT A;  2NLN A;  2LAN A;  1CMF A;  4MRY A;  2BBN A;  1EL4 A;  1BJF A;  1NIW A;  4AQI A;  3BUM B;  2JNX A;  1OQP A;  2JPT A;  3RLZ A;  1DVI A;  2JQ6 A;  1WLZ A;  1CLM A;  1IKU A;  5JJG A;  1UHI A;  1OZO A;  3SG5 A;  1C7W A;  1KQM C;  1KFU L;  4E68 A;  1DF0 A;  4GUK A;  2KAY A;  2G9B A;  3TZ1 A;  2PRU A;  1EG4 A;  2F3Y A;  4P2Y B;  3FWB A;  1PAL A;  4ORA B;  5F6T A;  1TRF A;  4UPG A;  2MJW B;  5AXI A;  1K90 D;  1JSA A;  3AKB A;  2Y5I A;  1GGW A;  1KQV A;  3JVT B;  1UWO A;  2HPS A;  2WCB A;  1SYM A;  2B1U A;  1DJX A;  1KK7 Y;  1QVI Y;  5KTY A;  2L4H A;  4MN0 A;  1TNP A;  2F33 A;  2QAC A;  1NCZ A;  1V1F A;  3A8R A;  1SCM C;  1QTX A;  1N0Y A;  1TNQ A;  1UUS A;  1BR4 B;  3BUX B;  4OCI A;  1WY9 A;  2VRG A;  2ZFD A;  3KO0 A;  2KOT A;  4USL A;  2LAP A;  1QS7 A;  3BUN B;  2JC2 A;  3I5I B;  2BCB A;  3M0W A;  1IGV A;  2M7N A;  3PAT A;  3ZNI A;  2KI4 C;  1CDM A;  2LLT A;  4PHJ A;  1IQ3 A;  5KU1 A;  1IJ6 A;  2K2A A;  2FCD A;  2K2F A;  3LLE A;  4TNC A;  4CPV A;  3DVJ A;  1UP5 A;  1FW4 A;  4I5J A;  4PHM A;  3O6B A;  1XVJ A;  3BUW B;  1BU3 A;  1KFX L;  3OP0 A;  2M29 A;  3IQO A;  2EC6 C;  1XK4 C;  5CPV A;  3VRP A;  3C1V A;  3RM1 A;  4JWQ A;  3CS1 A;  2F2P A;  3PAL A;  3OHM B;  2JRF A;  2ZN9 A;  3EVU A;  4PHK A;  1U5I B;  4ZCU A;  1BOD A;  2M7L A;  3AAK A;  4PAL A;  1SMG A;  2I2R E;  1B7T Y;  1K94 A;  1EXR A;  1MUX A;  1SY9 A;  1UHN A;  1N2D A;  1C7V A;  4YGA A;  1JWD A;  2ZRT A;  4MZK A;  1ALV A;  5HLO A;  4GPL B;  4MZL A;  1NX3 A;  1HT9 A;  4OV2 A;  2M3W A;  1TIZ A;  1FF1 A;  2COL B;  2LHI A;  1FI5 A;  2JTT A;  1ZFS A;  2JT3 A;  1KCY A;  5I2L A;  2I18 A;  1NPQ A;  4MZJ A;  1S6J A;  1REC A;  3BYA A;  1SL9 A;  1ZMZ A;  1DJI A;  4I5N B;  1PSB A;  2OTG B;  2LE9 B;  1AJ4 A;  1EH2 A;  4NDD A;  1M63 B;  2HET A;  2F8P A;  1CLL A;  1S26 D;  2KFH A;  5PAL A;  1SKT A;  1YVH A;  1NX2 A;  1QLK A;  2QPT A;  1OSA A;  2Q4U A;  1DJY A;  1A29 A;  3DF0 B;  1A03 A;  1RTP 1;  3I5F B;  2HF5 A;  2OS8 C;  2WND A;  1UHJ A;  4ORC B;  4PDZ A;  1H4B A;  2OPO A;  1K95 A;  3AAJ A;  3HX4 A;  2SCP A;  1UHK A;  1TOP A;  1J1D A;  2K8M B;  1B1G A;  3WXA A;  1IQ5 A;  1YX7 A;  5JOL A;  1F54 A;  2BL0 C;  2LP3 A;  3FS7 A;  2KBM A;  5CSN A;  4BY5 A;  4YI9 A;  2I94 A;  4MRX A;  3NSL A;  2LMT A;  3LCP C;  2DOQ A;  2LV7 A;  5DKR A;  4CID A;  1QV0 A;  2O5G A;  3DVE A;  3TUY B;  1S5G Y;  2KNE A;  4DCK A;  1YUU A;  2L2E A;  4YI8 A;  4JPZ B;  1W7J B;  4WQ2 A;  2K7B A;  1PK0 D;  3SIA A;  2LLU A;  3VRN A;  1KSM A;  1E8A A;  2KHN A;  3TDU A;  1NX1 A;  3I5H C;  3KPX A;  1CFC A;  2ZKM X;  2CT9 A;  3A4U B;  1F8H A;  1SL8 A;  1PRW A;  2BCA A;  2A4J A;  3I5G C;  4N1G A;  4QJ4 B;  5BPJ A;  1J7Q A;  3PFV A;  2M1U A;  1LIN A;  3DD4 A;  1F55 A;  1JBA A;  5HKW A;  1OMR A;  1XYD A;  2EGD A;  3TS5 C;  4AQJ A;  1QX5 B; 
#chains in the Genus database with same CATH topology
 1CB1 A;  1AUI B;  4PE4 A;  3S0A A;  2K0J A;  4FTG A;  1WRZ A;  4L9M A;  4YGE B;  2KLD A;  1AK8 A;  3SG3 A;  3CR4 X;  2BE4 A;  3PN7 C;  2HQW A;  1DT7 B;  4MBE A;  5ER5 A;  2IS9 A;  1DC1 A;  1F70 A;  2HQ8 A;  2WC8 A;  2KSP A;  2NCO A;  1ZUZ A;  3WHT B;  1L2O B;  1Q80 A;  1TCF A;  2NZ0 A;  5EL2 A;  1A75 B;  1QX2 A;  2JXC A;  1F71 A;  2BNX A;  1J7P A;  2V53 A;  4P5O E;  2KAV A;  1SCV A;  1LKJ A;  3O78 A;  4A4C A;  4OR9 B;  5G08 A;  1G33 A;  4PT1 A;  1S6C A;  1OOI X;  2NXQ A;  2CXJ A;  5AEQ A;  1C3Z A;  4PCW A;  1NWD A;  5I2O A;  4CFQ A;  3EK8 A;  2WOR A;  1XA5 A;  2PSR A;  1S1E A;  1J1E A;  3L4L A;  2LVJ A;  1LS8 A;  3SS4 A;  1DGU A;  2KYC A;  3I5I C;  2ZNE A;  4PE0 A;  1NCX A;  3O4Y A;  2KI6 D;  2M8U A;  1OW4 A;  1KQM B;  3CZT X;  2Y1M A;  3EKJ A;  4FQO A;  2MAZ A;  1K96 A;  2LUX A;  3SG2 A;  1HQV A;  1K9U A;  1S36 A;  3EVV A;  2FOT A;  1B8L A;  1DMO A;  3NSK A;  2JU0 A;  2H61 A;  3WHU B;  2LC5 A;  1QX7 A;  1OE9 B;  2CNP A;  1QV1 A;  2GGM A;  1BOC A;  3FE8 A;  3CR2 A;  1MQ1 A;  1C07 A;  1Z4H A;  1G4Y R;  4PHN A;  1EG3 A;  1FI6 A;  3EK4 A;  2LMU A;  2L4I A;  1YRT B;  2BEC A;  1P28 A;  1Y1U A;  2H8V A;  4NDC A;  1SK6 D;  2M1K B;  4F7F A;  1N65 A;  2AUC A;  2M97 A;  2RGI A;  2ZRS A;  3DVK A;  1D1O A;  1KWO C;  2ISD A;  1SRA A;  1CLB A;  1U5I A;  1BT6 A;  3LK0 A;  1K93 D;  1M46 A;  4INW A;  1XFX O;  1QJT A;  4M2P A;  4CFR A;  1YR5 A;  1JFJ A;  2GV5 A;  3O4X A;  1AHR A;  3ICB A;  1XFU O;  2KI4 B;  3GK1 A;  2CCM A;  1PSR A;  1MWN A;  3PM2 A;  1C3Y A;  4GFT A;  4QJ3 B;  1PVB A;  3R1V A;  4GGN A;  2R2I A;  5D3O A;  1M39 A;  1XFW O;  4I5K A;  1JFK A;  2TN4 A;  3JTD C;  3VB1 A;  4JD9 A;  1XK4 A;  2QEB A;  1EJ3 A;  4M2Q A;  1B4C A;  3O2P A;  1MXL C;  1SW8 A;  3GK2 A;  1IJ5 A;  2AAO A;  3GK4 X;  2WCH A;  2Y1N A;  3K1E A;  3V2L A;  4XYN A;  4C0J A;  1WRL A;  3OBV A;  3CAB A;  3BXK A;  1M31 A;  3DF0 A;  2H2K A;  4DIR A;  1WDC B;  1ALW A;  3VRO A;  3S0F A;  2KFG A;  5CSF A;  1R2U A;  4GNK B;  2Y4Q A;  1ORG A;  1MXE A;  3OX5 A;  3UNW A;  2SAS A;  2WC6 A;  5AFP A;  1K2H A;  4GGF C;  3EKH A;  5DKQ A;  1JC2 A;  1NX0 A;  1H8B A;  3CLN A;  1QLS A;  3BJH A;  3TUY C;  1F4O A;  2LUC A;  1AVS A;  1CFP A;  1YX8 A;  4IJ7 A;  4CLN A;  2PAL A;  3KEV A;  5FI2 A;  5I2Q A;  3CDN A;  1S6I A;  1RJV A;  2K61 A;  1BR1 B;  3EK7 A;  2JT8 A;  2E30 A;  4GBA A;  1NUB A;  1TTX A;  5HKZ A;  5HKY A;  3CWG A;  3DY9 A;  2LVI A;  1YVL A;  3CTN A;  5TNC A;  4ZCV A;  2KYF A;  3CR5 X;  3OB1 B;  1Y1A A;  1J7R A;  1TNW A;  3SJS A;  2KI6 C;  1LA3 A;  2WCK A;  4NDB A;  1QWV A;  2PMY A;  1M45 A;  2L5Y A;  1OMV A;  1LVC D;  3PJI A;  1RWY A;  5I8N A;  2Q91 A;  3LL8 B;  3VRR A;  1DEL A;  4HSZ A;  1IRJ A;  1K9K A;  4ORB B;  1SR6 B;  2BL0 B;  4YBH B;  1B8R A;  4C0K A;  4XJK A;  5D7F A;  2KAX A;  1CFD A;  4XJK B;  2PAS A;  1BMO A;  2LNK A;  2WCE A;  1BF5 A;  1TN4 A;  1IG5 A;  5ER4 X;  4INX A;  1H4B A;  1KK8 B;  5CSJ A;  3AKA A;  1AP4 A;  1XFV O;  1CDP A;  4GAO A;  1LXF C;  5DKN A;  1NP8 A;  1KFU S;  1IIO A;  2ZND A;  4M2O A;  1A75 A;  3Q8I A;  4N1F A;  1CDN A;  3NXA A;  3GOF A;  1CM1 A;  3I5H B;  1KSO A;  1RK9 A;  1FBV A;  1TUZ A;  2JOJ A;  2KGR A;  3JVT C;  4BY4 A;  4DUQ A;  1YUS A;  1DGV A;  3KF9 A;  4HRG A;  1MR8 A;  1TWO A;  2BCX A;  2JUL A;  3I5G B;  5CSI A;  2WCF A;  2MBX A;  3EG5 B;  1J55 A;  2LVK A;  3TS5 B;  1YUR A;  3OX6 A;  5B8I B;  3B86 A;  4PE7 A;  3DVM A;  2L0P A;  1NCY A;  3QME A;  1DF0 B;  4I5L B;  3MSE B;  1UHH A;  1OOJ A;  1ZOT B;  2JT0 A;  2JXL A;  2FJU B;  4QJ5 B;  1K8U A;  1PUL A;  3OB2 B;  2MLE C;  3PN7 B;  1DTL A;  2BKH B;  2H61 C;  2FJY A;  1MF8 B;  1W9Z A;  2K7O A;  1YTZ C;  2GGZ A;  1CMG A;  2L98 A;  2E6W A;  2MA2 A;  2P6B B;  2JPO A;  2YGU A;  1GJY A;  2PVB A;  2BBM A;  1Y1X A;  1BG1 A;  1TCO B;  1WLM A;  1OOG A;  3IVT A;  3ZWH A;  1CNP A;  1B9A A;  5KSZ A;  1ZAC A;  3HCM A;  5FYX A;  4AOM A;  2QEO A;  1CFF A;  5AER A;  3TDI A;  1KK7 Z;  1QVI Z;  1MHO A;  3D0Y A;  3TDZ A;  4OZD A;  3D0Y B;  3FIA A;  1KFX S;  1JF2 A;  1SCM B;  1QAT A;  1JUO A;  3IF7 A;  4ETO A;  2BKI B;  1R6P A;  1CKK A;  2MRD A;  1CM4 A;  3VGO A;  4HRH A;  3L47 A;  1VRK A;  2O60 A;  3BUO B;  1B8C A;  2WCM A;  3BFB A;  2I7A A;  2F2O A;  1Y0V H;  1V1G A;  2KQ6 A;  3WNX B;  4JKT A;  2L51 A;  4N5X A;  4R1E A;  4OVN F;  4MVF A;  1IH0 A;  2L50 A;  2WCL A;  2CTN A;  2OTG C;  2LCP A;  3B88 A;  3QRX A;  4WRI A;  1GGZ A;  3SG4 A;  2KPH A;  4F0Z B;  1GQM A;  2L5X B;  3FWC A;  3KHE A;  5GQQ C;  4YGC B;  3D10 A;  2LLS A;  2EC6 B;  1S3P A;  1WDC C;  1SNL A;  3I5F C;  3NSO A;  1BLQ A;  1KWO B;  1NSH A;  1QIV A;  3E3R A;  1UUR A;  4DS7 A;  4IL1 A;  4YGD B;  1SL7 A;  3BOW A;  1QAS A;  3N7H A;  4MSP A;  1YRU B;  3BOW B;  1ODB A;  1NYA A;  1XO5 A;  2KFF A;  5AAN A;  4C0L A;  1DJH A;  3VRQ A;  3PLF B;  4NQG A;  4D1E A;  1CTR A;  1B7T Z;  3D76 A;  1RFJ A;  2M9G A;  4DRW A;  4A4B A;  4HRE E;  1OOF A;  1XFZ O;  3D77 A;  3F45 A;  2ZN8 A;  5FI7 A;  2AMI A;  5HLV A;  1W7I B;  1G8I A;  2D8N A;  2F3Z A;  1AJ5 A;  1A2X A;  1XFY O;  2QEH A;  3NSI A;  4JQ0 D;  1PVA A;  3B87 A;  5IBW A;  1LA0 A;  1QXP A;  2LHL A;  3JTD B;  1WRK A;  2JTZ A;  3S0E A;  4PE1 A;  1SPY A;  4WQ3 A;  1CDL A;  4OKH A;  1B47 A;  1DJZ A;  2PQL A;  3BQ3 A;  3NHT A;  4MLW A;  4ICB A;  5HYD A;  2M0R A;  2BE6 A;  1DEK A;  1F4Q A;  2MHH A;  2JNF A;  1A4P A;  1Z2C B;  2LP2 A;  2NCP A;  3H4S E;  1OMD A;  4U8D A;  1T14 A;  3CGA A;  2OS8 B;  1DJW A;  1SR6 C;  3UO9 A;  3SG7 A;  1RRO A;  3K21 A;  4GGF A;  2M49 B;  3LK1 A;  3PSR A;  3D74 A;  2KGB C;  1Y6W A;  3SIB A;  1OZS A;  1TNX A;  2LMV A;  1DJG A;  2G2B A;  2FCE A;  4MEW A;  4YRU A;  1J7O A;  4YGB B;  3EVR A;  1KK8 C;  2LM5 A;  1JF0 A;  2KDH A;  4Q04 A;  1L7Z A;  2K7D A;  2MLF C;  2P70 A;  3DYE A;  3CZ2 A;  2CBL A;  5K89 A;  2JWW A;  2K7C A;  3SG6 A;  1FPW A;  1L2O C;  2ERB A;  3D73 A;  1K9P A;  1S5G Z;  2KBI A;  3PM8 A;  1SBJ A;  5D69 A;  1X02 A;  5J3X A;  1OOH A;  2EHB A;  2JZI A;  2LVV A;  1IWQ A;  1QIW A;  2PYQ A;  2WOS A;  2KQY A;  3IQQ A;  1YUT A;  2NLN A;  1XFR A;  2LAN A;  1CMF A;  4MRY A;  2BBN A;  1EL4 A;  1BJF A;  2QEV A;  1NIW A;  4AQI A;  3BUM B;  2JNX A;  1OQP A;  2JPT A;  3RLZ A;  1DVI A;  2JQ6 A;  1WLZ A;  1CLM A;  1IKU A;  5JJG A;  1UHI A;  1OZO A;  3SG5 A;  1GM0 A;  2BAP A;  1C7W A;  1KQM C;  1KFU L;  4E68 A;  1DF0 A;  4GUK A;  2KAY A;  2G9B A;  3TZ1 A;  2PRU A;  2P71 A;  3NGV A;  1EG4 A;  2F3Y A;  4P2Y B;  3FWB A;  1PAL A;  4ORA B;  5F6T A;  1TRF A;  4UPG A;  2MJW B;  5AXI A;  1K90 D;  3DXL A;  1JSA A;  3AKB A;  2Y5I A;  1GGW A;  2WC5 A;  1KQV A;  3JVT B;  4USL A;  1UWO A;  2HPS A;  2WCB A;  1SYM A;  2B1U A;  1DJX A;  1KK7 Y;  1QVI Y;  5KTY A;  2L4H A;  4MN0 A;  1SSE B;  1TNP A;  2F33 A;  3L4A A;  2QAC A;  1NCZ A;  1V1F A;  5DIC A;  3A8R A;  1SCM C;  1QTX A;  1N0Y A;  1TNQ A;  1UUS A;  2L2C A;  3DZT A;  1BR4 B;  3BUX B;  4OCI A;  1WY9 A;  3CYZ A;  2VRG A;  2ZFD A;  3KO0 A;  2KOT A;  3D75 A;  2LAP A;  3NHI A;  1QS7 A;  3BUN B;  2JC2 A;  3I5I B;  2BCB A;  3S0B A;  3R1O A;  3M0W A;  1IGV A;  2M7N A;  3PAT A;  3ZNI A;  2KI4 C;  1CDM A;  2LLT A;  4PHJ A;  1IQ3 A;  5KU1 A;  1IJ6 A;  2K2A A;  2FCD A;  2K2F A;  3LLE A;  4TNC A;  4CPV A;  3DVJ A;  4KYN A;  1UP5 A;  1FW4 A;  4I5J A;  3S0G A;  4PHM A;  3O6B A;  3RZS A;  1XVJ A;  3BUW B;  3FE6 A;  1BU3 A;  1KFX L;  2GTE A;  2M29 A;  3IQO A;  2EC6 C;  3OP0 A;  1XK4 C;  5CPV A;  3VRP A;  3C1V A;  3RM1 A;  4JWQ A;  3CS1 A;  2F2P A;  3PAL A;  3OHM B;  2JRF A;  2ZN9 A;  3EVU A;  4PHK A;  1U5I B;  4ZCU A;  1BOD A;  2M7L A;  3AAK A;  4PAL A;  1SMG A;  2I2R E;  1B7T Y;  5FI6 A;  3S0D A;  1K94 A;  1EXR A;  1MUX A;  1SY9 A;  1UHN A;  1N2D A;  4FQT A;  4YGA A;  1C7V A;  1JWD A;  2ZRT A;  4MZK A;  1ALV A;  5HLO A;  4GPL B;  4MZL A;  5HL1 A;  3R72 A;  1NX3 A;  1HT9 A;  3CZ0 A;  2M3W A;  4OV2 A;  1TIZ A;  3R1P A;  1FF1 A;  2COL B;  2LHI A;  1FI5 A;  2JTT A;  1ZFS A;  2JT3 A;  1KCY A;  5I2L A;  1TUJ A;  2I18 A;  1NPQ A;  4MZJ A;  1S6J A;  1REC A;  3BFH A;  3BYA A;  1SL9 A;  2KLE A;  1ZMZ A;  1DJI A;  3B6X A;  1PSB A;  4I5N B;  2OTG B;  2LE9 B;  1AJ4 A;  1EH2 A;  4NDD A;  1M63 B;  2HET A;  2F8P A;  1CLL A;  1S26 D;  2KFH A;  5PAL A;  1SKT A;  1YVH A;  1NX2 A;  1QLK A;  2QPT A;  3SS5 A;  1OSA A;  2Q4U A;  1DJY A;  1A29 A;  3DF0 B;  3OGN A;  1A03 A;  1RTP 1;  3I5F B;  2HF5 A;  2OS8 C;  2WND A;  1UHJ A;  2WCJ A;  4ORC B;  4PDZ A;  5I94 A;  2OPO A;  1K95 A;  3AAJ A;  3HX4 A;  2SCP A;  1UHK A;  1TOP A;  1J1D A;  2K8M B;  1B1G A;  3WXA A;  1IQ5 A;  1YX7 A;  5JOL A;  1F54 A;  2BL0 C;  2LP3 A;  3FS7 A;  2KBM A;  5CSN A;  4BY5 A;  4YI9 A;  3FE9 A;  2I94 A;  3B7A A;  4MRX A;  3NSL A;  2LMT A;  3LCP C;  2DOQ A;  2LV7 A;  2QDI A;  5DKR A;  4CID A;  1QV0 A;  2O5G A;  3DVE A;  3TUY B;  1S5G Y;  2KNE A;  4DCK A;  1YUU A;  2L2E A;  1DQE A;  4JPZ B;  4YI8 A;  1W7J B;  4WQ2 A;  2K7B A;  1PK0 D;  3SIA A;  2K60 A;  3SS3 A;  2LLU A;  3VRN A;  1KSM A;  1E8A A;  2KHN A;  3TDU A;  1NX1 A;  3I5H C;  3KPX A;  1CFC A;  3BFA A;  2ZKM X;  2CT9 A;  3A4U B;  1F8H A;  1SL8 A;  1PRW A;  2BCA A;  2A4J A;  3I5G C;  4N1G A;  4QJ4 B;  3CZ1 A;  5BPJ A;  3PFV A;  2M1U A;  1J7Q A;  1LIN A;  3DD4 A;  1F55 A;  1JBA A;  5HKW A;  1OMR A;  1XYD A;  2EGD A;  3TS5 C;  4AQJ A;  1QX5 B;  3D78 A; 
#chains in the Genus database with same CATH homology
 1CB1 A;  1AUI B;  4PE4 A;  2K0J A;  4FTG A;  1WRZ A;  4L9M A;  4YGE B;  1AK8 A;  3SG3 A;  3CR4 X;  2BE4 A;  3PN7 C;  2HQW A;  1DT7 B;  4MBE A;  5ER5 A;  2IS9 A;  1F70 A;  2HQ8 A;  2WC8 A;  2KSP A;  2NCO A;  1ZUZ A;  3WHT B;  1L2O B;  1Q80 A;  1TCF A;  2NZ0 A;  1A75 B;  1QX2 A;  2JXC A;  1F71 A;  1J7P A;  2V53 A;  4P5O E;  2KAV A;  1SCV A;  1LKJ A;  3O78 A;  4A4C A;  4OR9 B;  5G08 A;  1G33 A;  1S6C A;  2NXQ A;  2CXJ A;  5AEQ A;  4PCW A;  1NWD A;  5I2O A;  4CFQ A;  3EK8 A;  2WOR A;  1XA5 A;  2PSR A;  1S1E A;  1J1E A;  2LVJ A;  1DGU A;  2KYC A;  3I5I C;  2ZNE A;  4PE0 A;  1NCX A;  3O4Y A;  2KI6 D;  2M8U A;  1KQM B;  3CZT X;  2Y1M A;  3EKJ A;  4FQO A;  2MAZ A;  1K96 A;  2LUX A;  3SG2 A;  1HQV A;  1K9U A;  1S36 A;  3EVV A;  2FOT A;  1B8L A;  1DMO A;  3NSK A;  2JU0 A;  2H61 A;  3WHU B;  2LC5 A;  1QX7 A;  1OE9 B;  2CNP A;  1QV1 A;  2GGM A;  1BOC A;  3CR2 A;  1MQ1 A;  1C07 A;  1G4Y R;  4PHN A;  1EG3 A;  1FI6 A;  3EK4 A;  2LMU A;  2L4I A;  1YRT B;  2BEC A;  1Y1U A;  4NDC A;  1SK6 D;  2M1K B;  1N65 A;  2AUC A;  2M97 A;  2RGI A;  2ZRS A;  3DVK A;  1D1O A;  1KWO C;  2ISD A;  1SRA A;  1CLB A;  1U5I A;  1BT6 A;  3LK0 A;  1K93 D;  1M46 A;  1XFX O;  1QJT A;  4M2P A;  4CFR A;  1YR5 A;  1JFJ A;  2GV5 A;  1AHR A;  3ICB A;  1XFU O;  2KI4 B;  3GK1 A;  2CCM A;  1PSR A;  1MWN A;  4GFT A;  4QJ3 B;  1PVB A;  4GGN A;  2R2I A;  1M39 A;  1XFW O;  4I5K A;  1JFK A;  2TN4 A;  3JTD C;  1XK4 A;  4M2Q A;  1EJ3 A;  1B4C A;  3O2P A;  1MXL C;  1SW8 A;  3GK2 A;  1IJ5 A;  2AAO A;  3GK4 X;  2Y1N A;  4C0J A;  4XYN A;  1WRL A;  3BXK A;  1M31 A;  3DF0 A;  2H2K A;  4DIR A;  1WDC B;  1ALW A;  3VRO A;  2KFG A;  5CSF A;  1R2U A;  4GNK B;  2Y4Q A;  1MXE A;  3OX5 A;  2SAS A;  5AFP A;  1K2H A;  4GGF C;  3EKH A;  5DKQ A;  1JC2 A;  1NX0 A;  1H8B A;  3CLN A;  1QLS A;  3TUY C;  1F4O A;  2LUC A;  1AVS A;  1CFP A;  1YX8 A;  4CLN A;  2PAL A;  3KEV A;  5I2Q A;  1S6I A;  1RJV A;  2K61 A;  1BR1 B;  3EK7 A;  2JT8 A;  2E30 A;  4GBA A;  1NUB A;  1TTX A;  5HKZ A;  5HKY A;  3CWG A;  2LVI A;  1YVL A;  3CTN A;  5TNC A;  4ZCV A;  2KYF A;  3CR5 X;  3OB1 B;  1Y1A A;  1J7R A;  1TNW A;  3SJS A;  2KI6 C;  1LA3 A;  4NDB A;  2PMY A;  1M45 A;  1OMV A;  1LVC D;  1RWY A;  5I8N A;  2Q91 A;  3LL8 B;  3VRR A;  4HSZ A;  1IRJ A;  1K9K A;  4ORB B;  1SR6 B;  2BL0 B;  4YBH B;  1B8R A;  4C0K A;  4XJK A;  5D7F A;  2KAX A;  1CFD A;  4XJK B;  2PAS A;  1BMO A;  2LNK A;  2WCE A;  1BF5 A;  1TN4 A;  1IG5 A;  5ER4 X;  1KK8 B;  5CSJ A;  3AKA A;  1AP4 A;  1XFV O;  1CDP A;  4GAO A;  1LXF C;  5DKN A;  1NP8 A;  1KFU S;  2ZND A;  4M2O A;  1A75 A;  4N1F A;  1CDN A;  3NXA A;  3GOF A;  1CM1 A;  3I5H B;  1KSO A;  1RK9 A;  1FBV A;  3JVT C;  2JOJ A;  2KGR A;  4BY4 A;  4DUQ A;  1YUS A;  1DGV A;  3KF9 A;  4HRG A;  1MR8 A;  2BCX A;  3I5G B;  2JUL A;  5CSI A;  2WCF A;  2MBX A;  1J55 A;  2LVK A;  3TS5 B;  1YUR A;  3OX6 A;  5B8I B;  4PE7 A;  3DVM A;  2L0P A;  1NCY A;  1DF0 B;  4I5L B;  3MSE B;  1UHH A;  1OOJ A;  1ZOT B;  2JT0 A;  2JXL A;  2FJU B;  4QJ5 B;  1K8U A;  1PUL A;  3OB2 B;  2MLE C;  3PN7 B;  1DTL A;  2BKH B;  2H61 C;  1MF8 B;  2K7O A;  1YTZ C;  2GGZ A;  1CMG A;  2L98 A;  2E6W A;  2MA2 A;  2P6B B;  1GJY A;  2PVB A;  2BBM A;  1Y1X A;  1BG1 A;  1TCO B;  1WLM A;  3ZWH A;  1CNP A;  1B9A A;  5KSZ A;  1ZAC A;  3HCM A;  5FYX A;  4AOM A;  1CFF A;  5AER A;  3TDI A;  1KK7 Z;  1QVI Z;  1MHO A;  3D0Y A;  3TDZ A;  3D0Y B;  3FIA A;  1KFX S;  1JF2 A;  1SCM B;  1QAT A;  1JUO A;  3IF7 A;  4ETO A;  2BKI B;  1R6P A;  1CKK A;  2MRD A;  1CM4 A;  3VGO A;  4HRH A;  1VRK A;  2O60 A;  3BUO B;  1B8C A;  2I7A A;  2F2O A;  1Y0V H;  1V1G A;  2KQ6 A;  3WNX B;  2L51 A;  4N5X A;  4R1E A;  4OVN F;  4MVF A;  1IH0 A;  2L50 A;  2CTN A;  2OTG C;  2LCP A;  3QRX A;  4WRI A;  1GGZ A;  3SG4 A;  4F0Z B;  1GQM A;  2L5X B;  3FWC A;  3KHE A;  5GQQ C;  4YGC B;  3D10 A;  2LLS A;  2EC6 B;  1S3P A;  1WDC C;  1SNL A;  3I5F C;  3NSO A;  1BLQ A;  1KWO B;  1NSH A;  1QIV A;  3E3R A;  1UUR A;  4DS7 A;  4IL1 A;  4YGD B;  1SL7 A;  3BOW A;  1QAS A;  4MSP A;  1YRU B;  3BOW B;  1ODB A;  1NYA A;  1XO5 A;  2KFF A;  5AAN A;  4C0L A;  1DJH A;  3VRQ A;  3PLF B;  4NQG A;  4D1E A;  1CTR A;  1B7T Z;  1RFJ A;  2M9G A;  4DRW A;  4A4B A;  4HRE E;  1XFZ O;  3F45 A;  5HLV A;  2ZN8 A;  2AMI A;  1W7I B;  1G8I A;  2D8N A;  2F3Z A;  1AJ5 A;  1A2X A;  1XFY O;  3NSI A;  4JQ0 D;  1PVA A;  5IBW A;  1LA0 A;  1QXP A;  2LHL A;  3JTD B;  1WRK A;  2JTZ A;  4PE1 A;  1SPY A;  4WQ3 A;  1CDL A;  4OKH A;  1B47 A;  1DJZ A;  3BQ3 A;  4MLW A;  4ICB A;  5HYD A;  2M0R A;  2BE6 A;  1F4Q A;  2MHH A;  2JNF A;  1A4P A;  2LP2 A;  2NCP A;  3H4S E;  1OMD A;  4U8D A;  3CGA A;  2OS8 B;  1DJW A;  1SR6 C;  3SG7 A;  1RRO A;  3K21 A;  4GGF A;  2M49 B;  3LK1 A;  3PSR A;  2KGB C;  1Y6W A;  3SIB A;  1OZS A;  1TNX A;  2LMV A;  1DJG A;  2G2B A;  2FCE A;  4MEW A;  4YRU A;  1J7O A;  4YGB B;  3EVR A;  1KK8 C;  2LM5 A;  1JF0 A;  2KDH A;  4Q04 A;  1L7Z A;  2K7D A;  2MLF C;  2CBL A;  5K89 A;  2JWW A;  2K7C A;  3SG6 A;  1FPW A;  1L2O C;  1K9P A;  1S5G Z;  2KBI A;  3PM8 A;  1SBJ A;  5D69 A;  1X02 A;  5J3X A;  2EHB A;  2JZI A;  2LVV A;  1IWQ A;  1QIW A;  2WOS A;  2KQY A;  3IQQ A;  1YUT A;  2NLN A;  2LAN A;  1CMF A;  4MRY A;  2BBN A;  1EL4 A;  1BJF A;  1NIW A;  4AQI A;  3BUM B;  2JNX A;  1OQP A;  2JPT A;  3RLZ A;  1DVI A;  2JQ6 A;  1WLZ A;  1CLM A;  1IKU A;  5JJG A;  1UHI A;  1OZO A;  3SG5 A;  1C7W A;  1KQM C;  1KFU L;  4E68 A;  1DF0 A;  4GUK A;  2KAY A;  2G9B A;  3TZ1 A;  2PRU A;  1EG4 A;  2F3Y A;  4P2Y B;  3FWB A;  1PAL A;  4ORA B;  5F6T A;  1TRF A;  4UPG A;  2MJW B;  5AXI A;  1K90 D;  1JSA A;  3AKB A;  2Y5I A;  1GGW A;  1KQV A;  3JVT B;  1UWO A;  2HPS A;  2WCB A;  1SYM A;  2B1U A;  1DJX A;  1KK7 Y;  1QVI Y;  5KTY A;  2L4H A;  4MN0 A;  1TNP A;  2F33 A;  2QAC A;  1NCZ A;  1V1F A;  3A8R A;  1SCM C;  1QTX A;  1N0Y A;  1TNQ A;  1UUS A;  1BR4 B;  3BUX B;  4OCI A;  1WY9 A;  2VRG A;  2ZFD A;  3KO0 A;  2KOT A;  4USL A;  2LAP A;  1QS7 A;  3BUN B;  2JC2 A;  3I5I B;  2BCB A;  3M0W A;  1IGV A;  2M7N A;  3PAT A;  3ZNI A;  2KI4 C;  1CDM A;  2LLT A;  4PHJ A;  1IQ3 A;  5KU1 A;  1IJ6 A;  2K2A A;  2FCD A;  2K2F A;  3LLE A;  4TNC A;  4CPV A;  3DVJ A;  1UP5 A;  1FW4 A;  4I5J A;  4PHM A;  3O6B A;  1XVJ A;  3BUW B;  1BU3 A;  1KFX L;  3OP0 A;  2M29 A;  3IQO A;  2EC6 C;  1XK4 C;  5CPV A;  3VRP A;  3C1V A;  3RM1 A;  4JWQ A;  3CS1 A;  2F2P A;  3PAL A;  3OHM B;  2JRF A;  2ZN9 A;  3EVU A;  4PHK A;  1U5I B;  4ZCU A;  1BOD A;  2M7L A;  3AAK A;  4PAL A;  1SMG A;  2I2R E;  1B7T Y;  1K94 A;  1EXR A;  1MUX A;  1SY9 A;  1UHN A;  1N2D A;  1C7V A;  4YGA A;  1JWD A;  2ZRT A;  4MZK A;  1ALV A;  5HLO A;  4GPL B;  4MZL A;  1NX3 A;  1HT9 A;  4OV2 A;  2M3W A;  1TIZ A;  1FF1 A;  2COL B;  2LHI A;  1FI5 A;  2JTT A;  1ZFS A;  2JT3 A;  1KCY A;  5I2L A;  2I18 A;  1NPQ A;  4MZJ A;  1S6J A;  1REC A;  3BYA A;  1SL9 A;  1ZMZ A;  1DJI A;  4I5N B;  1PSB A;  2OTG B;  2LE9 B;  1AJ4 A;  1EH2 A;  4NDD A;  1M63 B;  2HET A;  2F8P A;  1CLL A;  1S26 D;  2KFH A;  5PAL A;  1SKT A;  1YVH A;  1NX2 A;  1QLK A;  2QPT A;  1OSA A;  2Q4U A;  1DJY A;  1A29 A;  3DF0 B;  1A03 A;  1RTP 1;  3I5F B;  2HF5 A;  2OS8 C;  2WND A;  1UHJ A;  4ORC B;  4PDZ A;  1H4B A;  2OPO A;  1K95 A;  3AAJ A;  3HX4 A;  2SCP A;  1UHK A;  1TOP A;  1J1D A;  2K8M B;  1B1G A;  3WXA A;  1IQ5 A;  1YX7 A;  5JOL A;  1F54 A;  2BL0 C;  2LP3 A;  3FS7 A;  2KBM A;  5CSN A;  4BY5 A;  4YI9 A;  2I94 A;  4MRX A;  3NSL A;  2LMT A;  3LCP C;  2DOQ A;  2LV7 A;  5DKR A;  4CID A;  1QV0 A;  2O5G A;  3DVE A;  3TUY B;  1S5G Y;  2KNE A;  4DCK A;  1YUU A;  2L2E A;  4YI8 A;  4JPZ B;  1W7J B;  4WQ2 A;  2K7B A;  1PK0 D;  3SIA A;  2LLU A;  3VRN A;  1KSM A;  1E8A A;  2KHN A;  3TDU A;  1NX1 A;  3I5H C;  3KPX A;  1CFC A;  2ZKM X;  2CT9 A;  3A4U B;  1F8H A;  1SL8 A;  1PRW A;  2BCA A;  2A4J A;  3I5G C;  4N1G A;  4QJ4 B;  5BPJ A;  1J7Q A;  3PFV A;  2M1U A;  1LIN A;  3DD4 A;  1F55 A;  1JBA A;  5HKW A;  1OMR A;  1XYD A;  2EGD A;  3TS5 C;  4AQJ A;  1QX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...