1W7JB

Crystal structure of myosin v motor with essential light chain + adp-befx - near rigor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
139
structure length
131
Chain Sequence
b'EFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN VA
publication title Three Myosin V Structures Delineate Essential Features of Chemo-Mechanical Transduction
pubmed doi rcsb
source organism Gallus gallus
molecule tags Motor protein
total genus 29
structure length 131
sequence length 139
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1w7jB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1w7jB01
4I5KA 3KEVA 1B47A 2CT9A 2M97A 5CSFA 2SCPA 3EK4A 2ZRSA 3EVUA 3ZNIA 2QPTA 1A29A 1JSAA 2K2FA 2M7LA 4C0LA 5HYDA 2H2KA 1DJWA 2M1KB 1G8IA 1QLKA 1JF0A 5J3XA 4YGEB 1CTRA 5HLVA 3FWBA 1QLSA 3AKAA 1TN4A 1SL8A 1ZMZA 3FS7A 2WCEA 2LMTA 3GOFA 1M46A 1MWNA 1TNWA 1CMGA 4QJ4B 1GJYA 5DKNA 5BPJA 2SASA 2ZN8A 4E68A 5I2OA 1TNPA 2CCMA 2K0JA 4ETOA 1Y1XA 1K90D 1LXFC 2CXJA 3KHEA 1AVSA 2K2AA 2KGBC 1NPQA 2K7DA 1KFUS 4AOMA 1GGZA 3NSKA 3O78A 1K95A 1DTLA 2LVJA 1PK0D 2MJWB 2O5GA 5G08A 1XFZO 1TCFA 3VRNA 1CLBA 3O6BA 3DF0B 1RJVA 1DJGA 1GQMA 1WRKA 2A4JA 4XJKB 1IH0A 2ZN9A 3CGAA 4NDDA 1CMFA 1QTXA 1ZFSA 3BOWB 2KBIA 1NYAA 1F4OA 5CSNA 2K8MB 2H61A 5AANA 1AK8A 4PHMA 1OMDA 1B4CA 1B8LA 1IKUA 2JNFA 3F45A 1PVAA 1NX0A 1PVBA 1YRUB 3TS5B 1UHKA 4PE0A 3VRPA 2L0PA 2JXCA 1JFKA 1TTXA 3CZTX 2MLFC 1R2UA 2GGMA 2JT3A 2IS9A 1G4YR 4MZLA 1SW8A 2M0RA 5AFPA 5ER4X 1M45A 1NX2A 1TNXA 2KI4C 1LINA 3I5GB 3I5HC 1IRJA 1DJXA 3IQOA 4GAOA 3SG6A 5HKZA 2WOSA 1IJ6A 2H61C 4PHKA 1CM1A 3PM8A 1BU3A 3D10A 1K8UA 2Q4UA 1C7VA 1KQMC 2WCFA 5GQQC 2E30A 4IL1A 3NSIA 1S3PA 1SR6C 2EC6C 2M29A 1JUOA 1BG1A 2ZNDA 1CKKA 2V53A 1V1FA 4GFTA 5B8IB 3EK8A 3OB2B 1WY9A 3CTNA 4MSPA 1XK4A 1MF8B 1TCOB 3RLZA 1DJIA 1N0YA 2L50A 2LM5A 2JU0A 1WLMA 3MSEB 3WHTB 5HKYA 2OPOA 3DVEA 1KFUL 2LUXA 2LHIA 1V1GA 1DF0A 2BL0C 5AXIA 3CR4X 4DRWA 2LNKA 2LHLA 1FI5A 4C0JA 1S26D 2KQ6A 2LANA 1UHNA 2KAYA 4MN0A 4ZCVA 1CLLA 4MVFA 1N65A 4MEWA 1FI6A 1K9UA 2HQ8A 1UURA 2KFHA 1A4PA 2HQWA 2OS8C 4YGAA 1L7ZA 1M63B 1L2OB 2WNDA 1TNQA 3BQ3A 3SG5A 3VRRA 4WQ2A 4JWQA 4GGFA 1XK4C 3SG3A 1U5IB 3O4YA 4GNKB 4HREE 5F6TA 4OV2A 2K61A 4TNCA 5JJGA 1AJ4A 1F4QA 1K94A 3TDIA 1EG3A 1SBJA 2BECA 2L2EA 2JTTA 4PHNA 1BMOA 1EJ3A 4ICBA 2I94A 2NCPA 3OX5A 1WRLA 1Y0VH 2F2PA 2MLEC 4PALA 1WDCC 1MXLC 4D1EA 3I5FC 1SL9A 5TNCA 2LVKA 1NWDA 2MRDA 1B8CA 2CTNA 1QVIZ 1JFJA 1ZOTB 3PLFB 1RFJA 4YGBB 5AEQA 3HCMA 2B1UA 1KSMA 3BUMB 1YTZC 1WRZA 1FF1A 2ZRTA 1HT9A 1H8BA 1F55A 3H4SE 4GGFC 2R2IA 1K9PA 1YR5A 4GGNA 3WXAA 1BR4B 1QATA 4CIDA 1OSAA 4HSZA 1QXPA 3KF9A 3WHUB 3DVJA 3EK7A 3LCPC 3PSRA 2EC6B 3SG4A 1A03A 2KI6D 3I5IC 1W7IB 3KO0A 1H4BA 3LK0A 1KQVA 5HLOA 1E8AA 3PFVA 5CSJA 4BY4A 2L4IA 1YRTB 2JTZA 5I2QA 2PMYA 2LLUA 2BCAA 1RROA 1K93D 2QACA 1C07A 1CNPA 2COLB 2FCEA 3GK2A 2RGIA 1CFPA 1SYMA 1FPWA 2BBMA 2HETA 2BKIB 1SCMC 5D7FA 1X02A 4PE4A 1BOCA 2NXQA 1YX7A 3DVKA 3OX6A 3HX4A 1DJHA 2JZIA 4DUQA 3JTDC 4YRUA 3O2PA 2Y1MA 3BUNB 4PE7A 4CFQA 2LP2A 1OQPA 1PSRA 2LLTA 4MLWA 2EHBA 2Y4QA 1F71A 2AMIA 1KWOB 1CB1A 5KTYA 5DKRA 2KHNA 3TDZA 3BUXB 1IJ5A 2LAPA 2CBLA 2G2BA 1KFXS 1YUSA 1WDCB 3PATA 1UP5A 5CPVA 4ORBB 1EH2A 1RWYA 2PVBA 1XFYO 1QJTA 2E6WA 1J1DA 1UUSA 2KAVA 4I5NB 1KK8C 4XYNA 3KPXA 1PRWA 1SMGA 1IQ5A 4NDBA 2HPSA 3JVTC 5HKWA 3NSOA 1SRAA 3PN7C 2F3ZA 1BT6A 1EXRA 4GBAA 1MQ1A 2JRFA 2JNXA 3EKJA 1ODBA 4QJ3B 1BLQA 4FQOA 4I5LB 2O60A 1CFFA 4HRGA 4L9MA 4QJ5B 1NX3A 1OOJA 1MUXA 4OR9B 1QS7A 4PCWA 1QASA 2L51A 3D0YA 1QIVA 2LVIA 3VRQA 5IBWA 2KBMA 1J55A 3CS1A 4BY5A 4U8DA 2P6BB 4I5JA 1J1EA 2LLSA 2KYFA 3DF0A 3EVRA 1NP8A 1J7QA 3M0WA 5D69A 4OKHA 2Y5IA 3A4UB 4GPLB 3IF7A 3E3RA 1F70A 1CM4A 4XJKA 2I18A 2MAZA 1QX5B 1Y1AA 2KGRA 3BOWA 1A75A 2PALA 4UPGA 2I2RE 1NIWA 2CNPA 2LVVA 3VGOA 1PULA 1J7OA 4YI9A 1QX7A 2BE6A 4CLNA 4DCKA 2L98A 4P5OE 1OE9B 3BXKA 1SY9A 1F54A 2M9GA 2BCBA 1Y1UA 1AHRA 2KSPA 3BUWB 2OTGC 1XO5A 1MXEA 1CDPA 2M7NA 1J7RA 4PE1A 1N2DA 1ALWA 1YVHA 2LC5A 2WCBA 4WRIA 5I8NA 1BJFA 3CWGA 1BODA 1LA0A 2ISDA 1CDLA 2GGZA 1JC2A 2HF5A 1KFXL 1OZOA 1RK9A 4GUKA 1F8HA 3I5HB 2KI4B 1YUUA 1C7WA 1ZUZA 3PALA 4N1FA 1K2HA 4NQGA 2JC2A 1QVIY 1K9KA 1J7PA 2JULA 5PALA 2BKHB 3CLNA 2MBXA 2M49B 4C0KA 2FCDA 3SIAA 1SPYA 1IWQA 1KQMB 1IGVA 3SJSA 1WLZA 3NSLA 3TS5C 3SG7A 1XFVO 1SR6B 1CDNA 1ALVA 4MZJA 1CLMA 1JBAA 4USLA 3EKHA 2I7AA 3IQQA 3LL8B 1QX2A 1S36A 1Y6WA 2F2OA 2LCPA 4A4BA 2ZFDA 1EG4A 2NZ0A 1AJ5A 1B7TZ 1S5GZ 1S6JA 2KI6C 3I5GC 2D8NA 3TUYC 3LK1A 2LV7A 3K21A 1DJZA 2JT0A 4PHJA 2KYCA 2KQYA 1XVJA 2BL0B 2FOTA 1Q80A 3QRXA 4MBEA 1DVIA 2JT8A 2M3WA 1EL4A 1B7TY 1S5GY 2KOTA 4ORCB 3RM1A 4M2QA 4M2PA 2ZNEA 2GV5A 2F8PA 1RTP1 4A4CA 3GK4X 2JPTA 1XFXO 2KFGA 1SCVA 1YVLA 2OS8B 1B8RA 5DKQA 4ZCUA 3OB1B 1XFWO 4N1GA 2DOQA 1U5IA 3WNXB 1XA5A 2LMVA 4MZKA 3SIBA 1TOPA 1FW4A 2BE4A 5I2LA 1S1EA 1W7JB 2Y1NA 3D0YB 2L5XB 1NX1A 1YX8A 3SG2A 2AUCA 3TDUA 2OTGB 1MHOA 1NUBA 1OMRA 2L4HA 2BCXA 1LA3A 4R1EA 1DF0B 1KSOA 2KFFA 2K7CA 1TRFA 2MA2A 5JOLA 5FYXA 3A8RA 1DT7B 1LVCD 1MR8A 4YBHB 2Q91A 1A75B 1BR1B 2JQ6A 1L2OC 3I5FB 2KDHA 1LKJA 2K7BA 4YI8A 1B1GA 1PSBA 3ICBA 5ER5A 4MRXA 4F0ZB 2MHHA 4NDCA 1UHIA 1SNLA 3AAJA 1RECA 4YGCB 1YURA 1S6IA 1XYDA 3ZWHA 5CSIA 2EGDA 1XFUO 1QV1A 4M2OA 5AERA 1AP4A 1SK6D 2ZKMX 2LMUA 4P2YB 3CR2A 1QIWA 2LP3A 1D1OA 1DGUA 2TN4A 3I5IB 1DJYA 5K89A 3AAKA 2BBNA 1PALA 1A2XA 2AAOA 4JQ0D 4DIRA 2VRGA 4OVNF 1VRKA 1GGWA 1S6CA 1UHHA 1UHJA 1NCYA 2WORA 2KAXA 1NSHA 3C1VA 1SL7A 3BYAA 3TUYB 2NLNA 1NCZA 2F33A 2PRUA 1K96A 3OHMB 1AUIB 3EVVA 2FJUB 3GK1A 1SCMB 2F3YA 2PSRA 1IQ3A 4AQJA 1DMOA 1R6PA 3BUOB 3DD4A 4WQ3A 1M39A 1G33A 4DS7A 1QV0A 2M8UA 2M1UA 1KCYA 5KSZA 3JTDB 2LUCA 2G9BA 1ZACA 2KNEA 4Q04A 4JPZB 1TIZA 3LLEA 3OP0A 1B9AA 1UWOA 5KU1A 1JWDA 3FIAA 3NXAA 4N5XA 1OZSA 2PASA 3CR5X 1NCXA 2JOJA 4HRHA 4YGDB 4PDZA 4AQIA 1KK7Z 4CPVA 4FTGA 1M31A 1JF2A 2LE9B 1CFDA 3TZ1A 1IG5A 4ORAB 1CDMA 3DVMA 1KK8B 2NCOA 4MRYA 1KK7Y 3FWCA 1CFCA 2JXLA 4CFRA 1BF5A 3JVTB 1OMVA 2K7OA 4OCIA 3PN7B 1SKTA 1FBVA 1KWOC 3AKBA 1HQVA 1DGVA 1YUTA 2JWWA 3VROA 2WC8A
chains in the Genus database with same CATH superfamily
4I5KA 3KEVA 1OOGA 1B47A 2CT9A 2M97A 5CSFA 2SCPA 3EK4A 1SSEB 2ZRSA 3EVUA 3ZNIA 2QPTA 1A29A 1JSAA 2K2FA 2M7LA 4C0LA 5HYDA 2H2KA 1DJWA 2M1KB 1G8IA 1QLKA 1JF0A 5J3XA 4YGEB 1CTRA 5HLVA 3FWBA 1QLSA 3AKAA 1TN4A 3Q8IA 1SL8A 1ZMZA 3FS7A 2WCEA 2LMTA 3SS4A 3GOFA 1M46A 1MWNA 1TNWA 1CMGA 4QJ4B 1GJYA 5DKNA 5BPJA 2SASA 2ZN8A 4E68A 5I2OA 1TNPA 2CCMA 2K0JA 4ETOA 1Y1XA 1K90D 1LXFC 2CXJA 3KHEA 2WCHA 1AVSA 2K2AA 1C3ZA 2KGBC 1NPQA 2K7DA 3B88A 1KFUS 4AOMA 1GGZA 3NSKA 3O78A 1K95A 5EL2A 1DTLA 2LVJA 2QEBA 3RZSA 1PK0D 2MJWB 1XFRA 2O5GA 5G08A 1XFZO 3B87A 1TCFA 3VRNA 1CLBA 3O6BA 3DF0B 4OZDA 1RJVA 1DJGA 1GQMA 1WRKA 2A4JA 4XJKB 1IH0A 2ZN9A 3CGAA 1OOFA 4NDDA 1CMFA 1QTXA 1ZFSA 2P70A 3BOWB 3S0FA 2KBIA 1Z4HA 1NYAA 1F4OA 1GM0A 5CSNA 2K8MB 2H61A 5AANA 1AK8A 4PHMA 1OMDA 1B4CA 1B8LA 1IKUA 2JNFA 3F45A 1DELA 1PVAA 5D3OA 1NX0A 1PVBA 1DC1A 3EG5B 1YRUB 3TS5B 1UHKA 4PE0A 3VRPA 2GTEA 2L0PA 2JXCA 1JFKA 1TTXA 4F7FA 3O4XA 3CZTX 2MLFC 2JPOA 1R2UA 2GGMA 2JT3A 2IS9A 1G4YR 4MZLA 1T14A 1SW8A 2M0RA 5AFPA 5ER4X 3DYEA 1M45A 1NX2A 1TNXA 2KI4C 1LINA 3I5GB 3I5HC 3S0GA 1IRJA 1DJXA 3IQOA 4GAOA 3SG6A 5HKZA 2WOSA 1IJ6A 2H61C 4PHKA 3L4LA 1CM1A 3PM8A 1BU3A 3CZ1A 3D10A 4PT1A 1K8UA 2Q4UA 1C7VA 3S0AA 1KQMC 2WCFA 5GQQC 2E30A 4IL1A 3NSIA 1S3PA 1SR6C 2EC6C 2M29A 1JUOA 1BG1A 2ZNDA 1CKKA 2V53A 1V1FA 4GFTA 4FQTA 5B8IB 3EK8A 3OB2B 1WY9A 3CTNA 4IJ7A 3D77A 4MSPA 1XK4A 1MF8B 1TCOB 3RLZA 1DJIA 1N0YA 2L50A 2LM5A 2JU0A 1WLMA 3MSEB 1TWOA 3WHTB 3CZ2A 5HKYA 2OPOA 3DVEA 1KFUL 2LUXA 2LHIA 1V1GA 1DF0A 2BL0C 3D74A 3CR4X 5AXIA 4DRWA 2LNKA 2LHLA 1FI5A 4C0JA 1S26D 2KQ6A 2LANA 1UHNA 2KAYA 4MN0A 4ZCVA 1CLLA 4MVFA 3CYZA 2QDIA 1N65A 3L47A 4MEWA 1FI6A 1K9UA 2PQLA 2HQ8A 1UURA 2KFHA 1A4PA 2HQWA 2OS8C 4YGAA 1L7ZA 1M63B 1L2OB 2WNDA 1TNQA 3BQ3A 3SG5A 3NGVA 5DICA 3VRRA 4WQ2A 3PJIA 4JWQA 2K60A 4GGFA 1XK4C 3SG3A 1U5IB 3O4YA 4GNKB 4HREE 5F6TA 3N7HA 4OV2A 2K61A 4TNCA 1C3YA 3BFHA 5JJGA 1AJ4A 1F4QA 1K94A 4JKTA 3TDIA 1EG3A 1SBJA 2BECA 2L2EA 2JTTA 4PHNA 1BMOA 1EJ3A 4ICBA 2I94A 2P71A 2NCPA 3OX5A 1WRLA 1Y0VH 2F2PA 2MLEC 4PALA 1WDCC 1MXLC 3BJHA 4D1EA 3L4AA 3I5FC 1SL9A 5FI7A 2LVKA 1NWDA 2MRDA 5TNCA 1B8CA 2CTNA 1QVIZ 1JFJA 1ZOTB 3PLFB 1RFJA 4YGBB 5AEQA 3HCMA 2B1UA 1KSMA 3BUMB 1YTZC 1WRZA 1FF1A 2ZRTA 1HT9A 1H8BA 1F55A 3H4SE 4GGFC 2QEHA 2R2IA 1K9PA 1YR5A 4GGNA 3WXAA 1BR4B 1QATA 4CIDA 1OSAA 4HSZA 1QXPA 3KF9A 3WHUB 3DVJA 3EK7A 3LCPC 3PSRA 3S0BA 2EC6B 3SG4A 1A03A 2KI6D 3I5IC 1W7IB 3KO0A 1OW4A 1H4BA 3LK0A 1KQVA 5HLOA 1E8AA 3NHTA 3PFVA 5CSJA 4BY4A 2L4IA 1YRTB 2JTZA 5I2QA 2PMYA 2LLUA 2BCAA 1RROA 1K93D 2QACA 1C07A 1CNPA 2COLB 2FCEA 3GK2A 2RGIA 2H8VA 1SYMA 1CFPA 1FPWA 2BBMA 2HETA 1P28A 2BKIB 1SCMC 5D7FA 1X02A 3CABA 4PE4A 1BOCA 2NXQA 1YX7A 3DVKA 3OX6A 3HX4A 1DJHA 2JZIA 2BNXA 4DUQA 3JTDC 4JD9A 4YRUA 3O2PA 2Y1MA 2BAPA 3BUNB 4PE7A 4CFQA 2LP2A 1OQPA 1PSRA 2LLTA 4MLWA 2EHBA 2Y4QA 1F71A 1ORGA 2AMIA 1KWOB 1CB1A 5KTYA 5DKRA 2KHNA 3S0DA 3SS3A 3TDZA 3BUXB 1IJ5A 2KPHA 2LAPA 2CBLA 2G2BA 1KFXS 1YUSA 1WDCB 3PATA 1UP5A 5CPVA 4ORBB 1EH2A 1RWYA 2PVBA 1XFYO 1QJTA 2E6WA 1J1DA 1UUSA 2KAVA 4I5NB 1KK8C 4XYNA 3D76A 3KPXA 1PRWA 1SMGA 1IQ5A 4NDBA 2HPSA 3JVTC 5HKWA 3NSOA 1SRAA 1W9ZA 2QEOA 3PN7C 2F3ZA 1BT6A 1EXRA 4GBAA 1MQ1A 2JRFA 3VB1A 2JNXA 3EKJA 1ODBA 4QJ3B 1BLQA 4FQOA 1TUJA 3IVTA 4I5LB 2O60A 5JOLA 1CFFA 4HRGA 4L9MA 3B6XA 1NX3A 4QJ5B 1OOJA 3B86A 1MUXA 1DEKA 2ERBA 4OR9B 1QS7A 4PCWA 1QASA 2L51A 3D0YA 1QIVA 3DXLA 2LVIA 3VRQA 5IBWA 1LS8A 2KBMA 1J55A 3CS1A 4BY5A 4U8DA 2P6BB 4I5JA 1Z2CB 1J1EA 3K1EA 2LLSA 2KYFA 3DF0A 3EVRA 1NP8A 1J7QA 3M0WA 5D69A 4OKHA 2Y5IA 3A4UB 4GPLB 3IF7A 3UO9A 3E3RA 1F70A 1CM4A 4XJKA 2I18A 2MAZA 1QX5B 1Y1AA 2KGRA 3BOWA 1A75A 2PALA 4UPGA 2KLDA 2I2RE 1NIWA 2CNPA 2LVVA 3VGOA 1PULA 1J7OA 4YI9A 1QX7A 3D78A 2BE6A 4CLNA 4DCKA 2L98A 4P5OE 1OE9B 3BXKA 3DZTA 1SY9A 1F54A 2M9GA 2BCBA 1Y1UA 4INWA 5I94A 1AHRA 2KSPA 3BUWB 1OOHA 2OTGC 1XO5A 1MXEA 5FI6A 1CDPA 2M7NA 1J7RA 2WCLA 1N2DA 4PE1A 1ALWA 1YVHA 2LC5A 2WCBA 4WRIA 5I8NA 1BJFA 3CWGA 1BODA 1LA0A 2ISDA 1CDLA 2GGZA 1JC2A 2HF5A 1KFXL 1OZOA 1RK9A 4GUKA 1F8HA 3I5HB 2KI4B 5HL1A 1YUUA 1C7WA 1ZUZA 2WCMA 3PALA 3R72A 4N1FA 4NQGA 1K2HA 2JC2A 1QVIY 1K9KA 1J7PA 2JULA 5PALA 2BKHB 3CLNA 2MBXA 2M49B 4C0KA 2FCDA 3SIAA 1SPYA 1IWQA 1KQMB 1IGVA 3SJSA 1WLZA 3NSLA 3TS5C 3SG7A 1XFVO 1SR6B 3FE8A 1CDNA 1ALVA 4MZJA 1CLMA 3S0EA 2PYQA 1JBAA 2WC5A 4USLA 2YGUA 3EKHA 2I7AA 3IQQA 3LL8B 1QX2A 1S36A 1Y6WA 2F2OA 2LCPA 4A4BA 2ZFDA 1EG4A 2NZ0A 1AJ5A 1B7TZ 1S5GZ 1S6JA 2KI6C 3I5GC 2D8NA 3R1OA 3LK1A 2LV7A 3K21A 3TUYC 1DJZA 2JT0A 4PHJA 2KYCA 2KQYA 1XVJA 2BL0B 2FOTA 1Q80A 3QRXA 4MBEA 1DVIA 2JT8A 2M3WA 1EL4A 1B7TY 1S5GY 2KOTA 4ORCB 3RM1A 1QWVA 4M2QA 4M2PA 2ZNEA 2GV5A 2L2CA 2F8PA 1RTP1 4A4CA 1IIOA 3GK4X 2JPTA 1XFXO 3PM2A 2KFGA 1SCVA 1YVLA 2OS8B 1B8RA 5DKQA 3B7AA 4ZCUA 3OB1B 1XFWO 4N1GA 2DOQA 1U5IA 3CZ0A 3QMEA 3V2LA 3WNXB 1XA5A 2LMVA 4MZKA 3SIBA 1TOPA 1FW4A 2BE4A 5I2LA 1S1EA 3BFBA 1W7JB 2QEVA 2WCKA 2Y1NA 2L5XB 1NX1A 1YX8A 3D0YB 3D75A 3SG2A 2AUCA 3TDUA 2OTGB 1MHOA 1NUBA 1OMRA 2L4HA 2BCXA 1LA3A 4R1EA 1DF0B 1KSOA 2KFFA 2K7CA 1TRFA 2MA2A 3FE9A 5FYXA 2KLEA 3A8RA 1DT7B 1LVCD 1MR8A 4YBHB 2Q91A 1A75B 1BR1B 2JQ6A 1L2OC 3I5FB 2KDHA 1LKJA 2K7BA 4YI8A 1B1GA 1PSBA 3ICBA 5ER5A 4MRXA 4F0ZB 3OGNA 2MHHA 4NDCA 1UHIA 1SNLA 3AAJA 1DQEA 1RECA 4YGCB 1YURA 1S6IA 1XYDA 3ZWHA 5CSIA 2EGDA 1XFUO 1QV1A 4M2OA 5AERA 1AP4A 1SK6D 2ZKMX 2LMUA 2FJYA 4P2YB 3CR2A 1QIWA 2LP3A 1D1OA 1DGUA 2TN4A 3I5IB 3R1VA 1DJYA 3SS5A 5K89A 3AAKA 1PALA 2AAOA 1A2XA 2BBNA 4JQ0D 4DIRA 2VRGA 4OVNF 1VRKA 3OBVA 1GGWA 1S6CA 1UHHA 1UHJA 1NCYA 2WORA 2KAXA 1NSHA 3C1VA 1SL7A 1TUZA 3BYAA 3TUYB 5FI2A 2NLNA 1NCZA 2F33A 2PRUA 1K96A 3OHMB 1AUIB 1OOIX 3EVVA 2FJUB 3GK1A 1SCMB 2F3YA 2PSRA 1IQ3A 4AQJA 3NHIA 1DMOA 1R6PA 3BUOB 3FE6A 3DD4A 4WQ3A 1M39A 1G33A 4DS7A 1QV0A 2M8UA 2M1UA 1KCYA 5KSZA 3JTDB 4KYNA 2LUCA 2G9BA 1ZACA 2KNEA 4INXA 4Q04A 4JPZB 1TIZA 3LLEA 3OP0A 1B9AA 3D73A 1UWOA 2WC6A 5KU1A 1JWDA 3DY9A 3FIAA 3NXAA 2WCJA 4N5XA 1OZSA 2PASA 3CR5X 1NCXA 2JOJA 4HRHA 3BFAA 4YGDB 3R1PA 4PDZA 4AQIA 1KK7Z 4CPVA 4FTGA 1M31A 1JF2A 2LE9B 1CFDA 2L5YA 3TZ1A 1IG5A 4ORAB 1CDMA 3DVMA 3UNWA 1KK8B 2NCOA 4MRYA 1KK7Y 3FWCA 1CFCA 2JXLA 4CFRA 1BF5A 3JVTB 1OMVA 2K7OA 4OCIA 3PN7B 1SKTA 3CDNA 1FBVA 1KWOC 3AKBA 1HQVA 1DGVA 1YUTA 2JWWA 3VROA 2WC8A
chains in the Genus database with same CATH topology
4I5KA 3KEVA 1B47A 2CT9A 2M97A 5CSFA 2SCPA 3EK4A 2ZRSA 3EVUA 3ZNIA 2QPTA 1A29A 1JSAA 2K2FA 2M7LA 4C0LA 5HYDA 2H2KA 1DJWA 2M1KB 1G8IA 1QLKA 1JF0A 5J3XA 4YGEB 1CTRA 5HLVA 3FWBA 1QLSA 3AKAA 1TN4A 1SL8A 1ZMZA 3FS7A 2WCEA 2LMTA 3GOFA 1M46A 1MWNA 1TNWA 1CMGA 4QJ4B 1GJYA 5DKNA 5BPJA 2SASA 2ZN8A 4E68A 5I2OA 1TNPA 2CCMA 2K0JA 4ETOA 1Y1XA 1K90D 1LXFC 2CXJA 3KHEA 1AVSA 2K2AA 2KGBC 1NPQA 2K7DA 1KFUS 4AOMA 1GGZA 3NSKA 3O78A 1K95A 1DTLA 2LVJA 1PK0D 2MJWB 2O5GA 5G08A 1XFZO 1TCFA 3VRNA 1CLBA 3O6BA 3DF0B 1RJVA 1DJGA 1GQMA 1WRKA 2A4JA 4XJKB 1IH0A 2ZN9A 3CGAA 4NDDA 1CMFA 1QTXA 1ZFSA 3BOWB 2KBIA 1NYAA 1F4OA 5CSNA 2K8MB 2H61A 5AANA 1AK8A 4PHMA 1OMDA 1B4CA 1B8LA 1IKUA 2JNFA 3F45A 1PVAA 1NX0A 1PVBA 1YRUB 3TS5B 1UHKA 4PE0A 3VRPA 2L0PA 2JXCA 1JFKA 1TTXA 3CZTX 2MLFC 1R2UA 2GGMA 2JT3A 2IS9A 1G4YR 4MZLA 1SW8A 2M0RA 5AFPA 5ER4X 1M45A 1NX2A 1TNXA 2KI4C 1LINA 3I5GB 3I5HC 1IRJA 1DJXA 3IQOA 4GAOA 3SG6A 5HKZA 2WOSA 1IJ6A 2H61C 4PHKA 1CM1A 3PM8A 1BU3A 3D10A 1K8UA 2Q4UA 1C7VA 1KQMC 2WCFA 5GQQC 2E30A 4IL1A 3NSIA 1S3PA 1SR6C 2EC6C 2M29A 1JUOA 1BG1A 2ZNDA 1CKKA 2V53A 1V1FA 4GFTA 5B8IB 3EK8A 3OB2B 1WY9A 3CTNA 4MSPA 1XK4A 1MF8B 1TCOB 3RLZA 1DJIA 1N0YA 2L50A 2LM5A 2JU0A 1WLMA 3MSEB 3WHTB 5HKYA 2OPOA 3DVEA 1KFUL 2LUXA 2LHIA 1V1GA 1DF0A 2BL0C 5AXIA 3CR4X 4DRWA 2LNKA 2LHLA 1FI5A 4C0JA 1S26D 2KQ6A 2LANA 1UHNA 2KAYA 4MN0A 4ZCVA 1CLLA 4MVFA 1N65A 4MEWA 1FI6A 1K9UA 2HQ8A 1UURA 2KFHA 1A4PA 2HQWA 2OS8C 4YGAA 1L7ZA 1M63B 1L2OB 2WNDA 1TNQA 3BQ3A 3SG5A 3VRRA 4WQ2A 4JWQA 4GGFA 1XK4C 3SG3A 1U5IB 3O4YA 4GNKB 4HREE 5F6TA 4OV2A 2K61A 4TNCA 5JJGA 1AJ4A 1F4QA 1K94A 3TDIA 1EG3A 1SBJA 2BECA 2L2EA 2JTTA 4PHNA 1BMOA 1EJ3A 4ICBA 2I94A 2NCPA 3OX5A 1WRLA 1Y0VH 2F2PA 2MLEC 4PALA 1WDCC 1MXLC 4D1EA 3I5FC 1SL9A 5TNCA 2LVKA 1NWDA 2MRDA 1B8CA 2CTNA 1QVIZ 1JFJA 1ZOTB 3PLFB 1RFJA 4YGBB 5AEQA 3HCMA 2B1UA 1KSMA 3BUMB 1YTZC 1WRZA 1FF1A 2ZRTA 1HT9A 1H8BA 1F55A 3H4SE 4GGFC 2R2IA 1K9PA 1YR5A 4GGNA 3WXAA 1BR4B 1QATA 4CIDA 1OSAA 4HSZA 1QXPA 3KF9A 3WHUB 3DVJA 3EK7A 3LCPC 3PSRA 2EC6B 3SG4A 1A03A 2KI6D 3I5IC 1W7IB 3KO0A 1H4BA 3LK0A 1KQVA 5HLOA 1E8AA 3PFVA 5CSJA 4BY4A 2L4IA 1YRTB 2JTZA 5I2QA 2PMYA 2LLUA 2BCAA 1RROA 1K93D 2QACA 1C07A 1CNPA 2COLB 2FCEA 3GK2A 2RGIA 1CFPA 1SYMA 1FPWA 2BBMA 2HETA 2BKIB 1SCMC 5D7FA 1X02A 4PE4A 1BOCA 2NXQA 1YX7A 3DVKA 3OX6A 3HX4A 1DJHA 2JZIA 4DUQA 3JTDC 4YRUA 3O2PA 2Y1MA 3BUNB 4PE7A 4CFQA 2LP2A 1OQPA 1PSRA 2LLTA 4MLWA 2EHBA 2Y4QA 1F71A 2AMIA 1KWOB 1CB1A 5KTYA 5DKRA 2KHNA 3TDZA 3BUXB 1IJ5A 2LAPA 2CBLA 2G2BA 1KFXS 1YUSA 1WDCB 3PATA 1UP5A 5CPVA 4ORBB 1EH2A 1RWYA 2PVBA 1XFYO 1QJTA 2E6WA 1J1DA 1UUSA 2KAVA 4I5NB 1KK8C 4XYNA 3KPXA 1PRWA 1SMGA 1IQ5A 4NDBA 2HPSA 3JVTC 5HKWA 3NSOA 1SRAA 3PN7C 2F3ZA 1BT6A 1EXRA 4GBAA 1MQ1A 2JRFA 2JNXA 3EKJA 1ODBA 4QJ3B 1BLQA 4FQOA 4I5LB 2O60A 1CFFA 4HRGA 4L9MA 4QJ5B 1NX3A 1OOJA 1MUXA 4OR9B 1QS7A 4PCWA 1QASA 2L51A 3D0YA 1QIVA 2LVIA 3VRQA 5IBWA 2KBMA 1J55A 3CS1A 4BY5A 4U8DA 2P6BB 4I5JA 1J1EA 2LLSA 2KYFA 3DF0A 3EVRA 1NP8A 1J7QA 3M0WA 5D69A 4OKHA 2Y5IA 3A4UB 4GPLB 3IF7A 3E3RA 1F70A 1CM4A 4XJKA 2I18A 2MAZA 1QX5B 1Y1AA 2KGRA 3BOWA 1A75A 2PALA 4UPGA 2I2RE 1NIWA 2CNPA 2LVVA 3VGOA 1PULA 1J7OA 4YI9A 1QX7A 2BE6A 4CLNA 4DCKA 2L98A 4P5OE 1OE9B 3BXKA 1SY9A 1F54A 2M9GA 2BCBA 1Y1UA 1AHRA 2KSPA 3BUWB 2OTGC 1XO5A 1MXEA 1CDPA 2M7NA 1J7RA 4PE1A 1N2DA 1ALWA 1YVHA 2LC5A 2WCBA 4WRIA 5I8NA 1BJFA 3CWGA 1BODA 1LA0A 2ISDA 1CDLA 2GGZA 1JC2A 2HF5A 1KFXL 1OZOA 1RK9A 4GUKA 1F8HA 3I5HB 2KI4B 1YUUA 1C7WA 1ZUZA 3PALA 4N1FA 1K2HA 4NQGA 2JC2A 1QVIY 1K9KA 1J7PA 2JULA 5PALA 2BKHB 3CLNA 2MBXA 2M49B 4C0KA 2FCDA 3SIAA 1SPYA 1IWQA 1KQMB 1IGVA 3SJSA 1WLZA 3NSLA 3TS5C 3SG7A 1XFVO 1SR6B 1CDNA 1ALVA 4MZJA 1CLMA 1JBAA 4USLA 3EKHA 2I7AA 3IQQA 3LL8B 1QX2A 1S36A 1Y6WA 2F2OA 2LCPA 4A4BA 2ZFDA 1EG4A 2NZ0A 1AJ5A 1B7TZ 1S5GZ 1S6JA 2KI6C 3I5GC 2D8NA 3TUYC 3LK1A 2LV7A 3K21A 1DJZA 2JT0A 4PHJA 2KYCA 2KQYA 1XVJA 2BL0B 2FOTA 1Q80A 3QRXA 4MBEA 1DVIA 2JT8A 2M3WA 1EL4A 1B7TY 1S5GY 2KOTA 4ORCB 3RM1A 4M2QA 4M2PA 2ZNEA 2GV5A 2F8PA 1RTP1 4A4CA 3GK4X 2JPTA 1XFXO 2KFGA 1SCVA 1YVLA 2OS8B 1B8RA 5DKQA 4ZCUA 3OB1B 1XFWO 4N1GA 2DOQA 1U5IA 3WNXB 1XA5A 2LMVA 4MZKA 3SIBA 1TOPA 1FW4A 2BE4A 5I2LA 1S1EA 1W7JB 2Y1NA 3D0YB 2L5XB 1NX1A 1YX8A 3SG2A 2AUCA 3TDUA 2OTGB 1MHOA 1NUBA 1OMRA 2L4HA 2BCXA 1LA3A 4R1EA 1DF0B 1KSOA 2KFFA 2K7CA 1TRFA 2MA2A 5JOLA 5FYXA 3A8RA 1DT7B 1LVCD 1MR8A 4YBHB 2Q91A 1A75B 1BR1B 2JQ6A 1L2OC 3I5FB 2KDHA 1LKJA 2K7BA 4YI8A 1B1GA 1PSBA 3ICBA 5ER5A 4MRXA 4F0ZB 2MHHA 4NDCA 1UHIA 1SNLA 3AAJA 1RECA 4YGCB 1YURA 1S6IA 1XYDA 3ZWHA 5CSIA 2EGDA 1XFUO 1QV1A 4M2OA 5AERA 1AP4A 1SK6D 2ZKMX 2LMUA 4P2YB 3CR2A 1QIWA 2LP3A 1D1OA 1DGUA 2TN4A 3I5IB 1DJYA 5K89A 3AAKA 2BBNA 1PALA 1A2XA 2AAOA 4JQ0D 4DIRA 2VRGA 4OVNF 1VRKA 1GGWA 1S6CA 1UHHA 1UHJA 1NCYA 2WORA 2KAXA 1NSHA 3C1VA 1SL7A 3BYAA 3TUYB 2NLNA 1NCZA 2F33A 2PRUA 1K96A 3OHMB 1AUIB 3EVVA 2FJUB 3GK1A 1SCMB 2F3YA 2PSRA 1IQ3A 4AQJA 1DMOA 1R6PA 3BUOB 3DD4A 4WQ3A 1M39A 1G33A 4DS7A 1QV0A 2M8UA 2M1UA 1KCYA 5KSZA 3JTDB 2LUCA 2G9BA 1ZACA 2KNEA 4Q04A 4JPZB 1TIZA 3LLEA 3OP0A 1B9AA 1UWOA 5KU1A 1JWDA 3FIAA 3NXAA 4N5XA 1OZSA 2PASA 3CR5X 1NCXA 2JOJA 4HRHA 4YGDB 4PDZA 4AQIA 1KK7Z 4CPVA 4FTGA 1M31A 1JF2A 2LE9B 1CFDA 3TZ1A 1IG5A 4ORAB 1CDMA 3DVMA 1KK8B 2NCOA 4MRYA 1KK7Y 3FWCA 1CFCA 2JXLA 4CFRA 1BF5A 3JVTB 1OMVA 2K7OA 4OCIA 3PN7B 1SKTA 1FBVA 1KWOC 3AKBA 1HQVA 1DGVA 1YUTA 2JWWA 3VROA 2WC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5K A;  3KEV A;  1B47 A;  2CT9 A;  2M97 A;  5CSF A;  2SCP A;  3EK4 A;  2ZRS A;  3EVU A;  3ZNI A;  2QPT A;  1A29 A;  1JSA A;  2K2F A;  2M7L A;  4C0L A;  5HYD A;  2H2K A;  1DJW A;  2M1K B;  1G8I A;  1QLK A;  1JF0 A;  5J3X A;  4YGE B;  1CTR A;  5HLV A;  3FWB A;  1QLS A;  3AKA A;  1TN4 A;  1SL8 A;  1ZMZ A;  3FS7 A;  2WCE A;  2LMT A;  3GOF A;  1M46 A;  1MWN A;  1TNW A;  1CMG A;  4QJ4 B;  1GJY A;  5DKN A;  5BPJ A;  2SAS A;  2ZN8 A;  4E68 A;  5I2O A;  1TNP A;  2CCM A;  2K0J A;  4ETO A;  1Y1X A;  1K90 D;  1LXF C;  2CXJ A;  3KHE A;  1AVS A;  2K2A A;  2KGB C;  1NPQ A;  2K7D A;  1KFU S;  4AOM A;  1GGZ A;  3NSK A;  3O78 A;  1K95 A;  1DTL A;  2LVJ A;  1PK0 D;  2MJW B;  2O5G A;  5G08 A;  1XFZ O;  1TCF A;  3VRN A;  1CLB A;  3O6B A;  3DF0 B;  1RJV A;  1DJG A;  1GQM A;  1WRK A;  2A4J A;  4XJK B;  1IH0 A;  2ZN9 A;  3CGA A;  4NDD A;  1CMF A;  1QTX A;  1ZFS A;  3BOW B;  2KBI A;  1NYA A;  1F4O A;  5CSN A;  2K8M B;  2H61 A;  5AAN A;  1AK8 A;  4PHM A;  1OMD A;  1B4C A;  1B8L A;  1IKU A;  2JNF A;  3F45 A;  1PVA A;  1NX0 A;  1PVB A;  1YRU B;  3TS5 B;  1UHK A;  4PE0 A;  3VRP A;  2L0P A;  2JXC A;  1JFK A;  1TTX A;  3CZT X;  2MLF C;  1R2U A;  2GGM A;  2JT3 A;  2IS9 A;  1G4Y R;  4MZL A;  1SW8 A;  2M0R A;  5AFP A;  5ER4 X;  1M45 A;  1NX2 A;  1TNX A;  2KI4 C;  1LIN A;  3I5G B;  3I5H C;  1IRJ A;  1DJX A;  3IQO A;  4GAO A;  3SG6 A;  5HKZ A;  2WOS A;  1IJ6 A;  2H61 C;  4PHK A;  1CM1 A;  3PM8 A;  1BU3 A;  3D10 A;  1K8U A;  2Q4U A;  1C7V A;  1KQM C;  2WCF A;  5GQQ C;  2E30 A;  4IL1 A;  3NSI A;  1S3P A;  1SR6 C;  2EC6 C;  2M29 A;  1JUO A;  1BG1 A;  2ZND A;  1CKK A;  2V53 A;  1V1F A;  4GFT A;  5B8I B;  3EK8 A;  3OB2 B;  1WY9 A;  3CTN A;  4MSP A;  1XK4 A;  1MF8 B;  1TCO B;  3RLZ A;  1DJI A;  1N0Y A;  2L50 A;  2LM5 A;  2JU0 A;  1WLM A;  3MSE B;  3WHT B;  5HKY A;  2OPO A;  3DVE A;  1KFU L;  2LUX A;  2LHI A;  1V1G A;  1DF0 A;  2BL0 C;  5AXI A;  3CR4 X;  4DRW A;  2LNK A;  2LHL A;  1FI5 A;  4C0J A;  1S26 D;  2KQ6 A;  2LAN A;  1UHN A;  2KAY A;  4MN0 A;  4ZCV A;  1CLL A;  4MVF A;  1N65 A;  4MEW A;  1FI6 A;  1K9U A;  2HQ8 A;  1UUR A;  2KFH A;  1A4P A;  2HQW A;  2OS8 C;  4YGA A;  1L7Z A;  1M63 B;  1L2O B;  2WND A;  1TNQ A;  3BQ3 A;  3SG5 A;  3VRR A;  4WQ2 A;  4JWQ A;  4GGF A;  1XK4 C;  3SG3 A;  1U5I B;  3O4Y A;  4GNK B;  4HRE E;  5F6T A;  4OV2 A;  2K61 A;  4TNC A;  5JJG A;  1AJ4 A;  1F4Q A;  1K94 A;  3TDI A;  1EG3 A;  1SBJ A;  2BEC A;  2L2E A;  2JTT A;  4PHN A;  1BMO A;  1EJ3 A;  4ICB A;  2I94 A;  2NCP A;  3OX5 A;  1WRL A;  1Y0V H;  2F2P A;  2MLE C;  4PAL A;  1WDC C;  1MXL C;  4D1E A;  3I5F C;  1SL9 A;  5TNC A;  2LVK A;  1NWD A;  2MRD A;  1B8C A;  2CTN A;  1QVI Z;  1JFJ A;  1ZOT B;  3PLF B;  1RFJ A;  4YGB B;  5AEQ A;  3HCM A;  2B1U A;  1KSM A;  3BUM B;  1YTZ C;  1WRZ A;  1FF1 A;  2ZRT A;  1HT9 A;  1H8B A;  1F55 A;  3H4S E;  4GGF C;  2R2I A;  1K9P A;  1YR5 A;  4GGN A;  3WXA A;  1BR4 B;  1QAT A;  4CID A;  1OSA A;  4HSZ A;  1QXP A;  3KF9 A;  3WHU B;  3DVJ A;  3EK7 A;  3LCP C;  3PSR A;  2EC6 B;  3SG4 A;  1A03 A;  2KI6 D;  3I5I C;  1W7I B;  3KO0 A;  1H4B A;  3LK0 A;  1KQV A;  5HLO A;  1E8A A;  3PFV A;  5CSJ A;  4BY4 A;  2L4I A;  1YRT B;  2JTZ A;  5I2Q A;  2PMY A;  2LLU A;  2BCA A;  1RRO A;  1K93 D;  2QAC A;  1C07 A;  1CNP A;  2COL B;  2FCE A;  3GK2 A;  2RGI A;  1CFP A;  1SYM A;  1FPW A;  2BBM A;  2HET A;  2BKI B;  1SCM C;  5D7F A;  1X02 A;  4PE4 A;  1BOC A;  2NXQ A;  1YX7 A;  3DVK A;  3OX6 A;  3HX4 A;  1DJH A;  2JZI A;  4DUQ A;  3JTD C;  4YRU A;  3O2P A;  2Y1M A;  3BUN B;  4PE7 A;  4CFQ A;  2LP2 A;  1OQP A;  1PSR A;  2LLT A;  4MLW A;  2EHB A;  2Y4Q A;  1F71 A;  2AMI A;  1KWO B;  1CB1 A;  5KTY A;  5DKR A;  2KHN A;  3TDZ A;  3BUX B;  1IJ5 A;  2LAP A;  2CBL A;  2G2B A;  1KFX S;  1YUS A;  1WDC B;  3PAT A;  1UP5 A;  5CPV A;  4ORB B;  1EH2 A;  1RWY A;  2PVB A;  1XFY O;  1QJT A;  2E6W A;  1J1D A;  1UUS A;  2KAV A;  4I5N B;  1KK8 C;  4XYN A;  3KPX A;  1PRW A;  1SMG A;  1IQ5 A;  4NDB A;  2HPS A;  3JVT C;  5HKW A;  3NSO A;  1SRA A;  3PN7 C;  2F3Z A;  1BT6 A;  1EXR A;  4GBA A;  1MQ1 A;  2JRF A;  2JNX A;  3EKJ A;  1ODB A;  4QJ3 B;  1BLQ A;  4FQO A;  4I5L B;  2O60 A;  1CFF A;  4HRG A;  4L9M A;  4QJ5 B;  1NX3 A;  1OOJ A;  1MUX A;  4OR9 B;  1QS7 A;  4PCW A;  1QAS A;  2L51 A;  3D0Y A;  1QIV A;  2LVI A;  3VRQ A;  5IBW A;  2KBM A;  1J55 A;  3CS1 A;  4BY5 A;  4U8D A;  2P6B B;  4I5J A;  1J1E A;  2LLS A;  2KYF A;  3DF0 A;  3EVR A;  1NP8 A;  1J7Q A;  3M0W A;  5D69 A;  4OKH A;  2Y5I A;  3A4U B;  4GPL B;  3IF7 A;  3E3R A;  1F70 A;  1CM4 A;  4XJK A;  2I18 A;  2MAZ A;  1QX5 B;  1Y1A A;  2KGR A;  3BOW A;  1A75 A;  2PAL A;  4UPG A;  2I2R E;  1NIW A;  2CNP A;  2LVV A;  3VGO A;  1PUL A;  1J7O A;  4YI9 A;  1QX7 A;  2BE6 A;  4CLN A;  4DCK A;  2L98 A;  4P5O E;  1OE9 B;  3BXK A;  1SY9 A;  1F54 A;  2M9G A;  2BCB A;  1Y1U A;  1AHR A;  2KSP A;  3BUW B;  2OTG C;  1XO5 A;  1MXE A;  1CDP A;  2M7N A;  1J7R A;  4PE1 A;  1N2D A;  1ALW A;  1YVH A;  2LC5 A;  2WCB A;  4WRI A;  5I8N A;  1BJF A;  3CWG A;  1BOD A;  1LA0 A;  2ISD A;  1CDL A;  2GGZ A;  1JC2 A;  2HF5 A;  1KFX L;  1OZO A;  1RK9 A;  4GUK A;  1F8H A;  3I5H B;  2KI4 B;  1YUU A;  1C7W A;  1ZUZ A;  3PAL A;  4N1F A;  1K2H A;  4NQG A;  2JC2 A;  1QVI Y;  1K9K A;  1J7P A;  2JUL A;  5PAL A;  2BKH B;  3CLN A;  2MBX A;  2M49 B;  4C0K A;  2FCD A;  3SIA A;  1SPY A;  1IWQ A;  1KQM B;  1IGV A;  3SJS A;  1WLZ A;  3NSL A;  3TS5 C;  3SG7 A;  1XFV O;  1SR6 B;  1CDN A;  1ALV A;  4MZJ A;  1CLM A;  1JBA A;  4USL A;  3EKH A;  2I7A A;  3IQQ A;  3LL8 B;  1QX2 A;  1S36 A;  1Y6W A;  2F2O A;  2LCP A;  4A4B A;  2ZFD A;  1EG4 A;  2NZ0 A;  1AJ5 A;  1B7T Z;  1S5G Z;  1S6J A;  2KI6 C;  3I5G C;  2D8N A;  3TUY C;  3LK1 A;  2LV7 A;  3K21 A;  1DJZ A;  2JT0 A;  4PHJ A;  2KYC A;  2KQY A;  1XVJ A;  2BL0 B;  2FOT A;  1Q80 A;  3QRX A;  4MBE A;  1DVI A;  2JT8 A;  2M3W A;  1EL4 A;  1B7T Y;  1S5G Y;  2KOT A;  4ORC B;  3RM1 A;  4M2Q A;  4M2P A;  2ZNE A;  2GV5 A;  2F8P A;  1RTP 1;  4A4C A;  3GK4 X;  2JPT A;  1XFX O;  2KFG A;  1SCV A;  1YVL A;  2OS8 B;  1B8R A;  5DKQ A;  4ZCU A;  3OB1 B;  1XFW O;  4N1G A;  2DOQ A;  1U5I A;  3WNX B;  1XA5 A;  2LMV A;  4MZK A;  3SIB A;  1TOP A;  1FW4 A;  2BE4 A;  5I2L A;  1S1E A;  1W7J B;  2Y1N A;  3D0Y B;  2L5X B;  1NX1 A;  1YX8 A;  3SG2 A;  2AUC A;  3TDU A;  2OTG B;  1MHO A;  1NUB A;  1OMR A;  2L4H A;  2BCX A;  1LA3 A;  4R1E A;  1DF0 B;  1KSO A;  2KFF A;  2K7C A;  1TRF A;  2MA2 A;  5JOL A;  5FYX A;  3A8R A;  1DT7 B;  1LVC D;  1MR8 A;  4YBH B;  2Q91 A;  1A75 B;  1BR1 B;  2JQ6 A;  1L2O C;  3I5F B;  2KDH A;  1LKJ A;  2K7B A;  4YI8 A;  1B1G A;  1PSB A;  3ICB A;  5ER5 A;  4MRX A;  4F0Z B;  2MHH A;  4NDC A;  1UHI A;  1SNL A;  3AAJ A;  1REC A;  4YGC B;  1YUR A;  1S6I A;  1XYD A;  3ZWH A;  5CSI A;  2EGD A;  1XFU O;  1QV1 A;  4M2O A;  5AER A;  1AP4 A;  1SK6 D;  2ZKM X;  2LMU A;  4P2Y B;  3CR2 A;  1QIW A;  2LP3 A;  1D1O A;  1DGU A;  2TN4 A;  3I5I B;  1DJY A;  5K89 A;  3AAK A;  2BBN A;  1PAL A;  1A2X A;  2AAO A;  4JQ0 D;  4DIR A;  2VRG A;  4OVN F;  1VRK A;  1GGW A;  1S6C A;  1UHH A;  1UHJ A;  1NCY A;  2WOR A;  2KAX A;  1NSH A;  3C1V A;  1SL7 A;  3BYA A;  3TUY B;  2NLN A;  1NCZ A;  2F33 A;  2PRU A;  1K96 A;  3OHM B;  1AUI B;  3EVV A;  2FJU B;  3GK1 A;  1SCM B;  2F3Y A;  2PSR A;  1IQ3 A;  4AQJ A;  1DMO A;  1R6P A;  3BUO B;  3DD4 A;  4WQ3 A;  1M39 A;  1G33 A;  4DS7 A;  1QV0 A;  2M8U A;  2M1U A;  1KCY A;  5KSZ A;  3JTD B;  2LUC A;  2G9B A;  1ZAC A;  2KNE A;  4Q04 A;  4JPZ B;  1TIZ A;  3LLE A;  3OP0 A;  1B9A A;  1UWO A;  5KU1 A;  1JWD A;  3FIA A;  3NXA A;  4N5X A;  1OZS A;  2PAS A;  3CR5 X;  1NCX A;  2JOJ A;  4HRH A;  4YGD B;  4PDZ A;  4AQI A;  1KK7 Z;  4CPV A;  4FTG A;  1M31 A;  1JF2 A;  2LE9 B;  1CFD A;  3TZ1 A;  1IG5 A;  4ORA B;  1CDM A;  3DVM A;  1KK8 B;  2NCO A;  4MRY A;  1KK7 Y;  3FWC A;  1CFC A;  2JXL A;  4CFR A;  1BF5 A;  3JVT B;  1OMV A;  2K7O A;  4OCI A;  3PN7 B;  1SKT A;  1FBV A;  1KWO C;  3AKB A;  1HQV A;  1DGV A;  1YUT A;  2JWW A;  3VRO A;  2WC8 A; 
#chains in the Genus database with same CATH topology
 4I5K A;  3KEV A;  1OOG A;  1B47 A;  2CT9 A;  2M97 A;  5CSF A;  2SCP A;  3EK4 A;  1SSE B;  2ZRS A;  3EVU A;  3ZNI A;  2QPT A;  1A29 A;  1JSA A;  2K2F A;  2M7L A;  4C0L A;  5HYD A;  2H2K A;  1DJW A;  2M1K B;  1G8I A;  1QLK A;  1JF0 A;  5J3X A;  4YGE B;  1CTR A;  5HLV A;  3FWB A;  1QLS A;  3AKA A;  1TN4 A;  3Q8I A;  1SL8 A;  1ZMZ A;  3FS7 A;  2WCE A;  2LMT A;  3SS4 A;  3GOF A;  1M46 A;  1MWN A;  1TNW A;  1CMG A;  4QJ4 B;  1GJY A;  5DKN A;  5BPJ A;  2SAS A;  2ZN8 A;  4E68 A;  5I2O A;  1TNP A;  2CCM A;  2K0J A;  4ETO A;  1Y1X A;  1K90 D;  1LXF C;  2CXJ A;  3KHE A;  2WCH A;  1AVS A;  2K2A A;  1C3Z A;  2KGB C;  1NPQ A;  2K7D A;  3B88 A;  1KFU S;  4AOM A;  1GGZ A;  3NSK A;  3O78 A;  1K95 A;  5EL2 A;  1DTL A;  2LVJ A;  2QEB A;  3RZS A;  1PK0 D;  2MJW B;  1XFR A;  2O5G A;  5G08 A;  1XFZ O;  3B87 A;  1TCF A;  3VRN A;  1CLB A;  3O6B A;  3DF0 B;  4OZD A;  1RJV A;  1DJG A;  1GQM A;  1WRK A;  2A4J A;  4XJK B;  1IH0 A;  2ZN9 A;  3CGA A;  1OOF A;  4NDD A;  1CMF A;  1QTX A;  1ZFS A;  2P70 A;  3BOW B;  3S0F A;  2KBI A;  1Z4H A;  1NYA A;  1F4O A;  1GM0 A;  5CSN A;  2K8M B;  2H61 A;  5AAN A;  1AK8 A;  4PHM A;  1OMD A;  1B4C A;  1B8L A;  1IKU A;  2JNF A;  3F45 A;  1DEL A;  1PVA A;  5D3O A;  1NX0 A;  1PVB A;  1DC1 A;  3EG5 B;  1YRU B;  3TS5 B;  1UHK A;  4PE0 A;  3VRP A;  2GTE A;  2L0P A;  2JXC A;  1JFK A;  1TTX A;  4F7F A;  3O4X A;  3CZT X;  2MLF C;  2JPO A;  1R2U A;  2GGM A;  2JT3 A;  2IS9 A;  1G4Y R;  4MZL A;  1T14 A;  1SW8 A;  2M0R A;  5AFP A;  5ER4 X;  3DYE A;  1M45 A;  1NX2 A;  1TNX A;  2KI4 C;  1LIN A;  3I5G B;  3I5H C;  3S0G A;  1IRJ A;  1DJX A;  3IQO A;  4GAO A;  3SG6 A;  5HKZ A;  2WOS A;  1IJ6 A;  2H61 C;  4PHK A;  3L4L A;  1CM1 A;  3PM8 A;  1BU3 A;  3CZ1 A;  3D10 A;  4PT1 A;  1K8U A;  2Q4U A;  1C7V A;  3S0A A;  1KQM C;  2WCF A;  5GQQ C;  2E30 A;  4IL1 A;  3NSI A;  1S3P A;  1SR6 C;  2EC6 C;  2M29 A;  1JUO A;  1BG1 A;  2ZND A;  1CKK A;  2V53 A;  1V1F A;  4GFT A;  4FQT A;  5B8I B;  3EK8 A;  3OB2 B;  1WY9 A;  3CTN A;  4IJ7 A;  3D77 A;  4MSP A;  1XK4 A;  1MF8 B;  1TCO B;  3RLZ A;  1DJI A;  1N0Y A;  2L50 A;  2LM5 A;  2JU0 A;  1WLM A;  3MSE B;  1TWO A;  3WHT B;  3CZ2 A;  5HKY A;  2OPO A;  3DVE A;  1KFU L;  2LUX A;  2LHI A;  1V1G A;  1DF0 A;  2BL0 C;  3D74 A;  3CR4 X;  5AXI A;  4DRW A;  2LNK A;  2LHL A;  1FI5 A;  4C0J A;  1S26 D;  2KQ6 A;  2LAN A;  1UHN A;  2KAY A;  4MN0 A;  4ZCV A;  1CLL A;  4MVF A;  3CYZ A;  2QDI A;  1N65 A;  3L47 A;  4MEW A;  1FI6 A;  1K9U A;  2PQL A;  2HQ8 A;  1UUR A;  2KFH A;  1A4P A;  2HQW A;  2OS8 C;  4YGA A;  1L7Z A;  1M63 B;  1L2O B;  2WND A;  1TNQ A;  3BQ3 A;  3SG5 A;  3NGV A;  5DIC A;  3VRR A;  4WQ2 A;  3PJI A;  4JWQ A;  2K60 A;  4GGF A;  1XK4 C;  3SG3 A;  1U5I B;  3O4Y A;  4GNK B;  4HRE E;  5F6T A;  3N7H A;  4OV2 A;  2K61 A;  4TNC A;  1C3Y A;  3BFH A;  5JJG A;  1AJ4 A;  1F4Q A;  1K94 A;  4JKT A;  3TDI A;  1EG3 A;  1SBJ A;  2BEC A;  2L2E A;  2JTT A;  4PHN A;  1BMO A;  1EJ3 A;  4ICB A;  2I94 A;  2P71 A;  2NCP A;  3OX5 A;  1WRL A;  1Y0V H;  2F2P A;  2MLE C;  4PAL A;  1WDC C;  1MXL C;  3BJH A;  4D1E A;  3L4A A;  3I5F C;  1SL9 A;  5FI7 A;  2LVK A;  1NWD A;  2MRD A;  5TNC A;  1B8C A;  2CTN A;  1QVI Z;  1JFJ A;  1ZOT B;  3PLF B;  1RFJ A;  4YGB B;  5AEQ A;  3HCM A;  2B1U A;  1KSM A;  3BUM B;  1YTZ C;  1WRZ A;  1FF1 A;  2ZRT A;  1HT9 A;  1H8B A;  1F55 A;  3H4S E;  4GGF C;  2QEH A;  2R2I A;  1K9P A;  1YR5 A;  4GGN A;  3WXA A;  1BR4 B;  1QAT A;  4CID A;  1OSA A;  4HSZ A;  1QXP A;  3KF9 A;  3WHU B;  3DVJ A;  3EK7 A;  3LCP C;  3PSR A;  3S0B A;  2EC6 B;  3SG4 A;  1A03 A;  2KI6 D;  3I5I C;  1W7I B;  3KO0 A;  1OW4 A;  1H4B A;  3LK0 A;  1KQV A;  5HLO A;  1E8A A;  3NHT A;  3PFV A;  5CSJ A;  4BY4 A;  2L4I A;  1YRT B;  2JTZ A;  5I2Q A;  2PMY A;  2LLU A;  2BCA A;  1RRO A;  1K93 D;  2QAC A;  1C07 A;  1CNP A;  2COL B;  2FCE A;  3GK2 A;  2RGI A;  2H8V A;  1SYM A;  1CFP A;  1FPW A;  2BBM A;  2HET A;  1P28 A;  2BKI B;  1SCM C;  5D7F A;  1X02 A;  3CAB A;  4PE4 A;  1BOC A;  2NXQ A;  1YX7 A;  3DVK A;  3OX6 A;  3HX4 A;  1DJH A;  2JZI A;  2BNX A;  4DUQ A;  3JTD C;  4JD9 A;  4YRU A;  3O2P A;  2Y1M A;  2BAP A;  3BUN B;  4PE7 A;  4CFQ A;  2LP2 A;  1OQP A;  1PSR A;  2LLT A;  4MLW A;  2EHB A;  2Y4Q A;  1F71 A;  1ORG A;  2AMI A;  1KWO B;  1CB1 A;  5KTY A;  5DKR A;  2KHN A;  3S0D A;  3SS3 A;  3TDZ A;  3BUX B;  1IJ5 A;  2KPH A;  2LAP A;  2CBL A;  2G2B A;  1KFX S;  1YUS A;  1WDC B;  3PAT A;  1UP5 A;  5CPV A;  4ORB B;  1EH2 A;  1RWY A;  2PVB A;  1XFY O;  1QJT A;  2E6W A;  1J1D A;  1UUS A;  2KAV A;  4I5N B;  1KK8 C;  4XYN A;  3D76 A;  3KPX A;  1PRW A;  1SMG A;  1IQ5 A;  4NDB A;  2HPS A;  3JVT C;  5HKW A;  3NSO A;  1SRA A;  1W9Z A;  2QEO A;  3PN7 C;  2F3Z A;  1BT6 A;  1EXR A;  4GBA A;  1MQ1 A;  2JRF A;  3VB1 A;  2JNX A;  3EKJ A;  1ODB A;  4QJ3 B;  1BLQ A;  4FQO A;  1TUJ A;  3IVT A;  4I5L B;  2O60 A;  5JOL A;  1CFF A;  4HRG A;  4L9M A;  3B6X A;  1NX3 A;  4QJ5 B;  1OOJ A;  3B86 A;  1MUX A;  1DEK A;  2ERB A;  4OR9 B;  1QS7 A;  4PCW A;  1QAS A;  2L51 A;  3D0Y A;  1QIV A;  3DXL A;  2LVI A;  3VRQ A;  5IBW A;  1LS8 A;  2KBM A;  1J55 A;  3CS1 A;  4BY5 A;  4U8D A;  2P6B B;  4I5J A;  1Z2C B;  1J1E A;  3K1E A;  2LLS A;  2KYF A;  3DF0 A;  3EVR A;  1NP8 A;  1J7Q A;  3M0W A;  5D69 A;  4OKH A;  2Y5I A;  3A4U B;  4GPL B;  3IF7 A;  3UO9 A;  3E3R A;  1F70 A;  1CM4 A;  4XJK A;  2I18 A;  2MAZ A;  1QX5 B;  1Y1A A;  2KGR A;  3BOW A;  1A75 A;  2PAL A;  4UPG A;  2KLD A;  2I2R E;  1NIW A;  2CNP A;  2LVV A;  3VGO A;  1PUL A;  1J7O A;  4YI9 A;  1QX7 A;  3D78 A;  2BE6 A;  4CLN A;  4DCK A;  2L98 A;  4P5O E;  1OE9 B;  3BXK A;  3DZT A;  1SY9 A;  1F54 A;  2M9G A;  2BCB A;  1Y1U A;  4INW A;  5I94 A;  1AHR A;  2KSP A;  3BUW B;  1OOH A;  2OTG C;  1XO5 A;  1MXE A;  5FI6 A;  1CDP A;  2M7N A;  1J7R A;  2WCL A;  1N2D A;  4PE1 A;  1ALW A;  1YVH A;  2LC5 A;  2WCB A;  4WRI A;  5I8N A;  1BJF A;  3CWG A;  1BOD A;  1LA0 A;  2ISD A;  1CDL A;  2GGZ A;  1JC2 A;  2HF5 A;  1KFX L;  1OZO A;  1RK9 A;  4GUK A;  1F8H A;  3I5H B;  2KI4 B;  5HL1 A;  1YUU A;  1C7W A;  1ZUZ A;  2WCM A;  3PAL A;  3R72 A;  4N1F A;  4NQG A;  1K2H A;  2JC2 A;  1QVI Y;  1K9K A;  1J7P A;  2JUL A;  5PAL A;  2BKH B;  3CLN A;  2MBX A;  2M49 B;  4C0K A;  2FCD A;  3SIA A;  1SPY A;  1IWQ A;  1KQM B;  1IGV A;  3SJS A;  1WLZ A;  3NSL A;  3TS5 C;  3SG7 A;  1XFV O;  1SR6 B;  3FE8 A;  1CDN A;  1ALV A;  4MZJ A;  1CLM A;  3S0E A;  2PYQ A;  1JBA A;  2WC5 A;  4USL A;  2YGU A;  3EKH A;  2I7A A;  3IQQ A;  3LL8 B;  1QX2 A;  1S36 A;  1Y6W A;  2F2O A;  2LCP A;  4A4B A;  2ZFD A;  1EG4 A;  2NZ0 A;  1AJ5 A;  1B7T Z;  1S5G Z;  1S6J A;  2KI6 C;  3I5G C;  2D8N A;  3R1O A;  3LK1 A;  2LV7 A;  3K21 A;  3TUY C;  1DJZ A;  2JT0 A;  4PHJ A;  2KYC A;  2KQY A;  1XVJ A;  2BL0 B;  2FOT A;  1Q80 A;  3QRX A;  4MBE A;  1DVI A;  2JT8 A;  2M3W A;  1EL4 A;  1B7T Y;  1S5G Y;  2KOT A;  4ORC B;  3RM1 A;  1QWV A;  4M2Q A;  4M2P A;  2ZNE A;  2GV5 A;  2L2C A;  2F8P A;  1RTP 1;  4A4C A;  1IIO A;  3GK4 X;  2JPT A;  1XFX O;  3PM2 A;  2KFG A;  1SCV A;  1YVL A;  2OS8 B;  1B8R A;  5DKQ A;  3B7A A;  4ZCU A;  3OB1 B;  1XFW O;  4N1G A;  2DOQ A;  1U5I A;  3CZ0 A;  3QME A;  3V2L A;  3WNX B;  1XA5 A;  2LMV A;  4MZK A;  3SIB A;  1TOP A;  1FW4 A;  2BE4 A;  5I2L A;  1S1E A;  3BFB A;  1W7J B;  2QEV A;  2WCK A;  2Y1N A;  2L5X B;  1NX1 A;  1YX8 A;  3D0Y B;  3D75 A;  3SG2 A;  2AUC A;  3TDU A;  2OTG B;  1MHO A;  1NUB A;  1OMR A;  2L4H A;  2BCX A;  1LA3 A;  4R1E A;  1DF0 B;  1KSO A;  2KFF A;  2K7C A;  1TRF A;  2MA2 A;  3FE9 A;  5FYX A;  2KLE A;  3A8R A;  1DT7 B;  1LVC D;  1MR8 A;  4YBH B;  2Q91 A;  1A75 B;  1BR1 B;  2JQ6 A;  1L2O C;  3I5F B;  2KDH A;  1LKJ A;  2K7B A;  4YI8 A;  1B1G A;  1PSB A;  3ICB A;  5ER5 A;  4MRX A;  4F0Z B;  3OGN A;  2MHH A;  4NDC A;  1UHI A;  1SNL A;  3AAJ A;  1DQE A;  1REC A;  4YGC B;  1YUR A;  1S6I A;  1XYD A;  3ZWH A;  5CSI A;  2EGD A;  1XFU O;  1QV1 A;  4M2O A;  5AER A;  1AP4 A;  1SK6 D;  2ZKM X;  2LMU A;  2FJY A;  4P2Y B;  3CR2 A;  1QIW A;  2LP3 A;  1D1O A;  1DGU A;  2TN4 A;  3I5I B;  3R1V A;  1DJY A;  3SS5 A;  5K89 A;  3AAK A;  1PAL A;  2AAO A;  1A2X A;  2BBN A;  4JQ0 D;  4DIR A;  2VRG A;  4OVN F;  1VRK A;  3OBV A;  1GGW A;  1S6C A;  1UHH A;  1UHJ A;  1NCY A;  2WOR A;  2KAX A;  1NSH A;  3C1V A;  1SL7 A;  1TUZ A;  3BYA A;  3TUY B;  5FI2 A;  2NLN A;  1NCZ A;  2F33 A;  2PRU A;  1K96 A;  3OHM B;  1AUI B;  1OOI X;  3EVV A;  2FJU B;  3GK1 A;  1SCM B;  2F3Y A;  2PSR A;  1IQ3 A;  4AQJ A;  3NHI A;  1DMO A;  1R6P A;  3BUO B;  3FE6 A;  3DD4 A;  4WQ3 A;  1M39 A;  1G33 A;  4DS7 A;  1QV0 A;  2M8U A;  2M1U A;  1KCY A;  5KSZ A;  3JTD B;  4KYN A;  2LUC A;  2G9B A;  1ZAC A;  2KNE A;  4INX A;  4Q04 A;  4JPZ B;  1TIZ A;  3LLE A;  3OP0 A;  1B9A A;  3D73 A;  1UWO A;  2WC6 A;  5KU1 A;  1JWD A;  3DY9 A;  3FIA A;  3NXA A;  2WCJ A;  4N5X A;  1OZS A;  2PAS A;  3CR5 X;  1NCX A;  2JOJ A;  4HRH A;  3BFA A;  4YGD B;  3R1P A;  4PDZ A;  4AQI A;  1KK7 Z;  4CPV A;  4FTG A;  1M31 A;  1JF2 A;  2LE9 B;  1CFD A;  2L5Y A;  3TZ1 A;  1IG5 A;  4ORA B;  1CDM A;  3DVM A;  3UNW A;  1KK8 B;  2NCO A;  4MRY A;  1KK7 Y;  3FWC A;  1CFC A;  2JXL A;  4CFR A;  1BF5 A;  3JVT B;  1OMV A;  2K7O A;  4OCI A;  3PN7 B;  1SKT A;  3CDN A;  1FBV A;  1KWO C;  3AKB A;  1HQV A;  1DGV A;  1YUT A;  2JWW A;  3VRO A;  2WC8 A; 
#chains in the Genus database with same CATH homology
 4I5K A;  3KEV A;  1B47 A;  2CT9 A;  2M97 A;  5CSF A;  2SCP A;  3EK4 A;  2ZRS A;  3EVU A;  3ZNI A;  2QPT A;  1A29 A;  1JSA A;  2K2F A;  2M7L A;  4C0L A;  5HYD A;  2H2K A;  1DJW A;  2M1K B;  1G8I A;  1QLK A;  1JF0 A;  5J3X A;  4YGE B;  1CTR A;  5HLV A;  3FWB A;  1QLS A;  3AKA A;  1TN4 A;  1SL8 A;  1ZMZ A;  3FS7 A;  2WCE A;  2LMT A;  3GOF A;  1M46 A;  1MWN A;  1TNW A;  1CMG A;  4QJ4 B;  1GJY A;  5DKN A;  5BPJ A;  2SAS A;  2ZN8 A;  4E68 A;  5I2O A;  1TNP A;  2CCM A;  2K0J A;  4ETO A;  1Y1X A;  1K90 D;  1LXF C;  2CXJ A;  3KHE A;  1AVS A;  2K2A A;  2KGB C;  1NPQ A;  2K7D A;  1KFU S;  4AOM A;  1GGZ A;  3NSK A;  3O78 A;  1K95 A;  1DTL A;  2LVJ A;  1PK0 D;  2MJW B;  2O5G A;  5G08 A;  1XFZ O;  1TCF A;  3VRN A;  1CLB A;  3O6B A;  3DF0 B;  1RJV A;  1DJG A;  1GQM A;  1WRK A;  2A4J A;  4XJK B;  1IH0 A;  2ZN9 A;  3CGA A;  4NDD A;  1CMF A;  1QTX A;  1ZFS A;  3BOW B;  2KBI A;  1NYA A;  1F4O A;  5CSN A;  2K8M B;  2H61 A;  5AAN A;  1AK8 A;  4PHM A;  1OMD A;  1B4C A;  1B8L A;  1IKU A;  2JNF A;  3F45 A;  1PVA A;  1NX0 A;  1PVB A;  1YRU B;  3TS5 B;  1UHK A;  4PE0 A;  3VRP A;  2L0P A;  2JXC A;  1JFK A;  1TTX A;  3CZT X;  2MLF C;  1R2U A;  2GGM A;  2JT3 A;  2IS9 A;  1G4Y R;  4MZL A;  1SW8 A;  2M0R A;  5AFP A;  5ER4 X;  1M45 A;  1NX2 A;  1TNX A;  2KI4 C;  1LIN A;  3I5G B;  3I5H C;  1IRJ A;  1DJX A;  3IQO A;  4GAO A;  3SG6 A;  5HKZ A;  2WOS A;  1IJ6 A;  2H61 C;  4PHK A;  1CM1 A;  3PM8 A;  1BU3 A;  3D10 A;  1K8U A;  2Q4U A;  1C7V A;  1KQM C;  2WCF A;  5GQQ C;  2E30 A;  4IL1 A;  3NSI A;  1S3P A;  1SR6 C;  2EC6 C;  2M29 A;  1JUO A;  1BG1 A;  2ZND A;  1CKK A;  2V53 A;  1V1F A;  4GFT A;  5B8I B;  3EK8 A;  3OB2 B;  1WY9 A;  3CTN A;  4MSP A;  1XK4 A;  1MF8 B;  1TCO B;  3RLZ A;  1DJI A;  1N0Y A;  2L50 A;  2LM5 A;  2JU0 A;  1WLM A;  3MSE B;  3WHT B;  5HKY A;  2OPO A;  3DVE A;  1KFU L;  2LUX A;  2LHI A;  1V1G A;  1DF0 A;  2BL0 C;  5AXI A;  3CR4 X;  4DRW A;  2LNK A;  2LHL A;  1FI5 A;  4C0J A;  1S26 D;  2KQ6 A;  2LAN A;  1UHN A;  2KAY A;  4MN0 A;  4ZCV A;  1CLL A;  4MVF A;  1N65 A;  4MEW A;  1FI6 A;  1K9U A;  2HQ8 A;  1UUR A;  2KFH A;  1A4P A;  2HQW A;  2OS8 C;  4YGA A;  1L7Z A;  1M63 B;  1L2O B;  2WND A;  1TNQ A;  3BQ3 A;  3SG5 A;  3VRR A;  4WQ2 A;  4JWQ A;  4GGF A;  1XK4 C;  3SG3 A;  1U5I B;  3O4Y A;  4GNK B;  4HRE E;  5F6T A;  4OV2 A;  2K61 A;  4TNC A;  5JJG A;  1AJ4 A;  1F4Q A;  1K94 A;  3TDI A;  1EG3 A;  1SBJ A;  2BEC A;  2L2E A;  2JTT A;  4PHN A;  1BMO A;  1EJ3 A;  4ICB A;  2I94 A;  2NCP A;  3OX5 A;  1WRL A;  1Y0V H;  2F2P A;  2MLE C;  4PAL A;  1WDC C;  1MXL C;  4D1E A;  3I5F C;  1SL9 A;  5TNC A;  2LVK A;  1NWD A;  2MRD A;  1B8C A;  2CTN A;  1QVI Z;  1JFJ A;  1ZOT B;  3PLF B;  1RFJ A;  4YGB B;  5AEQ A;  3HCM A;  2B1U A;  1KSM A;  3BUM B;  1YTZ C;  1WRZ A;  1FF1 A;  2ZRT A;  1HT9 A;  1H8B A;  1F55 A;  3H4S E;  4GGF C;  2R2I A;  1K9P A;  1YR5 A;  4GGN A;  3WXA A;  1BR4 B;  1QAT A;  4CID A;  1OSA A;  4HSZ A;  1QXP A;  3KF9 A;  3WHU B;  3DVJ A;  3EK7 A;  3LCP C;  3PSR A;  2EC6 B;  3SG4 A;  1A03 A;  2KI6 D;  3I5I C;  1W7I B;  3KO0 A;  1H4B A;  3LK0 A;  1KQV A;  5HLO A;  1E8A A;  3PFV A;  5CSJ A;  4BY4 A;  2L4I A;  1YRT B;  2JTZ A;  5I2Q A;  2PMY A;  2LLU A;  2BCA A;  1RRO A;  1K93 D;  2QAC A;  1C07 A;  1CNP A;  2COL B;  2FCE A;  3GK2 A;  2RGI A;  1CFP A;  1SYM A;  1FPW A;  2BBM A;  2HET A;  2BKI B;  1SCM C;  5D7F A;  1X02 A;  4PE4 A;  1BOC A;  2NXQ A;  1YX7 A;  3DVK A;  3OX6 A;  3HX4 A;  1DJH A;  2JZI A;  4DUQ A;  3JTD C;  4YRU A;  3O2P A;  2Y1M A;  3BUN B;  4PE7 A;  4CFQ A;  2LP2 A;  1OQP A;  1PSR A;  2LLT A;  4MLW A;  2EHB A;  2Y4Q A;  1F71 A;  2AMI A;  1KWO B;  1CB1 A;  5KTY A;  5DKR A;  2KHN A;  3TDZ A;  3BUX B;  1IJ5 A;  2LAP A;  2CBL A;  2G2B A;  1KFX S;  1YUS A;  1WDC B;  3PAT A;  1UP5 A;  5CPV A;  4ORB B;  1EH2 A;  1RWY A;  2PVB A;  1XFY O;  1QJT A;  2E6W A;  1J1D A;  1UUS A;  2KAV A;  4I5N B;  1KK8 C;  4XYN A;  3KPX A;  1PRW A;  1SMG A;  1IQ5 A;  4NDB A;  2HPS A;  3JVT C;  5HKW A;  3NSO A;  1SRA A;  3PN7 C;  2F3Z A;  1BT6 A;  1EXR A;  4GBA A;  1MQ1 A;  2JRF A;  2JNX A;  3EKJ A;  1ODB A;  4QJ3 B;  1BLQ A;  4FQO A;  4I5L B;  2O60 A;  1CFF A;  4HRG A;  4L9M A;  4QJ5 B;  1NX3 A;  1OOJ A;  1MUX A;  4OR9 B;  1QS7 A;  4PCW A;  1QAS A;  2L51 A;  3D0Y A;  1QIV A;  2LVI A;  3VRQ A;  5IBW A;  2KBM A;  1J55 A;  3CS1 A;  4BY5 A;  4U8D A;  2P6B B;  4I5J A;  1J1E A;  2LLS A;  2KYF A;  3DF0 A;  3EVR A;  1NP8 A;  1J7Q A;  3M0W A;  5D69 A;  4OKH A;  2Y5I A;  3A4U B;  4GPL B;  3IF7 A;  3E3R A;  1F70 A;  1CM4 A;  4XJK A;  2I18 A;  2MAZ A;  1QX5 B;  1Y1A A;  2KGR A;  3BOW A;  1A75 A;  2PAL A;  4UPG A;  2I2R E;  1NIW A;  2CNP A;  2LVV A;  3VGO A;  1PUL A;  1J7O A;  4YI9 A;  1QX7 A;  2BE6 A;  4CLN A;  4DCK A;  2L98 A;  4P5O E;  1OE9 B;  3BXK A;  1SY9 A;  1F54 A;  2M9G A;  2BCB A;  1Y1U A;  1AHR A;  2KSP A;  3BUW B;  2OTG C;  1XO5 A;  1MXE A;  1CDP A;  2M7N A;  1J7R A;  4PE1 A;  1N2D A;  1ALW A;  1YVH A;  2LC5 A;  2WCB A;  4WRI A;  5I8N A;  1BJF A;  3CWG A;  1BOD A;  1LA0 A;  2ISD A;  1CDL A;  2GGZ A;  1JC2 A;  2HF5 A;  1KFX L;  1OZO A;  1RK9 A;  4GUK A;  1F8H A;  3I5H B;  2KI4 B;  1YUU A;  1C7W A;  1ZUZ A;  3PAL A;  4N1F A;  1K2H A;  4NQG A;  2JC2 A;  1QVI Y;  1K9K A;  1J7P A;  2JUL A;  5PAL A;  2BKH B;  3CLN A;  2MBX A;  2M49 B;  4C0K A;  2FCD A;  3SIA A;  1SPY A;  1IWQ A;  1KQM B;  1IGV A;  3SJS A;  1WLZ A;  3NSL A;  3TS5 C;  3SG7 A;  1XFV O;  1SR6 B;  1CDN A;  1ALV A;  4MZJ A;  1CLM A;  1JBA A;  4USL A;  3EKH A;  2I7A A;  3IQQ A;  3LL8 B;  1QX2 A;  1S36 A;  1Y6W A;  2F2O A;  2LCP A;  4A4B A;  2ZFD A;  1EG4 A;  2NZ0 A;  1AJ5 A;  1B7T Z;  1S5G Z;  1S6J A;  2KI6 C;  3I5G C;  2D8N A;  3TUY C;  3LK1 A;  2LV7 A;  3K21 A;  1DJZ A;  2JT0 A;  4PHJ A;  2KYC A;  2KQY A;  1XVJ A;  2BL0 B;  2FOT A;  1Q80 A;  3QRX A;  4MBE A;  1DVI A;  2JT8 A;  2M3W A;  1EL4 A;  1B7T Y;  1S5G Y;  2KOT A;  4ORC B;  3RM1 A;  4M2Q A;  4M2P A;  2ZNE A;  2GV5 A;  2F8P A;  1RTP 1;  4A4C A;  3GK4 X;  2JPT A;  1XFX O;  2KFG A;  1SCV A;  1YVL A;  2OS8 B;  1B8R A;  5DKQ A;  4ZCU A;  3OB1 B;  1XFW O;  4N1G A;  2DOQ A;  1U5I A;  3WNX B;  1XA5 A;  2LMV A;  4MZK A;  3SIB A;  1TOP A;  1FW4 A;  2BE4 A;  5I2L A;  1S1E A;  1W7J B;  2Y1N A;  3D0Y B;  2L5X B;  1NX1 A;  1YX8 A;  3SG2 A;  2AUC A;  3TDU A;  2OTG B;  1MHO A;  1NUB A;  1OMR A;  2L4H A;  2BCX A;  1LA3 A;  4R1E A;  1DF0 B;  1KSO A;  2KFF A;  2K7C A;  1TRF A;  2MA2 A;  5JOL A;  5FYX A;  3A8R A;  1DT7 B;  1LVC D;  1MR8 A;  4YBH B;  2Q91 A;  1A75 B;  1BR1 B;  2JQ6 A;  1L2O C;  3I5F B;  2KDH A;  1LKJ A;  2K7B A;  4YI8 A;  1B1G A;  1PSB A;  3ICB A;  5ER5 A;  4MRX A;  4F0Z B;  2MHH A;  4NDC A;  1UHI A;  1SNL A;  3AAJ A;  1REC A;  4YGC B;  1YUR A;  1S6I A;  1XYD A;  3ZWH A;  5CSI A;  2EGD A;  1XFU O;  1QV1 A;  4M2O A;  5AER A;  1AP4 A;  1SK6 D;  2ZKM X;  2LMU A;  4P2Y B;  3CR2 A;  1QIW A;  2LP3 A;  1D1O A;  1DGU A;  2TN4 A;  3I5I B;  1DJY A;  5K89 A;  3AAK A;  2BBN A;  1PAL A;  1A2X A;  2AAO A;  4JQ0 D;  4DIR A;  2VRG A;  4OVN F;  1VRK A;  1GGW A;  1S6C A;  1UHH A;  1UHJ A;  1NCY A;  2WOR A;  2KAX A;  1NSH A;  3C1V A;  1SL7 A;  3BYA A;  3TUY B;  2NLN A;  1NCZ A;  2F33 A;  2PRU A;  1K96 A;  3OHM B;  1AUI B;  3EVV A;  2FJU B;  3GK1 A;  1SCM B;  2F3Y A;  2PSR A;  1IQ3 A;  4AQJ A;  1DMO A;  1R6P A;  3BUO B;  3DD4 A;  4WQ3 A;  1M39 A;  1G33 A;  4DS7 A;  1QV0 A;  2M8U A;  2M1U A;  1KCY A;  5KSZ A;  3JTD B;  2LUC A;  2G9B A;  1ZAC A;  2KNE A;  4Q04 A;  4JPZ B;  1TIZ A;  3LLE A;  3OP0 A;  1B9A A;  1UWO A;  5KU1 A;  1JWD A;  3FIA A;  3NXA A;  4N5X A;  1OZS A;  2PAS A;  3CR5 X;  1NCX A;  2JOJ A;  4HRH A;  4YGD B;  4PDZ A;  4AQI A;  1KK7 Z;  4CPV A;  4FTG A;  1M31 A;  1JF2 A;  2LE9 B;  1CFD A;  3TZ1 A;  1IG5 A;  4ORA B;  1CDM A;  3DVM A;  1KK8 B;  2NCO A;  4MRY A;  1KK7 Y;  3FWC A;  1CFC A;  2JXL A;  4CFR A;  1BF5 A;  3JVT B;  1OMV A;  2K7O A;  4OCI A;  3PN7 B;  1SKT A;  1FBV A;  1KWO C;  3AKB A;  1HQV A;  1DGV A;  1YUT A;  2JWW A;  3VRO A;  2WC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...