4DS7A

Crystal structure of yeast calmodulin bound to the c-terminal fragment of spindle pole body protein spc110
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
144
structure length
144
Chain Sequence
NLTEEQIAEFKEAFALFDKDNSGSISASELATVMRSLGLSPSEAEVADLMNEIDVDGNHAIEFSEFLALMSRQLKCNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIKQFAALLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Calmodulin
publication title The molecular architecture of the yeast spindle pole body core determined by Bayesian integrative modeling.
pubmed doi rcsb
source organism Kluyveromyces lactis
total genus 50
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ds7A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ds7A01
1AVSA 1PVBA 2DOQA 1BF5A 3WNXB 1K8UA 1UURA 2ZN8A 2M3WA 1S6JA 3A4UB 1LXFC 1B4CA 5K89A 1YX8A 1GJYA 2Y1MA 4GFTA 2LHLA 2JOJA 2E6WA 4ORAB 1S5GY 1G8IA 1SR6B 1NX2A 2Y4QA 1DJYA 1WLMA 2BKIB 1B8CA 1OOJA 2H61A 3CLNA 4QJ4B 4DIRA 2K2FA 1FI5A 1EL4A 1ODBA 1AJ4A 1JSAA 2WCFA 3DF0B 2ZKMX 3EK8A 1ZUZA 2M29A 1ZMZA 2JULA 2L98A 4F0ZB 2FOTA 2ISDA 2F2OA 3FWBA 1IGVA 2LMUA 5B8IB 5HKYA 1MQ1A 1S36A 2E30A 2F2PA 5HYDA 5HLVA 1UUSA 5D69A 3D10A 1BT6A 1QASA 2AUCA 2MHHA 2LVVA 4BY4A 1GQMA 1MR8A 1JFKA 2NZ0A 2I18A 2K7DA 4JPZB 3HX4A 2BE4A 1B7TZ 5AERA 3O2PA 2CTNA 1UHKA 1QLKA 1JUOA 1QX2A 2Q4UA 3I5HC 4U8DA 1NUBA 1K96A 1TCFA 2BBMA 2MLEC 3BQ3A 1CFFA 1EG4A 4NDBA 4AQJA 1AP4A 1JF2A 1YRTB 3RLZA 3DD4A 1UHNA 2BL0B 1N65A 1SRAA 3DVJA 4DCKA 1KQMB 3C1VA 1OZSA 4HRHA 1KSMA 4ORCB 1YVHA 4C0KA 4I5LB 4UPGA 1J1EA 1H4BA 1JBAA 1OZOA 3I5IC 1XK4C 1F54A 1UP5A 2LM5A 5CSIA 1XA5A 1CNPA 3LCPC 2GGMA 1WRKA 4MBEA 4YBHB 2EC6B 2CBLA 3EVRA 3NSIA 1GGZA 1XFVO 1S26D 4M2PA 5AANA 2MJWB 3EK4A 1TOPA 4C0JA 1QLSA 2KOTA 1EG3A 2LP3A 1D1OA 1BLQA 4PDZA 4ORBB 1R2UA 4GGNA 2K7OA 3GK2A 1RJVA 3TUYB 1YTZC 1CFPA 1JC2A 1G4YR 1MXEA 1Y1XA 2WORA 3I5GB 3TS5B 5D7FA 1J1DA 1AUIB 1QXPA 2JXCA 1CLMA 3EVUA 1IH0A 1N0YA 1W7JB 2M7NA 2MBXA 1A03A 1KK7Z 2EGDA 1IRJA 2KYCA 1E8AA 1S3PA 1YRUB 1DTLA 1CTRA 2I94A 1LA3A 1OE9B 3AKAA 1WRLA 1BR4B 2JRFA 2SCPA 4MZKA 5HKZA 1K93D 1S5GZ 4C0LA 1K9PA 2JQ6A 1Y6WA 3FIAA 1CLBA 3BOWB 1QX7A 2KBIA 1YUSA 1J55A 4IL1A 1KK8B 1A2XA 1IWQA 1G33A 1W7IB 2M97A 2JTZA 1PALA 1LINA 2PRUA 1BJFA 1FW4A 2B1UA 3ZNIA 4E68A 2MRDA 3SG7A 1N2DA 5JOLA 1J7QA 1M46A 3O4YA 3KEVA 3PALA 4FTGA 1R6PA 4PE7A 4WRIA 2JNFA 1RWYA 4CLNA 5KU1A 2FJUB 5DKQA 2L50A 1SY9A 4PALA 3KPXA 2CNPA 2LANA 3PFVA 2LV7A 4I5JA 1ZACA 3LL8B 3HCMA 1B9AA 1KFXL 1UHHA 1MHOA 1KK7Y 1SBJA 3D0YA 4JQ0D 4YGAA 2K8MB 5F6TA 1TNPA 1PRWA 1KK8C 1YX7A 5DKRA 2GGZA 4ZCVA 1CKKA 1BU3A 1DJHA 3I5HB 1CFDA 1DVIA 1OMRA 2K7BA 2L4HA 5CPVA 4YI8A 2OTGB 3VROA 2JPTA 4PHMA 1BR1B 3MSEB 1XYDA 1WLZA 2FCEA 3VGOA 1SCVA 1F55A 1TIZA 1S6IA 1TTXA 1DF0B 2NLNA 1QTXA 2P6BB 5I2LA 2JNXA 2L2EA 1CM1A 1QJTA 4BY5A 2BKHB 2JU0A 1FF1A 1B47A 2SASA 2HF5A 3I5IB 4YI9A 3VRPA 4GGFC 1X02A 1A75B 3LLEA 2V53A 2ZN9A 2PALA 1J7PA 4CFQA 3BUMB 1XFUO 2RGIA 1CDMA 1QX5B 3DVEA 4USLA 4GAOA 1TRFA 2NXQA 5DKNA 2BCBA 3DVKA 2KGBC 1PULA 2JT8A 4N5XA 1JFJA 4XJKA 4XYNA 3VRRA 2F3YA 3BXKA 2CT9A 3M0WA 4OKHA 5JJGA 2OTGC 5CSJA 3BUOB 3JTDC 3PATA 1KFUL 1OMVA 1NX3A 2F8PA 3NSOA 3CTNA 4R1EA 1IKUA 2M49B 1YUTA 1XFXO 3OHMB 4P5OE 1KQVA 1CMGA 3CS1A 1IQ3A 1HQVA 2CXJA 1JWDA 5AEQA 1KWOC 1Y1AA 4MZJA 1IG5A 1CDLA 2WNDA 3AKBA 4MN0A 4A4BA 4MSPA 2M1KB 2A4JA 3LK0A 1UHJA 3NXAA 1M39A 1LKJA 2F3ZA 3EKJA 2K7CA 1C7WA 2KSPA 3KHEA 2K61A 2JZIA 3F45A 3SG2A 1NIWA 1A4PA 1FPWA 3CGAA 1SPYA 2JT0A 3SG3A 5I2OA 4AOMA 3JVTC 1M45A 1NCXA 1RK9A 1SL8A 1F4QA 1BODA 4ICBA 4NQGA 4OR9B 2L4IA 1M63B 3PM8A 1TNQA 4OV2A 4D1EA 1K2HA 2BE6A 2OPOA 3DF0A 4M2QA 1QIWA 2PMYA 1QS7A 2KFFA 4M2OA 5IBWA 3AAJA 1PSBA 1IJ6A 1DMOA 1NPQA 4CFRA 4YGEB 2G9BA 3SJSA 3O78A 2KAXA 2LLUA 3OX6A 1QV1A 2M0RA 3IQOA 2O60A 2LUXA 1K95A 1L2OC 4MVFA 1QATA 3TDZA 4HREE 2JXLA 3ICBA 3VRQA 1K9UA 3SG5A 3SG6A 1MWNA 1RROA 2HETA 1QVIZ 4DUQA 1DJXA 4N1GA 3ZWHA 2KNEA 1WY9A 1PSRA 2NCOA 1AHRA 3PSRA 1TNWA 4MEWA 3CZTX 2BBNA 4L9MA 4GUKA 4QJ3B 1AK8A 2R2IA 1XFWO 2WCEA 1DJWA 5HKWA 2LVIA 4P2YB 3WXAA 3CR4X 1CM4A 1CLLA 1NCYA 1ALWA 1V1GA 1U5IB 4FQOA 1SL9A 5G08A 1ALVA 1S1EA 2MAZA 1TNXA 3BUNB 3FWCA 1K94A 1RFJA 4PHJA 4PHNA 3KF9A 2LMTA 4WQ3A 2H61C 2F33A 1F71A 1KFUS 2BCAA 1SMGA 3GK1A 4PHKA 5KSZA 1DGUA 1OSAA 2I7AA 1WDCC 2NCPA 4ETOA 2HQ8A 3OB2B 1C7VA 3OP0A 1CMFA 4PE1A 3JTDB 1DJIA 4MRXA 2HQWA 2LAPA 2LHIA 3PN7C 5CSNA 2KFGA 1DT7B 1QVIY 2WC8A 1HT9A 1QIVA 1L7ZA 2ZRSA 2KYFA 1KWOB 1CDNA 2I2RE 4DS7A 1PK0D 2KQ6A 4PE0A 1SK6D 3SG4A 5BPJA 4PE4A 3I5FC 1OMDA 1UWOA 2M9GA 2QPTA 2COLB 3BOWA 5FYXA 2MA2A 1FBVA 2QACA 4OVNF 1H8BA 3JVTB 2FCDA 1DJZA 2L51A 2D8NA 1UHIA 4DRWA 4MZLA 4ZCUA 3WHTB 1NYAA 1OQPA 1A29A 4YRUA 1ZOTB 4PCWA 4GPLB 1Y0VH 1F8HA 1YVLA 3RM1A 1F4OA 2LLTA 4HSZA 4AQIA 5I8NA 1RECA 2BECA 1NWDA 3EVVA 2JTTA 2WOSA 4YGDB 2PSRA 1LVCD 2IS9A 3PLFB 2M8UA 1U5IA 1YUUA 1GGWA 4CIDA 4GGFA 4I5KA 1K9KA 3IQQA 2KAVA 3E3RA 1SR6C 2HPSA 4NDDA 1XFYO 2KBMA 2LUCA 4YGBB 1DGVA 2KFHA 4GNKB 5ER4X 4NDCA 2LCPA 1L2OB 1Q80A 2ZNDA 4TNCA 5HLOA 2WCBA 1K90D 1AJ5A 2JC2A 4Q04A 2OS8B 1MUXA 3BUXB 4OCIA 4MLWA 3FS7A 2Y1NA 2K0JA 1FI6A 3WHUB 2AAOA 3CR5X 1DF0A 3GOFA 2LVJA 2O5GA 1LA0A 5GQQC 1NX0A 3CWGA 1BG1A 1C07A 3A8RA 3TZ1A 1KSOA 1DJGA 3O6BA 3SIAA 2CCMA 1B1GA 1XVJA 2MLFC 2JWWA 1XK4A 1ZFSA 3D0YB 1KFXS 3QRXA 1Y1UA 2LNKA 4CPVA 4A4CA 1A75A 1SNLA 2L5XB 4N1FA 1NP8A 1XO5A 3K21A 1SCMB 1TN4A 2KI6C 4MRYA 2LC5A 1B7TY 5AXIA 1J7RA 2K2AA 2BL0C 2TN4A 2M7LA 1KQMC 5I2QA 3TDIA 3LK1A 1EH2A 2LP2A 1NSHA 2EHBA 4YGCB 3CR2A 1CDPA 1B8RA 1TCOB 2VRGA 2Y5IA 2OS8C 3OX5A 1KCYA 1SYMA 1WDCB 2LE9B 2ZFDA 3GK4X 1EJ3A 2PASA 1F70A 2KI6D 2LVKA 4GBAA 2KI4B 3DVMA 3NSLA 1QV0A 3TDUA 1CB1A 5TNCA 5J3XA 2EC6C 1WRZA 3KO0A 2JT3A 1BOCA 2LMVA 2KQYA 3SIBA 5KTYA 3PN7B 1M31A 1IQ5A 3H4SE 1J7OA 2M1UA 1CFCA 3IF7A 3OB1B 1VRKA 5CSFA 5PALA 1JF0A 1MF8B 2ZRTA 1SCMC 1SW8A 2LLSA 1YR5A 4HRGA 4WQ2A 3AAKA 3EK7A 4XJKB 3BYAA 4JWQA 2PVBA 1YURA 1IJ5A 1RTP1 2G2BA 2Q91A 1NX1A 2ZNEA 3BUWB 1PVAA 1BMOA 1S6CA 3I5FB 3TUYC 2KGRA 2BCXA 3I5GC 3NSKA 3EKHA 2H2KA 1NCZA 4I5NB 3TS5C 5AFPA 2KHNA 1SL7A 2GV5A 2KDHA 2L0PA 3VRNA 1EXRA 1MXLC 2AMIA 5ER5A 2KI4C 1SKTA 4QJ5B 1XFZO 2KAYA 1B8LA 1V1FA
chains in the Genus database with same CATH superfamily
1AVSA 1PVBA 2DOQA 1BF5A 3WNXB 1K8UA 1UURA 2ZN8A 2M3WA 1S6JA 3A4UB 1LXFC 1B4CA 5K89A 3R1OA 5D3OA 2WC6A 1YX8A 1GJYA 2Y1MA 4GFTA 2LHLA 2JOJA 2E6WA 4ORAB 1S5GY 1GM0A 1G8IA 1SR6B 1NX2A 2Y4QA 1DJYA 1WLMA 2BKIB 1B8CA 1OOJA 2H61A 3CLNA 4QJ4B 4DIRA 2L5YA 2K2FA 1FI5A 1EL4A 1ODBA 1AJ4A 1JSAA 2WCFA 3DF0B 2ZKMX 3EK8A 1ZUZA 2M29A 1ZMZA 2JULA 1Z2CB 2L98A 2FOTA 2ISDA 2F2OA 3BFBA 1IGVA 2LMUA 3FWBA 5B8IB 5HKYA 1MQ1A 1DEKA 1S36A 2E30A 2F2PA 5HYDA 5HLVA 3SS4A 3Q8IA 1UUSA 5D69A 3D10A 1BT6A 1QASA 2AUCA 1XFRA 3N7HA 2MHHA 2LVVA 3L4LA 4BY4A 1GQMA 1MR8A 1JFKA 2NZ0A 2I18A 2K7DA 4JPZB 3HX4A 2PYQA 3FE6A 2BE4A 1B7TZ 4IJ7A 3O2PA 5AERA 2CTNA 1UHKA 1QLKA 1JUOA 1QX2A 2Q4UA 3I5HC 4U8DA 1QWVA 1NUBA 1K96A 1TCFA 2BBMA 2MLEC 3BQ3A 1C3YA 1EG4A 4NDBA 4AQJA 1CFFA 1AP4A 2QEHA 1JF2A 1YRTB 3RLZA 3DD4A 1UHNA 2BL0B 1N65A 1SRAA 3DVJA 4DCKA 1KQMB 3C1VA 1OZSA 4HRHA 1KSMA 2P71A 1YVHA 3PM2A 1OOFA 1W9ZA 3QMEA 4I5LB 4ORCB 4C0KA 1J1EA 4UPGA 1H4BA 1ORGA 1JBAA 1OZOA 3I5IC 1XK4C 1F54A 1UP5A 2LM5A 1TWOA 5CSIA 1XA5A 1CNPA 3LCPC 2GGMA 1WRKA 2KLEA 4MBEA 1DQEA 4YBHB 2EC6B 1TUJA 2CBLA 3EVRA 3NSIA 1GGZA 1XFVO 1S26D 3RZSA 2KLDA 4M2PA 5AANA 2MJWB 3EK4A 1TOPA 4C0JA 3DZTA 1QLSA 2KOTA 1EG3A 2LP3A 2WCMA 1D1OA 1BLQA 4PDZA 4ORBB 1R2UA 4GGNA 2K7OA 3GK2A 1RJVA 3TUYB 2JPOA 2QEBA 1YTZC 1CFPA 1JC2A 1G4YR 1MXEA 1Y1XA 2WORA 3I5GB 4OZDA 3TS5B 5D7FA 1J1DA 1AUIB 1QXPA 2JXCA 1CLMA 3EVUA 3DY9A 1IH0A 1N0YA 1W7JB 2M7NA 2MBXA 1A03A 1KK7Z 2EGDA 1IRJA 1SSEB 2KYCA 1E8AA 1S3PA 1YRUB 1DTLA 1CTRA 2I94A 1LA3A 1OE9B 3AKAA 1WRLA 1C3ZA 1BR4B 2JRFA 4KYNA 2SCPA 4MZKA 5HKZA 1K93D 1S5GZ 4C0LA 1K9PA 2JQ6A 1Y6WA 3FIAA 1CLBA 3BOWB 1QX7A 2KBIA 1YUSA 1J55A 4IL1A 1KK8B 1A2XA 1IWQA 1G33A 1W7IB 2M97A 2JTZA 1PALA 1LINA 2PRUA 1BJFA 1FW4A 2B1UA 3ZNIA 4E68A 2MRDA 3NGVA 3SG7A 1N2DA 5JOLA 1J7QA 1M46A 3R1VA 3O4YA 3KEVA 3D75A 3PALA 4FTGA 1R6PA 4PE7A 4WRIA 2JNFA 1RWYA 4CLNA 5KU1A 2FJUB 5DKQA 2L50A 1SY9A 5FI6A 4PALA 3KPXA 2CNPA 2LANA 3PFVA 2LV7A 4I5JA 1ZACA 3LL8B 3V2LA 3HCMA 1B9AA 1UHHA 1KFXL 1MHOA 1KK7Y 1OOGA 1OOHA 1SBJA 3D0YA 4JQ0D 4YGAA 5DICA 2WC5A 2K8MB 5F6TA 1TNPA 1PRWA 1KK8C 1YX7A 5DKRA 2GGZA 4ZCVA 1CKKA 1BU3A 1DJHA 3I5HB 1CFDA 3PJIA 4F0ZB 1DVIA 1OMRA 2K7BA 3FE8A 1P28A 2L4HA 5CPVA 4YI8A 2OTGB 3VROA 2JPTA 4PHMA 1BR1B 3MSEB 1XYDA 2PQLA 3IVTA 1WLZA 2FCEA 3VGOA 1SCVA 1F55A 1TIZA 1S6IA 1TTXA 1DF0B 2NLNA 1QTXA 2P6BB 5I2LA 2JNXA 3OBVA 2L2EA 1CM1A 1QJTA 4BY5A 2BKHB 2JU0A 1FF1A 3S0EA 1B47A 2SASA 2HF5A 3I5IB 4YI9A 3O4XA 3VRPA 1Z4HA 4GGFC 3D78A 1X02A 1A75B 2QEVA 3LLEA 2V53A 4INWA 2ZN9A 2PALA 1J7PA 3CZ0A 4CFQA 3BUMB 1XFUO 2RGIA 1CDMA 1QX5B 2BNXA 3DVEA 4USLA 4GAOA 1TRFA 3VB1A 2NXQA 5DKNA 2BCBA 3DVKA 2KGBC 1PULA 2JT8A 4N5XA 1JFJA 4XJKA 5I94A 4XYNA 3VRRA 2F3YA 3BXKA 2CT9A 3M0WA 4OKHA 5JJGA 2OTGC 5CSJA 3BUOB 3JTDC 3PATA 1KFUL 1OMVA 1NX3A 2F8PA 3NSOA 3CTNA 4R1EA 1IKUA 2M49B 1YUTA 1XFXO 3OHMB 4P5OE 1KQVA 1CMGA 3CS1A 1IQ3A 1HQVA 2CXJA 2QDIA 2KPHA 1JWDA 5AEQA 1KWOC 1Y1AA 3B86A 1IG5A 4MZJA 1CDLA 2H8VA 2WNDA 3AKBA 3D73A 4MN0A 4A4BA 4MSPA 2M1KB 2A4JA 3LK0A 1UHJA 3NXAA 1M39A 1LKJA 2F3ZA 3EKJA 2K7CA 1C7WA 2KSPA 3DXLA 3KHEA 2K61A 3BFAA 2JZIA 3F45A 3SG2A 1NIWA 1OW4A 1A4PA 1FPWA 3CGAA 1SPYA 2JT0A 3SG3A 5I2OA 4AOMA 3JVTC 1M45A 1NCXA 1RK9A 2FJYA 1SL8A 1F4QA 1BODA 4ICBA 4NQGA 4OR9B 2L4IA 1M63B 3PM8A 3R72A 1TNQA 4OV2A 4D1EA 1K2HA 2BE6A 2OPOA 3DF0A 4M2QA 1QIWA 2PMYA 1DC1A 1QS7A 2KFFA 4M2OA 5IBWA 3AAJA 1PSBA 1IJ6A 1DMOA 1NPQA 4CFRA 4YGEB 2G9BA 3SJSA 3O78A 2QEOA 2KAXA 2LLUA 3OX6A 3NHIA 1QV1A 2M0RA 3OGNA 3IQOA 2O60A 2LUXA 1K95A 3S0GA 1L2OC 4MVFA 1QATA 3TDZA 3FE9A 4HREE 2JXLA 3ICBA 3VRQA 1K9UA 3SG5A 3SG6A 1MWNA 1RROA 2HETA 1QVIZ 3B88A 4DUQA 1DJXA 4F7FA 4N1GA 3ZWHA 2KNEA 1WY9A 1PSRA 2NCOA 1AHRA 3PSRA 1TNWA 4MEWA 3CZTX 2BBNA 4L9MA 4GUKA 4QJ3B 1AK8A 2R2IA 1XFWO 2WCEA 1DJWA 5HKWA 3CDNA 2LVIA 4P2YB 3WXAA 3CR4X 1CM4A 1CLLA 1NCYA 1ALWA 1V1GA 1U5IB 4FQOA 5FI2A 1SL9A 5G08A 1ALVA 1S1EA 2BAPA 2MAZA 1TNXA 3BUNB 2WCHA 1K94A 1RFJA 2K60A 3FWCA 4PHJA 4PHNA 3KF9A 2LMTA 4WQ3A 2H61C 2F33A 1F71A 1KFUS 2BCAA 1OOIX 1SMGA 3GK1A 4PHKA 5KSZA 1DGUA 1OSAA 2I7AA 2GTEA 1WDCC 2NCPA 4ETOA 2HQ8A 3CABA 3OB2B 1C7VA 3OP0A 1CMFA 4PE1A 3JTDB 1DJIA 4MRXA 2HQWA 2LAPA 2LHIA 3UO9A 3PN7C 5CSNA 2KFGA 1DT7B 1QVIY 2WC8A 3NHTA 1HT9A 1QIVA 1L7ZA 2ZRSA 2KYFA 1KWOB 4INXA 3S0FA 3B7AA 1CDNA 3CYZA 3K1EA 2I2RE 4DS7A 1PK0D 2KQ6A 3SS3A 4PE0A 1SK6D 3SG4A 5BPJA 4PE4A 3I5FC 1OMDA 1UWOA 2M9GA 2QPTA 3B87A 2COLB 3BOWA 5FYXA 2MA2A 1FBVA 2QACA 4OVNF 1H8BA 3JVTB 2FCDA 1DJZA 2L51A 2D8NA 1UHIA 4DRWA 4MZLA 4PT1A 4ZCUA 3WHTB 3L4AA 3UNWA 1NYAA 1OQPA 1A29A 4YRUA 1ZOTB 3BJHA 4PCWA 4GPLB 1Y0VH 3EG5B 1F8HA 3R1PA 1YVLA 3RM1A 1F4OA 2LLTA 4HSZA 4AQIA 5I8NA 3S0DA 1RECA 2BECA 1NWDA 3EVVA 2JTTA 2WOSA 4YGDB 2PSRA 1LVCD 2IS9A 3PLFB 2M8UA 1U5IA 1YUUA 1GGWA 3L47A 4CIDA 4GGFA 4I5KA 1K9KA 3IQQA 2KAVA 3E3RA 1SR6C 2HPSA 4NDDA 1XFYO 2KBMA 1IIOA 5HL1A 2LUCA 4YGBB 1DGVA 2L2CA 2YGUA 2KFHA 1DELA 4GNKB 5ER4X 4NDCA 2LCPA 4FQTA 1L2OB 1Q80A 2ZNDA 4TNCA 5HLOA 5EL2A 2WCBA 1K90D 1AJ5A 2JC2A 4Q04A 2OS8B 1MUXA 3BUXB 4OCIA 4MLWA 3FS7A 2Y1NA 2K0JA 1FI6A 3WHUB 2AAOA 3CR5X 1DF0A 3GOFA 2LVJA 2O5GA 1LA0A 5GQQC 1NX0A 3CWGA 1BG1A 1C07A 2ERBA 3A8RA 3TZ1A 2WCLA 1KSOA 1DJGA 3O6BA 3SIAA 2CCMA 1B1GA 1XVJA 2MLFC 2JWWA 1XK4A 1ZFSA 3D0YB 1KFXS 3QRXA 1Y1UA 2LNKA 4CPVA 4A4CA 1A75A 1SNLA 2L5XB 2WCJA 1NP8A 4N1FA 1XO5A 3K21A 1SCMB 1TN4A 2KI6C 4MRYA 2LC5A 1B7TY 5AXIA 1J7RA 2P70A 2K2AA 2BL0C 2TN4A 2M7LA 3BFHA 1KQMC 5I2QA 3TDIA 3LK1A 1EH2A 2LP2A 3SS5A 1NSHA 2EHBA 4YGCB 3CR2A 1CDPA 3B6XA 1B8RA 1TCOB 2VRGA 2Y5IA 1T14A 2OS8C 3OX5A 1KCYA 1SYMA 1WDCB 2LE9B 2ZFDA 3DYEA 3D76A 1EJ3A 2PASA 3GK4X 1F70A 2KI6D 2LVKA 4GBAA 2KI4B 3DVMA 3NSLA 1QV0A 3TDUA 1CB1A 5TNCA 5J3XA 2EC6C 1WRZA 3KO0A 2WCKA 2JT3A 3S0BA 2LMVA 2KQYA 1BOCA 3SIBA 3D77A 4JD9A 5KTYA 3S0AA 3PN7B 1M31A 1IQ5A 3CZ2A 3H4SE 1J7OA 2M1UA 1CFCA 3IF7A 3OB1B 3D74A 1VRKA 5CSFA 5PALA 1JF0A 1MF8B 2ZRTA 1SCMC 1SW8A 1LS8A 2LLSA 1YR5A 4HRGA 4WQ2A 3AAKA 3EK7A 4XJKB 3BYAA 4JWQA 2PVBA 1TUZA 1YURA 1IJ5A 1RTP1 2G2BA 2Q91A 1NX1A 2ZNEA 3BUWB 1PVAA 1BMOA 1S6CA 3I5FB 3TUYC 2KGRA 2BCXA 3I5GC 3CZ1A 3NSKA 3EKHA 2H2KA 1NCZA 4I5NB 3TS5C 5AFPA 2KHNA 1SL7A 2GV5A 2KDHA 2L0PA 4JKTA 3VRNA 1EXRA 1MXLC 2AMIA 5ER5A 5FI7A 2KI4C 1SKTA 4QJ5B 1XFZO 2KAYA 1B8LA 1V1FA
chains in the Genus database with same CATH topology
1AVSA 1PVBA 2DOQA 1BF5A 3WNXB 1K8UA 1UURA 2ZN8A 2M3WA 1S6JA 3A4UB 1LXFC 1B4CA 5K89A 1YX8A 1GJYA 2Y1MA 4GFTA 2LHLA 2JOJA 2E6WA 4ORAB 1S5GY 1G8IA 1SR6B 1NX2A 2Y4QA 1DJYA 1WLMA 2BKIB 1B8CA 1OOJA 2H61A 3CLNA 4QJ4B 4DIRA 2K2FA 1FI5A 1EL4A 1ODBA 1AJ4A 1JSAA 2WCFA 3DF0B 2ZKMX 3EK8A 1ZUZA 2M29A 1ZMZA 2JULA 2L98A 4F0ZB 2FOTA 2ISDA 2F2OA 3FWBA 1IGVA 2LMUA 5B8IB 5HKYA 1MQ1A 1S36A 2E30A 2F2PA 5HYDA 5HLVA 1UUSA 5D69A 3D10A 1BT6A 1QASA 2AUCA 2MHHA 2LVVA 4BY4A 1GQMA 1MR8A 1JFKA 2NZ0A 2I18A 2K7DA 4JPZB 3HX4A 2BE4A 1B7TZ 5AERA 3O2PA 2CTNA 1UHKA 1QLKA 1JUOA 1QX2A 2Q4UA 3I5HC 4U8DA 1NUBA 1K96A 1TCFA 2BBMA 2MLEC 3BQ3A 1CFFA 1EG4A 4NDBA 4AQJA 1AP4A 1JF2A 1YRTB 3RLZA 3DD4A 1UHNA 2BL0B 1N65A 1SRAA 3DVJA 4DCKA 1KQMB 3C1VA 1OZSA 4HRHA 1KSMA 4ORCB 1YVHA 4C0KA 4I5LB 4UPGA 1J1EA 1H4BA 1JBAA 1OZOA 3I5IC 1XK4C 1F54A 1UP5A 2LM5A 5CSIA 1XA5A 1CNPA 3LCPC 2GGMA 1WRKA 4MBEA 4YBHB 2EC6B 2CBLA 3EVRA 3NSIA 1GGZA 1XFVO 1S26D 4M2PA 5AANA 2MJWB 3EK4A 1TOPA 4C0JA 1QLSA 2KOTA 1EG3A 2LP3A 1D1OA 1BLQA 4PDZA 4ORBB 1R2UA 4GGNA 2K7OA 3GK2A 1RJVA 3TUYB 1YTZC 1CFPA 1JC2A 1G4YR 1MXEA 1Y1XA 2WORA 3I5GB 3TS5B 5D7FA 1J1DA 1AUIB 1QXPA 2JXCA 1CLMA 3EVUA 1IH0A 1N0YA 1W7JB 2M7NA 2MBXA 1A03A 1KK7Z 2EGDA 1IRJA 2KYCA 1E8AA 1S3PA 1YRUB 1DTLA 1CTRA 2I94A 1LA3A 1OE9B 3AKAA 1WRLA 1BR4B 2JRFA 2SCPA 4MZKA 5HKZA 1K93D 1S5GZ 4C0LA 1K9PA 2JQ6A 1Y6WA 3FIAA 1CLBA 3BOWB 1QX7A 2KBIA 1YUSA 1J55A 4IL1A 1KK8B 1A2XA 1IWQA 1G33A 1W7IB 2M97A 2JTZA 1PALA 1LINA 2PRUA 1BJFA 1FW4A 2B1UA 3ZNIA 4E68A 2MRDA 3SG7A 1N2DA 5JOLA 1J7QA 1M46A 3O4YA 3KEVA 3PALA 4FTGA 1R6PA 4PE7A 4WRIA 2JNFA 1RWYA 4CLNA 5KU1A 2FJUB 5DKQA 2L50A 1SY9A 4PALA 3KPXA 2CNPA 2LANA 3PFVA 2LV7A 4I5JA 1ZACA 3LL8B 3HCMA 1B9AA 1KFXL 1UHHA 1MHOA 1KK7Y 1SBJA 3D0YA 4JQ0D 4YGAA 2K8MB 5F6TA 1TNPA 1PRWA 1KK8C 1YX7A 5DKRA 2GGZA 4ZCVA 1CKKA 1BU3A 1DJHA 3I5HB 1CFDA 1DVIA 1OMRA 2K7BA 2L4HA 5CPVA 4YI8A 2OTGB 3VROA 2JPTA 4PHMA 1BR1B 3MSEB 1XYDA 1WLZA 2FCEA 3VGOA 1SCVA 1F55A 1TIZA 1S6IA 1TTXA 1DF0B 2NLNA 1QTXA 2P6BB 5I2LA 2JNXA 2L2EA 1CM1A 1QJTA 4BY5A 2BKHB 2JU0A 1FF1A 1B47A 2SASA 2HF5A 3I5IB 4YI9A 3VRPA 4GGFC 1X02A 1A75B 3LLEA 2V53A 2ZN9A 2PALA 1J7PA 4CFQA 3BUMB 1XFUO 2RGIA 1CDMA 1QX5B 3DVEA 4USLA 4GAOA 1TRFA 2NXQA 5DKNA 2BCBA 3DVKA 2KGBC 1PULA 2JT8A 4N5XA 1JFJA 4XJKA 4XYNA 3VRRA 2F3YA 3BXKA 2CT9A 3M0WA 4OKHA 5JJGA 2OTGC 5CSJA 3BUOB 3JTDC 3PATA 1KFUL 1OMVA 1NX3A 2F8PA 3NSOA 3CTNA 4R1EA 1IKUA 2M49B 1YUTA 1XFXO 3OHMB 4P5OE 1KQVA 1CMGA 3CS1A 1IQ3A 1HQVA 2CXJA 1JWDA 5AEQA 1KWOC 1Y1AA 4MZJA 1IG5A 1CDLA 2WNDA 3AKBA 4MN0A 4A4BA 4MSPA 2M1KB 2A4JA 3LK0A 1UHJA 3NXAA 1M39A 1LKJA 2F3ZA 3EKJA 2K7CA 1C7WA 2KSPA 3KHEA 2K61A 2JZIA 3F45A 3SG2A 1NIWA 1A4PA 1FPWA 3CGAA 1SPYA 2JT0A 3SG3A 5I2OA 4AOMA 3JVTC 1M45A 1NCXA 1RK9A 1SL8A 1F4QA 1BODA 4ICBA 4NQGA 4OR9B 2L4IA 1M63B 3PM8A 1TNQA 4OV2A 4D1EA 1K2HA 2BE6A 2OPOA 3DF0A 4M2QA 1QIWA 2PMYA 1QS7A 2KFFA 4M2OA 5IBWA 3AAJA 1PSBA 1IJ6A 1DMOA 1NPQA 4CFRA 4YGEB 2G9BA 3SJSA 3O78A 2KAXA 2LLUA 3OX6A 1QV1A 2M0RA 3IQOA 2O60A 2LUXA 1K95A 1L2OC 4MVFA 1QATA 3TDZA 4HREE 2JXLA 3ICBA 3VRQA 1K9UA 3SG5A 3SG6A 1MWNA 1RROA 2HETA 1QVIZ 4DUQA 1DJXA 4N1GA 3ZWHA 2KNEA 1WY9A 1PSRA 2NCOA 1AHRA 3PSRA 1TNWA 4MEWA 3CZTX 2BBNA 4L9MA 4GUKA 4QJ3B 1AK8A 2R2IA 1XFWO 2WCEA 1DJWA 5HKWA 2LVIA 4P2YB 3WXAA 3CR4X 1CM4A 1CLLA 1NCYA 1ALWA 1V1GA 1U5IB 4FQOA 1SL9A 5G08A 1ALVA 1S1EA 2MAZA 1TNXA 3BUNB 3FWCA 1K94A 1RFJA 4PHJA 4PHNA 3KF9A 2LMTA 4WQ3A 2H61C 2F33A 1F71A 1KFUS 2BCAA 1SMGA 3GK1A 4PHKA 5KSZA 1DGUA 1OSAA 2I7AA 1WDCC 2NCPA 4ETOA 2HQ8A 3OB2B 1C7VA 3OP0A 1CMFA 4PE1A 3JTDB 1DJIA 4MRXA 2HQWA 2LAPA 2LHIA 3PN7C 5CSNA 2KFGA 1DT7B 1QVIY 2WC8A 1HT9A 1QIVA 1L7ZA 2ZRSA 2KYFA 1KWOB 1CDNA 2I2RE 4DS7A 1PK0D 2KQ6A 4PE0A 1SK6D 3SG4A 5BPJA 4PE4A 3I5FC 1OMDA 1UWOA 2M9GA 2QPTA 2COLB 3BOWA 5FYXA 2MA2A 1FBVA 2QACA 4OVNF 1H8BA 3JVTB 2FCDA 1DJZA 2L51A 2D8NA 1UHIA 4DRWA 4MZLA 4ZCUA 3WHTB 1NYAA 1OQPA 1A29A 4YRUA 1ZOTB 4PCWA 4GPLB 1Y0VH 1F8HA 1YVLA 3RM1A 1F4OA 2LLTA 4HSZA 4AQIA 5I8NA 1RECA 2BECA 1NWDA 3EVVA 2JTTA 2WOSA 4YGDB 2PSRA 1LVCD 2IS9A 3PLFB 2M8UA 1U5IA 1YUUA 1GGWA 4CIDA 4GGFA 4I5KA 1K9KA 3IQQA 2KAVA 3E3RA 1SR6C 2HPSA 4NDDA 1XFYO 2KBMA 2LUCA 4YGBB 1DGVA 2KFHA 4GNKB 5ER4X 4NDCA 2LCPA 1L2OB 1Q80A 2ZNDA 4TNCA 5HLOA 2WCBA 1K90D 1AJ5A 2JC2A 4Q04A 2OS8B 1MUXA 3BUXB 4OCIA 4MLWA 3FS7A 2Y1NA 2K0JA 1FI6A 3WHUB 2AAOA 3CR5X 1DF0A 3GOFA 2LVJA 2O5GA 1LA0A 5GQQC 1NX0A 3CWGA 1BG1A 1C07A 3A8RA 3TZ1A 1KSOA 1DJGA 3O6BA 3SIAA 2CCMA 1B1GA 1XVJA 2MLFC 2JWWA 1XK4A 1ZFSA 3D0YB 1KFXS 3QRXA 1Y1UA 2LNKA 4CPVA 4A4CA 1A75A 1SNLA 2L5XB 4N1FA 1NP8A 1XO5A 3K21A 1SCMB 1TN4A 2KI6C 4MRYA 2LC5A 1B7TY 5AXIA 1J7RA 2K2AA 2BL0C 2TN4A 2M7LA 1KQMC 5I2QA 3TDIA 3LK1A 1EH2A 2LP2A 1NSHA 2EHBA 4YGCB 3CR2A 1CDPA 1B8RA 1TCOB 2VRGA 2Y5IA 2OS8C 3OX5A 1KCYA 1SYMA 1WDCB 2LE9B 2ZFDA 3GK4X 1EJ3A 2PASA 1F70A 2KI6D 2LVKA 4GBAA 2KI4B 3DVMA 3NSLA 1QV0A 3TDUA 1CB1A 5TNCA 5J3XA 2EC6C 1WRZA 3KO0A 2JT3A 1BOCA 2LMVA 2KQYA 3SIBA 5KTYA 3PN7B 1M31A 1IQ5A 3H4SE 1J7OA 2M1UA 1CFCA 3IF7A 3OB1B 1VRKA 5CSFA 5PALA 1JF0A 1MF8B 2ZRTA 1SCMC 1SW8A 2LLSA 1YR5A 4HRGA 4WQ2A 3AAKA 3EK7A 4XJKB 3BYAA 4JWQA 2PVBA 1YURA 1IJ5A 1RTP1 2G2BA 2Q91A 1NX1A 2ZNEA 3BUWB 1PVAA 1BMOA 1S6CA 3I5FB 3TUYC 2KGRA 2BCXA 3I5GC 3NSKA 3EKHA 2H2KA 1NCZA 4I5NB 3TS5C 5AFPA 2KHNA 1SL7A 2GV5A 2KDHA 2L0PA 3VRNA 1EXRA 1MXLC 2AMIA 5ER5A 2KI4C 1SKTA 4QJ5B 1XFZO 2KAYA 1B8LA 1V1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVS A;  1PVB A;  2DOQ A;  1BF5 A;  3WNX B;  1K8U A;  1UUR A;  2ZN8 A;  2M3W A;  1S6J A;  3A4U B;  1LXF C;  1B4C A;  5K89 A;  1YX8 A;  1GJY A;  2Y1M A;  4GFT A;  2LHL A;  2JOJ A;  2E6W A;  4ORA B;  1S5G Y;  1G8I A;  1SR6 B;  1NX2 A;  2Y4Q A;  1DJY A;  1WLM A;  2BKI B;  1B8C A;  1OOJ A;  2H61 A;  3CLN A;  4QJ4 B;  4DIR A;  2K2F A;  1FI5 A;  1EL4 A;  1ODB A;  1AJ4 A;  1JSA A;  2WCF A;  3DF0 B;  2ZKM X;  3EK8 A;  1ZUZ A;  2M29 A;  1ZMZ A;  2JUL A;  2L98 A;  4F0Z B;  2FOT A;  2ISD A;  2F2O A;  3FWB A;  1IGV A;  2LMU A;  5B8I B;  5HKY A;  1MQ1 A;  1S36 A;  2E30 A;  2F2P A;  5HYD A;  5HLV A;  1UUS A;  5D69 A;  3D10 A;  1BT6 A;  1QAS A;  2AUC A;  2MHH A;  2LVV A;  4BY4 A;  1GQM A;  1MR8 A;  1JFK A;  2NZ0 A;  2I18 A;  2K7D A;  4JPZ B;  3HX4 A;  2BE4 A;  1B7T Z;  5AER A;  3O2P A;  2CTN A;  1UHK A;  1QLK A;  1JUO A;  1QX2 A;  2Q4U A;  3I5H C;  4U8D A;  1NUB A;  1K96 A;  1TCF A;  2BBM A;  2MLE C;  3BQ3 A;  1CFF A;  1EG4 A;  4NDB A;  4AQJ A;  1AP4 A;  1JF2 A;  1YRT B;  3RLZ A;  3DD4 A;  1UHN A;  2BL0 B;  1N65 A;  1SRA A;  3DVJ A;  4DCK A;  1KQM B;  3C1V A;  1OZS A;  4HRH A;  1KSM A;  4ORC B;  1YVH A;  4C0K A;  4I5L B;  4UPG A;  1J1E A;  1H4B A;  1JBA A;  1OZO A;  3I5I C;  1XK4 C;  1F54 A;  1UP5 A;  2LM5 A;  5CSI A;  1XA5 A;  1CNP A;  3LCP C;  2GGM A;  1WRK A;  4MBE A;  4YBH B;  2EC6 B;  2CBL A;  3EVR A;  3NSI A;  1GGZ A;  1XFV O;  1S26 D;  4M2P A;  5AAN A;  2MJW B;  3EK4 A;  1TOP A;  4C0J A;  1QLS A;  2KOT A;  1EG3 A;  2LP3 A;  1D1O A;  1BLQ A;  4PDZ A;  4ORB B;  1R2U A;  4GGN A;  2K7O A;  3GK2 A;  1RJV A;  3TUY B;  1YTZ C;  1CFP A;  1JC2 A;  1G4Y R;  1MXE A;  1Y1X A;  2WOR A;  3I5G B;  3TS5 B;  5D7F A;  1J1D A;  1AUI B;  1QXP A;  2JXC A;  1CLM A;  3EVU A;  1IH0 A;  1N0Y A;  1W7J B;  2M7N A;  2MBX A;  1A03 A;  1KK7 Z;  2EGD A;  1IRJ A;  2KYC A;  1E8A A;  1S3P A;  1YRU B;  1DTL A;  1CTR A;  2I94 A;  1LA3 A;  1OE9 B;  3AKA A;  1WRL A;  1BR4 B;  2JRF A;  2SCP A;  4MZK A;  5HKZ A;  1K93 D;  1S5G Z;  4C0L A;  1K9P A;  2JQ6 A;  1Y6W A;  3FIA A;  1CLB A;  3BOW B;  1QX7 A;  2KBI A;  1YUS A;  1J55 A;  4IL1 A;  1KK8 B;  1A2X A;  1IWQ A;  1G33 A;  1W7I B;  2M97 A;  2JTZ A;  1PAL A;  1LIN A;  2PRU A;  1BJF A;  1FW4 A;  2B1U A;  3ZNI A;  4E68 A;  2MRD A;  3SG7 A;  1N2D A;  5JOL A;  1J7Q A;  1M46 A;  3O4Y A;  3KEV A;  3PAL A;  4FTG A;  1R6P A;  4PE7 A;  4WRI A;  2JNF A;  1RWY A;  4CLN A;  5KU1 A;  2FJU B;  5DKQ A;  2L50 A;  1SY9 A;  4PAL A;  3KPX A;  2CNP A;  2LAN A;  3PFV A;  2LV7 A;  4I5J A;  1ZAC A;  3LL8 B;  3HCM A;  1B9A A;  1KFX L;  1UHH A;  1MHO A;  1KK7 Y;  1SBJ A;  3D0Y A;  4JQ0 D;  4YGA A;  2K8M B;  5F6T A;  1TNP A;  1PRW A;  1KK8 C;  1YX7 A;  5DKR A;  2GGZ A;  4ZCV A;  1CKK A;  1BU3 A;  1DJH A;  3I5H B;  1CFD A;  1DVI A;  1OMR A;  2K7B A;  2L4H A;  5CPV A;  4YI8 A;  2OTG B;  3VRO A;  2JPT A;  4PHM A;  1BR1 B;  3MSE B;  1XYD A;  1WLZ A;  2FCE A;  3VGO A;  1SCV A;  1F55 A;  1TIZ A;  1S6I A;  1TTX A;  1DF0 B;  2NLN A;  1QTX A;  2P6B B;  5I2L A;  2JNX A;  2L2E A;  1CM1 A;  1QJT A;  4BY5 A;  2BKH B;  2JU0 A;  1FF1 A;  1B47 A;  2SAS A;  2HF5 A;  3I5I B;  4YI9 A;  3VRP A;  4GGF C;  1X02 A;  1A75 B;  3LLE A;  2V53 A;  2ZN9 A;  2PAL A;  1J7P A;  4CFQ A;  3BUM B;  1XFU O;  2RGI A;  1CDM A;  1QX5 B;  3DVE A;  4USL A;  4GAO A;  1TRF A;  2NXQ A;  5DKN A;  2BCB A;  3DVK A;  2KGB C;  1PUL A;  2JT8 A;  4N5X A;  1JFJ A;  4XJK A;  4XYN A;  3VRR A;  2F3Y A;  3BXK A;  2CT9 A;  3M0W A;  4OKH A;  5JJG A;  2OTG C;  5CSJ A;  3BUO B;  3JTD C;  3PAT A;  1KFU L;  1OMV A;  1NX3 A;  2F8P A;  3NSO A;  3CTN A;  4R1E A;  1IKU A;  2M49 B;  1YUT A;  1XFX O;  3OHM B;  4P5O E;  1KQV A;  1CMG A;  3CS1 A;  1IQ3 A;  1HQV A;  2CXJ A;  1JWD A;  5AEQ A;  1KWO C;  1Y1A A;  4MZJ A;  1IG5 A;  1CDL A;  2WND A;  3AKB A;  4MN0 A;  4A4B A;  4MSP A;  2M1K B;  2A4J A;  3LK0 A;  1UHJ A;  3NXA A;  1M39 A;  1LKJ A;  2F3Z A;  3EKJ A;  2K7C A;  1C7W A;  2KSP A;  3KHE A;  2K61 A;  2JZI A;  3F45 A;  3SG2 A;  1NIW A;  1A4P A;  1FPW A;  3CGA A;  1SPY A;  2JT0 A;  3SG3 A;  5I2O A;  4AOM A;  3JVT C;  1M45 A;  1NCX A;  1RK9 A;  1SL8 A;  1F4Q A;  1BOD A;  4ICB A;  4NQG A;  4OR9 B;  2L4I A;  1M63 B;  3PM8 A;  1TNQ A;  4OV2 A;  4D1E A;  1K2H A;  2BE6 A;  2OPO A;  3DF0 A;  4M2Q A;  1QIW A;  2PMY A;  1QS7 A;  2KFF A;  4M2O A;  5IBW A;  3AAJ A;  1PSB A;  1IJ6 A;  1DMO A;  1NPQ A;  4CFR A;  4YGE B;  2G9B A;  3SJS A;  3O78 A;  2KAX A;  2LLU A;  3OX6 A;  1QV1 A;  2M0R A;  3IQO A;  2O60 A;  2LUX A;  1K95 A;  1L2O C;  4MVF A;  1QAT A;  3TDZ A;  4HRE E;  2JXL A;  3ICB A;  3VRQ A;  1K9U A;  3SG5 A;  3SG6 A;  1MWN A;  1RRO A;  2HET A;  1QVI Z;  4DUQ A;  1DJX A;  4N1G A;  3ZWH A;  2KNE A;  1WY9 A;  1PSR A;  2NCO A;  1AHR A;  3PSR A;  1TNW A;  4MEW A;  3CZT X;  2BBN A;  4L9M A;  4GUK A;  4QJ3 B;  1AK8 A;  2R2I A;  1XFW O;  2WCE A;  1DJW A;  5HKW A;  2LVI A;  4P2Y B;  3WXA A;  3CR4 X;  1CM4 A;  1CLL A;  1NCY A;  1ALW A;  1V1G A;  1U5I B;  4FQO A;  1SL9 A;  5G08 A;  1ALV A;  1S1E A;  2MAZ A;  1TNX A;  3BUN B;  3FWC A;  1K94 A;  1RFJ A;  4PHJ A;  4PHN A;  3KF9 A;  2LMT A;  4WQ3 A;  2H61 C;  2F33 A;  1F71 A;  1KFU S;  2BCA A;  1SMG A;  3GK1 A;  4PHK A;  5KSZ A;  1DGU A;  1OSA A;  2I7A A;  1WDC C;  2NCP A;  4ETO A;  2HQ8 A;  3OB2 B;  1C7V A;  3OP0 A;  1CMF A;  4PE1 A;  3JTD B;  1DJI A;  4MRX A;  2HQW A;  2LAP A;  2LHI A;  3PN7 C;  5CSN A;  2KFG A;  1DT7 B;  1QVI Y;  2WC8 A;  1HT9 A;  1QIV A;  1L7Z A;  2ZRS A;  2KYF A;  1KWO B;  1CDN A;  2I2R E;  4DS7 A;  1PK0 D;  2KQ6 A;  4PE0 A;  1SK6 D;  3SG4 A;  5BPJ A;  4PE4 A;  3I5F C;  1OMD A;  1UWO A;  2M9G A;  2QPT A;  2COL B;  3BOW A;  5FYX A;  2MA2 A;  1FBV A;  2QAC A;  4OVN F;  1H8B A;  3JVT B;  2FCD A;  1DJZ A;  2L51 A;  2D8N A;  1UHI A;  4DRW A;  4MZL A;  4ZCU A;  3WHT B;  1NYA A;  1OQP A;  1A29 A;  4YRU A;  1ZOT B;  4PCW A;  4GPL B;  1Y0V H;  1F8H A;  1YVL A;  3RM1 A;  1F4O A;  2LLT A;  4HSZ A;  4AQI A;  5I8N A;  1REC A;  2BEC A;  1NWD A;  3EVV A;  2JTT A;  2WOS A;  4YGD B;  2PSR A;  1LVC D;  2IS9 A;  3PLF B;  2M8U A;  1U5I A;  1YUU A;  1GGW A;  4CID A;  4GGF A;  4I5K A;  1K9K A;  3IQQ A;  2KAV A;  3E3R A;  1SR6 C;  2HPS A;  4NDD A;  1XFY O;  2KBM A;  2LUC A;  4YGB B;  1DGV A;  2KFH A;  4GNK B;  5ER4 X;  4NDC A;  2LCP A;  1L2O B;  1Q80 A;  2ZND A;  4TNC A;  5HLO A;  2WCB A;  1K90 D;  1AJ5 A;  2JC2 A;  4Q04 A;  2OS8 B;  1MUX A;  3BUX B;  4OCI A;  4MLW A;  3FS7 A;  2Y1N A;  2K0J A;  1FI6 A;  3WHU B;  2AAO A;  3CR5 X;  1DF0 A;  3GOF A;  2LVJ A;  2O5G A;  1LA0 A;  5GQQ C;  1NX0 A;  3CWG A;  1BG1 A;  1C07 A;  3A8R A;  3TZ1 A;  1KSO A;  1DJG A;  3O6B A;  3SIA A;  2CCM A;  1B1G A;  1XVJ A;  2MLF C;  2JWW A;  1XK4 A;  1ZFS A;  3D0Y B;  1KFX S;  3QRX A;  1Y1U A;  2LNK A;  4CPV A;  4A4C A;  1A75 A;  1SNL A;  2L5X B;  4N1F A;  1NP8 A;  1XO5 A;  3K21 A;  1SCM B;  1TN4 A;  2KI6 C;  4MRY A;  2LC5 A;  1B7T Y;  5AXI A;  1J7R A;  2K2A A;  2BL0 C;  2TN4 A;  2M7L A;  1KQM C;  5I2Q A;  3TDI A;  3LK1 A;  1EH2 A;  2LP2 A;  1NSH A;  2EHB A;  4YGC B;  3CR2 A;  1CDP A;  1B8R A;  1TCO B;  2VRG A;  2Y5I A;  2OS8 C;  3OX5 A;  1KCY A;  1SYM A;  1WDC B;  2LE9 B;  2ZFD A;  3GK4 X;  1EJ3 A;  2PAS A;  1F70 A;  2KI6 D;  2LVK A;  4GBA A;  2KI4 B;  3DVM A;  3NSL A;  1QV0 A;  3TDU A;  1CB1 A;  5TNC A;  5J3X A;  2EC6 C;  1WRZ A;  3KO0 A;  2JT3 A;  1BOC A;  2LMV A;  2KQY A;  3SIB A;  5KTY A;  3PN7 B;  1M31 A;  1IQ5 A;  3H4S E;  1J7O A;  2M1U A;  1CFC A;  3IF7 A;  3OB1 B;  1VRK A;  5CSF A;  5PAL A;  1JF0 A;  1MF8 B;  2ZRT A;  1SCM C;  1SW8 A;  2LLS A;  1YR5 A;  4HRG A;  4WQ2 A;  3AAK A;  3EK7 A;  4XJK B;  3BYA A;  4JWQ A;  2PVB A;  1YUR A;  1IJ5 A;  1RTP 1;  2G2B A;  2Q91 A;  1NX1 A;  2ZNE A;  3BUW B;  1PVA A;  1BMO A;  1S6C A;  3I5F B;  3TUY C;  2KGR A;  2BCX A;  3I5G C;  3NSK A;  3EKH A;  2H2K A;  1NCZ A;  4I5N B;  3TS5 C;  5AFP A;  2KHN A;  1SL7 A;  2GV5 A;  2KDH A;  2L0P A;  3VRN A;  1EXR A;  1MXL C;  2AMI A;  5ER5 A;  2KI4 C;  1SKT A;  4QJ5 B;  1XFZ O;  2KAY A;  1B8L A;  1V1F A; 
#chains in the Genus database with same CATH topology
 1AVS A;  1PVB A;  2DOQ A;  1BF5 A;  3WNX B;  1K8U A;  1UUR A;  2ZN8 A;  2M3W A;  1S6J A;  3A4U B;  1LXF C;  1B4C A;  5K89 A;  3R1O A;  5D3O A;  2WC6 A;  1YX8 A;  1GJY A;  2Y1M A;  4GFT A;  2LHL A;  2JOJ A;  2E6W A;  4ORA B;  1S5G Y;  1GM0 A;  1G8I A;  1SR6 B;  1NX2 A;  2Y4Q A;  1DJY A;  1WLM A;  2BKI B;  1B8C A;  1OOJ A;  2H61 A;  3CLN A;  4QJ4 B;  4DIR A;  2L5Y A;  2K2F A;  1FI5 A;  1EL4 A;  1ODB A;  1AJ4 A;  1JSA A;  2WCF A;  3DF0 B;  2ZKM X;  3EK8 A;  1ZUZ A;  2M29 A;  1ZMZ A;  2JUL A;  1Z2C B;  2L98 A;  2FOT A;  2ISD A;  2F2O A;  3BFB A;  1IGV A;  2LMU A;  3FWB A;  5B8I B;  5HKY A;  1MQ1 A;  1DEK A;  1S36 A;  2E30 A;  2F2P A;  5HYD A;  5HLV A;  3SS4 A;  3Q8I A;  1UUS A;  5D69 A;  3D10 A;  1BT6 A;  1QAS A;  2AUC A;  1XFR A;  3N7H A;  2MHH A;  2LVV A;  3L4L A;  4BY4 A;  1GQM A;  1MR8 A;  1JFK A;  2NZ0 A;  2I18 A;  2K7D A;  4JPZ B;  3HX4 A;  2PYQ A;  3FE6 A;  2BE4 A;  1B7T Z;  4IJ7 A;  3O2P A;  5AER A;  2CTN A;  1UHK A;  1QLK A;  1JUO A;  1QX2 A;  2Q4U A;  3I5H C;  4U8D A;  1QWV A;  1NUB A;  1K96 A;  1TCF A;  2BBM A;  2MLE C;  3BQ3 A;  1C3Y A;  1EG4 A;  4NDB A;  4AQJ A;  1CFF A;  1AP4 A;  2QEH A;  1JF2 A;  1YRT B;  3RLZ A;  3DD4 A;  1UHN A;  2BL0 B;  1N65 A;  1SRA A;  3DVJ A;  4DCK A;  1KQM B;  3C1V A;  1OZS A;  4HRH A;  1KSM A;  2P71 A;  1YVH A;  3PM2 A;  1OOF A;  1W9Z A;  3QME A;  4I5L B;  4ORC B;  4C0K A;  1J1E A;  4UPG A;  1H4B A;  1ORG A;  1JBA A;  1OZO A;  3I5I C;  1XK4 C;  1F54 A;  1UP5 A;  2LM5 A;  1TWO A;  5CSI A;  1XA5 A;  1CNP A;  3LCP C;  2GGM A;  1WRK A;  2KLE A;  4MBE A;  1DQE A;  4YBH B;  2EC6 B;  1TUJ A;  2CBL A;  3EVR A;  3NSI A;  1GGZ A;  1XFV O;  1S26 D;  3RZS A;  2KLD A;  4M2P A;  5AAN A;  2MJW B;  3EK4 A;  1TOP A;  4C0J A;  3DZT A;  1QLS A;  2KOT A;  1EG3 A;  2LP3 A;  2WCM A;  1D1O A;  1BLQ A;  4PDZ A;  4ORB B;  1R2U A;  4GGN A;  2K7O A;  3GK2 A;  1RJV A;  3TUY B;  2JPO A;  2QEB A;  1YTZ C;  1CFP A;  1JC2 A;  1G4Y R;  1MXE A;  1Y1X A;  2WOR A;  3I5G B;  4OZD A;  3TS5 B;  5D7F A;  1J1D A;  1AUI B;  1QXP A;  2JXC A;  1CLM A;  3EVU A;  3DY9 A;  1IH0 A;  1N0Y A;  1W7J B;  2M7N A;  2MBX A;  1A03 A;  1KK7 Z;  2EGD A;  1IRJ A;  1SSE B;  2KYC A;  1E8A A;  1S3P A;  1YRU B;  1DTL A;  1CTR A;  2I94 A;  1LA3 A;  1OE9 B;  3AKA A;  1WRL A;  1C3Z A;  1BR4 B;  2JRF A;  4KYN A;  2SCP A;  4MZK A;  5HKZ A;  1K93 D;  1S5G Z;  4C0L A;  1K9P A;  2JQ6 A;  1Y6W A;  3FIA A;  1CLB A;  3BOW B;  1QX7 A;  2KBI A;  1YUS A;  1J55 A;  4IL1 A;  1KK8 B;  1A2X A;  1IWQ A;  1G33 A;  1W7I B;  2M97 A;  2JTZ A;  1PAL A;  1LIN A;  2PRU A;  1BJF A;  1FW4 A;  2B1U A;  3ZNI A;  4E68 A;  2MRD A;  3NGV A;  3SG7 A;  1N2D A;  5JOL A;  1J7Q A;  1M46 A;  3R1V A;  3O4Y A;  3KEV A;  3D75 A;  3PAL A;  4FTG A;  1R6P A;  4PE7 A;  4WRI A;  2JNF A;  1RWY A;  4CLN A;  5KU1 A;  2FJU B;  5DKQ A;  2L50 A;  1SY9 A;  5FI6 A;  4PAL A;  3KPX A;  2CNP A;  2LAN A;  3PFV A;  2LV7 A;  4I5J A;  1ZAC A;  3LL8 B;  3V2L A;  3HCM A;  1B9A A;  1UHH A;  1KFX L;  1MHO A;  1KK7 Y;  1OOG A;  1OOH A;  1SBJ A;  3D0Y A;  4JQ0 D;  4YGA A;  5DIC A;  2WC5 A;  2K8M B;  5F6T A;  1TNP A;  1PRW A;  1KK8 C;  1YX7 A;  5DKR A;  2GGZ A;  4ZCV A;  1CKK A;  1BU3 A;  1DJH A;  3I5H B;  1CFD A;  3PJI A;  4F0Z B;  1DVI A;  1OMR A;  2K7B A;  3FE8 A;  1P28 A;  2L4H A;  5CPV A;  4YI8 A;  2OTG B;  3VRO A;  2JPT A;  4PHM A;  1BR1 B;  3MSE B;  1XYD A;  2PQL A;  3IVT A;  1WLZ A;  2FCE A;  3VGO A;  1SCV A;  1F55 A;  1TIZ A;  1S6I A;  1TTX A;  1DF0 B;  2NLN A;  1QTX A;  2P6B B;  5I2L A;  2JNX A;  3OBV A;  2L2E A;  1CM1 A;  1QJT A;  4BY5 A;  2BKH B;  2JU0 A;  1FF1 A;  3S0E A;  1B47 A;  2SAS A;  2HF5 A;  3I5I B;  4YI9 A;  3O4X A;  3VRP A;  1Z4H A;  4GGF C;  3D78 A;  1X02 A;  1A75 B;  2QEV A;  3LLE A;  2V53 A;  4INW A;  2ZN9 A;  2PAL A;  1J7P A;  3CZ0 A;  4CFQ A;  3BUM B;  1XFU O;  2RGI A;  1CDM A;  1QX5 B;  2BNX A;  3DVE A;  4USL A;  4GAO A;  1TRF A;  3VB1 A;  2NXQ A;  5DKN A;  2BCB A;  3DVK A;  2KGB C;  1PUL A;  2JT8 A;  4N5X A;  1JFJ A;  4XJK A;  5I94 A;  4XYN A;  3VRR A;  2F3Y A;  3BXK A;  2CT9 A;  3M0W A;  4OKH A;  5JJG A;  2OTG C;  5CSJ A;  3BUO B;  3JTD C;  3PAT A;  1KFU L;  1OMV A;  1NX3 A;  2F8P A;  3NSO A;  3CTN A;  4R1E A;  1IKU A;  2M49 B;  1YUT A;  1XFX O;  3OHM B;  4P5O E;  1KQV A;  1CMG A;  3CS1 A;  1IQ3 A;  1HQV A;  2CXJ A;  2QDI A;  2KPH A;  1JWD A;  5AEQ A;  1KWO C;  1Y1A A;  3B86 A;  1IG5 A;  4MZJ A;  1CDL A;  2H8V A;  2WND A;  3AKB A;  3D73 A;  4MN0 A;  4A4B A;  4MSP A;  2M1K B;  2A4J A;  3LK0 A;  1UHJ A;  3NXA A;  1M39 A;  1LKJ A;  2F3Z A;  3EKJ A;  2K7C A;  1C7W A;  2KSP A;  3DXL A;  3KHE A;  2K61 A;  3BFA A;  2JZI A;  3F45 A;  3SG2 A;  1NIW A;  1OW4 A;  1A4P A;  1FPW A;  3CGA A;  1SPY A;  2JT0 A;  3SG3 A;  5I2O A;  4AOM A;  3JVT C;  1M45 A;  1NCX A;  1RK9 A;  2FJY A;  1SL8 A;  1F4Q A;  1BOD A;  4ICB A;  4NQG A;  4OR9 B;  2L4I A;  1M63 B;  3PM8 A;  3R72 A;  1TNQ A;  4OV2 A;  4D1E A;  1K2H A;  2BE6 A;  2OPO A;  3DF0 A;  4M2Q A;  1QIW A;  2PMY A;  1DC1 A;  1QS7 A;  2KFF A;  4M2O A;  5IBW A;  3AAJ A;  1PSB A;  1IJ6 A;  1DMO A;  1NPQ A;  4CFR A;  4YGE B;  2G9B A;  3SJS A;  3O78 A;  2QEO A;  2KAX A;  2LLU A;  3OX6 A;  3NHI A;  1QV1 A;  2M0R A;  3OGN A;  3IQO A;  2O60 A;  2LUX A;  1K95 A;  3S0G A;  1L2O C;  4MVF A;  1QAT A;  3TDZ A;  3FE9 A;  4HRE E;  2JXL A;  3ICB A;  3VRQ A;  1K9U A;  3SG5 A;  3SG6 A;  1MWN A;  1RRO A;  2HET A;  1QVI Z;  3B88 A;  4DUQ A;  1DJX A;  4F7F A;  4N1G A;  3ZWH A;  2KNE A;  1WY9 A;  1PSR A;  2NCO A;  1AHR A;  3PSR A;  1TNW A;  4MEW A;  3CZT X;  2BBN A;  4L9M A;  4GUK A;  4QJ3 B;  1AK8 A;  2R2I A;  1XFW O;  2WCE A;  1DJW A;  5HKW A;  3CDN A;  2LVI A;  4P2Y B;  3WXA A;  3CR4 X;  1CM4 A;  1CLL A;  1NCY A;  1ALW A;  1V1G A;  1U5I B;  4FQO A;  5FI2 A;  1SL9 A;  5G08 A;  1ALV A;  1S1E A;  2BAP A;  2MAZ A;  1TNX A;  3BUN B;  2WCH A;  1K94 A;  1RFJ A;  2K60 A;  3FWC A;  4PHJ A;  4PHN A;  3KF9 A;  2LMT A;  4WQ3 A;  2H61 C;  2F33 A;  1F71 A;  1KFU S;  2BCA A;  1OOI X;  1SMG A;  3GK1 A;  4PHK A;  5KSZ A;  1DGU A;  1OSA A;  2I7A A;  2GTE A;  1WDC C;  2NCP A;  4ETO A;  2HQ8 A;  3CAB A;  3OB2 B;  1C7V A;  3OP0 A;  1CMF A;  4PE1 A;  3JTD B;  1DJI A;  4MRX A;  2HQW A;  2LAP A;  2LHI A;  3UO9 A;  3PN7 C;  5CSN A;  2KFG A;  1DT7 B;  1QVI Y;  2WC8 A;  3NHT A;  1HT9 A;  1QIV A;  1L7Z A;  2ZRS A;  2KYF A;  1KWO B;  4INX A;  3S0F A;  3B7A A;  1CDN A;  3CYZ A;  3K1E A;  2I2R E;  4DS7 A;  1PK0 D;  2KQ6 A;  3SS3 A;  4PE0 A;  1SK6 D;  3SG4 A;  5BPJ A;  4PE4 A;  3I5F C;  1OMD A;  1UWO A;  2M9G A;  2QPT A;  3B87 A;  2COL B;  3BOW A;  5FYX A;  2MA2 A;  1FBV A;  2QAC A;  4OVN F;  1H8B A;  3JVT B;  2FCD A;  1DJZ A;  2L51 A;  2D8N A;  1UHI A;  4DRW A;  4MZL A;  4PT1 A;  4ZCU A;  3WHT B;  3L4A A;  3UNW A;  1NYA A;  1OQP A;  1A29 A;  4YRU A;  1ZOT B;  3BJH A;  4PCW A;  4GPL B;  1Y0V H;  3EG5 B;  1F8H A;  3R1P A;  1YVL A;  3RM1 A;  1F4O A;  2LLT A;  4HSZ A;  4AQI A;  5I8N A;  3S0D A;  1REC A;  2BEC A;  1NWD A;  3EVV A;  2JTT A;  2WOS A;  4YGD B;  2PSR A;  1LVC D;  2IS9 A;  3PLF B;  2M8U A;  1U5I A;  1YUU A;  1GGW A;  3L47 A;  4CID A;  4GGF A;  4I5K A;  1K9K A;  3IQQ A;  2KAV A;  3E3R A;  1SR6 C;  2HPS A;  4NDD A;  1XFY O;  2KBM A;  1IIO A;  5HL1 A;  2LUC A;  4YGB B;  1DGV A;  2L2C A;  2YGU A;  2KFH A;  1DEL A;  4GNK B;  5ER4 X;  4NDC A;  2LCP A;  4FQT A;  1L2O B;  1Q80 A;  2ZND A;  4TNC A;  5HLO A;  5EL2 A;  2WCB A;  1K90 D;  1AJ5 A;  2JC2 A;  4Q04 A;  2OS8 B;  1MUX A;  3BUX B;  4OCI A;  4MLW A;  3FS7 A;  2Y1N A;  2K0J A;  1FI6 A;  3WHU B;  2AAO A;  3CR5 X;  1DF0 A;  3GOF A;  2LVJ A;  2O5G A;  1LA0 A;  5GQQ C;  1NX0 A;  3CWG A;  1BG1 A;  1C07 A;  2ERB A;  3A8R A;  3TZ1 A;  2WCL A;  1KSO A;  1DJG A;  3O6B A;  3SIA A;  2CCM A;  1B1G A;  1XVJ A;  2MLF C;  2JWW A;  1XK4 A;  1ZFS A;  3D0Y B;  1KFX S;  3QRX A;  1Y1U A;  2LNK A;  4CPV A;  4A4C A;  1A75 A;  1SNL A;  2L5X B;  2WCJ A;  1NP8 A;  4N1F A;  1XO5 A;  3K21 A;  1SCM B;  1TN4 A;  2KI6 C;  4MRY A;  2LC5 A;  1B7T Y;  5AXI A;  1J7R A;  2P70 A;  2K2A A;  2BL0 C;  2TN4 A;  2M7L A;  3BFH A;  1KQM C;  5I2Q A;  3TDI A;  3LK1 A;  1EH2 A;  2LP2 A;  3SS5 A;  1NSH A;  2EHB A;  4YGC B;  3CR2 A;  1CDP A;  3B6X A;  1B8R A;  1TCO B;  2VRG A;  2Y5I A;  1T14 A;  2OS8 C;  3OX5 A;  1KCY A;  1SYM A;  1WDC B;  2LE9 B;  2ZFD A;  3DYE A;  3D76 A;  1EJ3 A;  2PAS A;  3GK4 X;  1F70 A;  2KI6 D;  2LVK A;  4GBA A;  2KI4 B;  3DVM A;  3NSL A;  1QV0 A;  3TDU A;  1CB1 A;  5TNC A;  5J3X A;  2EC6 C;  1WRZ A;  3KO0 A;  2WCK A;  2JT3 A;  3S0B A;  2LMV A;  2KQY A;  1BOC A;  3SIB A;  3D77 A;  4JD9 A;  5KTY A;  3S0A A;  3PN7 B;  1M31 A;  1IQ5 A;  3CZ2 A;  3H4S E;  1J7O A;  2M1U A;  1CFC A;  3IF7 A;  3OB1 B;  3D74 A;  1VRK A;  5CSF A;  5PAL A;  1JF0 A;  1MF8 B;  2ZRT A;  1SCM C;  1SW8 A;  1LS8 A;  2LLS A;  1YR5 A;  4HRG A;  4WQ2 A;  3AAK A;  3EK7 A;  4XJK B;  3BYA A;  4JWQ A;  2PVB A;  1TUZ A;  1YUR A;  1IJ5 A;  1RTP 1;  2G2B A;  2Q91 A;  1NX1 A;  2ZNE A;  3BUW B;  1PVA A;  1BMO A;  1S6C A;  3I5F B;  3TUY C;  2KGR A;  2BCX A;  3I5G C;  3CZ1 A;  3NSK A;  3EKH A;  2H2K A;  1NCZ A;  4I5N B;  3TS5 C;  5AFP A;  2KHN A;  1SL7 A;  2GV5 A;  2KDH A;  2L0P A;  4JKT A;  3VRN A;  1EXR A;  1MXL C;  2AMI A;  5ER5 A;  5FI7 A;  2KI4 C;  1SKT A;  4QJ5 B;  1XFZ O;  2KAY A;  1B8L A;  1V1F A; 
#chains in the Genus database with same CATH homology
 1AVS A;  1PVB A;  2DOQ A;  1BF5 A;  3WNX B;  1K8U A;  1UUR A;  2ZN8 A;  2M3W A;  1S6J A;  3A4U B;  1LXF C;  1B4C A;  5K89 A;  1YX8 A;  1GJY A;  2Y1M A;  4GFT A;  2LHL A;  2JOJ A;  2E6W A;  4ORA B;  1S5G Y;  1G8I A;  1SR6 B;  1NX2 A;  2Y4Q A;  1DJY A;  1WLM A;  2BKI B;  1B8C A;  1OOJ A;  2H61 A;  3CLN A;  4QJ4 B;  4DIR A;  2K2F A;  1FI5 A;  1EL4 A;  1ODB A;  1AJ4 A;  1JSA A;  2WCF A;  3DF0 B;  2ZKM X;  3EK8 A;  1ZUZ A;  2M29 A;  1ZMZ A;  2JUL A;  2L98 A;  4F0Z B;  2FOT A;  2ISD A;  2F2O A;  3FWB A;  1IGV A;  2LMU A;  5B8I B;  5HKY A;  1MQ1 A;  1S36 A;  2E30 A;  2F2P A;  5HYD A;  5HLV A;  1UUS A;  5D69 A;  3D10 A;  1BT6 A;  1QAS A;  2AUC A;  2MHH A;  2LVV A;  4BY4 A;  1GQM A;  1MR8 A;  1JFK A;  2NZ0 A;  2I18 A;  2K7D A;  4JPZ B;  3HX4 A;  2BE4 A;  1B7T Z;  5AER A;  3O2P A;  2CTN A;  1UHK A;  1QLK A;  1JUO A;  1QX2 A;  2Q4U A;  3I5H C;  4U8D A;  1NUB A;  1K96 A;  1TCF A;  2BBM A;  2MLE C;  3BQ3 A;  1CFF A;  1EG4 A;  4NDB A;  4AQJ A;  1AP4 A;  1JF2 A;  1YRT B;  3RLZ A;  3DD4 A;  1UHN A;  2BL0 B;  1N65 A;  1SRA A;  3DVJ A;  4DCK A;  1KQM B;  3C1V A;  1OZS A;  4HRH A;  1KSM A;  4ORC B;  1YVH A;  4C0K A;  4I5L B;  4UPG A;  1J1E A;  1H4B A;  1JBA A;  1OZO A;  3I5I C;  1XK4 C;  1F54 A;  1UP5 A;  2LM5 A;  5CSI A;  1XA5 A;  1CNP A;  3LCP C;  2GGM A;  1WRK A;  4MBE A;  4YBH B;  2EC6 B;  2CBL A;  3EVR A;  3NSI A;  1GGZ A;  1XFV O;  1S26 D;  4M2P A;  5AAN A;  2MJW B;  3EK4 A;  1TOP A;  4C0J A;  1QLS A;  2KOT A;  1EG3 A;  2LP3 A;  1D1O A;  1BLQ A;  4PDZ A;  4ORB B;  1R2U A;  4GGN A;  2K7O A;  3GK2 A;  1RJV A;  3TUY B;  1YTZ C;  1CFP A;  1JC2 A;  1G4Y R;  1MXE A;  1Y1X A;  2WOR A;  3I5G B;  3TS5 B;  5D7F A;  1J1D A;  1AUI B;  1QXP A;  2JXC A;  1CLM A;  3EVU A;  1IH0 A;  1N0Y A;  1W7J B;  2M7N A;  2MBX A;  1A03 A;  1KK7 Z;  2EGD A;  1IRJ A;  2KYC A;  1E8A A;  1S3P A;  1YRU B;  1DTL A;  1CTR A;  2I94 A;  1LA3 A;  1OE9 B;  3AKA A;  1WRL A;  1BR4 B;  2JRF A;  2SCP A;  4MZK A;  5HKZ A;  1K93 D;  1S5G Z;  4C0L A;  1K9P A;  2JQ6 A;  1Y6W A;  3FIA A;  1CLB A;  3BOW B;  1QX7 A;  2KBI A;  1YUS A;  1J55 A;  4IL1 A;  1KK8 B;  1A2X A;  1IWQ A;  1G33 A;  1W7I B;  2M97 A;  2JTZ A;  1PAL A;  1LIN A;  2PRU A;  1BJF A;  1FW4 A;  2B1U A;  3ZNI A;  4E68 A;  2MRD A;  3SG7 A;  1N2D A;  5JOL A;  1J7Q A;  1M46 A;  3O4Y A;  3KEV A;  3PAL A;  4FTG A;  1R6P A;  4PE7 A;  4WRI A;  2JNF A;  1RWY A;  4CLN A;  5KU1 A;  2FJU B;  5DKQ A;  2L50 A;  1SY9 A;  4PAL A;  3KPX A;  2CNP A;  2LAN A;  3PFV A;  2LV7 A;  4I5J A;  1ZAC A;  3LL8 B;  3HCM A;  1B9A A;  1KFX L;  1UHH A;  1MHO A;  1KK7 Y;  1SBJ A;  3D0Y A;  4JQ0 D;  4YGA A;  2K8M B;  5F6T A;  1TNP A;  1PRW A;  1KK8 C;  1YX7 A;  5DKR A;  2GGZ A;  4ZCV A;  1CKK A;  1BU3 A;  1DJH A;  3I5H B;  1CFD A;  1DVI A;  1OMR A;  2K7B A;  2L4H A;  5CPV A;  4YI8 A;  2OTG B;  3VRO A;  2JPT A;  4PHM A;  1BR1 B;  3MSE B;  1XYD A;  1WLZ A;  2FCE A;  3VGO A;  1SCV A;  1F55 A;  1TIZ A;  1S6I A;  1TTX A;  1DF0 B;  2NLN A;  1QTX A;  2P6B B;  5I2L A;  2JNX A;  2L2E A;  1CM1 A;  1QJT A;  4BY5 A;  2BKH B;  2JU0 A;  1FF1 A;  1B47 A;  2SAS A;  2HF5 A;  3I5I B;  4YI9 A;  3VRP A;  4GGF C;  1X02 A;  1A75 B;  3LLE A;  2V53 A;  2ZN9 A;  2PAL A;  1J7P A;  4CFQ A;  3BUM B;  1XFU O;  2RGI A;  1CDM A;  1QX5 B;  3DVE A;  4USL A;  4GAO A;  1TRF A;  2NXQ A;  5DKN A;  2BCB A;  3DVK A;  2KGB C;  1PUL A;  2JT8 A;  4N5X A;  1JFJ A;  4XJK A;  4XYN A;  3VRR A;  2F3Y A;  3BXK A;  2CT9 A;  3M0W A;  4OKH A;  5JJG A;  2OTG C;  5CSJ A;  3BUO B;  3JTD C;  3PAT A;  1KFU L;  1OMV A;  1NX3 A;  2F8P A;  3NSO A;  3CTN A;  4R1E A;  1IKU A;  2M49 B;  1YUT A;  1XFX O;  3OHM B;  4P5O E;  1KQV A;  1CMG A;  3CS1 A;  1IQ3 A;  1HQV A;  2CXJ A;  1JWD A;  5AEQ A;  1KWO C;  1Y1A A;  4MZJ A;  1IG5 A;  1CDL A;  2WND A;  3AKB A;  4MN0 A;  4A4B A;  4MSP A;  2M1K B;  2A4J A;  3LK0 A;  1UHJ A;  3NXA A;  1M39 A;  1LKJ A;  2F3Z A;  3EKJ A;  2K7C A;  1C7W A;  2KSP A;  3KHE A;  2K61 A;  2JZI A;  3F45 A;  3SG2 A;  1NIW A;  1A4P A;  1FPW A;  3CGA A;  1SPY A;  2JT0 A;  3SG3 A;  5I2O A;  4AOM A;  3JVT C;  1M45 A;  1NCX A;  1RK9 A;  1SL8 A;  1F4Q A;  1BOD A;  4ICB A;  4NQG A;  4OR9 B;  2L4I A;  1M63 B;  3PM8 A;  1TNQ A;  4OV2 A;  4D1E A;  1K2H A;  2BE6 A;  2OPO A;  3DF0 A;  4M2Q A;  1QIW A;  2PMY A;  1QS7 A;  2KFF A;  4M2O A;  5IBW A;  3AAJ A;  1PSB A;  1IJ6 A;  1DMO A;  1NPQ A;  4CFR A;  4YGE B;  2G9B A;  3SJS A;  3O78 A;  2KAX A;  2LLU A;  3OX6 A;  1QV1 A;  2M0R A;  3IQO A;  2O60 A;  2LUX A;  1K95 A;  1L2O C;  4MVF A;  1QAT A;  3TDZ A;  4HRE E;  2JXL A;  3ICB A;  3VRQ A;  1K9U A;  3SG5 A;  3SG6 A;  1MWN A;  1RRO A;  2HET A;  1QVI Z;  4DUQ A;  1DJX A;  4N1G A;  3ZWH A;  2KNE A;  1WY9 A;  1PSR A;  2NCO A;  1AHR A;  3PSR A;  1TNW A;  4MEW A;  3CZT X;  2BBN A;  4L9M A;  4GUK A;  4QJ3 B;  1AK8 A;  2R2I A;  1XFW O;  2WCE A;  1DJW A;  5HKW A;  2LVI A;  4P2Y B;  3WXA A;  3CR4 X;  1CM4 A;  1CLL A;  1NCY A;  1ALW A;  1V1G A;  1U5I B;  4FQO A;  1SL9 A;  5G08 A;  1ALV A;  1S1E A;  2MAZ A;  1TNX A;  3BUN B;  3FWC A;  1K94 A;  1RFJ A;  4PHJ A;  4PHN A;  3KF9 A;  2LMT A;  4WQ3 A;  2H61 C;  2F33 A;  1F71 A;  1KFU S;  2BCA A;  1SMG A;  3GK1 A;  4PHK A;  5KSZ A;  1DGU A;  1OSA A;  2I7A A;  1WDC C;  2NCP A;  4ETO A;  2HQ8 A;  3OB2 B;  1C7V A;  3OP0 A;  1CMF A;  4PE1 A;  3JTD B;  1DJI A;  4MRX A;  2HQW A;  2LAP A;  2LHI A;  3PN7 C;  5CSN A;  2KFG A;  1DT7 B;  1QVI Y;  2WC8 A;  1HT9 A;  1QIV A;  1L7Z A;  2ZRS A;  2KYF A;  1KWO B;  1CDN A;  2I2R E;  4DS7 A;  1PK0 D;  2KQ6 A;  4PE0 A;  1SK6 D;  3SG4 A;  5BPJ A;  4PE4 A;  3I5F C;  1OMD A;  1UWO A;  2M9G A;  2QPT A;  2COL B;  3BOW A;  5FYX A;  2MA2 A;  1FBV A;  2QAC A;  4OVN F;  1H8B A;  3JVT B;  2FCD A;  1DJZ A;  2L51 A;  2D8N A;  1UHI A;  4DRW A;  4MZL A;  4ZCU A;  3WHT B;  1NYA A;  1OQP A;  1A29 A;  4YRU A;  1ZOT B;  4PCW A;  4GPL B;  1Y0V H;  1F8H A;  1YVL A;  3RM1 A;  1F4O A;  2LLT A;  4HSZ A;  4AQI A;  5I8N A;  1REC A;  2BEC A;  1NWD A;  3EVV A;  2JTT A;  2WOS A;  4YGD B;  2PSR A;  1LVC D;  2IS9 A;  3PLF B;  2M8U A;  1U5I A;  1YUU A;  1GGW A;  4CID A;  4GGF A;  4I5K A;  1K9K A;  3IQQ A;  2KAV A;  3E3R A;  1SR6 C;  2HPS A;  4NDD A;  1XFY O;  2KBM A;  2LUC A;  4YGB B;  1DGV A;  2KFH A;  4GNK B;  5ER4 X;  4NDC A;  2LCP A;  1L2O B;  1Q80 A;  2ZND A;  4TNC A;  5HLO A;  2WCB A;  1K90 D;  1AJ5 A;  2JC2 A;  4Q04 A;  2OS8 B;  1MUX A;  3BUX B;  4OCI A;  4MLW A;  3FS7 A;  2Y1N A;  2K0J A;  1FI6 A;  3WHU B;  2AAO A;  3CR5 X;  1DF0 A;  3GOF A;  2LVJ A;  2O5G A;  1LA0 A;  5GQQ C;  1NX0 A;  3CWG A;  1BG1 A;  1C07 A;  3A8R A;  3TZ1 A;  1KSO A;  1DJG A;  3O6B A;  3SIA A;  2CCM A;  1B1G A;  1XVJ A;  2MLF C;  2JWW A;  1XK4 A;  1ZFS A;  3D0Y B;  1KFX S;  3QRX A;  1Y1U A;  2LNK A;  4CPV A;  4A4C A;  1A75 A;  1SNL A;  2L5X B;  4N1F A;  1NP8 A;  1XO5 A;  3K21 A;  1SCM B;  1TN4 A;  2KI6 C;  4MRY A;  2LC5 A;  1B7T Y;  5AXI A;  1J7R A;  2K2A A;  2BL0 C;  2TN4 A;  2M7L A;  1KQM C;  5I2Q A;  3TDI A;  3LK1 A;  1EH2 A;  2LP2 A;  1NSH A;  2EHB A;  4YGC B;  3CR2 A;  1CDP A;  1B8R A;  1TCO B;  2VRG A;  2Y5I A;  2OS8 C;  3OX5 A;  1KCY A;  1SYM A;  1WDC B;  2LE9 B;  2ZFD A;  3GK4 X;  1EJ3 A;  2PAS A;  1F70 A;  2KI6 D;  2LVK A;  4GBA A;  2KI4 B;  3DVM A;  3NSL A;  1QV0 A;  3TDU A;  1CB1 A;  5TNC A;  5J3X A;  2EC6 C;  1WRZ A;  3KO0 A;  2JT3 A;  1BOC A;  2LMV A;  2KQY A;  3SIB A;  5KTY A;  3PN7 B;  1M31 A;  1IQ5 A;  3H4S E;  1J7O A;  2M1U A;  1CFC A;  3IF7 A;  3OB1 B;  1VRK A;  5CSF A;  5PAL A;  1JF0 A;  1MF8 B;  2ZRT A;  1SCM C;  1SW8 A;  2LLS A;  1YR5 A;  4HRG A;  4WQ2 A;  3AAK A;  3EK7 A;  4XJK B;  3BYA A;  4JWQ A;  2PVB A;  1YUR A;  1IJ5 A;  1RTP 1;  2G2B A;  2Q91 A;  1NX1 A;  2ZNE A;  3BUW B;  1PVA A;  1BMO A;  1S6C A;  3I5F B;  3TUY C;  2KGR A;  2BCX A;  3I5G C;  3NSK A;  3EKH A;  2H2K A;  1NCZ A;  4I5N B;  3TS5 C;  5AFP A;  2KHN A;  1SL7 A;  2GV5 A;  2KDH A;  2L0P A;  3VRN A;  1EXR A;  1MXL C;  2AMI A;  5ER5 A;  2KI4 C;  1SKT A;  4QJ5 B;  1XFZ O;  2KAY A;  1B8L A;  1V1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...