4DS7A

Crystal structure of yeast calmodulin bound to the c-terminal fragment of spindle pole body protein spc110
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
144
structure length
144
Chain Sequence
NLTEEQIAEFKEAFALFDKDNSGSISASELATVMRSLGLSPSEAEVADLMNEIDVDGNHAIEFSEFLALMSRQLKCNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIKQFAALLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title The molecular architecture of the yeast spindle pole body core determined by Bayesian integrative modeling.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Protein binding
total genus 50
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ds7A02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ds7A01
1NCZA 1KFXL 2FOTA 2WC8A 1U5IB 1J1EA 2OPOA 4FTGA 5GQQC 2KI6C 2LHLA 1AJ5A 1PSBA 1ZACA 1TN4A 1YX7A 1IKUA 1GJYA 1QIWA 3CGAA 1SCMC 4C0LA 4ORCB 5I8NA 4I5KA 4GGFC 1OOJA 2F2OA 2HPSA 1YRTB 2KAVA 2JU0A 2I7AA 2M49B 2MA2A 3I5FC 3TDZA 4PE4A 3BOWA 4GNKB 4M2PA 1UP5A 4MVFA 2BKIB 2EHBA 2KSPA 2WORA 4GFTA 3CR2A 1PSRA 2EC6B 2MHHA 1CLLA 1XFXO 5AFPA 3VRRA 1S36A 2JPTA 3CLNA 1PVBA 2ZRSA 1N0YA 1NX3A 4CIDA 3O4YA 1AHRA 3TDUA 1RECA 1BF5A 4AQJA 4YI8A 4PDZA 4PE1A 1A4PA 2COLB 1M63B 3SG3A 3EK4A 3PM8A 3AAKA 3F45A 5KU1A 1CDMA 1IRJA 1XFVO 2K61A 3M0WA 4ICBA 1OSAA 1WRKA 1QATA 1KK8C 2L4IA 1YVHA 1DGUA 1QV0A 5ER4X 2M7LA 2JRFA 3AKBA 4DS7A 1PK0D 2M7NA 1B7TY 1XO5A 1SL8A 2LAPA 1DT7B 3OB1B 1SK6D 1ZUZA 4I5LB 1PALA 1AP4A 2ZFDA 1CFFA 1OMVA 2JT3A 2OS8B 1G4YR 1XFWO 3DF0B 3KF9A 3EVVA 1K93D 1CFPA 2KFHA 5D69A 1JSAA 2KBMA 1K96A 1QVIY 4M2QA 1S3PA 1OZSA 2I94A 4P2YB 1S6JA 2RGIA 3O6BA 4HRGA 1CDLA 1QV1A 3TS5C 3DD4A 5FYXA 4XJKA 1S5GZ 3PSRA 1EG4A 1ZFSA 3FIAA 1KFUL 2WOSA 3SIAA 4WQ2A 1IG5A 1CMGA 4I5JA 4NDDA 1BMOA 1KK7Z 1ZMZA 1L2OC 4JWQA 3GK2A 2V53A 3I5GB 1EG3A 2JTTA 4CLNA 2G9BA 5D7FA 1UHHA 1PVAA 3EVUA 3NSIA 4AOMA 4YRUA 1NSHA 2PSRA 2K2FA 1JBAA 1IH0A 1CMFA 4MSPA 4OCIA 3ZWHA 1MHOA 2LVJA 1QLSA 1J7OA 1B47A 4E68A 1JF2A 2LVIA 3DVKA 2B1UA 1NIWA 3VROA 3ZNIA 4DUQA 2LMTA 3SIBA 1JWDA 2CXJA 1J55A 4XJKB 2LCPA 3TDIA 1YRUB 3H4SE 4F0ZB 2K2AA 3D0YB 1S26D 3O78A 1UHNA 3EK7A 5KSZA 1V1FA 1J7QA 4HRHA 4MRXA 3E3RA 3O2PA 3MSEB 3PALA 3WHUB 1MQ1A 2AMIA 1TNWA 3CS1A 2JXCA 1BU3A 1MXLC 1WY9A 4PE0A 4YBHB 2Q4UA 5TNCA 3LLEA 2P6BB 3SG4A 2O5GA 2NZ0A 1DJWA 5ER5A 1M45A 3RLZA 1D1OA 5CSFA 1C7VA 2SCPA 3SG2A 1K94A 4YGBB 1IWQA 2NLNA 3CWGA 1SBJA 2LNKA 1S6IA 1BR1B 2WCFA 1Y1XA 4M2OA 5AERA 1BR4B 1S5GY 3D10A 4R1EA 2H61A 3PN7B 1PULA 4MZJA 3OHMB 1DJXA 5J3XA 1N2DA 2LM5A 1KK7Y 1YUUA 1SW8A 4ZCUA 2CBLA 2BL0B 3AKAA 4Q04A 3I5HB 1B4CA 4U8DA 1PRWA 4MN0A 2LANA 2D8NA 3FWBA 3TZ1A 1EXRA 2M9GA 3KEVA 4GGFA 1KWOB 1OMDA 2EC6C 1V1GA 3NXAA 2KAYA 3WNXB 2LV7A 1Y6WA 1HQVA 1R2UA 1JUOA 4BY5A 1X02A 2JT0A 2F33A 2LUXA 5BPJA 2MBXA 2LLSA 3K21A 4OKHA 4C0JA 2MLFC 1F4OA 2GGMA 3BQ3A 4YGDB 1N65A 1W7JB 2KI6D 1TCFA 4PHNA 1L7ZA 1Q80A 2ZNDA 1RTP1 1ALVA 1XFUO 1R6PA 1YTZC 1M39A 3JTDB 4PCWA 1IQ3A 5I2LA 2JOJA 1CB1A 2KNEA 1YURA 2KDHA 1IGVA 2HETA 2KFFA 3GK4X 1SR6C 3AAJA 4ZCVA 1DJHA 1F70A 1SY9A 2QPTA 3BUOB 3BUMB 1AJ4A 2VRGA 2TN4A 4YGEB 1IJ5A 1H4BA 3BOWB 1WLZA 2K7DA 4QJ4B 1TNQA 4HSZA 1MXEA 2K7BA 3OB2B 1J7PA 3HCMA 1LVCD 1YVLA 4N1FA 3IF7A 1G8IA 5PALA 3DVJA 1NPQA 4MLWA 3VRPA 3WHTB 3I5IC 1UHJA 2KGRA 1CM4A 1FPWA 1MUXA 1DF0A 1NYAA 1TNXA 2AUCA 2KFGA 2KI4B 3EKHA 3FWCA 4JQ0D 2JWWA 1NX2A 3OX5A 1B8LA 2FJUB 3A8RA 1DVIA 2JTZA 3QRXA 3DVEA 1KK8B 1CLBA 4FQOA 4C0KA 2LP3A 2F3ZA 5AXIA 1E8AA 1C07A 1OZOA 2OTGC 3I5GC 2KGBC 5K89A 4YGCB 1KSOA 1GGWA 1KQMB 3TUYB 4GGNA 2LE9B 1CNPA 1MWNA 2K7OA 1QJTA 5CSIA 2HQWA 2Y5IA 2O60A 4OV2A 2LMVA 1ALWA 2ISDA 2BKHB 1C7WA 2A4JA 2PMYA 1CLMA 1JF0A 1UURA 1KQVA 5CSJA 2KQ6A 5DKNA 1CDPA 2QACA 2LUCA 2PALA 2ZN8A 4NDBA 3RM1A 1YR5A 4I5NB 3JVTB 2DOQA 1JFJA 1B8CA 2E30A 5CPVA 1JFKA 4A4BA 1KFXS 1K8UA 2AAOA 3BUWB 4N5XA 1CDNA 1F55A 3OX6A 2LVKA 2KOTA 1TIZA 2ZKMX 4AQIA 1YX8A 3KO0A 4CPVA 1XK4C 1UHIA 1WRZA 1FI5A 1CFDA 4DRWA 5JOLA 4CFRA 1MR8A 3DVMA 4WRIA 1NCXA 1YUSA 1QX2A 2M3WA 2NXQA 2K8MB 2H2KA 2L98A 2F3YA 4UPGA 1B8RA 1B1GA 1DJZA 3PLFB 2BCXA 3PN7C 3SG7A 1WDCB 3NSLA 2L5XB 5IBWA 2JNFA 3EKJA 1U5IA 2M29A 1GQMA 1K9PA 1IQ5A 2CTNA 1K2HA 3I5HC 2MLEC 4QJ5B 4MZKA 2CNPA 1OMRA 1OE9B 3IQQA 4HREE 2WNDA 4ORBB 2BE4A 2I2RE 1TCOB 1KWOC 4NDCA 2ZN9A 3SG6A 1W7IB 1NX1A 1MF8B 4BY4A 2Y4QA 1DJGA 1M31A 1F8HA 4PHJA 1Y1UA 2KHNA 1G33A 1AUIB 5CSNA 1K95A 2SASA 2HF5A 2JQ6A 2LLUA 1NP8A 2MAZA 1A29A 2Q91A 1CFCA 4GBAA 4OR9B 3SG5A 1BODA 3JTDC 2M1UA 1BOCA 1ODBA 1ZOTB 1SRAA 1LINA 4GPLB 4PHKA 3PATA 1QLKA 4USLA 1CKKA 5I2OA 4PALA 1XFYO 1SCMB 2M8UA 2LLTA 2MRDA 4L9MA 1UWOA 1TRFA 1XVJA 3FS7A 2Y1MA 3LK0A 2L2EA 1S1EA 4DIRA 1UUSA 2JULA 3BYAA 1KFUS 3I5FB 4YI9A 1WLMA 4TNCA 5DKQA 2IS9A 1SNLA 3OP0A 2M97A 2G2BA 1A2XA 2F8PA 2M0RA 2OS8C 2WCEA 4PE7A 5HKZA 1RROA 3BUNB 2KBIA 1OQPA 4NQGA 1QIVA 3DF0A 2L50A 2KI4C 5HLVA 2LMUA 2GGZA 1K9UA 3KHEA 1S6CA 1SL7A 2L4HA 4N1GA 1F4QA 1RJVA 2L51A 1TOPA 1TTXA 2FCDA 4JPZB 1RWYA 2BECA 1CTRA 1SPYA 3SJSA 1JC2A 1KQMC 2CCMA 3TUYC 1SR6B 3EK8A 3CZTX 1LA0A 5HKWA 2NCOA 1K90D 1FW4A 3PFVA 4ORAB 4CFQA 5AEQA 1YUTA 1FBVA 1F71A 2BCAA 3LCPC 2PASA 2JT8A 1SMGA 1SL9A 4WQ3A 2LVVA 1BG1A 3VGOA 3BUXB 3I5IB 1H8BA 3A4UB 2M1KB 1LXFC 3IQOA 1HT9A 4OVNF 4MEWA 5AANA 1FI6A 1DF0B 3GK1A 1J7RA 2GV5A 2JZIA 1RFJA 1KCYA 1QX7A 3D0YA 2ZNEA 1B9AA 3VRNA 5HYDA 1A03A 2LC5A 2JNXA 3JVTC 2WCBA 3TS5B 1LA3A 2L0PA 2JXLA 1Y0VH 1M46A 1AVSA 2BBNA 2CT9A 1J1DA 1K9KA 2OTGB 4DCKA 1UHKA 3EVRA 2PRUA 1BT6A 3BXKA 4MBEA 1EH2A 1EL4A 1L2OB 1SKTA 3NSOA 5HKYA 2Y1NA 1EJ3A 2LP2A 1DJIA 2F2PA 2PVBA 1XFZO 2ZRTA 5B8IB 1CM1A 2I18A 4ETOA 2BBMA 2R2IA 2BCBA 5F6TA 1XK4A 3CR5X 1A75A 4MZLA 2E6WA 3CTNA 1QX5B 3ICBA 4A4CA 1BJFA 1QTXA 1GGZA 1LKJA 1WDCC 4YGAA 1NX0A 4D1EA 3GOFA 4GUKA 2JC2A 1RK9A 4QJ3B 1QS7A 3KPXA 1QASA 3C1VA 1NCYA 2MJWB 3HX4A 3NSKA 1SCVA 2KYCA 4P5OE 2FCEA 1DJYA 1TNPA 4IL1A 2NCPA 2BL0C 1XYDA 5DKRA 1Y1AA 2HQ8A 1DTLA 1XA5A 2BE6A 1B7TZ 1QXPA 1DMOA 1NUBA 1AK8A 1NWDA 4GAOA 1IJ6A 2KYFA 1A75B 1VRKA 2KAXA 4XYNA 5HLOA 4PHMA 5JJGA 1BLQA 3LK1A 1F54A 1WRLA 2KQYA 5I2QA 3LL8B 3WXAA 2LHIA 1KSMA 2EGDA 2K0JA 3CR4X 1FF1A 4MRYA 1QVIZ 5G08A 2K7CA 1DGVA 1SYMA 2H61C 3VRQA 5KTYA
chains in the Genus database with same CATH superfamily
1NCZA 1KFXL 3OBVA 2FOTA 2WC8A 1U5IB 1J1EA 2OPOA 4FTGA 5GQQC 2KI6C 2LHLA 3PM2A 1AJ5A 1PSBA 1ZACA 1TN4A 1YX7A 1IKUA 1GJYA 1QIWA 3CGAA 1SCMC 4C0LA 4ORCB 5I8NA 4KYNA 4I5KA 2L5YA 4GGFC 1OOJA 3S0GA 2F2OA 2HPSA 1YRTB 2KAVA 2JU0A 2I7AA 2M49B 2MA2A 1DQEA 3I5FC 3TDZA 4PE4A 3BOWA 4GNKB 4M2PA 1UP5A 3D75A 4MVFA 2BKIB 2EHBA 2KSPA 2WORA 4GFTA 3CR2A 1PSRA 2EC6B 4PT1A 3DXLA 2MHHA 1CLLA 1XFXO 5AFPA 3S0DA 3VRRA 1S36A 2JPTA 3CLNA 1PVBA 2ZRSA 1N0YA 1NX3A 4CIDA 3O4YA 1AHRA 3TDUA 1RECA 1BF5A 4AQJA 4YI8A 4PDZA 4PE1A 1A4PA 2PQLA 2COLB 1M63B 3SG3A 3EK4A 3PM8A 3AAKA 3F45A 5KU1A 1DC1A 1CDMA 1IRJA 1XFVO 2K61A 3M0WA 4ICBA 1OSAA 1WRKA 1QATA 1KK8C 2L4IA 2BAPA 1YVHA 1C3YA 1DGUA 1QV0A 2KLEA 5DICA 5ER4X 2M7LA 2JRFA 3AKBA 4DS7A 1PK0D 2M7NA 1B7TY 1XO5A 1SL8A 2K60A 2LAPA 1DT7B 3R1PA 3OB1B 3K1EA 1SK6D 1ZUZA 4I5LB 1PALA 1AP4A 2ZFDA 1CFFA 1OMVA 2JT3A 2OS8B 1G4YR 1XFWO 3DF0B 3KF9A 3EVVA 1K93D 1CFPA 2KFHA 5D69A 1JSAA 2KBMA 1K96A 3CABA 1QVIY 4M2QA 1S3PA 1OZSA 2I94A 4P2YB 1S6JA 2RGIA 3O6BA 4HRGA 1CDLA 1QV1A 3TS5C 3DD4A 5FYXA 4XJKA 1S5GZ 3PSRA 4JKTA 1EG4A 1ZFSA 3FIAA 1KFUL 2WOSA 3SIAA 4WQ2A 1IG5A 1CMGA 4I5JA 4NDDA 1BMOA 1KK7Z 1ZMZA 2QEHA 3PJIA 1L2OC 4JWQA 1Z2CB 3FE8A 3GK2A 2V53A 1ORGA 3I5GB 1EG3A 2JTTA 2PYQA 4CLNA 2G9BA 5D7FA 1UHHA 1PVAA 3EVUA 3NSIA 4AOMA 4YRUA 1NSHA 2PSRA 2K2FA 1JBAA 1IH0A 1CMFA 1OOIX 4MSPA 4OCIA 3ZWHA 1MHOA 2LVJA 1QLSA 1J7OA 1B47A 4E68A 1JF2A 2LVIA 3DVKA 2B1UA 1NIWA 3VROA 3ZNIA 4DUQA 2LMTA 2YGUA 3SIBA 1JWDA 2CXJA 1J55A 4XJKB 2LCPA 3TDIA 1YRUB 3H4SE 4F0ZB 2K2AA 2QDIA 3D0YB 1S26D 1QWVA 1UHNA 3O78A 3EK7A 5KSZA 1V1FA 2FJYA 2KLDA 1J7QA 4HRHA 4MRXA 3E3RA 3O2PA 3MSEB 3PALA 3WHUB 2GTEA 1MQ1A 2AMIA 1TNWA 2KPHA 2JXCA 3CS1A 1BU3A 3NHTA 1MXLC 1WY9A 4PE0A 4YBHB 2Q4UA 5TNCA 3LLEA 3CDNA 2P6BB 3SG4A 1OOGA 2O5GA 2NZ0A 1DJWA 3FE6A 5ER5A 1M45A 3RLZA 1D1OA 1TWOA 2L2CA 5CSFA 1C7VA 2SCPA 3SG2A 1K94A 4YGBB 1IWQA 3B88A 1W9ZA 2NLNA 3CWGA 1SBJA 2LNKA 1S6IA 1BR1B 2WCFA 1Y1XA 4M2OA 1SSEB 5AERA 1BR4B 1OOHA 1S5GY 3D10A 1TUJA 4R1EA 2H61A 3PN7B 1PULA 4MZJA 3OHMB 1DJXA 5J3XA 1N2DA 2LM5A 1KK7Y 1YUUA 1SW8A 4ZCUA 2CBLA 2BL0B 3AKAA 4Q04A 3I5HB 1B4CA 4U8DA 1PRWA 4MN0A 2LANA 2D8NA 3FWBA 3TZ1A 1EXRA 2M9GA 3KEVA 4GGFA 1KWOB 1OMDA 2EC6C 1V1GA 3NXAA 3VB1A 2KAYA 3WNXB 1P28A 1Y6WA 2LV7A 1HQVA 1R2UA 1JUOA 4BY5A 1X02A 1Z4HA 2JT0A 2F33A 2LUXA 5BPJA 2MBXA 2LLSA 1XFRA 3D73A 3K21A 4OKHA 4C0JA 2MLFC 1F4OA 2GGMA 3BQ3A 5FI7A 4YGDB 1N65A 1W7JB 2KI6D 5EL2A 1TCFA 4INWA 4PHNA 1L7ZA 1Q80A 2ZNDA 1RTP1 1ALVA 1XFUO 1R6PA 1YTZC 1M39A 2WCMA 3CZ1A 3JTDB 4PCWA 1DELA 5I2LA 1IQ3A 3D77A 2JOJA 1CB1A 2KNEA 1YURA 2KDHA 1IGVA 2HETA 2KFFA 3GK4X 5D3OA 3UO9A 1SR6C 3AAJA 4ZCVA 1DJHA 1F70A 1SY9A 2QPTA 3BUOB 3BUMB 1AJ4A 2VRGA 2TN4A 3R1OA 1IJ5A 4YGEB 1H4BA 3BOWB 1WLZA 2K7DA 4QJ4B 1TNQA 4HSZA 1MXEA 2K7BA 3OB2B 1J7PA 3HCMA 1LVCD 1YVLA 4N1FA 3IF7A 1G8IA 5PALA 3DVJA 1NPQA 4MLWA 3D78A 3VRPA 4F7FA 3WHTB 3I5IC 3L4LA 1UHJA 2KGRA 1CM4A 1FPWA 1MUXA 1DF0A 1NYAA 1TNXA 2AUCA 2KFGA 2KI4B 3EKHA 3FWCA 4JQ0D 2JWWA 1NX2A 3OX5A 1B8LA 2FJUB 3A8RA 1DVIA 3B7AA 2JTZA 3QRXA 3DVEA 1KK8B 1CLBA 4FQOA 4C0KA 2LP3A 2F3ZA 3NGVA 5AXIA 1E8AA 1C07A 1OZOA 3S0EA 2OTGC 3I5GC 2KGBC 5K89A 4YGCB 1KSOA 1GGWA 1KQMB 3TUYB 4GGNA 2LE9B 1CNPA 1MWNA 2K7OA 3D76A 3NHIA 1QJTA 3QMEA 5CSIA 2HQWA 2Y5IA 2O60A 4OV2A 2LMVA 3BFAA 1ALWA 2ISDA 2BKHB 1C7WA 2A4JA 3BJHA 2PMYA 1CLMA 1JF0A 1UURA 1KQVA 5CSJA 2KQ6A 5DKNA 1CDPA 3B6XA 2QACA 2LUCA 2PALA 3BFHA 2ZN8A 4NDBA 2WCLA 3RM1A 1YR5A 4I5NB 3JVTB 2DOQA 3B87A 1JFJA 1B8CA 2E30A 5CPVA 1JFKA 2QEVA 4A4BA 1KFXS 1K8UA 2AAOA 3BUWB 4N5XA 3UNWA 1CDNA 1F55A 3OX6A 2LVKA 2KOTA 1TIZA 2ZKMX 4AQIA 1YX8A 3KO0A 4CPVA 1XK4C 1UHIA 3SS4A 1WRZA 1FI5A 1CFDA 4DRWA 5JOLA 4CFRA 1MR8A 3DVMA 4WRIA 1NCXA 1YUSA 1QX2A 2M3WA 2NXQA 2K8MB 2H2KA 2L98A 2F3YA 4UPGA 1B8RA 1B1GA 1DJZA 3PLFB 3Q8IA 2BCXA 3PN7C 3SG7A 1WDCB 3NSLA 2L5XB 5IBWA 2JNFA 3EKJA 1U5IA 2M29A 1GQMA 1K9PA 1IQ5A 2CTNA 4IJ7A 1K2HA 3I5HC 2MLEC 4QJ5B 4MZKA 2CNPA 1OMRA 1OE9B 3IQQA 4HREE 2WNDA 4ORBB 2BE4A 2I2RE 1TCOB 1KWOC 4NDCA 2ZN9A 3SG6A 1W7IB 1NX1A 1MF8B 4BY4A 2Y4QA 3O4XA 1DJGA 1M31A 3RZSA 1F8HA 4PHJA 3S0FA 1Y1UA 2KHNA 1G33A 5HL1A 1AUIB 5CSNA 1TUZA 1K95A 2SASA 2HF5A 2JQ6A 2LLUA 1NP8A 2MAZA 1A29A 2Q91A 1CFCA 4GBAA 4OR9B 3SG5A 1BODA 3JTDC 2M1UA 1BOCA 1ODBA 1ZOTB 3L47A 1SRAA 3SS5A 3EG5B 1LINA 4GPLB 4PHKA 3PATA 1QLKA 3CYZA 4USLA 1CKKA 5I2OA 3S0AA 4PALA 1XFYO 3IVTA 3OGNA 1SCMB 2M8UA 2LLTA 2MRDA 4L9MA 1UWOA 1TRFA 1XVJA 3FS7A 2Y1MA 3LK0A 2L2EA 1S1EA 4DIRA 1UUSA 2JULA 3BYAA 1KFUS 3I5FB 4YI9A 1WLMA 4TNCA 5DKQA 2IS9A 1SNLA 3DY9A 3OP0A 3DYEA 2WCJA 2M97A 2G2BA 1A2XA 2F8PA 2M0RA 2OS8C 2WCEA 2QEOA 4PE7A 5HKZA 1RROA 3BUNB 2KBIA 1OQPA 3CZ0A 4NQGA 1QIVA 3DF0A 2L50A 2KI4C 5HLVA 2LMUA 2GGZA 5I94A 1K9UA 3KHEA 1S6CA 1SL7A 2L4HA 5FI6A 4N1GA 1F4QA 1RJVA 2L51A 1TOPA 1TTXA 2FCDA 4JPZB 4OZDA 3V2LA 1RWYA 2BECA 1CTRA 1SPYA 3SJSA 1JC2A 1OOFA 1KQMC 2CCMA 3TUYC 1SR6B 3EK8A 3CZTX 1DEKA 1LA0A 1C3ZA 5HKWA 2NCOA 1K90D 1FW4A 3SS3A 3PFVA 4ORAB 4CFQA 5AEQA 1YUTA 1FBVA 1F71A 2BCAA 3LCPC 2PASA 2JT8A 1SMGA 1SL9A 4WQ3A 2LVVA 1BG1A 3VGOA 3BUXB 3I5IB 1H8BA 3A4UB 2M1KB 1LXFC 3IQOA 1HT9A 4OVNF 4MEWA 5AANA 1FI6A 1DF0B 3GK1A 1J7RA 2GV5A 2JZIA 1RFJA 1KCYA 1QX7A 3S0BA 3D0YA 2ZNEA 1B9AA 3VRNA 5HYDA 1A03A 2LC5A 2JNXA 3JVTC 2WCBA 3CZ2A 3TS5B 1LA3A 2L0PA 2JXLA 1Y0VH 1M46A 4FQTA 1AVSA 2BBNA 2CT9A 5FI2A 1J1DA 1K9KA 2OTGB 4DCKA 1LS8A 1UHKA 3EVRA 2PRUA 1BT6A 3BXKA 3BFBA 4MBEA 1EH2A 3DZTA 1EL4A 1L2OB 1SKTA 2WCKA 3NSOA 5HKYA 2Y1NA 3N7HA 1EJ3A 2LP2A 2H8VA 1DJIA 2F2PA 2PVBA 1XFZO 2ZRTA 5B8IB 1CM1A 2I18A 4ETOA 2BBMA 2R2IA 2BCBA 5F6TA 1XK4A 3CR5X 1A75A 4MZLA 2E6WA 3CTNA 1QX5B 2BNXA 3ICBA 4A4CA 1BJFA 3R1VA 1QTXA 3FE9A 2P70A 1GGZA 1LKJA 1WDCC 4YGAA 1NX0A 4D1EA 3GOFA 4GUKA 2JC2A 1GM0A 1RK9A 3D74A 4QJ3B 1QS7A 3KPXA 1QASA 3B86A 1NCYA 3C1VA 2MJWB 3HX4A 4JD9A 3NSKA 1SCVA 2KYCA 4P5OE 1IIOA 2FCEA 1DJYA 1TNPA 4IL1A 2NCPA 2BL0C 3R72A 1XYDA 5DKRA 1Y1AA 2HQ8A 1DTLA 2ERBA 1XA5A 2BE6A 1B7TZ 1QXPA 3L4AA 1OW4A 2WC5A 1DMOA 1T14A 1NUBA 1AK8A 1NWDA 4GAOA 1IJ6A 2KYFA 1A75B 1VRKA 2KAXA 4XYNA 5HLOA 4PHMA 2JPOA 5JJGA 2QEBA 3LK1A 1WRLA 4INXA 1BLQA 1F54A 2KQYA 2WCHA 5I2QA 3LL8B 3WXAA 2LHIA 1KSMA 2EGDA 2K0JA 3CR4X 1FF1A 4MRYA 2WC6A 1QVIZ 2P71A 2K7CA 1DGVA 5G08A 1SYMA 2H61C 3VRQA 5KTYA
chains in the Genus database with same CATH topology
1NCZA 1KFXL 2FOTA 2WC8A 1U5IB 1J1EA 2OPOA 4FTGA 5GQQC 2KI6C 2LHLA 1AJ5A 1PSBA 1ZACA 1TN4A 1YX7A 1IKUA 1GJYA 1QIWA 3CGAA 1SCMC 4C0LA 4ORCB 5I8NA 4I5KA 4GGFC 1OOJA 2F2OA 2HPSA 1YRTB 2KAVA 2JU0A 2I7AA 2M49B 2MA2A 3I5FC 3TDZA 4PE4A 3BOWA 4GNKB 4M2PA 1UP5A 4MVFA 2BKIB 2EHBA 2KSPA 2WORA 4GFTA 3CR2A 1PSRA 2EC6B 2MHHA 1CLLA 1XFXO 5AFPA 3VRRA 1S36A 2JPTA 3CLNA 1PVBA 2ZRSA 1N0YA 1NX3A 4CIDA 3O4YA 1AHRA 3TDUA 1RECA 1BF5A 4AQJA 4YI8A 4PDZA 4PE1A 1A4PA 2COLB 1M63B 3SG3A 3EK4A 3PM8A 3AAKA 3F45A 5KU1A 1CDMA 1IRJA 1XFVO 2K61A 3M0WA 4ICBA 1OSAA 1WRKA 1QATA 1KK8C 2L4IA 1YVHA 1DGUA 1QV0A 5ER4X 2M7LA 2JRFA 3AKBA 4DS7A 1PK0D 2M7NA 1B7TY 1XO5A 1SL8A 2LAPA 1DT7B 3OB1B 1SK6D 1ZUZA 4I5LB 1PALA 1AP4A 2ZFDA 1CFFA 1OMVA 2JT3A 2OS8B 1G4YR 1XFWO 3DF0B 3KF9A 3EVVA 1K93D 1CFPA 2KFHA 5D69A 1JSAA 2KBMA 1K96A 1QVIY 4M2QA 1S3PA 1OZSA 2I94A 4P2YB 1S6JA 2RGIA 3O6BA 4HRGA 1CDLA 1QV1A 3TS5C 3DD4A 5FYXA 4XJKA 1S5GZ 3PSRA 1EG4A 1ZFSA 3FIAA 1KFUL 2WOSA 3SIAA 4WQ2A 1IG5A 1CMGA 4I5JA 4NDDA 1BMOA 1KK7Z 1ZMZA 1L2OC 4JWQA 3GK2A 2V53A 3I5GB 1EG3A 2JTTA 4CLNA 2G9BA 5D7FA 1UHHA 1PVAA 3EVUA 3NSIA 4AOMA 4YRUA 1NSHA 2PSRA 2K2FA 1JBAA 1IH0A 1CMFA 4MSPA 4OCIA 3ZWHA 1MHOA 2LVJA 1QLSA 1J7OA 1B47A 4E68A 1JF2A 2LVIA 3DVKA 2B1UA 1NIWA 3VROA 3ZNIA 4DUQA 2LMTA 3SIBA 1JWDA 2CXJA 1J55A 4XJKB 2LCPA 3TDIA 1YRUB 3H4SE 4F0ZB 2K2AA 3D0YB 1S26D 3O78A 1UHNA 3EK7A 5KSZA 1V1FA 1J7QA 4HRHA 4MRXA 3E3RA 3O2PA 3MSEB 3PALA 3WHUB 1MQ1A 2AMIA 1TNWA 3CS1A 2JXCA 1BU3A 1MXLC 1WY9A 4PE0A 4YBHB 2Q4UA 5TNCA 3LLEA 2P6BB 3SG4A 2O5GA 2NZ0A 1DJWA 5ER5A 1M45A 3RLZA 1D1OA 5CSFA 1C7VA 2SCPA 3SG2A 1K94A 4YGBB 1IWQA 2NLNA 3CWGA 1SBJA 2LNKA 1S6IA 1BR1B 2WCFA 1Y1XA 4M2OA 5AERA 1BR4B 1S5GY 3D10A 4R1EA 2H61A 3PN7B 1PULA 4MZJA 3OHMB 1DJXA 5J3XA 1N2DA 2LM5A 1KK7Y 1YUUA 1SW8A 4ZCUA 2CBLA 2BL0B 3AKAA 4Q04A 3I5HB 1B4CA 4U8DA 1PRWA 4MN0A 2LANA 2D8NA 3FWBA 3TZ1A 1EXRA 2M9GA 3KEVA 4GGFA 1KWOB 1OMDA 2EC6C 1V1GA 3NXAA 2KAYA 3WNXB 2LV7A 1Y6WA 1HQVA 1R2UA 1JUOA 4BY5A 1X02A 2JT0A 2F33A 2LUXA 5BPJA 2MBXA 2LLSA 3K21A 4OKHA 4C0JA 2MLFC 1F4OA 2GGMA 3BQ3A 4YGDB 1N65A 1W7JB 2KI6D 1TCFA 4PHNA 1L7ZA 1Q80A 2ZNDA 1RTP1 1ALVA 1XFUO 1R6PA 1YTZC 1M39A 3JTDB 4PCWA 1IQ3A 5I2LA 2JOJA 1CB1A 2KNEA 1YURA 2KDHA 1IGVA 2HETA 2KFFA 3GK4X 1SR6C 3AAJA 4ZCVA 1DJHA 1F70A 1SY9A 2QPTA 3BUOB 3BUMB 1AJ4A 2VRGA 2TN4A 4YGEB 1IJ5A 1H4BA 3BOWB 1WLZA 2K7DA 4QJ4B 1TNQA 4HSZA 1MXEA 2K7BA 3OB2B 1J7PA 3HCMA 1LVCD 1YVLA 4N1FA 3IF7A 1G8IA 5PALA 3DVJA 1NPQA 4MLWA 3VRPA 3WHTB 3I5IC 1UHJA 2KGRA 1CM4A 1FPWA 1MUXA 1DF0A 1NYAA 1TNXA 2AUCA 2KFGA 2KI4B 3EKHA 3FWCA 4JQ0D 2JWWA 1NX2A 3OX5A 1B8LA 2FJUB 3A8RA 1DVIA 2JTZA 3QRXA 3DVEA 1KK8B 1CLBA 4FQOA 4C0KA 2LP3A 2F3ZA 5AXIA 1E8AA 1C07A 1OZOA 2OTGC 3I5GC 2KGBC 5K89A 4YGCB 1KSOA 1GGWA 1KQMB 3TUYB 4GGNA 2LE9B 1CNPA 1MWNA 2K7OA 1QJTA 5CSIA 2HQWA 2Y5IA 2O60A 4OV2A 2LMVA 1ALWA 2ISDA 2BKHB 1C7WA 2A4JA 2PMYA 1CLMA 1JF0A 1UURA 1KQVA 5CSJA 2KQ6A 5DKNA 1CDPA 2QACA 2LUCA 2PALA 2ZN8A 4NDBA 3RM1A 1YR5A 4I5NB 3JVTB 2DOQA 1JFJA 1B8CA 2E30A 5CPVA 1JFKA 4A4BA 1KFXS 1K8UA 2AAOA 3BUWB 4N5XA 1CDNA 1F55A 3OX6A 2LVKA 2KOTA 1TIZA 2ZKMX 4AQIA 1YX8A 3KO0A 4CPVA 1XK4C 1UHIA 1WRZA 1FI5A 1CFDA 4DRWA 5JOLA 4CFRA 1MR8A 3DVMA 4WRIA 1NCXA 1YUSA 1QX2A 2M3WA 2NXQA 2K8MB 2H2KA 2L98A 2F3YA 4UPGA 1B8RA 1B1GA 1DJZA 3PLFB 2BCXA 3PN7C 3SG7A 1WDCB 3NSLA 2L5XB 5IBWA 2JNFA 3EKJA 1U5IA 2M29A 1GQMA 1K9PA 1IQ5A 2CTNA 1K2HA 3I5HC 2MLEC 4QJ5B 4MZKA 2CNPA 1OMRA 1OE9B 3IQQA 4HREE 2WNDA 4ORBB 2BE4A 2I2RE 1TCOB 1KWOC 4NDCA 2ZN9A 3SG6A 1W7IB 1NX1A 1MF8B 4BY4A 2Y4QA 1DJGA 1M31A 1F8HA 4PHJA 1Y1UA 2KHNA 1G33A 1AUIB 5CSNA 1K95A 2SASA 2HF5A 2JQ6A 2LLUA 1NP8A 2MAZA 1A29A 2Q91A 1CFCA 4GBAA 4OR9B 3SG5A 1BODA 3JTDC 2M1UA 1BOCA 1ODBA 1ZOTB 1SRAA 1LINA 4GPLB 4PHKA 3PATA 1QLKA 4USLA 1CKKA 5I2OA 4PALA 1XFYO 1SCMB 2M8UA 2LLTA 2MRDA 4L9MA 1UWOA 1TRFA 1XVJA 3FS7A 2Y1MA 3LK0A 2L2EA 1S1EA 4DIRA 1UUSA 2JULA 3BYAA 1KFUS 3I5FB 4YI9A 1WLMA 4TNCA 5DKQA 2IS9A 1SNLA 3OP0A 2M97A 2G2BA 1A2XA 2F8PA 2M0RA 2OS8C 2WCEA 4PE7A 5HKZA 1RROA 3BUNB 2KBIA 1OQPA 4NQGA 1QIVA 3DF0A 2L50A 2KI4C 5HLVA 2LMUA 2GGZA 1K9UA 3KHEA 1S6CA 1SL7A 2L4HA 4N1GA 1F4QA 1RJVA 2L51A 1TOPA 1TTXA 2FCDA 4JPZB 1RWYA 2BECA 1CTRA 1SPYA 3SJSA 1JC2A 1KQMC 2CCMA 3TUYC 1SR6B 3EK8A 3CZTX 1LA0A 5HKWA 2NCOA 1K90D 1FW4A 3PFVA 4ORAB 4CFQA 5AEQA 1YUTA 1FBVA 1F71A 2BCAA 3LCPC 2PASA 2JT8A 1SMGA 1SL9A 4WQ3A 2LVVA 1BG1A 3VGOA 3BUXB 3I5IB 1H8BA 3A4UB 2M1KB 1LXFC 3IQOA 1HT9A 4OVNF 4MEWA 5AANA 1FI6A 1DF0B 3GK1A 1J7RA 2GV5A 2JZIA 1RFJA 1KCYA 1QX7A 3D0YA 2ZNEA 1B9AA 3VRNA 5HYDA 1A03A 2LC5A 2JNXA 3JVTC 2WCBA 3TS5B 1LA3A 2L0PA 2JXLA 1Y0VH 1M46A 1AVSA 2BBNA 2CT9A 1J1DA 1K9KA 2OTGB 4DCKA 1UHKA 3EVRA 2PRUA 1BT6A 3BXKA 4MBEA 1EH2A 1EL4A 1L2OB 1SKTA 3NSOA 5HKYA 2Y1NA 1EJ3A 2LP2A 1DJIA 2F2PA 2PVBA 1XFZO 2ZRTA 5B8IB 1CM1A 2I18A 4ETOA 2BBMA 2R2IA 2BCBA 5F6TA 1XK4A 3CR5X 1A75A 4MZLA 2E6WA 3CTNA 1QX5B 3ICBA 4A4CA 1BJFA 1QTXA 1GGZA 1LKJA 1WDCC 4YGAA 1NX0A 4D1EA 3GOFA 4GUKA 2JC2A 1RK9A 4QJ3B 1QS7A 3KPXA 1QASA 3C1VA 1NCYA 2MJWB 3HX4A 3NSKA 1SCVA 2KYCA 4P5OE 2FCEA 1DJYA 1TNPA 4IL1A 2NCPA 2BL0C 1XYDA 5DKRA 1Y1AA 2HQ8A 1DTLA 1XA5A 2BE6A 1B7TZ 1QXPA 1DMOA 1NUBA 1AK8A 1NWDA 4GAOA 1IJ6A 2KYFA 1A75B 1VRKA 2KAXA 4XYNA 5HLOA 4PHMA 5JJGA 1BLQA 3LK1A 1F54A 1WRLA 2KQYA 5I2QA 3LL8B 3WXAA 2LHIA 1KSMA 2EGDA 2K0JA 3CR4X 1FF1A 4MRYA 1QVIZ 5G08A 2K7CA 1DGVA 1SYMA 2H61C 3VRQA 5KTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCZ A;  1KFX L;  2FOT A;  2WC8 A;  1U5I B;  1J1E A;  2OPO A;  4FTG A;  5GQQ C;  2KI6 C;  2LHL A;  1AJ5 A;  1PSB A;  1ZAC A;  1TN4 A;  1YX7 A;  1IKU A;  1GJY A;  1QIW A;  3CGA A;  1SCM C;  4C0L A;  4ORC B;  5I8N A;  4I5K A;  4GGF C;  1OOJ A;  2F2O A;  2HPS A;  1YRT B;  2KAV A;  2JU0 A;  2I7A A;  2M49 B;  2MA2 A;  3I5F C;  3TDZ A;  4PE4 A;  3BOW A;  4GNK B;  4M2P A;  1UP5 A;  4MVF A;  2BKI B;  2EHB A;  2KSP A;  2WOR A;  4GFT A;  3CR2 A;  1PSR A;  2EC6 B;  2MHH A;  1CLL A;  1XFX O;  5AFP A;  3VRR A;  1S36 A;  2JPT A;  3CLN A;  1PVB A;  2ZRS A;  1N0Y A;  1NX3 A;  4CID A;  3O4Y A;  1AHR A;  3TDU A;  1REC A;  1BF5 A;  4AQJ A;  4YI8 A;  4PDZ A;  4PE1 A;  1A4P A;  2COL B;  1M63 B;  3SG3 A;  3EK4 A;  3PM8 A;  3AAK A;  3F45 A;  5KU1 A;  1CDM A;  1IRJ A;  1XFV O;  2K61 A;  3M0W A;  4ICB A;  1OSA A;  1WRK A;  1QAT A;  1KK8 C;  2L4I A;  1YVH A;  1DGU A;  1QV0 A;  5ER4 X;  2M7L A;  2JRF A;  3AKB A;  4DS7 A;  1PK0 D;  2M7N A;  1B7T Y;  1XO5 A;  1SL8 A;  2LAP A;  1DT7 B;  3OB1 B;  1SK6 D;  1ZUZ A;  4I5L B;  1PAL A;  1AP4 A;  2ZFD A;  1CFF A;  1OMV A;  2JT3 A;  2OS8 B;  1G4Y R;  1XFW O;  3DF0 B;  3KF9 A;  3EVV A;  1K93 D;  1CFP A;  2KFH A;  5D69 A;  1JSA A;  2KBM A;  1K96 A;  1QVI Y;  4M2Q A;  1S3P A;  1OZS A;  2I94 A;  4P2Y B;  1S6J A;  2RGI A;  3O6B A;  4HRG A;  1CDL A;  1QV1 A;  3TS5 C;  3DD4 A;  5FYX A;  4XJK A;  1S5G Z;  3PSR A;  1EG4 A;  1ZFS A;  3FIA A;  1KFU L;  2WOS A;  3SIA A;  4WQ2 A;  1IG5 A;  1CMG A;  4I5J A;  4NDD A;  1BMO A;  1KK7 Z;  1ZMZ A;  1L2O C;  4JWQ A;  3GK2 A;  2V53 A;  3I5G B;  1EG3 A;  2JTT A;  4CLN A;  2G9B A;  5D7F A;  1UHH A;  1PVA A;  3EVU A;  3NSI A;  4AOM A;  4YRU A;  1NSH A;  2PSR A;  2K2F A;  1JBA A;  1IH0 A;  1CMF A;  4MSP A;  4OCI A;  3ZWH A;  1MHO A;  2LVJ A;  1QLS A;  1J7O A;  1B47 A;  4E68 A;  1JF2 A;  2LVI A;  3DVK A;  2B1U A;  1NIW A;  3VRO A;  3ZNI A;  4DUQ A;  2LMT A;  3SIB A;  1JWD A;  2CXJ A;  1J55 A;  4XJK B;  2LCP A;  3TDI A;  1YRU B;  3H4S E;  4F0Z B;  2K2A A;  3D0Y B;  1S26 D;  3O78 A;  1UHN A;  3EK7 A;  5KSZ A;  1V1F A;  1J7Q A;  4HRH A;  4MRX A;  3E3R A;  3O2P A;  3MSE B;  3PAL A;  3WHU B;  1MQ1 A;  2AMI A;  1TNW A;  3CS1 A;  2JXC A;  1BU3 A;  1MXL C;  1WY9 A;  4PE0 A;  4YBH B;  2Q4U A;  5TNC A;  3LLE A;  2P6B B;  3SG4 A;  2O5G A;  2NZ0 A;  1DJW A;  5ER5 A;  1M45 A;  3RLZ A;  1D1O A;  5CSF A;  1C7V A;  2SCP A;  3SG2 A;  1K94 A;  4YGB B;  1IWQ A;  2NLN A;  3CWG A;  1SBJ A;  2LNK A;  1S6I A;  1BR1 B;  2WCF A;  1Y1X A;  4M2O A;  5AER A;  1BR4 B;  1S5G Y;  3D10 A;  4R1E A;  2H61 A;  3PN7 B;  1PUL A;  4MZJ A;  3OHM B;  1DJX A;  5J3X A;  1N2D A;  2LM5 A;  1KK7 Y;  1YUU A;  1SW8 A;  4ZCU A;  2CBL A;  2BL0 B;  3AKA A;  4Q04 A;  3I5H B;  1B4C A;  4U8D A;  1PRW A;  4MN0 A;  2LAN A;  2D8N A;  3FWB A;  3TZ1 A;  1EXR A;  2M9G A;  3KEV A;  4GGF A;  1KWO B;  1OMD A;  2EC6 C;  1V1G A;  3NXA A;  2KAY A;  3WNX B;  2LV7 A;  1Y6W A;  1HQV A;  1R2U A;  1JUO A;  4BY5 A;  1X02 A;  2JT0 A;  2F33 A;  2LUX A;  5BPJ A;  2MBX A;  2LLS A;  3K21 A;  4OKH A;  4C0J A;  2MLF C;  1F4O A;  2GGM A;  3BQ3 A;  4YGD B;  1N65 A;  1W7J B;  2KI6 D;  1TCF A;  4PHN A;  1L7Z A;  1Q80 A;  2ZND A;  1RTP 1;  1ALV A;  1XFU O;  1R6P A;  1YTZ C;  1M39 A;  3JTD B;  4PCW A;  1IQ3 A;  5I2L A;  2JOJ A;  1CB1 A;  2KNE A;  1YUR A;  2KDH A;  1IGV A;  2HET A;  2KFF A;  3GK4 X;  1SR6 C;  3AAJ A;  4ZCV A;  1DJH A;  1F70 A;  1SY9 A;  2QPT A;  3BUO B;  3BUM B;  1AJ4 A;  2VRG A;  2TN4 A;  4YGE B;  1IJ5 A;  1H4B A;  3BOW B;  1WLZ A;  2K7D A;  4QJ4 B;  1TNQ A;  4HSZ A;  1MXE A;  2K7B A;  3OB2 B;  1J7P A;  3HCM A;  1LVC D;  1YVL A;  4N1F A;  3IF7 A;  1G8I A;  5PAL A;  3DVJ A;  1NPQ A;  4MLW A;  3VRP A;  3WHT B;  3I5I C;  1UHJ A;  2KGR A;  1CM4 A;  1FPW A;  1MUX A;  1DF0 A;  1NYA A;  1TNX A;  2AUC A;  2KFG A;  2KI4 B;  3EKH A;  3FWC A;  4JQ0 D;  2JWW A;  1NX2 A;  3OX5 A;  1B8L A;  2FJU B;  3A8R A;  1DVI A;  2JTZ A;  3QRX A;  3DVE A;  1KK8 B;  1CLB A;  4FQO A;  4C0K A;  2LP3 A;  2F3Z A;  5AXI A;  1E8A A;  1C07 A;  1OZO A;  2OTG C;  3I5G C;  2KGB C;  5K89 A;  4YGC B;  1KSO A;  1GGW A;  1KQM B;  3TUY B;  4GGN A;  2LE9 B;  1CNP A;  1MWN A;  2K7O A;  1QJT A;  5CSI A;  2HQW A;  2Y5I A;  2O60 A;  4OV2 A;  2LMV A;  1ALW A;  2ISD A;  2BKH B;  1C7W A;  2A4J A;  2PMY A;  1CLM A;  1JF0 A;  1UUR A;  1KQV A;  5CSJ A;  2KQ6 A;  5DKN A;  1CDP A;  2QAC A;  2LUC A;  2PAL A;  2ZN8 A;  4NDB A;  3RM1 A;  1YR5 A;  4I5N B;  3JVT B;  2DOQ A;  1JFJ A;  1B8C A;  2E30 A;  5CPV A;  1JFK A;  4A4B A;  1KFX S;  1K8U A;  2AAO A;  3BUW B;  4N5X A;  1CDN A;  1F55 A;  3OX6 A;  2LVK A;  2KOT A;  1TIZ A;  2ZKM X;  4AQI A;  1YX8 A;  3KO0 A;  4CPV A;  1XK4 C;  1UHI A;  1WRZ A;  1FI5 A;  1CFD A;  4DRW A;  5JOL A;  4CFR A;  1MR8 A;  3DVM A;  4WRI A;  1NCX A;  1YUS A;  1QX2 A;  2M3W A;  2NXQ A;  2K8M B;  2H2K A;  2L98 A;  2F3Y A;  4UPG A;  1B8R A;  1B1G A;  1DJZ A;  3PLF B;  2BCX A;  3PN7 C;  3SG7 A;  1WDC B;  3NSL A;  2L5X B;  5IBW A;  2JNF A;  3EKJ A;  1U5I A;  2M29 A;  1GQM A;  1K9P A;  1IQ5 A;  2CTN A;  1K2H A;  3I5H C;  2MLE C;  4QJ5 B;  4MZK A;  2CNP A;  1OMR A;  1OE9 B;  3IQQ A;  4HRE E;  2WND A;  4ORB B;  2BE4 A;  2I2R E;  1TCO B;  1KWO C;  4NDC A;  2ZN9 A;  3SG6 A;  1W7I B;  1NX1 A;  1MF8 B;  4BY4 A;  2Y4Q A;  1DJG A;  1M31 A;  1F8H A;  4PHJ A;  1Y1U A;  2KHN A;  1G33 A;  1AUI B;  5CSN A;  1K95 A;  2SAS A;  2HF5 A;  2JQ6 A;  2LLU A;  1NP8 A;  2MAZ A;  1A29 A;  2Q91 A;  1CFC A;  4GBA A;  4OR9 B;  3SG5 A;  1BOD A;  3JTD C;  2M1U A;  1BOC A;  1ODB A;  1ZOT B;  1SRA A;  1LIN A;  4GPL B;  4PHK A;  3PAT A;  1QLK A;  4USL A;  1CKK A;  5I2O A;  4PAL A;  1XFY O;  1SCM B;  2M8U A;  2LLT A;  2MRD A;  4L9M A;  1UWO A;  1TRF A;  1XVJ A;  3FS7 A;  2Y1M A;  3LK0 A;  2L2E A;  1S1E A;  4DIR A;  1UUS A;  2JUL A;  3BYA A;  1KFU S;  3I5F B;  4YI9 A;  1WLM A;  4TNC A;  5DKQ A;  2IS9 A;  1SNL A;  3OP0 A;  2M97 A;  2G2B A;  1A2X A;  2F8P A;  2M0R A;  2OS8 C;  2WCE A;  4PE7 A;  5HKZ A;  1RRO A;  3BUN B;  2KBI A;  1OQP A;  4NQG A;  1QIV A;  3DF0 A;  2L50 A;  2KI4 C;  5HLV A;  2LMU A;  2GGZ A;  1K9U A;  3KHE A;  1S6C A;  1SL7 A;  2L4H A;  4N1G A;  1F4Q A;  1RJV A;  2L51 A;  1TOP A;  1TTX A;  2FCD A;  4JPZ B;  1RWY A;  2BEC A;  1CTR A;  1SPY A;  3SJS A;  1JC2 A;  1KQM C;  2CCM A;  3TUY C;  1SR6 B;  3EK8 A;  3CZT X;  1LA0 A;  5HKW A;  2NCO A;  1K90 D;  1FW4 A;  3PFV A;  4ORA B;  4CFQ A;  5AEQ A;  1YUT A;  1FBV A;  1F71 A;  2BCA A;  3LCP C;  2PAS A;  2JT8 A;  1SMG A;  1SL9 A;  4WQ3 A;  2LVV A;  1BG1 A;  3VGO A;  3BUX B;  3I5I B;  1H8B A;  3A4U B;  2M1K B;  1LXF C;  3IQO A;  1HT9 A;  4OVN F;  4MEW A;  5AAN A;  1FI6 A;  1DF0 B;  3GK1 A;  1J7R A;  2GV5 A;  2JZI A;  1RFJ A;  1KCY A;  1QX7 A;  3D0Y A;  2ZNE A;  1B9A A;  3VRN A;  5HYD A;  1A03 A;  2LC5 A;  2JNX A;  3JVT C;  2WCB A;  3TS5 B;  1LA3 A;  2L0P A;  2JXL A;  1Y0V H;  1M46 A;  1AVS A;  2BBN A;  2CT9 A;  1J1D A;  1K9K A;  2OTG B;  4DCK A;  1UHK A;  3EVR A;  2PRU A;  1BT6 A;  3BXK A;  4MBE A;  1EH2 A;  1EL4 A;  1L2O B;  1SKT A;  3NSO A;  5HKY A;  2Y1N A;  1EJ3 A;  2LP2 A;  1DJI A;  2F2P A;  2PVB A;  1XFZ O;  2ZRT A;  5B8I B;  1CM1 A;  2I18 A;  4ETO A;  2BBM A;  2R2I A;  2BCB A;  5F6T A;  1XK4 A;  3CR5 X;  1A75 A;  4MZL A;  2E6W A;  3CTN A;  1QX5 B;  3ICB A;  4A4C A;  1BJF A;  1QTX A;  1GGZ A;  1LKJ A;  1WDC C;  4YGA A;  1NX0 A;  4D1E A;  3GOF A;  4GUK A;  2JC2 A;  1RK9 A;  4QJ3 B;  1QS7 A;  3KPX A;  1QAS A;  3C1V A;  1NCY A;  2MJW B;  3HX4 A;  3NSK A;  1SCV A;  2KYC A;  4P5O E;  2FCE A;  1DJY A;  1TNP A;  4IL1 A;  2NCP A;  2BL0 C;  1XYD A;  5DKR A;  1Y1A A;  2HQ8 A;  1DTL A;  1XA5 A;  2BE6 A;  1B7T Z;  1QXP A;  1DMO A;  1NUB A;  1AK8 A;  1NWD A;  4GAO A;  1IJ6 A;  2KYF A;  1A75 B;  1VRK A;  2KAX A;  4XYN A;  5HLO A;  4PHM A;  5JJG A;  1BLQ A;  3LK1 A;  1F54 A;  1WRL A;  2KQY A;  5I2Q A;  3LL8 B;  3WXA A;  2LHI A;  1KSM A;  2EGD A;  2K0J A;  3CR4 X;  1FF1 A;  4MRY A;  1QVI Z;  5G08 A;  2K7C A;  1DGV A;  1SYM A;  2H61 C;  3VRQ A;  5KTY A; 
#chains in the Genus database with same CATH topology
 1NCZ A;  1KFX L;  3OBV A;  2FOT A;  2WC8 A;  1U5I B;  1J1E A;  2OPO A;  4FTG A;  5GQQ C;  2KI6 C;  2LHL A;  3PM2 A;  1AJ5 A;  1PSB A;  1ZAC A;  1TN4 A;  1YX7 A;  1IKU A;  1GJY A;  1QIW A;  3CGA A;  1SCM C;  4C0L A;  4ORC B;  5I8N A;  4KYN A;  4I5K A;  2L5Y A;  4GGF C;  1OOJ A;  3S0G A;  2F2O A;  2HPS A;  1YRT B;  2KAV A;  2JU0 A;  2I7A A;  2M49 B;  2MA2 A;  1DQE A;  3I5F C;  3TDZ A;  4PE4 A;  3BOW A;  4GNK B;  4M2P A;  1UP5 A;  3D75 A;  4MVF A;  2BKI B;  2EHB A;  2KSP A;  2WOR A;  4GFT A;  3CR2 A;  1PSR A;  2EC6 B;  4PT1 A;  3DXL A;  2MHH A;  1CLL A;  1XFX O;  5AFP A;  3S0D A;  3VRR A;  1S36 A;  2JPT A;  3CLN A;  1PVB A;  2ZRS A;  1N0Y A;  1NX3 A;  4CID A;  3O4Y A;  1AHR A;  3TDU A;  1REC A;  1BF5 A;  4AQJ A;  4YI8 A;  4PDZ A;  4PE1 A;  1A4P A;  2PQL A;  2COL B;  1M63 B;  3SG3 A;  3EK4 A;  3PM8 A;  3AAK A;  3F45 A;  5KU1 A;  1DC1 A;  1CDM A;  1IRJ A;  1XFV O;  2K61 A;  3M0W A;  4ICB A;  1OSA A;  1WRK A;  1QAT A;  1KK8 C;  2L4I A;  2BAP A;  1YVH A;  1C3Y A;  1DGU A;  1QV0 A;  2KLE A;  5DIC A;  5ER4 X;  2M7L A;  2JRF A;  3AKB A;  4DS7 A;  1PK0 D;  2M7N A;  1B7T Y;  1XO5 A;  1SL8 A;  2K60 A;  2LAP A;  1DT7 B;  3R1P A;  3OB1 B;  3K1E A;  1SK6 D;  1ZUZ A;  4I5L B;  1PAL A;  1AP4 A;  2ZFD A;  1CFF A;  1OMV A;  2JT3 A;  2OS8 B;  1G4Y R;  1XFW O;  3DF0 B;  3KF9 A;  3EVV A;  1K93 D;  1CFP A;  2KFH A;  5D69 A;  1JSA A;  2KBM A;  1K96 A;  3CAB A;  1QVI Y;  4M2Q A;  1S3P A;  1OZS A;  2I94 A;  4P2Y B;  1S6J A;  2RGI A;  3O6B A;  4HRG A;  1CDL A;  1QV1 A;  3TS5 C;  3DD4 A;  5FYX A;  4XJK A;  1S5G Z;  3PSR A;  4JKT A;  1EG4 A;  1ZFS A;  3FIA A;  1KFU L;  2WOS A;  3SIA A;  4WQ2 A;  1IG5 A;  1CMG A;  4I5J A;  4NDD A;  1BMO A;  1KK7 Z;  1ZMZ A;  2QEH A;  3PJI A;  1L2O C;  4JWQ A;  1Z2C B;  3FE8 A;  3GK2 A;  2V53 A;  1ORG A;  3I5G B;  1EG3 A;  2JTT A;  2PYQ A;  4CLN A;  2G9B A;  5D7F A;  1UHH A;  1PVA A;  3EVU A;  3NSI A;  4AOM A;  4YRU A;  1NSH A;  2PSR A;  2K2F A;  1JBA A;  1IH0 A;  1CMF A;  1OOI X;  4MSP A;  4OCI A;  3ZWH A;  1MHO A;  2LVJ A;  1QLS A;  1J7O A;  1B47 A;  4E68 A;  1JF2 A;  2LVI A;  3DVK A;  2B1U A;  1NIW A;  3VRO A;  3ZNI A;  4DUQ A;  2LMT A;  2YGU A;  3SIB A;  1JWD A;  2CXJ A;  1J55 A;  4XJK B;  2LCP A;  3TDI A;  1YRU B;  3H4S E;  4F0Z B;  2K2A A;  2QDI A;  3D0Y B;  1S26 D;  1QWV A;  1UHN A;  3O78 A;  3EK7 A;  5KSZ A;  1V1F A;  2FJY A;  2KLD A;  1J7Q A;  4HRH A;  4MRX A;  3E3R A;  3O2P A;  3MSE B;  3PAL A;  3WHU B;  2GTE A;  1MQ1 A;  2AMI A;  1TNW A;  2KPH A;  2JXC A;  3CS1 A;  1BU3 A;  3NHT A;  1MXL C;  1WY9 A;  4PE0 A;  4YBH B;  2Q4U A;  5TNC A;  3LLE A;  3CDN A;  2P6B B;  3SG4 A;  1OOG A;  2O5G A;  2NZ0 A;  1DJW A;  3FE6 A;  5ER5 A;  1M45 A;  3RLZ A;  1D1O A;  1TWO A;  2L2C A;  5CSF A;  1C7V A;  2SCP A;  3SG2 A;  1K94 A;  4YGB B;  1IWQ A;  3B88 A;  1W9Z A;  2NLN A;  3CWG A;  1SBJ A;  2LNK A;  1S6I A;  1BR1 B;  2WCF A;  1Y1X A;  4M2O A;  1SSE B;  5AER A;  1BR4 B;  1OOH A;  1S5G Y;  3D10 A;  1TUJ A;  4R1E A;  2H61 A;  3PN7 B;  1PUL A;  4MZJ A;  3OHM B;  1DJX A;  5J3X A;  1N2D A;  2LM5 A;  1KK7 Y;  1YUU A;  1SW8 A;  4ZCU A;  2CBL A;  2BL0 B;  3AKA A;  4Q04 A;  3I5H B;  1B4C A;  4U8D A;  1PRW A;  4MN0 A;  2LAN A;  2D8N A;  3FWB A;  3TZ1 A;  1EXR A;  2M9G A;  3KEV A;  4GGF A;  1KWO B;  1OMD A;  2EC6 C;  1V1G A;  3NXA A;  3VB1 A;  2KAY A;  3WNX B;  1P28 A;  1Y6W A;  2LV7 A;  1HQV A;  1R2U A;  1JUO A;  4BY5 A;  1X02 A;  1Z4H A;  2JT0 A;  2F33 A;  2LUX A;  5BPJ A;  2MBX A;  2LLS A;  1XFR A;  3D73 A;  3K21 A;  4OKH A;  4C0J A;  2MLF C;  1F4O A;  2GGM A;  3BQ3 A;  5FI7 A;  4YGD B;  1N65 A;  1W7J B;  2KI6 D;  5EL2 A;  1TCF A;  4INW A;  4PHN A;  1L7Z A;  1Q80 A;  2ZND A;  1RTP 1;  1ALV A;  1XFU O;  1R6P A;  1YTZ C;  1M39 A;  2WCM A;  3CZ1 A;  3JTD B;  4PCW A;  1DEL A;  5I2L A;  1IQ3 A;  3D77 A;  2JOJ A;  1CB1 A;  2KNE A;  1YUR A;  2KDH A;  1IGV A;  2HET A;  2KFF A;  3GK4 X;  5D3O A;  3UO9 A;  1SR6 C;  3AAJ A;  4ZCV A;  1DJH A;  1F70 A;  1SY9 A;  2QPT A;  3BUO B;  3BUM B;  1AJ4 A;  2VRG A;  2TN4 A;  3R1O A;  1IJ5 A;  4YGE B;  1H4B A;  3BOW B;  1WLZ A;  2K7D A;  4QJ4 B;  1TNQ A;  4HSZ A;  1MXE A;  2K7B A;  3OB2 B;  1J7P A;  3HCM A;  1LVC D;  1YVL A;  4N1F A;  3IF7 A;  1G8I A;  5PAL A;  3DVJ A;  1NPQ A;  4MLW A;  3D78 A;  3VRP A;  4F7F A;  3WHT B;  3I5I C;  3L4L A;  1UHJ A;  2KGR A;  1CM4 A;  1FPW A;  1MUX A;  1DF0 A;  1NYA A;  1TNX A;  2AUC A;  2KFG A;  2KI4 B;  3EKH A;  3FWC A;  4JQ0 D;  2JWW A;  1NX2 A;  3OX5 A;  1B8L A;  2FJU B;  3A8R A;  1DVI A;  3B7A A;  2JTZ A;  3QRX A;  3DVE A;  1KK8 B;  1CLB A;  4FQO A;  4C0K A;  2LP3 A;  2F3Z A;  3NGV A;  5AXI A;  1E8A A;  1C07 A;  1OZO A;  3S0E A;  2OTG C;  3I5G C;  2KGB C;  5K89 A;  4YGC B;  1KSO A;  1GGW A;  1KQM B;  3TUY B;  4GGN A;  2LE9 B;  1CNP A;  1MWN A;  2K7O A;  3D76 A;  3NHI A;  1QJT A;  3QME A;  5CSI A;  2HQW A;  2Y5I A;  2O60 A;  4OV2 A;  2LMV A;  3BFA A;  1ALW A;  2ISD A;  2BKH B;  1C7W A;  2A4J A;  3BJH A;  2PMY A;  1CLM A;  1JF0 A;  1UUR A;  1KQV A;  5CSJ A;  2KQ6 A;  5DKN A;  1CDP A;  3B6X A;  2QAC A;  2LUC A;  2PAL A;  3BFH A;  2ZN8 A;  4NDB A;  2WCL A;  3RM1 A;  1YR5 A;  4I5N B;  3JVT B;  2DOQ A;  3B87 A;  1JFJ A;  1B8C A;  2E30 A;  5CPV A;  1JFK A;  2QEV A;  4A4B A;  1KFX S;  1K8U A;  2AAO A;  3BUW B;  4N5X A;  3UNW A;  1CDN A;  1F55 A;  3OX6 A;  2LVK A;  2KOT A;  1TIZ A;  2ZKM X;  4AQI A;  1YX8 A;  3KO0 A;  4CPV A;  1XK4 C;  1UHI A;  3SS4 A;  1WRZ A;  1FI5 A;  1CFD A;  4DRW A;  5JOL A;  4CFR A;  1MR8 A;  3DVM A;  4WRI A;  1NCX A;  1YUS A;  1QX2 A;  2M3W A;  2NXQ A;  2K8M B;  2H2K A;  2L98 A;  2F3Y A;  4UPG A;  1B8R A;  1B1G A;  1DJZ A;  3PLF B;  3Q8I A;  2BCX A;  3PN7 C;  3SG7 A;  1WDC B;  3NSL A;  2L5X B;  5IBW A;  2JNF A;  3EKJ A;  1U5I A;  2M29 A;  1GQM A;  1K9P A;  1IQ5 A;  2CTN A;  4IJ7 A;  1K2H A;  3I5H C;  2MLE C;  4QJ5 B;  4MZK A;  2CNP A;  1OMR A;  1OE9 B;  3IQQ A;  4HRE E;  2WND A;  4ORB B;  2BE4 A;  2I2R E;  1TCO B;  1KWO C;  4NDC A;  2ZN9 A;  3SG6 A;  1W7I B;  1NX1 A;  1MF8 B;  4BY4 A;  2Y4Q A;  3O4X A;  1DJG A;  1M31 A;  3RZS A;  1F8H A;  4PHJ A;  3S0F A;  1Y1U A;  2KHN A;  1G33 A;  5HL1 A;  1AUI B;  5CSN A;  1TUZ A;  1K95 A;  2SAS A;  2HF5 A;  2JQ6 A;  2LLU A;  1NP8 A;  2MAZ A;  1A29 A;  2Q91 A;  1CFC A;  4GBA A;  4OR9 B;  3SG5 A;  1BOD A;  3JTD C;  2M1U A;  1BOC A;  1ODB A;  1ZOT B;  3L47 A;  1SRA A;  3SS5 A;  3EG5 B;  1LIN A;  4GPL B;  4PHK A;  3PAT A;  1QLK A;  3CYZ A;  4USL A;  1CKK A;  5I2O A;  3S0A A;  4PAL A;  1XFY O;  3IVT A;  3OGN A;  1SCM B;  2M8U A;  2LLT A;  2MRD A;  4L9M A;  1UWO A;  1TRF A;  1XVJ A;  3FS7 A;  2Y1M A;  3LK0 A;  2L2E A;  1S1E A;  4DIR A;  1UUS A;  2JUL A;  3BYA A;  1KFU S;  3I5F B;  4YI9 A;  1WLM A;  4TNC A;  5DKQ A;  2IS9 A;  1SNL A;  3DY9 A;  3OP0 A;  3DYE A;  2WCJ A;  2M97 A;  2G2B A;  1A2X A;  2F8P A;  2M0R A;  2OS8 C;  2WCE A;  2QEO A;  4PE7 A;  5HKZ A;  1RRO A;  3BUN B;  2KBI A;  1OQP A;  3CZ0 A;  4NQG A;  1QIV A;  3DF0 A;  2L50 A;  2KI4 C;  5HLV A;  2LMU A;  2GGZ A;  5I94 A;  1K9U A;  3KHE A;  1S6C A;  1SL7 A;  2L4H A;  5FI6 A;  4N1G A;  1F4Q A;  1RJV A;  2L51 A;  1TOP A;  1TTX A;  2FCD A;  4JPZ B;  4OZD A;  3V2L A;  1RWY A;  2BEC A;  1CTR A;  1SPY A;  3SJS A;  1JC2 A;  1OOF A;  1KQM C;  2CCM A;  3TUY C;  1SR6 B;  3EK8 A;  3CZT X;  1DEK A;  1LA0 A;  1C3Z A;  5HKW A;  2NCO A;  1K90 D;  1FW4 A;  3SS3 A;  3PFV A;  4ORA B;  4CFQ A;  5AEQ A;  1YUT A;  1FBV A;  1F71 A;  2BCA A;  3LCP C;  2PAS A;  2JT8 A;  1SMG A;  1SL9 A;  4WQ3 A;  2LVV A;  1BG1 A;  3VGO A;  3BUX B;  3I5I B;  1H8B A;  3A4U B;  2M1K B;  1LXF C;  3IQO A;  1HT9 A;  4OVN F;  4MEW A;  5AAN A;  1FI6 A;  1DF0 B;  3GK1 A;  1J7R A;  2GV5 A;  2JZI A;  1RFJ A;  1KCY A;  1QX7 A;  3S0B A;  3D0Y A;  2ZNE A;  1B9A A;  3VRN A;  5HYD A;  1A03 A;  2LC5 A;  2JNX A;  3JVT C;  2WCB A;  3CZ2 A;  3TS5 B;  1LA3 A;  2L0P A;  2JXL A;  1Y0V H;  1M46 A;  4FQT A;  1AVS A;  2BBN A;  2CT9 A;  5FI2 A;  1J1D A;  1K9K A;  2OTG B;  4DCK A;  1LS8 A;  1UHK A;  3EVR A;  2PRU A;  1BT6 A;  3BXK A;  3BFB A;  4MBE A;  1EH2 A;  3DZT A;  1EL4 A;  1L2O B;  1SKT A;  2WCK A;  3NSO A;  5HKY A;  2Y1N A;  3N7H A;  1EJ3 A;  2LP2 A;  2H8V A;  1DJI A;  2F2P A;  2PVB A;  1XFZ O;  2ZRT A;  5B8I B;  1CM1 A;  2I18 A;  4ETO A;  2BBM A;  2R2I A;  2BCB A;  5F6T A;  1XK4 A;  3CR5 X;  1A75 A;  4MZL A;  2E6W A;  3CTN A;  1QX5 B;  2BNX A;  3ICB A;  4A4C A;  1BJF A;  3R1V A;  1QTX A;  3FE9 A;  2P70 A;  1GGZ A;  1LKJ A;  1WDC C;  4YGA A;  1NX0 A;  4D1E A;  3GOF A;  4GUK A;  2JC2 A;  1GM0 A;  1RK9 A;  3D74 A;  4QJ3 B;  1QS7 A;  3KPX A;  1QAS A;  3B86 A;  1NCY A;  3C1V A;  2MJW B;  3HX4 A;  4JD9 A;  3NSK A;  1SCV A;  2KYC A;  4P5O E;  1IIO A;  2FCE A;  1DJY A;  1TNP A;  4IL1 A;  2NCP A;  2BL0 C;  3R72 A;  1XYD A;  5DKR A;  1Y1A A;  2HQ8 A;  1DTL A;  2ERB A;  1XA5 A;  2BE6 A;  1B7T Z;  1QXP A;  3L4A A;  1OW4 A;  2WC5 A;  1DMO A;  1T14 A;  1NUB A;  1AK8 A;  1NWD A;  4GAO A;  1IJ6 A;  2KYF A;  1A75 B;  1VRK A;  2KAX A;  4XYN A;  5HLO A;  4PHM A;  2JPO A;  5JJG A;  2QEB A;  3LK1 A;  1WRL A;  4INX A;  1BLQ A;  1F54 A;  2KQY A;  2WCH A;  5I2Q A;  3LL8 B;  3WXA A;  2LHI A;  1KSM A;  2EGD A;  2K0J A;  3CR4 X;  1FF1 A;  4MRY A;  2WC6 A;  1QVI Z;  2P71 A;  2K7C A;  1DGV A;  5G08 A;  1SYM A;  2H61 C;  3VRQ A;  5KTY A; 
#chains in the Genus database with same CATH homology
 1NCZ A;  1KFX L;  2FOT A;  2WC8 A;  1U5I B;  1J1E A;  2OPO A;  4FTG A;  5GQQ C;  2KI6 C;  2LHL A;  1AJ5 A;  1PSB A;  1ZAC A;  1TN4 A;  1YX7 A;  1IKU A;  1GJY A;  1QIW A;  3CGA A;  1SCM C;  4C0L A;  4ORC B;  5I8N A;  4I5K A;  4GGF C;  1OOJ A;  2F2O A;  2HPS A;  1YRT B;  2KAV A;  2JU0 A;  2I7A A;  2M49 B;  2MA2 A;  3I5F C;  3TDZ A;  4PE4 A;  3BOW A;  4GNK B;  4M2P A;  1UP5 A;  4MVF A;  2BKI B;  2EHB A;  2KSP A;  2WOR A;  4GFT A;  3CR2 A;  1PSR A;  2EC6 B;  2MHH A;  1CLL A;  1XFX O;  5AFP A;  3VRR A;  1S36 A;  2JPT A;  3CLN A;  1PVB A;  2ZRS A;  1N0Y A;  1NX3 A;  4CID A;  3O4Y A;  1AHR A;  3TDU A;  1REC A;  1BF5 A;  4AQJ A;  4YI8 A;  4PDZ A;  4PE1 A;  1A4P A;  2COL B;  1M63 B;  3SG3 A;  3EK4 A;  3PM8 A;  3AAK A;  3F45 A;  5KU1 A;  1CDM A;  1IRJ A;  1XFV O;  2K61 A;  3M0W A;  4ICB A;  1OSA A;  1WRK A;  1QAT A;  1KK8 C;  2L4I A;  1YVH A;  1DGU A;  1QV0 A;  5ER4 X;  2M7L A;  2JRF A;  3AKB A;  4DS7 A;  1PK0 D;  2M7N A;  1B7T Y;  1XO5 A;  1SL8 A;  2LAP A;  1DT7 B;  3OB1 B;  1SK6 D;  1ZUZ A;  4I5L B;  1PAL A;  1AP4 A;  2ZFD A;  1CFF A;  1OMV A;  2JT3 A;  2OS8 B;  1G4Y R;  1XFW O;  3DF0 B;  3KF9 A;  3EVV A;  1K93 D;  1CFP A;  2KFH A;  5D69 A;  1JSA A;  2KBM A;  1K96 A;  1QVI Y;  4M2Q A;  1S3P A;  1OZS A;  2I94 A;  4P2Y B;  1S6J A;  2RGI A;  3O6B A;  4HRG A;  1CDL A;  1QV1 A;  3TS5 C;  3DD4 A;  5FYX A;  4XJK A;  1S5G Z;  3PSR A;  1EG4 A;  1ZFS A;  3FIA A;  1KFU L;  2WOS A;  3SIA A;  4WQ2 A;  1IG5 A;  1CMG A;  4I5J A;  4NDD A;  1BMO A;  1KK7 Z;  1ZMZ A;  1L2O C;  4JWQ A;  3GK2 A;  2V53 A;  3I5G B;  1EG3 A;  2JTT A;  4CLN A;  2G9B A;  5D7F A;  1UHH A;  1PVA A;  3EVU A;  3NSI A;  4AOM A;  4YRU A;  1NSH A;  2PSR A;  2K2F A;  1JBA A;  1IH0 A;  1CMF A;  4MSP A;  4OCI A;  3ZWH A;  1MHO A;  2LVJ A;  1QLS A;  1J7O A;  1B47 A;  4E68 A;  1JF2 A;  2LVI A;  3DVK A;  2B1U A;  1NIW A;  3VRO A;  3ZNI A;  4DUQ A;  2LMT A;  3SIB A;  1JWD A;  2CXJ A;  1J55 A;  4XJK B;  2LCP A;  3TDI A;  1YRU B;  3H4S E;  4F0Z B;  2K2A A;  3D0Y B;  1S26 D;  3O78 A;  1UHN A;  3EK7 A;  5KSZ A;  1V1F A;  1J7Q A;  4HRH A;  4MRX A;  3E3R A;  3O2P A;  3MSE B;  3PAL A;  3WHU B;  1MQ1 A;  2AMI A;  1TNW A;  3CS1 A;  2JXC A;  1BU3 A;  1MXL C;  1WY9 A;  4PE0 A;  4YBH B;  2Q4U A;  5TNC A;  3LLE A;  2P6B B;  3SG4 A;  2O5G A;  2NZ0 A;  1DJW A;  5ER5 A;  1M45 A;  3RLZ A;  1D1O A;  5CSF A;  1C7V A;  2SCP A;  3SG2 A;  1K94 A;  4YGB B;  1IWQ A;  2NLN A;  3CWG A;  1SBJ A;  2LNK A;  1S6I A;  1BR1 B;  2WCF A;  1Y1X A;  4M2O A;  5AER A;  1BR4 B;  1S5G Y;  3D10 A;  4R1E A;  2H61 A;  3PN7 B;  1PUL A;  4MZJ A;  3OHM B;  1DJX A;  5J3X A;  1N2D A;  2LM5 A;  1KK7 Y;  1YUU A;  1SW8 A;  4ZCU A;  2CBL A;  2BL0 B;  3AKA A;  4Q04 A;  3I5H B;  1B4C A;  4U8D A;  1PRW A;  4MN0 A;  2LAN A;  2D8N A;  3FWB A;  3TZ1 A;  1EXR A;  2M9G A;  3KEV A;  4GGF A;  1KWO B;  1OMD A;  2EC6 C;  1V1G A;  3NXA A;  2KAY A;  3WNX B;  2LV7 A;  1Y6W A;  1HQV A;  1R2U A;  1JUO A;  4BY5 A;  1X02 A;  2JT0 A;  2F33 A;  2LUX A;  5BPJ A;  2MBX A;  2LLS A;  3K21 A;  4OKH A;  4C0J A;  2MLF C;  1F4O A;  2GGM A;  3BQ3 A;  4YGD B;  1N65 A;  1W7J B;  2KI6 D;  1TCF A;  4PHN A;  1L7Z A;  1Q80 A;  2ZND A;  1RTP 1;  1ALV A;  1XFU O;  1R6P A;  1YTZ C;  1M39 A;  3JTD B;  4PCW A;  1IQ3 A;  5I2L A;  2JOJ A;  1CB1 A;  2KNE A;  1YUR A;  2KDH A;  1IGV A;  2HET A;  2KFF A;  3GK4 X;  1SR6 C;  3AAJ A;  4ZCV A;  1DJH A;  1F70 A;  1SY9 A;  2QPT A;  3BUO B;  3BUM B;  1AJ4 A;  2VRG A;  2TN4 A;  4YGE B;  1IJ5 A;  1H4B A;  3BOW B;  1WLZ A;  2K7D A;  4QJ4 B;  1TNQ A;  4HSZ A;  1MXE A;  2K7B A;  3OB2 B;  1J7P A;  3HCM A;  1LVC D;  1YVL A;  4N1F A;  3IF7 A;  1G8I A;  5PAL A;  3DVJ A;  1NPQ A;  4MLW A;  3VRP A;  3WHT B;  3I5I C;  1UHJ A;  2KGR A;  1CM4 A;  1FPW A;  1MUX A;  1DF0 A;  1NYA A;  1TNX A;  2AUC A;  2KFG A;  2KI4 B;  3EKH A;  3FWC A;  4JQ0 D;  2JWW A;  1NX2 A;  3OX5 A;  1B8L A;  2FJU B;  3A8R A;  1DVI A;  2JTZ A;  3QRX A;  3DVE A;  1KK8 B;  1CLB A;  4FQO A;  4C0K A;  2LP3 A;  2F3Z A;  5AXI A;  1E8A A;  1C07 A;  1OZO A;  2OTG C;  3I5G C;  2KGB C;  5K89 A;  4YGC B;  1KSO A;  1GGW A;  1KQM B;  3TUY B;  4GGN A;  2LE9 B;  1CNP A;  1MWN A;  2K7O A;  1QJT A;  5CSI A;  2HQW A;  2Y5I A;  2O60 A;  4OV2 A;  2LMV A;  1ALW A;  2ISD A;  2BKH B;  1C7W A;  2A4J A;  2PMY A;  1CLM A;  1JF0 A;  1UUR A;  1KQV A;  5CSJ A;  2KQ6 A;  5DKN A;  1CDP A;  2QAC A;  2LUC A;  2PAL A;  2ZN8 A;  4NDB A;  3RM1 A;  1YR5 A;  4I5N B;  3JVT B;  2DOQ A;  1JFJ A;  1B8C A;  2E30 A;  5CPV A;  1JFK A;  4A4B A;  1KFX S;  1K8U A;  2AAO A;  3BUW B;  4N5X A;  1CDN A;  1F55 A;  3OX6 A;  2LVK A;  2KOT A;  1TIZ A;  2ZKM X;  4AQI A;  1YX8 A;  3KO0 A;  4CPV A;  1XK4 C;  1UHI A;  1WRZ A;  1FI5 A;  1CFD A;  4DRW A;  5JOL A;  4CFR A;  1MR8 A;  3DVM A;  4WRI A;  1NCX A;  1YUS A;  1QX2 A;  2M3W A;  2NXQ A;  2K8M B;  2H2K A;  2L98 A;  2F3Y A;  4UPG A;  1B8R A;  1B1G A;  1DJZ A;  3PLF B;  2BCX A;  3PN7 C;  3SG7 A;  1WDC B;  3NSL A;  2L5X B;  5IBW A;  2JNF A;  3EKJ A;  1U5I A;  2M29 A;  1GQM A;  1K9P A;  1IQ5 A;  2CTN A;  1K2H A;  3I5H C;  2MLE C;  4QJ5 B;  4MZK A;  2CNP A;  1OMR A;  1OE9 B;  3IQQ A;  4HRE E;  2WND A;  4ORB B;  2BE4 A;  2I2R E;  1TCO B;  1KWO C;  4NDC A;  2ZN9 A;  3SG6 A;  1W7I B;  1NX1 A;  1MF8 B;  4BY4 A;  2Y4Q A;  1DJG A;  1M31 A;  1F8H A;  4PHJ A;  1Y1U A;  2KHN A;  1G33 A;  1AUI B;  5CSN A;  1K95 A;  2SAS A;  2HF5 A;  2JQ6 A;  2LLU A;  1NP8 A;  2MAZ A;  1A29 A;  2Q91 A;  1CFC A;  4GBA A;  4OR9 B;  3SG5 A;  1BOD A;  3JTD C;  2M1U A;  1BOC A;  1ODB A;  1ZOT B;  1SRA A;  1LIN A;  4GPL B;  4PHK A;  3PAT A;  1QLK A;  4USL A;  1CKK A;  5I2O A;  4PAL A;  1XFY O;  1SCM B;  2M8U A;  2LLT A;  2MRD A;  4L9M A;  1UWO A;  1TRF A;  1XVJ A;  3FS7 A;  2Y1M A;  3LK0 A;  2L2E A;  1S1E A;  4DIR A;  1UUS A;  2JUL A;  3BYA A;  1KFU S;  3I5F B;  4YI9 A;  1WLM A;  4TNC A;  5DKQ A;  2IS9 A;  1SNL A;  3OP0 A;  2M97 A;  2G2B A;  1A2X A;  2F8P A;  2M0R A;  2OS8 C;  2WCE A;  4PE7 A;  5HKZ A;  1RRO A;  3BUN B;  2KBI A;  1OQP A;  4NQG A;  1QIV A;  3DF0 A;  2L50 A;  2KI4 C;  5HLV A;  2LMU A;  2GGZ A;  1K9U A;  3KHE A;  1S6C A;  1SL7 A;  2L4H A;  4N1G A;  1F4Q A;  1RJV A;  2L51 A;  1TOP A;  1TTX A;  2FCD A;  4JPZ B;  1RWY A;  2BEC A;  1CTR A;  1SPY A;  3SJS A;  1JC2 A;  1KQM C;  2CCM A;  3TUY C;  1SR6 B;  3EK8 A;  3CZT X;  1LA0 A;  5HKW A;  2NCO A;  1K90 D;  1FW4 A;  3PFV A;  4ORA B;  4CFQ A;  5AEQ A;  1YUT A;  1FBV A;  1F71 A;  2BCA A;  3LCP C;  2PAS A;  2JT8 A;  1SMG A;  1SL9 A;  4WQ3 A;  2LVV A;  1BG1 A;  3VGO A;  3BUX B;  3I5I B;  1H8B A;  3A4U B;  2M1K B;  1LXF C;  3IQO A;  1HT9 A;  4OVN F;  4MEW A;  5AAN A;  1FI6 A;  1DF0 B;  3GK1 A;  1J7R A;  2GV5 A;  2JZI A;  1RFJ A;  1KCY A;  1QX7 A;  3D0Y A;  2ZNE A;  1B9A A;  3VRN A;  5HYD A;  1A03 A;  2LC5 A;  2JNX A;  3JVT C;  2WCB A;  3TS5 B;  1LA3 A;  2L0P A;  2JXL A;  1Y0V H;  1M46 A;  1AVS A;  2BBN A;  2CT9 A;  1J1D A;  1K9K A;  2OTG B;  4DCK A;  1UHK A;  3EVR A;  2PRU A;  1BT6 A;  3BXK A;  4MBE A;  1EH2 A;  1EL4 A;  1L2O B;  1SKT A;  3NSO A;  5HKY A;  2Y1N A;  1EJ3 A;  2LP2 A;  1DJI A;  2F2P A;  2PVB A;  1XFZ O;  2ZRT A;  5B8I B;  1CM1 A;  2I18 A;  4ETO A;  2BBM A;  2R2I A;  2BCB A;  5F6T A;  1XK4 A;  3CR5 X;  1A75 A;  4MZL A;  2E6W A;  3CTN A;  1QX5 B;  3ICB A;  4A4C A;  1BJF A;  1QTX A;  1GGZ A;  1LKJ A;  1WDC C;  4YGA A;  1NX0 A;  4D1E A;  3GOF A;  4GUK A;  2JC2 A;  1RK9 A;  4QJ3 B;  1QS7 A;  3KPX A;  1QAS A;  3C1V A;  1NCY A;  2MJW B;  3HX4 A;  3NSK A;  1SCV A;  2KYC A;  4P5O E;  2FCE A;  1DJY A;  1TNP A;  4IL1 A;  2NCP A;  2BL0 C;  1XYD A;  5DKR A;  1Y1A A;  2HQ8 A;  1DTL A;  1XA5 A;  2BE6 A;  1B7T Z;  1QXP A;  1DMO A;  1NUB A;  1AK8 A;  1NWD A;  4GAO A;  1IJ6 A;  2KYF A;  1A75 B;  1VRK A;  2KAX A;  4XYN A;  5HLO A;  4PHM A;  5JJG A;  1BLQ A;  3LK1 A;  1F54 A;  1WRL A;  2KQY A;  5I2Q A;  3LL8 B;  3WXA A;  2LHI A;  1KSM A;  2EGD A;  2K0J A;  3CR4 X;  1FF1 A;  4MRY A;  1QVI Z;  5G08 A;  2K7C A;  1DGV A;  1SYM A;  2H61 C;  3VRQ A;  5KTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...