1W7JB

Crystal structure of myosin v motor with essential light chain + adp-befx - near rigor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
139
structure length
131
Chain Sequence
EFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN VA
publication title Three Myosin V Structures Delineate Essential Features of Chemo-Mechanical Transduction
pubmed doi rcsb
source organism Gallus gallus
molecule tags Motor protein
total genus 29
structure length 131
sequence length 139
ec nomenclature
pdb deposition date 2004-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1w7jB02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1w7jB01
2ZKMX 1M46A 2Y4QA 1SCMC 1TIZA 1V1FA 4A4BA 1NUBA 4BY5A 2JPTA 2LVIA 4PHNA 1F71A 1CLMA 1PALA 3LL8B 1ODBA 1DF0B 2QPTA 3PATA 1IGVA 1MUXA 1IJ6A 2P6BB 2KFHA 1YTZC 3D0YB 5CSNA 3VRPA 2JU0A 1WLZA 1AHRA 1KQMB 1NCXA 1F8HA 4YGEB 4ETOA 2K7CA 2ZFDA 3SG3A 1A03A 1A29A 1CNPA 3BYAA 1ALVA 1S6CA 2JRFA 3EVUA 1U5IB 1QLSA 1SL8A 2JXCA 2NCPA 3VRQA 2K2AA 2EHBA 3A4UB 2NXQA 2M49B 4ORCB 2BL0C 3TDUA 1QV1A 1JC2A 2LUXA 1QVIY 1KWOC 2H61A 1J7PA 3CWGA 5DKNA 1A75A 4JWQA 1IWQA 2L4HA 1MWNA 2DOQA 2K0JA 3SIAA 1DTLA 3EKHA 5KSZA 4PE0A 1CFPA 1NX0A 4FTGA 1KK8C 4OVNF 3FWBA 2CCMA 1R2UA 1TCFA 2AUCA 2JT3A 2ZNDA 3A8RA 4P2YB 4PALA 1AK8A 2LMTA 2KAYA 1ZACA 2OS8B 1J1DA 2WC8A 1BF5A 1Y1AA 1QIWA 1SBJA 2EC6C 4F0ZB 1XFYO 3VROA 5HLOA 2M0RA 3KO0A 1SW8A 1XVJA 3VRRA 4YRUA 1BG1A 4AOMA 4PHJA 1J7QA 1L7ZA 1A4PA 1QIVA 1QATA 4M2PA 2PALA 1BR1B 4YGCB 3EKJA 2NZ0A 3CLNA 3BUMB 1FF1A 4I5NB 1S5GY 3ZWHA 1K90D 1QX7A 4E68A 2HQ8A 1RFJA 1YUTA 3IF7A 1F55A 2HETA 3AAKA 1DJIA 2CXJA 1FBVA 2M9GA 4MEWA 4MZKA 1K8UA 1X02A 1GQMA 1V1GA 1XFUO 2I18A 2JWWA 3E3RA 1S6JA 3TUYB 1CTRA 3TZ1A 4I5LB 4WQ3A 3DVMA 2NLNA 4HRHA 2HPSA 4MLWA 1SKTA 1F54A 4HSZA 2Y1NA 1IH0A 1SMGA 3TDIA 1OOJA 1MXLC 1DGUA 3DD4A 4WQ2A 2M8UA 5TNCA 4XJKB 2KAXA 4FQOA 2JTTA 1R6PA 1LA0A 2GGMA 2LC5A 1D1OA 2WOSA 2JOJA 3BUXB 1CLBA 1KK7Z 3GK2A 1TNPA 3HCMA 5CSFA 1B7TZ 1F4QA 3JVTC 1NCZA 1SCVA 2ZN8A 1MHOA 3OB1B 1A2XA 2L98A 2JT8A 5DKRA 4YI9A 4PDZA 1RROA 4CLNA 4MN0A 1HT9A 1QS7A 4U8DA 2G2BA 2BECA 1UURA 4ICBA 4MSPA 1CDLA 1BU3A 4GGFA 1QASA 5CSIA 1TOPA 4YGDB 3EK8A 1UHIA 3LLEA 1JFJA 2ZNEA 1KQMC 2MJWB 1SK6D 1B8RA 1QLKA 4DIRA 1C7VA 2JTZA 3HX4A 3BUNB 5IBWA 1KFUL 2A4JA 2E6WA 2KFFA 3VGOA 1TTXA 3AAJA 4P5OE 2LCPA 1CMFA 2LMVA 2R2IA 3WHUB 2K61A 3RM1A 4GGNA 4R1EA 2KHNA 1KFUS 2B1UA 1JSAA 2KYFA 1LA3A 2F2PA 2WNDA 5D7FA 5K89A 3ZNIA 5AFPA 1QVIZ 2HF5A 1DVIA 2ISDA 1F70A 1QJTA 1NX2A 5ER5A 2BCXA 1IQ5A 1H8BA 5HKZA 2KGRA 5BPJA 1UWOA 2Y5IA 2JXLA 3CTNA 4GBAA 1AVSA 1YR5A 1NX1A 2OS8C 2F8PA 3BUOB 3OX6A 4CIDA 1WRKA 1PSRA 1RECA 4USLA 3BOWB 3SJSA 1S1EA 1JF2A 1JWDA 3DF0B 1CDPA 1PVAA 1NPQA 2LV7A 2AMIA 2IS9A 3D10A 2BBNA 2JNXA 4GUKA 3EVVA 5I2OA 4OCIA 1TNQA 2K8MB 2L51A 1L2OB 2OTGB 3NSKA 1RK9A 4N1FA 4ORBB 2MBXA 1CDMA 1FW4A 2KI6C 1SY9A 4WRIA 4A4CA 1S5GZ 3NSIA 2HQWA 2M3WA 3TUYC 1YRUB 1CM4A 1PULA 1XK4C 1IRJA 3C1VA 3O4YA 4CPVA 2GV5A 2LNKA 1CM1A 2KQYA 3WNXB 1XO5A 4AQJA 4CFRA 2M1KB 1YX8A 1Y6WA 2KDHA 1SL7A 1NIWA 3CR4X 2L50A 3EK7A 2M7LA 3PSRA 1LINA 3ICBA 1CKKA 1S26D 2BE4A 3KEVA 1K94A 1QX5B 4D1EA 1G33A 3OX5A 3NSOA 1BJFA 2FCDA 2JT0A 2SASA 1TRFA 1BODA 4MVFA 2MAZA 5FYXA 1XFWO 4DCKA 1CFFA 1YURA 3BUWB 1MXEA 3O78A 3RLZA 2MLEC 1B1GA 1K93D 2V53A 4HRGA 2FCEA 1G8IA 3TS5B 1XA5A 1WDCB 4GFTA 5CPVA 1AUIB 1UHJA 2I94A 1CFCA 3CR5X 4I5JA 1GGZA 1K95A 1OZSA 2LUCA 1UHHA 4L9MA 2ZN9A 1QTXA 4ORAB 4QJ4B 1CMGA 3VRNA 4PE7A 2CTNA 5JOLA 2JQ6A 1OZOA 1SRAA 3JTDB 3IQQA 1DF0A 3KF9A 2LLSA 1IG5A 2L2EA 1XYDA 5HKWA 2BKIB 2KBMA 2BCAA 1EH2A 1EJ3A 3D0YA 2Y1MA 4MRYA 2K7BA 1E8AA 1DJXA 1K9PA 1LVCD 4GAOA 2G9BA 1FI6A 2PMYA 3SG5A 1M63B 3KHEA 1NCYA 1U5IA 3H4SE 1A75B 1BMOA 1K9KA 3MSEB 2LAPA 3WHTB 4HREE 1S3PA 4DS7A 4C0LA 1GJYA 2KSPA 1SYMA 2F3ZA 1LXFC 5GQQC 1DGVA 3AKAA 4GPLB 1L2OC 2OTGC 3F45A 3I5FC 3OHMB 1WY9A 4NDBA 2COLB 4PCWA 1WLMA 5CSJA 3I5HC 2M29A 1J7RA 3GK4X 3PM8A 2LANA 1BT6A 2KAVA 4M2OA 4C0JA 2LMUA 1XFVO 1RWYA 4MZLA 2KOTA 2LP2A 1BLQA 5I2QA 1EXRA 4N1GA 1PSBA 1NYAA 2JNFA 3PALA 2JZIA 2K7DA 2O5GA 5D69A 1W7JB 3LK0A 4C0KA 3I5GB 4M2QA 1JBAA 2LVVA 4BY4A 5KU1A 2NCOA 2WCEA 4DUQA 4GGFC 2QACA 1KK7Y 5F6TA 1B8LA 1B7TY 2LLUA 4PE1A 5AEQA 1NWDA 5G08A 3NXAA 1M31A 3DVEA 1UHKA 3SG7A 5I2LA 1HQVA 2GGZA 2KQ6A 2JC2A 4QJ5B 1EG4A 4OV2A 3I5FB 1ZUZA 4JQ0D 2I2RE 1NSHA 3I5HB 4MBEA 5I8NA 4DRWA 1KCYA 4QJ3B 3PN7B 5AXIA 3IQOA 5B8IB 1WRZA 4XJKA 1DJGA 1KQVA 3KPXA 2H2KA 2LLTA 1YUUA 1F4OA 1SR6B 3TS5C 1WDCC 4NDCA 4MZJA 2LVJA 4XYNA 4AQIA 1FI5A 2BE6A 4YGBB 5PALA 2KBIA 2FOTA 2KFGA 1UP5A 1K96A 4I5KA 2PSRA 3SG6A 1Y1XA 1S36A 2TN4A 1RJVA 1Q80A 3I5IB 3FIAA 1JUOA 1BOCA 3K21A 1OMVA 1BR4B 3FWCA 1KSOA 1B47A 1IKUA 1KFXL 2BKHB 2KI4B 1B9AA 2PASA 2L5XB 3JTDC 1AP4A 5JJGA 4ZCVA 3SG2A 1TN4A 1N2DA 1K9UA 1CFDA 3CR2A 3NSLA 3TDZA 4CFQA 1KFXS 1H4BA 5HLVA 1SCMB 2KGBC 2ZRTA 1TNWA 2H61C 4IL1A 1UHNA 3WXAA 1FPWA 1AJ4A 2KYCA 2D8NA 1QV0A 5HYDA 2K2FA 2BCBA 3CZTX 4NQGA 3DVKA 2JULA 3AKBA 1TNXA 1ZMZA 2F3YA 2CT9A 2KNEA 5DKQA 1NP8A 1M39A 4YBHB 1CDNA 1ZFSA 4ZCUA 1XFZO 3SG4A 1DT7B 1IJ5A 1GGWA 4NDDA 1AJ5A 1YX7A 2Q4UA 2M7NA 5ER4X 3SIBA 4JPZB 2FJUB 1J1EA 2MHHA 2K7OA 1LKJA 2L4IA 1CB1A 1M45A 2BL0B 1RTP1 1B8CA 1DJZA 1KWOB 1SPYA 1S6IA 1KSMA 1XFXO 3CS1A 3CGAA 2LHIA 3BOWA 1JFKA 1K2HA 4PE4A 3DF0A 1G4YR 2LE9B 3GOFA 1ZOTB 2RGIA 1OMRA 1YVLA 5AANA 2EGDA 1CLLA 1PRWA 2M97A 3I5GC 1OE9B 1SNLA 5J3XA 2AAOA 1J55A 5HKYA 1KK8B 2I7AA 2OPOA 1WRLA 3OB2B 1MR8A 2F2OA 2VRGA 1EG3A 2CNPA 1Y0VH 1J7OA 1DMOA 2EC6B 1MQ1A 1W7IB 1VRKA 1JF0A 2SCPA 1ALWA 2WCBA 1N0YA 2PVBA 3DVJA 3LK1A 3O2PA 2LM5A 2PRUA 4N5XA 1SL9A 2O60A 1QX2A 3PFVA 1DJWA 2WCFA 3FS7A 1YUSA 2BBMA 3O6BA 2MRDA 1C07A 1NX3A 3PN7C 2L0PA 1DJHA 2MA2A 2WORA 3PLFB 1UUSA 4GNKB 1Y1UA 3GK1A 3LCPC 1N65A 2E30A 2LVKA 3BQ3A 2F33A 5KTYA 1SR6C 2Q91A 4TNCA 1EL4A 4OKHA 4UPGA 2ZRSA 4OR9B 2MLFC 3EK4A 1C7WA 1PK0D 4PHMA 1DJYA 1OQPA 1IQ3A 2LP3A 2CBLA 3BXKA 2KI6D 3I5IC 3QRXA 3OP0A 3M0WA 4PHKA 1MF8B 1QXPA 1OMDA 3JVTB 2KI4C 3EVRA 1TCOB 1YRTB 2M1UA 2LHLA 1PVBA 5AERA 4YGAA 1B4CA 1XK4A 4Q04A 4YI8A 1OSAA 4MRXA 1YVHA
chains in the Genus database with same CATH superfamily
2ZKMX 1M46A 2Y4QA 1SCMC 1TIZA 1V1FA 4A4BA 2ERBA 1NUBA 4BY5A 2JPTA 2LVIA 4PHNA 3S0FA 1CLMA 1PALA 1F71A 3LL8B 1ODBA 1DF0B 2QPTA 3PATA 1IGVA 1MUXA 1IJ6A 2P6BB 2KFHA 1YTZC 3D0YB 5CSNA 3VRPA 2JU0A 1WLZA 1AHRA 1KQMB 1NCXA 1F8HA 4YGEB 4ETOA 2K7CA 2ZFDA 3SG3A 1A03A 1A29A 1CNPA 3BYAA 1ALVA 1S6CA 2JRFA 3EVUA 1U5IB 1QLSA 1SL8A 3D77A 3D73A 2JXCA 3S0BA 2NCPA 3VRQA 2K2AA 2EHBA 3A4UB 2NXQA 2M49B 4ORCB 2BL0C 3TDUA 1QV1A 1JC2A 2LUXA 1QVIY 1KWOC 2H61A 1J7PA 3CWGA 5DKNA 1A75A 4JWQA 1IWQA 2L4HA 2QEOA 1MWNA 2DOQA 2K0JA 3B7AA 1DTLA 3SIAA 3EKHA 5KSZA 4PE0A 1CFPA 1NX0A 4FTGA 1KK8C 4OVNF 3FWBA 2CCMA 1R2UA 1TCFA 2AUCA 2BNXA 2JT3A 2ZNDA 3A8RA 3BFBA 4P2YB 4PALA 2LMTA 1AK8A 2KAYA 1ZACA 2OS8B 1J1DA 2WC8A 1C3YA 1BF5A 1Y1AA 1QIWA 1SBJA 2EC6C 4F0ZB 1XFYO 2PYQA 3VROA 5I94A 5HLOA 2M0RA 3D78A 3KO0A 3S0GA 1SW8A 1XVJA 3VRRA 4YRUA 1BG1A 4AOMA 2WC5A 4PHJA 1J7QA 1L7ZA 1A4PA 1QIVA 1QATA 2P70A 2PALA 4M2PA 1BR1B 4YGCB 3EKJA 2NZ0A 3CLNA 3BUMB 1FF1A 4I5NB 3QMEA 1S5GY 5AANA 3ZWHA 4F7FA 1K90D 1QX7A 4E68A 2HQ8A 1RFJA 1YUTA 2P71A 3IF7A 1F55A 2HETA 3AAKA 1DJIA 2CXJA 1FBVA 2M9GA 4MEWA 4MZKA 1K8UA 1X02A 1GQMA 1V1GA 1XFUO 2I18A 2JWWA 2WCHA 1S6JA 3E3RA 1CTRA 3OBVA 1QWVA 4I5LB 3TZ1A 4WQ3A 3DVMA 2NLNA 4HRHA 2HPSA 4MLWA 2K60A 1SKTA 3K1EA 1OOGA 4HSZA 1F54A 2Y1NA 1IH0A 1SMGA 3TDIA 1OOJA 1MXLC 1DGUA 1TUJA 3DD4A 4WQ2A 2M8UA 5TNCA 4XJKB 2KAXA 4FQOA 2JTTA 1R6PA 1LA0A 2GGMA 2LC5A 1D1OA 2WOSA 2JOJA 3BUXB 1CLBA 1KK7Z 3GK2A 1OW4A 1OOHA 1TNPA 3HCMA 1B7TZ 1F4QA 3JVTC 5CSFA 1NCZA 1SCVA 2ZN8A 1MHOA 3OB1B 2QEBA 2YGUA 1A2XA 2L98A 2JT8A 2KPHA 5DKRA 4YI9A 4PDZA 1RROA 4CLNA 4MN0A 1HT9A 1QS7A 4U8DA 2G2BA 3VB1A 2BECA 1UURA 4ICBA 4MSPA 1CDLA 1BU3A 4GGFA 1QASA 5CSIA 1TOPA 1XFRA 4YGDB 3EK8A 1UHIA 3LLEA 1ORGA 2GTEA 1JFJA 2ZNEA 1KQMC 2MJWB 1SK6D 1B8RA 1QLKA 2WC6A 3D74A 2JTZA 4DIRA 1C7VA 3UNWA 3D76A 2WCJA 3HX4A 3BUNB 5IBWA 1KFUL 2A4JA 2E6WA 2KFFA 3VGOA 1TTXA 3AAJA 4P5OE 2LCPA 1CMFA 2LMVA 2R2IA 3WHUB 2K61A 4FQTA 3RM1A 4GGNA 3PJIA 4R1EA 2KHNA 4PT1A 1KFUS 2B1UA 1JSAA 2KYFA 3OGNA 1LA3A 3CDNA 2F2PA 2WNDA 5D7FA 5K89A 3ZNIA 5AFPA 1QVIZ 2HF5A 1DVIA 2ISDA 1F70A 3NHTA 1QJTA 1NX2A 5ER5A 2BCXA 1IQ5A 1H8BA 5HKZA 2KGRA 5BPJA 1UWOA 1GM0A 2Y5IA 2JXLA 3CTNA 4GBAA 1AVSA 1YR5A 1NX1A 2OS8C 2F8PA 3BUOB 2QDIA 3OX6A 4CIDA 3FE8A 1WRKA 1PSRA 1RECA 4USLA 3BOWB 3SJSA 1S1EA 1JF2A 1JWDA 3DF0B 1CDPA 1PVAA 1NPQA 2LV7A 2AMIA 2IS9A 3D10A 2BBNA 2JNXA 4GUKA 1OOFA 3EVVA 5I2OA 4OCIA 1TNQA 2K8MB 2L51A 1L2OB 2OTGB 3NSKA 1RK9A 4N1FA 4ORBB 2MBXA 1CDMA 1FW4A 2KI6C 1SY9A 4WRIA 4A4CA 1S5GZ 3NSIA 2HQWA 2M3WA 3TUYC 1YRUB 1CM4A 1PULA 1XK4C 1IRJA 3C1VA 3O4YA 4CPVA 2GV5A 2LNKA 1CM1A 2KQYA 3WNXB 1XO5A 4AQJA 4CFRA 3D75A 5DICA 2WCMA 2M1KB 1YX8A 1Y6WA 2KDHA 1SL7A 1NIWA 3CR4X 3N7HA 2L50A 3EK7A 1Z4HA 2M7LA 3DZTA 3Q8IA 3PSRA 1LINA 3ICBA 1CKKA 1S26D 1DQEA 2BE4A 3KEVA 4PCWA 1K94A 1QX5B 4D1EA 1G33A 3OX5A 3NSOA 1BJFA 3BFAA 2FCDA 2JT0A 2SASA 1TRFA 3DY9A 1BODA 4MVFA 2MAZA 5FYXA 1XFWO 4DCKA 1CFFA 1YURA 3BUWB 1MXEA 3O78A 3CYZA 3RLZA 3CABA 2MLEC 1B1GA 1K93D 3S0EA 2V53A 4HRGA 2FCEA 1G8IA 1TWOA 3TS5B 1XA5A 1WDCB 1DC1A 4GFTA 5CPVA 3PM2A 1AUIB 3R1VA 1UHJA 2I94A 1CFCA 3CR5X 4I5JA 1GGZA 1K95A 1OZSA 2LUCA 1UHHA 4L9MA 2ZN9A 1QTXA 4ORAB 4QJ4B 1CMGA 3VRNA 3CZ2A 3B88A 2CTNA 4PE7A 5JOLA 2WCLA 2JQ6A 1OZOA 1SRAA 2FJYA 3JTDB 3IQQA 1DF0A 3KF9A 2LLSA 1IG5A 2L2EA 1XYDA 1T14A 5HKWA 2BKIB 2KBMA 2BCAA 3DYEA 1EH2A 1EJ3A 3D0YA 2Y1MA 3IVTA 2K7BA 4MRYA 1E8AA 1DJXA 1K9PA 1LVCD 3FE9A 4GAOA 1C3ZA 2G9BA 4OZDA 4IJ7A 1FI6A 2PMYA 3SG5A 1M63B 3BJHA 3KHEA 1NCYA 1U5IA 3H4SE 1A75B 1BMOA 1K9KA 3MSEB 2LAPA 3WHTB 4HREE 1S3PA 4DS7A 4C0LA 1GJYA 2KSPA 1SYMA 2F3ZA 1LXFC 3NHIA 5GQQC 1DGVA 3AKAA 4GPLB 4INXA 1L2OC 2OTGC 1Z2CB 3F45A 3I5FC 1WY9A 3OHMB 2COLB 3B6XA 4NDBA 1WLMA 4JD9A 5CSJA 3I5HC 2M29A 3S0DA 1J7RA 2PQLA 3GK4X 3PM8A 2LANA 1BT6A 2QEVA 2KAVA 4M2OA 4C0JA 2LMUA 1XFVO 1RWYA 3R72A 3O4XA 2KOTA 2LP2A 4MZLA 1BLQA 5I2QA 1EXRA 4N1GA 1DELA 4KYNA 1PSBA 1NYAA 2JNFA 3PALA 2JZIA 2K7DA 2O5GA 5D69A 1W7JB 3LK0A 4C0KA 3I5GB 4M2QA 1JBAA 2LVVA 4BY4A 5KU1A 2NCOA 2WCEA 4DUQA 4GGFC 2QACA 1KK7Y 5F6TA 1B8LA 1B7TY 3BFHA 2LLUA 4PE1A 3L4LA 5AEQA 1NWDA 5G08A 3NXAA 1M31A 3DVEA 3R1OA 1UHKA 3SG7A 5I2LA 1HQVA 2GGZA 2KQ6A 3EG5B 2JC2A 3B87A 4QJ5B 1EG4A 4OV2A 3I5FB 1ZUZA 4JQ0D 2I2RE 1NSHA 3I5HB 4MBEA 5I8NA 4DRWA 4INWA 1KCYA 4QJ3B 3PN7B 5AXIA 3IQOA 5B8IB 1TUZA 1WRZA 4XJKA 1DJGA 1KQVA 1P28A 2H8VA 3KPXA 2H2KA 2LLTA 1YUUA 1F4OA 1SR6B 3TS5C 1WDCC 3DXLA 4NDCA 3SS3A 4MZJA 2LVJA 4XYNA 4AQIA 1FI5A 2BE6A 4YGBB 4JKTA 2KBIA 5PALA 2FOTA 2KFGA 1UP5A 1K96A 4I5KA 2PSRA 3SG6A 1Y1XA 1S36A 2TN4A 1RJVA 1Q80A 1DEKA 3I5IB 3FIAA 1JUOA 1BOCA 3K21A 1OMVA 1BR4B 3FWCA 3SS5A 1KSOA 1B47A 1IKUA 1KFXL 2BKHB 2KI4B 1B9AA 2PASA 2L5XB 3JTDC 1AP4A 5JJGA 4ZCVA 3SG2A 5EL2A 1TN4A 1N2DA 1K9UA 5FI7A 1CFDA 3CR2A 3NSLA 3TDZA 4CFQA 1KFXS 1H4BA 3NGVA 5HLVA 1SCMB 2KGBC 2ZRTA 1TNWA 2H61C 1OOIX 1UHNA 4IL1A 3WXAA 1FPWA 1AJ4A 2KYCA 2D8NA 1QV0A 5HYDA 5HL1A 2K2FA 2BCBA 3CZTX 4NQGA 3DVKA 2JULA 3AKBA 1TNXA 1ZMZA 2F3YA 2CT9A 2KNEA 5DKQA 1NP8A 1M39A 4YBHB 3S0AA 3FE6A 2QEHA 1CDNA 1ZFSA 4ZCUA 3TUYB 1XFZO 3SG4A 1DT7B 1IJ5A 1GGWA 4NDDA 1AJ5A 1YX7A 2Q4UA 2M7NA 5ER4X 3SIBA 4JPZB 2BAPA 2FJUB 1J1EA 3SS4A 2MHHA 2K7OA 1LKJA 1W9ZA 2L4IA 1M45A 1CB1A 2BL0B 1RTP1 1B8CA 1DJZA 1KWOB 1SPYA 1S6IA 1KSMA 1XFXO 3CS1A 3CGAA 2LHIA 3BOWA 5D3OA 1JFKA 1K2HA 1SSEB 4PE4A 3DF0A 1G4YR 2LE9B 3GOFA 1ZOTB 2RGIA 1OMRA 1YVLA 2JPOA 2EGDA 1CLLA 1PRWA 2M97A 3I5GC 1OE9B 1SNLA 5J3XA 2AAOA 3V2LA 1J55A 5HKYA 1KK8B 2I7AA 2OPOA 1WRLA 3OB2B 1MR8A 2F2OA 2VRGA 1EG3A 2CNPA 1Y0VH 2KLDA 1J7OA 1DMOA 2EC6B 1MQ1A 1W7IB 1VRKA 1JF0A 2SCPA 3RZSA 1ALWA 2WCBA 1N0YA 2PVBA 3DVJA 3LK1A 3O2PA 2LM5A 2PRUA 4N5XA 1SL9A 2O60A 1QX2A 2WCKA 3PFVA 1DJWA 2WCFA 2KLEA 3FS7A 1YUSA 2BBMA 3O6BA 2MRDA 1C07A 1NX3A 3PN7C 2L0PA 1LS8A 3CZ0A 1DJHA 2MA2A 2WORA 3PLFB 1UUSA 4GNKB 1Y1UA 3GK1A 3LCPC 1N65A 3CZ1A 5FI2A 2E30A 2LVKA 3BQ3A 2F33A 5KTYA 1SR6C 2Q91A 4TNCA 1EL4A 4OKHA 4UPGA 2ZRSA 4OR9B 2MLFC 3EK4A 1C7WA 1PK0D 4PHMA 1DJYA 1OQPA 3L4AA 1IQ3A 3L47A 2LP3A 2CBLA 1IIOA 3BXKA 2KI6D 3I5IC 3QRXA 3OP0A 3M0WA 4PHKA 5FI6A 1MF8B 1QXPA 1OMDA 3UO9A 2L5YA 3JVTB 2KI4C 3R1PA 3EVRA 2L2CA 1TCOB 1YRTB 2M1UA 3B86A 2LHLA 1PVBA 5AERA 4YGAA 1B4CA 1XK4A 4Q04A 4YI8A 1OSAA 4MRXA 1YVHA
chains in the Genus database with same CATH topology
2ZKMX 1M46A 2Y4QA 1SCMC 1TIZA 1V1FA 4A4BA 1NUBA 4BY5A 2JPTA 2LVIA 4PHNA 1F71A 1CLMA 1PALA 3LL8B 1ODBA 1DF0B 2QPTA 3PATA 1IGVA 1MUXA 1IJ6A 2P6BB 2KFHA 1YTZC 3D0YB 5CSNA 3VRPA 2JU0A 1WLZA 1AHRA 1KQMB 1NCXA 1F8HA 4YGEB 4ETOA 2K7CA 2ZFDA 3SG3A 1A03A 1A29A 1CNPA 3BYAA 1ALVA 1S6CA 2JRFA 3EVUA 1U5IB 1QLSA 1SL8A 2JXCA 2NCPA 3VRQA 2K2AA 2EHBA 3A4UB 2NXQA 2M49B 4ORCB 2BL0C 3TDUA 1QV1A 1JC2A 2LUXA 1QVIY 1KWOC 2H61A 1J7PA 3CWGA 5DKNA 1A75A 4JWQA 1IWQA 2L4HA 1MWNA 2DOQA 2K0JA 3SIAA 1DTLA 3EKHA 5KSZA 4PE0A 1CFPA 1NX0A 4FTGA 1KK8C 4OVNF 3FWBA 2CCMA 1R2UA 1TCFA 2AUCA 2JT3A 2ZNDA 3A8RA 4P2YB 4PALA 1AK8A 2LMTA 2KAYA 1ZACA 2OS8B 1J1DA 2WC8A 1BF5A 1Y1AA 1QIWA 1SBJA 2EC6C 4F0ZB 1XFYO 3VROA 5HLOA 2M0RA 3KO0A 1SW8A 1XVJA 3VRRA 4YRUA 1BG1A 4AOMA 4PHJA 1J7QA 1L7ZA 1A4PA 1QIVA 1QATA 4M2PA 2PALA 1BR1B 4YGCB 3EKJA 2NZ0A 3CLNA 3BUMB 1FF1A 4I5NB 1S5GY 3ZWHA 1K90D 1QX7A 4E68A 2HQ8A 1RFJA 1YUTA 3IF7A 1F55A 2HETA 3AAKA 1DJIA 2CXJA 1FBVA 2M9GA 4MEWA 4MZKA 1K8UA 1X02A 1GQMA 1V1GA 1XFUO 2I18A 2JWWA 3E3RA 1S6JA 3TUYB 1CTRA 3TZ1A 4I5LB 4WQ3A 3DVMA 2NLNA 4HRHA 2HPSA 4MLWA 1SKTA 1F54A 4HSZA 2Y1NA 1IH0A 1SMGA 3TDIA 1OOJA 1MXLC 1DGUA 3DD4A 4WQ2A 2M8UA 5TNCA 4XJKB 2KAXA 4FQOA 2JTTA 1R6PA 1LA0A 2GGMA 2LC5A 1D1OA 2WOSA 2JOJA 3BUXB 1CLBA 1KK7Z 3GK2A 1TNPA 3HCMA 5CSFA 1B7TZ 1F4QA 3JVTC 1NCZA 1SCVA 2ZN8A 1MHOA 3OB1B 1A2XA 2L98A 2JT8A 5DKRA 4YI9A 4PDZA 1RROA 4CLNA 4MN0A 1HT9A 1QS7A 4U8DA 2G2BA 2BECA 1UURA 4ICBA 4MSPA 1CDLA 1BU3A 4GGFA 1QASA 5CSIA 1TOPA 4YGDB 3EK8A 1UHIA 3LLEA 1JFJA 2ZNEA 1KQMC 2MJWB 1SK6D 1B8RA 1QLKA 4DIRA 1C7VA 2JTZA 3HX4A 3BUNB 5IBWA 1KFUL 2A4JA 2E6WA 2KFFA 3VGOA 1TTXA 3AAJA 4P5OE 2LCPA 1CMFA 2LMVA 2R2IA 3WHUB 2K61A 3RM1A 4GGNA 4R1EA 2KHNA 1KFUS 2B1UA 1JSAA 2KYFA 1LA3A 2F2PA 2WNDA 5D7FA 5K89A 3ZNIA 5AFPA 1QVIZ 2HF5A 1DVIA 2ISDA 1F70A 1QJTA 1NX2A 5ER5A 2BCXA 1IQ5A 1H8BA 5HKZA 2KGRA 5BPJA 1UWOA 2Y5IA 2JXLA 3CTNA 4GBAA 1AVSA 1YR5A 1NX1A 2OS8C 2F8PA 3BUOB 3OX6A 4CIDA 1WRKA 1PSRA 1RECA 4USLA 3BOWB 3SJSA 1S1EA 1JF2A 1JWDA 3DF0B 1CDPA 1PVAA 1NPQA 2LV7A 2AMIA 2IS9A 3D10A 2BBNA 2JNXA 4GUKA 3EVVA 5I2OA 4OCIA 1TNQA 2K8MB 2L51A 1L2OB 2OTGB 3NSKA 1RK9A 4N1FA 4ORBB 2MBXA 1CDMA 1FW4A 2KI6C 1SY9A 4WRIA 4A4CA 1S5GZ 3NSIA 2HQWA 2M3WA 3TUYC 1YRUB 1CM4A 1PULA 1XK4C 1IRJA 3C1VA 3O4YA 4CPVA 2GV5A 2LNKA 1CM1A 2KQYA 3WNXB 1XO5A 4AQJA 4CFRA 2M1KB 1YX8A 1Y6WA 2KDHA 1SL7A 1NIWA 3CR4X 2L50A 3EK7A 2M7LA 3PSRA 1LINA 3ICBA 1CKKA 1S26D 2BE4A 3KEVA 1K94A 1QX5B 4D1EA 1G33A 3OX5A 3NSOA 1BJFA 2FCDA 2JT0A 2SASA 1TRFA 1BODA 4MVFA 2MAZA 5FYXA 1XFWO 4DCKA 1CFFA 1YURA 3BUWB 1MXEA 3O78A 3RLZA 2MLEC 1B1GA 1K93D 2V53A 4HRGA 2FCEA 1G8IA 3TS5B 1XA5A 1WDCB 4GFTA 5CPVA 1AUIB 1UHJA 2I94A 1CFCA 3CR5X 4I5JA 1GGZA 1K95A 1OZSA 2LUCA 1UHHA 4L9MA 2ZN9A 1QTXA 4ORAB 4QJ4B 1CMGA 3VRNA 4PE7A 2CTNA 5JOLA 2JQ6A 1OZOA 1SRAA 3JTDB 3IQQA 1DF0A 3KF9A 2LLSA 1IG5A 2L2EA 1XYDA 5HKWA 2BKIB 2KBMA 2BCAA 1EH2A 1EJ3A 3D0YA 2Y1MA 4MRYA 2K7BA 1E8AA 1DJXA 1K9PA 1LVCD 4GAOA 2G9BA 1FI6A 2PMYA 3SG5A 1M63B 3KHEA 1NCYA 1U5IA 3H4SE 1A75B 1BMOA 1K9KA 3MSEB 2LAPA 3WHTB 4HREE 1S3PA 4DS7A 4C0LA 1GJYA 2KSPA 1SYMA 2F3ZA 1LXFC 5GQQC 1DGVA 3AKAA 4GPLB 1L2OC 2OTGC 3F45A 3I5FC 3OHMB 1WY9A 4NDBA 2COLB 4PCWA 1WLMA 5CSJA 3I5HC 2M29A 1J7RA 3GK4X 3PM8A 2LANA 1BT6A 2KAVA 4M2OA 4C0JA 2LMUA 1XFVO 1RWYA 4MZLA 2KOTA 2LP2A 1BLQA 5I2QA 1EXRA 4N1GA 1PSBA 1NYAA 2JNFA 3PALA 2JZIA 2K7DA 2O5GA 5D69A 1W7JB 3LK0A 4C0KA 3I5GB 4M2QA 1JBAA 2LVVA 4BY4A 5KU1A 2NCOA 2WCEA 4DUQA 4GGFC 2QACA 1KK7Y 5F6TA 1B8LA 1B7TY 2LLUA 4PE1A 5AEQA 1NWDA 5G08A 3NXAA 1M31A 3DVEA 1UHKA 3SG7A 5I2LA 1HQVA 2GGZA 2KQ6A 2JC2A 4QJ5B 1EG4A 4OV2A 3I5FB 1ZUZA 4JQ0D 2I2RE 1NSHA 3I5HB 4MBEA 5I8NA 4DRWA 1KCYA 4QJ3B 3PN7B 5AXIA 3IQOA 5B8IB 1WRZA 4XJKA 1DJGA 1KQVA 3KPXA 2H2KA 2LLTA 1YUUA 1F4OA 1SR6B 3TS5C 1WDCC 4NDCA 4MZJA 2LVJA 4XYNA 4AQIA 1FI5A 2BE6A 4YGBB 5PALA 2KBIA 2FOTA 2KFGA 1UP5A 1K96A 4I5KA 2PSRA 3SG6A 1Y1XA 1S36A 2TN4A 1RJVA 1Q80A 3I5IB 3FIAA 1JUOA 1BOCA 3K21A 1OMVA 1BR4B 3FWCA 1KSOA 1B47A 1IKUA 1KFXL 2BKHB 2KI4B 1B9AA 2PASA 2L5XB 3JTDC 1AP4A 5JJGA 4ZCVA 3SG2A 1TN4A 1N2DA 1K9UA 1CFDA 3CR2A 3NSLA 3TDZA 4CFQA 1KFXS 1H4BA 5HLVA 1SCMB 2KGBC 2ZRTA 1TNWA 2H61C 4IL1A 1UHNA 3WXAA 1FPWA 1AJ4A 2KYCA 2D8NA 1QV0A 5HYDA 2K2FA 2BCBA 3CZTX 4NQGA 3DVKA 2JULA 3AKBA 1TNXA 1ZMZA 2F3YA 2CT9A 2KNEA 5DKQA 1NP8A 1M39A 4YBHB 1CDNA 1ZFSA 4ZCUA 1XFZO 3SG4A 1DT7B 1IJ5A 1GGWA 4NDDA 1AJ5A 1YX7A 2Q4UA 2M7NA 5ER4X 3SIBA 4JPZB 2FJUB 1J1EA 2MHHA 2K7OA 1LKJA 2L4IA 1CB1A 1M45A 2BL0B 1RTP1 1B8CA 1DJZA 1KWOB 1SPYA 1S6IA 1KSMA 1XFXO 3CS1A 3CGAA 2LHIA 3BOWA 1JFKA 1K2HA 4PE4A 3DF0A 1G4YR 2LE9B 3GOFA 1ZOTB 2RGIA 1OMRA 1YVLA 5AANA 2EGDA 1CLLA 1PRWA 2M97A 3I5GC 1OE9B 1SNLA 5J3XA 2AAOA 1J55A 5HKYA 1KK8B 2I7AA 2OPOA 1WRLA 3OB2B 1MR8A 2F2OA 2VRGA 1EG3A 2CNPA 1Y0VH 1J7OA 1DMOA 2EC6B 1MQ1A 1W7IB 1VRKA 1JF0A 2SCPA 1ALWA 2WCBA 1N0YA 2PVBA 3DVJA 3LK1A 3O2PA 2LM5A 2PRUA 4N5XA 1SL9A 2O60A 1QX2A 3PFVA 1DJWA 2WCFA 3FS7A 1YUSA 2BBMA 3O6BA 2MRDA 1C07A 1NX3A 3PN7C 2L0PA 1DJHA 2MA2A 2WORA 3PLFB 1UUSA 4GNKB 1Y1UA 3GK1A 3LCPC 1N65A 2E30A 2LVKA 3BQ3A 2F33A 5KTYA 1SR6C 2Q91A 4TNCA 1EL4A 4OKHA 4UPGA 2ZRSA 4OR9B 2MLFC 3EK4A 1C7WA 1PK0D 4PHMA 1DJYA 1OQPA 1IQ3A 2LP3A 2CBLA 3BXKA 2KI6D 3I5IC 3QRXA 3OP0A 3M0WA 4PHKA 1MF8B 1QXPA 1OMDA 3JVTB 2KI4C 3EVRA 1TCOB 1YRTB 2M1UA 2LHLA 1PVBA 5AERA 4YGAA 1B4CA 1XK4A 4Q04A 4YI8A 1OSAA 4MRXA 1YVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZKM X;  1M46 A;  2Y4Q A;  1SCM C;  1TIZ A;  1V1F A;  4A4B A;  1NUB A;  4BY5 A;  2JPT A;  2LVI A;  4PHN A;  1F71 A;  1CLM A;  1PAL A;  3LL8 B;  1ODB A;  1DF0 B;  2QPT A;  3PAT A;  1IGV A;  1MUX A;  1IJ6 A;  2P6B B;  2KFH A;  1YTZ C;  3D0Y B;  5CSN A;  3VRP A;  2JU0 A;  1WLZ A;  1AHR A;  1KQM B;  1NCX A;  1F8H A;  4YGE B;  4ETO A;  2K7C A;  2ZFD A;  3SG3 A;  1A03 A;  1A29 A;  1CNP A;  3BYA A;  1ALV A;  1S6C A;  2JRF A;  3EVU A;  1U5I B;  1QLS A;  1SL8 A;  2JXC A;  2NCP A;  3VRQ A;  2K2A A;  2EHB A;  3A4U B;  2NXQ A;  2M49 B;  4ORC B;  2BL0 C;  3TDU A;  1QV1 A;  1JC2 A;  2LUX A;  1QVI Y;  1KWO C;  2H61 A;  1J7P A;  3CWG A;  5DKN A;  1A75 A;  4JWQ A;  1IWQ A;  2L4H A;  1MWN A;  2DOQ A;  2K0J A;  3SIA A;  1DTL A;  3EKH A;  5KSZ A;  4PE0 A;  1CFP A;  1NX0 A;  4FTG A;  1KK8 C;  4OVN F;  3FWB A;  2CCM A;  1R2U A;  1TCF A;  2AUC A;  2JT3 A;  2ZND A;  3A8R A;  4P2Y B;  4PAL A;  1AK8 A;  2LMT A;  2KAY A;  1ZAC A;  2OS8 B;  1J1D A;  2WC8 A;  1BF5 A;  1Y1A A;  1QIW A;  1SBJ A;  2EC6 C;  4F0Z B;  1XFY O;  3VRO A;  5HLO A;  2M0R A;  3KO0 A;  1SW8 A;  1XVJ A;  3VRR A;  4YRU A;  1BG1 A;  4AOM A;  4PHJ A;  1J7Q A;  1L7Z A;  1A4P A;  1QIV A;  1QAT A;  4M2P A;  2PAL A;  1BR1 B;  4YGC B;  3EKJ A;  2NZ0 A;  3CLN A;  3BUM B;  1FF1 A;  4I5N B;  1S5G Y;  3ZWH A;  1K90 D;  1QX7 A;  4E68 A;  2HQ8 A;  1RFJ A;  1YUT A;  3IF7 A;  1F55 A;  2HET A;  3AAK A;  1DJI A;  2CXJ A;  1FBV A;  2M9G A;  4MEW A;  4MZK A;  1K8U A;  1X02 A;  1GQM A;  1V1G A;  1XFU O;  2I18 A;  2JWW A;  3E3R A;  1S6J A;  3TUY B;  1CTR A;  3TZ1 A;  4I5L B;  4WQ3 A;  3DVM A;  2NLN A;  4HRH A;  2HPS A;  4MLW A;  1SKT A;  1F54 A;  4HSZ A;  2Y1N A;  1IH0 A;  1SMG A;  3TDI A;  1OOJ A;  1MXL C;  1DGU A;  3DD4 A;  4WQ2 A;  2M8U A;  5TNC A;  4XJK B;  2KAX A;  4FQO A;  2JTT A;  1R6P A;  1LA0 A;  2GGM A;  2LC5 A;  1D1O A;  2WOS A;  2JOJ A;  3BUX B;  1CLB A;  1KK7 Z;  3GK2 A;  1TNP A;  3HCM A;  5CSF A;  1B7T Z;  1F4Q A;  3JVT C;  1NCZ A;  1SCV A;  2ZN8 A;  1MHO A;  3OB1 B;  1A2X A;  2L98 A;  2JT8 A;  5DKR A;  4YI9 A;  4PDZ A;  1RRO A;  4CLN A;  4MN0 A;  1HT9 A;  1QS7 A;  4U8D A;  2G2B A;  2BEC A;  1UUR A;  4ICB A;  4MSP A;  1CDL A;  1BU3 A;  4GGF A;  1QAS A;  5CSI A;  1TOP A;  4YGD B;  3EK8 A;  1UHI A;  3LLE A;  1JFJ A;  2ZNE A;  1KQM C;  2MJW B;  1SK6 D;  1B8R A;  1QLK A;  4DIR A;  1C7V A;  2JTZ A;  3HX4 A;  3BUN B;  5IBW A;  1KFU L;  2A4J A;  2E6W A;  2KFF A;  3VGO A;  1TTX A;  3AAJ A;  4P5O E;  2LCP A;  1CMF A;  2LMV A;  2R2I A;  3WHU B;  2K61 A;  3RM1 A;  4GGN A;  4R1E A;  2KHN A;  1KFU S;  2B1U A;  1JSA A;  2KYF A;  1LA3 A;  2F2P A;  2WND A;  5D7F A;  5K89 A;  3ZNI A;  5AFP A;  1QVI Z;  2HF5 A;  1DVI A;  2ISD A;  1F70 A;  1QJT A;  1NX2 A;  5ER5 A;  2BCX A;  1IQ5 A;  1H8B A;  5HKZ A;  2KGR A;  5BPJ A;  1UWO A;  2Y5I A;  2JXL A;  3CTN A;  4GBA A;  1AVS A;  1YR5 A;  1NX1 A;  2OS8 C;  2F8P A;  3BUO B;  3OX6 A;  4CID A;  1WRK A;  1PSR A;  1REC A;  4USL A;  3BOW B;  3SJS A;  1S1E A;  1JF2 A;  1JWD A;  3DF0 B;  1CDP A;  1PVA A;  1NPQ A;  2LV7 A;  2AMI A;  2IS9 A;  3D10 A;  2BBN A;  2JNX A;  4GUK A;  3EVV A;  5I2O A;  4OCI A;  1TNQ A;  2K8M B;  2L51 A;  1L2O B;  2OTG B;  3NSK A;  1RK9 A;  4N1F A;  4ORB B;  2MBX A;  1CDM A;  1FW4 A;  2KI6 C;  1SY9 A;  4WRI A;  4A4C A;  1S5G Z;  3NSI A;  2HQW A;  2M3W A;  3TUY C;  1YRU B;  1CM4 A;  1PUL A;  1XK4 C;  1IRJ A;  3C1V A;  3O4Y A;  4CPV A;  2GV5 A;  2LNK A;  1CM1 A;  2KQY A;  3WNX B;  1XO5 A;  4AQJ A;  4CFR A;  2M1K B;  1YX8 A;  1Y6W A;  2KDH A;  1SL7 A;  1NIW A;  3CR4 X;  2L50 A;  3EK7 A;  2M7L A;  3PSR A;  1LIN A;  3ICB A;  1CKK A;  1S26 D;  2BE4 A;  3KEV A;  1K94 A;  1QX5 B;  4D1E A;  1G33 A;  3OX5 A;  3NSO A;  1BJF A;  2FCD A;  2JT0 A;  2SAS A;  1TRF A;  1BOD A;  4MVF A;  2MAZ A;  5FYX A;  1XFW O;  4DCK A;  1CFF A;  1YUR A;  3BUW B;  1MXE A;  3O78 A;  3RLZ A;  2MLE C;  1B1G A;  1K93 D;  2V53 A;  4HRG A;  2FCE A;  1G8I A;  3TS5 B;  1XA5 A;  1WDC B;  4GFT A;  5CPV A;  1AUI B;  1UHJ A;  2I94 A;  1CFC A;  3CR5 X;  4I5J A;  1GGZ A;  1K95 A;  1OZS A;  2LUC A;  1UHH A;  4L9M A;  2ZN9 A;  1QTX A;  4ORA B;  4QJ4 B;  1CMG A;  3VRN A;  4PE7 A;  2CTN A;  5JOL A;  2JQ6 A;  1OZO A;  1SRA A;  3JTD B;  3IQQ A;  1DF0 A;  3KF9 A;  2LLS A;  1IG5 A;  2L2E A;  1XYD A;  5HKW A;  2BKI B;  2KBM A;  2BCA A;  1EH2 A;  1EJ3 A;  3D0Y A;  2Y1M A;  4MRY A;  2K7B A;  1E8A A;  1DJX A;  1K9P A;  1LVC D;  4GAO A;  2G9B A;  1FI6 A;  2PMY A;  3SG5 A;  1M63 B;  3KHE A;  1NCY A;  1U5I A;  3H4S E;  1A75 B;  1BMO A;  1K9K A;  3MSE B;  2LAP A;  3WHT B;  4HRE E;  1S3P A;  4DS7 A;  4C0L A;  1GJY A;  2KSP A;  1SYM A;  2F3Z A;  1LXF C;  5GQQ C;  1DGV A;  3AKA A;  4GPL B;  1L2O C;  2OTG C;  3F45 A;  3I5F C;  3OHM B;  1WY9 A;  4NDB A;  2COL B;  4PCW A;  1WLM A;  5CSJ A;  3I5H C;  2M29 A;  1J7R A;  3GK4 X;  3PM8 A;  2LAN A;  1BT6 A;  2KAV A;  4M2O A;  4C0J A;  2LMU A;  1XFV O;  1RWY A;  4MZL A;  2KOT A;  2LP2 A;  1BLQ A;  5I2Q A;  1EXR A;  4N1G A;  1PSB A;  1NYA A;  2JNF A;  3PAL A;  2JZI A;  2K7D A;  2O5G A;  5D69 A;  1W7J B;  3LK0 A;  4C0K A;  3I5G B;  4M2Q A;  1JBA A;  2LVV A;  4BY4 A;  5KU1 A;  2NCO A;  2WCE A;  4DUQ A;  4GGF C;  2QAC A;  1KK7 Y;  5F6T A;  1B8L A;  1B7T Y;  2LLU A;  4PE1 A;  5AEQ A;  1NWD A;  5G08 A;  3NXA A;  1M31 A;  3DVE A;  1UHK A;  3SG7 A;  5I2L A;  1HQV A;  2GGZ A;  2KQ6 A;  2JC2 A;  4QJ5 B;  1EG4 A;  4OV2 A;  3I5F B;  1ZUZ A;  4JQ0 D;  2I2R E;  1NSH A;  3I5H B;  4MBE A;  5I8N A;  4DRW A;  1KCY A;  4QJ3 B;  3PN7 B;  5AXI A;  3IQO A;  5B8I B;  1WRZ A;  4XJK A;  1DJG A;  1KQV A;  3KPX A;  2H2K A;  2LLT A;  1YUU A;  1F4O A;  1SR6 B;  3TS5 C;  1WDC C;  4NDC A;  4MZJ A;  2LVJ A;  4XYN A;  4AQI A;  1FI5 A;  2BE6 A;  4YGB B;  5PAL A;  2KBI A;  2FOT A;  2KFG A;  1UP5 A;  1K96 A;  4I5K A;  2PSR A;  3SG6 A;  1Y1X A;  1S36 A;  2TN4 A;  1RJV A;  1Q80 A;  3I5I B;  3FIA A;  1JUO A;  1BOC A;  3K21 A;  1OMV A;  1BR4 B;  3FWC A;  1KSO A;  1B47 A;  1IKU A;  1KFX L;  2BKH B;  2KI4 B;  1B9A A;  2PAS A;  2L5X B;  3JTD C;  1AP4 A;  5JJG A;  4ZCV A;  3SG2 A;  1TN4 A;  1N2D A;  1K9U A;  1CFD A;  3CR2 A;  3NSL A;  3TDZ A;  4CFQ A;  1KFX S;  1H4B A;  5HLV A;  1SCM B;  2KGB C;  2ZRT A;  1TNW A;  2H61 C;  4IL1 A;  1UHN A;  3WXA A;  1FPW A;  1AJ4 A;  2KYC A;  2D8N A;  1QV0 A;  5HYD A;  2K2F A;  2BCB A;  3CZT X;  4NQG A;  3DVK A;  2JUL A;  3AKB A;  1TNX A;  1ZMZ A;  2F3Y A;  2CT9 A;  2KNE A;  5DKQ A;  1NP8 A;  1M39 A;  4YBH B;  1CDN A;  1ZFS A;  4ZCU A;  1XFZ O;  3SG4 A;  1DT7 B;  1IJ5 A;  1GGW A;  4NDD A;  1AJ5 A;  1YX7 A;  2Q4U A;  2M7N A;  5ER4 X;  3SIB A;  4JPZ B;  2FJU B;  1J1E A;  2MHH A;  2K7O A;  1LKJ A;  2L4I A;  1CB1 A;  1M45 A;  2BL0 B;  1RTP 1;  1B8C A;  1DJZ A;  1KWO B;  1SPY A;  1S6I A;  1KSM A;  1XFX O;  3CS1 A;  3CGA A;  2LHI A;  3BOW A;  1JFK A;  1K2H A;  4PE4 A;  3DF0 A;  1G4Y R;  2LE9 B;  3GOF A;  1ZOT B;  2RGI A;  1OMR A;  1YVL A;  5AAN A;  2EGD A;  1CLL A;  1PRW A;  2M97 A;  3I5G C;  1OE9 B;  1SNL A;  5J3X A;  2AAO A;  1J55 A;  5HKY A;  1KK8 B;  2I7A A;  2OPO A;  1WRL A;  3OB2 B;  1MR8 A;  2F2O A;  2VRG A;  1EG3 A;  2CNP A;  1Y0V H;  1J7O A;  1DMO A;  2EC6 B;  1MQ1 A;  1W7I B;  1VRK A;  1JF0 A;  2SCP A;  1ALW A;  2WCB A;  1N0Y A;  2PVB A;  3DVJ A;  3LK1 A;  3O2P A;  2LM5 A;  2PRU A;  4N5X A;  1SL9 A;  2O60 A;  1QX2 A;  3PFV A;  1DJW A;  2WCF A;  3FS7 A;  1YUS A;  2BBM A;  3O6B A;  2MRD A;  1C07 A;  1NX3 A;  3PN7 C;  2L0P A;  1DJH A;  2MA2 A;  2WOR A;  3PLF B;  1UUS A;  4GNK B;  1Y1U A;  3GK1 A;  3LCP C;  1N65 A;  2E30 A;  2LVK A;  3BQ3 A;  2F33 A;  5KTY A;  1SR6 C;  2Q91 A;  4TNC A;  1EL4 A;  4OKH A;  4UPG A;  2ZRS A;  4OR9 B;  2MLF C;  3EK4 A;  1C7W A;  1PK0 D;  4PHM A;  1DJY A;  1OQP A;  1IQ3 A;  2LP3 A;  2CBL A;  3BXK A;  2KI6 D;  3I5I C;  3QRX A;  3OP0 A;  3M0W A;  4PHK A;  1MF8 B;  1QXP A;  1OMD A;  3JVT B;  2KI4 C;  3EVR A;  1TCO B;  1YRT B;  2M1U A;  2LHL A;  1PVB A;  5AER A;  4YGA A;  1B4C A;  1XK4 A;  4Q04 A;  4YI8 A;  1OSA A;  4MRX A;  1YVH A; 
#chains in the Genus database with same CATH topology
 2ZKM X;  1M46 A;  2Y4Q A;  1SCM C;  1TIZ A;  1V1F A;  4A4B A;  2ERB A;  1NUB A;  4BY5 A;  2JPT A;  2LVI A;  4PHN A;  3S0F A;  1CLM A;  1PAL A;  1F71 A;  3LL8 B;  1ODB A;  1DF0 B;  2QPT A;  3PAT A;  1IGV A;  1MUX A;  1IJ6 A;  2P6B B;  2KFH A;  1YTZ C;  3D0Y B;  5CSN A;  3VRP A;  2JU0 A;  1WLZ A;  1AHR A;  1KQM B;  1NCX A;  1F8H A;  4YGE B;  4ETO A;  2K7C A;  2ZFD A;  3SG3 A;  1A03 A;  1A29 A;  1CNP A;  3BYA A;  1ALV A;  1S6C A;  2JRF A;  3EVU A;  1U5I B;  1QLS A;  1SL8 A;  3D77 A;  3D73 A;  2JXC A;  3S0B A;  2NCP A;  3VRQ A;  2K2A A;  2EHB A;  3A4U B;  2NXQ A;  2M49 B;  4ORC B;  2BL0 C;  3TDU A;  1QV1 A;  1JC2 A;  2LUX A;  1QVI Y;  1KWO C;  2H61 A;  1J7P A;  3CWG A;  5DKN A;  1A75 A;  4JWQ A;  1IWQ A;  2L4H A;  2QEO A;  1MWN A;  2DOQ A;  2K0J A;  3B7A A;  1DTL A;  3SIA A;  3EKH A;  5KSZ A;  4PE0 A;  1CFP A;  1NX0 A;  4FTG A;  1KK8 C;  4OVN F;  3FWB A;  2CCM A;  1R2U A;  1TCF A;  2AUC A;  2BNX A;  2JT3 A;  2ZND A;  3A8R A;  3BFB A;  4P2Y B;  4PAL A;  2LMT A;  1AK8 A;  2KAY A;  1ZAC A;  2OS8 B;  1J1D A;  2WC8 A;  1C3Y A;  1BF5 A;  1Y1A A;  1QIW A;  1SBJ A;  2EC6 C;  4F0Z B;  1XFY O;  2PYQ A;  3VRO A;  5I94 A;  5HLO A;  2M0R A;  3D78 A;  3KO0 A;  3S0G A;  1SW8 A;  1XVJ A;  3VRR A;  4YRU A;  1BG1 A;  4AOM A;  2WC5 A;  4PHJ A;  1J7Q A;  1L7Z A;  1A4P A;  1QIV A;  1QAT A;  2P70 A;  2PAL A;  4M2P A;  1BR1 B;  4YGC B;  3EKJ A;  2NZ0 A;  3CLN A;  3BUM B;  1FF1 A;  4I5N B;  3QME A;  1S5G Y;  5AAN A;  3ZWH A;  4F7F A;  1K90 D;  1QX7 A;  4E68 A;  2HQ8 A;  1RFJ A;  1YUT A;  2P71 A;  3IF7 A;  1F55 A;  2HET A;  3AAK A;  1DJI A;  2CXJ A;  1FBV A;  2M9G A;  4MEW A;  4MZK A;  1K8U A;  1X02 A;  1GQM A;  1V1G A;  1XFU O;  2I18 A;  2JWW A;  2WCH A;  1S6J A;  3E3R A;  1CTR A;  3OBV A;  1QWV A;  4I5L B;  3TZ1 A;  4WQ3 A;  3DVM A;  2NLN A;  4HRH A;  2HPS A;  4MLW A;  2K60 A;  1SKT A;  3K1E A;  1OOG A;  4HSZ A;  1F54 A;  2Y1N A;  1IH0 A;  1SMG A;  3TDI A;  1OOJ A;  1MXL C;  1DGU A;  1TUJ A;  3DD4 A;  4WQ2 A;  2M8U A;  5TNC A;  4XJK B;  2KAX A;  4FQO A;  2JTT A;  1R6P A;  1LA0 A;  2GGM A;  2LC5 A;  1D1O A;  2WOS A;  2JOJ A;  3BUX B;  1CLB A;  1KK7 Z;  3GK2 A;  1OW4 A;  1OOH A;  1TNP A;  3HCM A;  1B7T Z;  1F4Q A;  3JVT C;  5CSF A;  1NCZ A;  1SCV A;  2ZN8 A;  1MHO A;  3OB1 B;  2QEB A;  2YGU A;  1A2X A;  2L98 A;  2JT8 A;  2KPH A;  5DKR A;  4YI9 A;  4PDZ A;  1RRO A;  4CLN A;  4MN0 A;  1HT9 A;  1QS7 A;  4U8D A;  2G2B A;  3VB1 A;  2BEC A;  1UUR A;  4ICB A;  4MSP A;  1CDL A;  1BU3 A;  4GGF A;  1QAS A;  5CSI A;  1TOP A;  1XFR A;  4YGD B;  3EK8 A;  1UHI A;  3LLE A;  1ORG A;  2GTE A;  1JFJ A;  2ZNE A;  1KQM C;  2MJW B;  1SK6 D;  1B8R A;  1QLK A;  2WC6 A;  3D74 A;  2JTZ A;  4DIR A;  1C7V A;  3UNW A;  3D76 A;  2WCJ A;  3HX4 A;  3BUN B;  5IBW A;  1KFU L;  2A4J A;  2E6W A;  2KFF A;  3VGO A;  1TTX A;  3AAJ A;  4P5O E;  2LCP A;  1CMF A;  2LMV A;  2R2I A;  3WHU B;  2K61 A;  4FQT A;  3RM1 A;  4GGN A;  3PJI A;  4R1E A;  2KHN A;  4PT1 A;  1KFU S;  2B1U A;  1JSA A;  2KYF A;  3OGN A;  1LA3 A;  3CDN A;  2F2P A;  2WND A;  5D7F A;  5K89 A;  3ZNI A;  5AFP A;  1QVI Z;  2HF5 A;  1DVI A;  2ISD A;  1F70 A;  3NHT A;  1QJT A;  1NX2 A;  5ER5 A;  2BCX A;  1IQ5 A;  1H8B A;  5HKZ A;  2KGR A;  5BPJ A;  1UWO A;  1GM0 A;  2Y5I A;  2JXL A;  3CTN A;  4GBA A;  1AVS A;  1YR5 A;  1NX1 A;  2OS8 C;  2F8P A;  3BUO B;  2QDI A;  3OX6 A;  4CID A;  3FE8 A;  1WRK A;  1PSR A;  1REC A;  4USL A;  3BOW B;  3SJS A;  1S1E A;  1JF2 A;  1JWD A;  3DF0 B;  1CDP A;  1PVA A;  1NPQ A;  2LV7 A;  2AMI A;  2IS9 A;  3D10 A;  2BBN A;  2JNX A;  4GUK A;  1OOF A;  3EVV A;  5I2O A;  4OCI A;  1TNQ A;  2K8M B;  2L51 A;  1L2O B;  2OTG B;  3NSK A;  1RK9 A;  4N1F A;  4ORB B;  2MBX A;  1CDM A;  1FW4 A;  2KI6 C;  1SY9 A;  4WRI A;  4A4C A;  1S5G Z;  3NSI A;  2HQW A;  2M3W A;  3TUY C;  1YRU B;  1CM4 A;  1PUL A;  1XK4 C;  1IRJ A;  3C1V A;  3O4Y A;  4CPV A;  2GV5 A;  2LNK A;  1CM1 A;  2KQY A;  3WNX B;  1XO5 A;  4AQJ A;  4CFR A;  3D75 A;  5DIC A;  2WCM A;  2M1K B;  1YX8 A;  1Y6W A;  2KDH A;  1SL7 A;  1NIW A;  3CR4 X;  3N7H A;  2L50 A;  3EK7 A;  1Z4H A;  2M7L A;  3DZT A;  3Q8I A;  3PSR A;  1LIN A;  3ICB A;  1CKK A;  1S26 D;  1DQE A;  2BE4 A;  3KEV A;  4PCW A;  1K94 A;  1QX5 B;  4D1E A;  1G33 A;  3OX5 A;  3NSO A;  1BJF A;  3BFA A;  2FCD A;  2JT0 A;  2SAS A;  1TRF A;  3DY9 A;  1BOD A;  4MVF A;  2MAZ A;  5FYX A;  1XFW O;  4DCK A;  1CFF A;  1YUR A;  3BUW B;  1MXE A;  3O78 A;  3CYZ A;  3RLZ A;  3CAB A;  2MLE C;  1B1G A;  1K93 D;  3S0E A;  2V53 A;  4HRG A;  2FCE A;  1G8I A;  1TWO A;  3TS5 B;  1XA5 A;  1WDC B;  1DC1 A;  4GFT A;  5CPV A;  3PM2 A;  1AUI B;  3R1V A;  1UHJ A;  2I94 A;  1CFC A;  3CR5 X;  4I5J A;  1GGZ A;  1K95 A;  1OZS A;  2LUC A;  1UHH A;  4L9M A;  2ZN9 A;  1QTX A;  4ORA B;  4QJ4 B;  1CMG A;  3VRN A;  3CZ2 A;  3B88 A;  2CTN A;  4PE7 A;  5JOL A;  2WCL A;  2JQ6 A;  1OZO A;  1SRA A;  2FJY A;  3JTD B;  3IQQ A;  1DF0 A;  3KF9 A;  2LLS A;  1IG5 A;  2L2E A;  1XYD A;  1T14 A;  5HKW A;  2BKI B;  2KBM A;  2BCA A;  3DYE A;  1EH2 A;  1EJ3 A;  3D0Y A;  2Y1M A;  3IVT A;  2K7B A;  4MRY A;  1E8A A;  1DJX A;  1K9P A;  1LVC D;  3FE9 A;  4GAO A;  1C3Z A;  2G9B A;  4OZD A;  4IJ7 A;  1FI6 A;  2PMY A;  3SG5 A;  1M63 B;  3BJH A;  3KHE A;  1NCY A;  1U5I A;  3H4S E;  1A75 B;  1BMO A;  1K9K A;  3MSE B;  2LAP A;  3WHT B;  4HRE E;  1S3P A;  4DS7 A;  4C0L A;  1GJY A;  2KSP A;  1SYM A;  2F3Z A;  1LXF C;  3NHI A;  5GQQ C;  1DGV A;  3AKA A;  4GPL B;  4INX A;  1L2O C;  2OTG C;  1Z2C B;  3F45 A;  3I5F C;  1WY9 A;  3OHM B;  2COL B;  3B6X A;  4NDB A;  1WLM A;  4JD9 A;  5CSJ A;  3I5H C;  2M29 A;  3S0D A;  1J7R A;  2PQL A;  3GK4 X;  3PM8 A;  2LAN A;  1BT6 A;  2QEV A;  2KAV A;  4M2O A;  4C0J A;  2LMU A;  1XFV O;  1RWY A;  3R72 A;  3O4X A;  2KOT A;  2LP2 A;  4MZL A;  1BLQ A;  5I2Q A;  1EXR A;  4N1G A;  1DEL A;  4KYN A;  1PSB A;  1NYA A;  2JNF A;  3PAL A;  2JZI A;  2K7D A;  2O5G A;  5D69 A;  1W7J B;  3LK0 A;  4C0K A;  3I5G B;  4M2Q A;  1JBA A;  2LVV A;  4BY4 A;  5KU1 A;  2NCO A;  2WCE A;  4DUQ A;  4GGF C;  2QAC A;  1KK7 Y;  5F6T A;  1B8L A;  1B7T Y;  3BFH A;  2LLU A;  4PE1 A;  3L4L A;  5AEQ A;  1NWD A;  5G08 A;  3NXA A;  1M31 A;  3DVE A;  3R1O A;  1UHK A;  3SG7 A;  5I2L A;  1HQV A;  2GGZ A;  2KQ6 A;  3EG5 B;  2JC2 A;  3B87 A;  4QJ5 B;  1EG4 A;  4OV2 A;  3I5F B;  1ZUZ A;  4JQ0 D;  2I2R E;  1NSH A;  3I5H B;  4MBE A;  5I8N A;  4DRW A;  4INW A;  1KCY A;  4QJ3 B;  3PN7 B;  5AXI A;  3IQO A;  5B8I B;  1TUZ A;  1WRZ A;  4XJK A;  1DJG A;  1KQV A;  1P28 A;  2H8V A;  3KPX A;  2H2K A;  2LLT A;  1YUU A;  1F4O A;  1SR6 B;  3TS5 C;  1WDC C;  3DXL A;  4NDC A;  3SS3 A;  4MZJ A;  2LVJ A;  4XYN A;  4AQI A;  1FI5 A;  2BE6 A;  4YGB B;  4JKT A;  2KBI A;  5PAL A;  2FOT A;  2KFG A;  1UP5 A;  1K96 A;  4I5K A;  2PSR A;  3SG6 A;  1Y1X A;  1S36 A;  2TN4 A;  1RJV A;  1Q80 A;  1DEK A;  3I5I B;  3FIA A;  1JUO A;  1BOC A;  3K21 A;  1OMV A;  1BR4 B;  3FWC A;  3SS5 A;  1KSO A;  1B47 A;  1IKU A;  1KFX L;  2BKH B;  2KI4 B;  1B9A A;  2PAS A;  2L5X B;  3JTD C;  1AP4 A;  5JJG A;  4ZCV A;  3SG2 A;  5EL2 A;  1TN4 A;  1N2D A;  1K9U A;  5FI7 A;  1CFD A;  3CR2 A;  3NSL A;  3TDZ A;  4CFQ A;  1KFX S;  1H4B A;  3NGV A;  5HLV A;  1SCM B;  2KGB C;  2ZRT A;  1TNW A;  2H61 C;  1OOI X;  1UHN A;  4IL1 A;  3WXA A;  1FPW A;  1AJ4 A;  2KYC A;  2D8N A;  1QV0 A;  5HYD A;  5HL1 A;  2K2F A;  2BCB A;  3CZT X;  4NQG A;  3DVK A;  2JUL A;  3AKB A;  1TNX A;  1ZMZ A;  2F3Y A;  2CT9 A;  2KNE A;  5DKQ A;  1NP8 A;  1M39 A;  4YBH B;  3S0A A;  3FE6 A;  2QEH A;  1CDN A;  1ZFS A;  4ZCU A;  3TUY B;  1XFZ O;  3SG4 A;  1DT7 B;  1IJ5 A;  1GGW A;  4NDD A;  1AJ5 A;  1YX7 A;  2Q4U A;  2M7N A;  5ER4 X;  3SIB A;  4JPZ B;  2BAP A;  2FJU B;  1J1E A;  3SS4 A;  2MHH A;  2K7O A;  1LKJ A;  1W9Z A;  2L4I A;  1M45 A;  1CB1 A;  2BL0 B;  1RTP 1;  1B8C A;  1DJZ A;  1KWO B;  1SPY A;  1S6I A;  1KSM A;  1XFX O;  3CS1 A;  3CGA A;  2LHI A;  3BOW A;  5D3O A;  1JFK A;  1K2H A;  1SSE B;  4PE4 A;  3DF0 A;  1G4Y R;  2LE9 B;  3GOF A;  1ZOT B;  2RGI A;  1OMR A;  1YVL A;  2JPO A;  2EGD A;  1CLL A;  1PRW A;  2M97 A;  3I5G C;  1OE9 B;  1SNL A;  5J3X A;  2AAO A;  3V2L A;  1J55 A;  5HKY A;  1KK8 B;  2I7A A;  2OPO A;  1WRL A;  3OB2 B;  1MR8 A;  2F2O A;  2VRG A;  1EG3 A;  2CNP A;  1Y0V H;  2KLD A;  1J7O A;  1DMO A;  2EC6 B;  1MQ1 A;  1W7I B;  1VRK A;  1JF0 A;  2SCP A;  3RZS A;  1ALW A;  2WCB A;  1N0Y A;  2PVB A;  3DVJ A;  3LK1 A;  3O2P A;  2LM5 A;  2PRU A;  4N5X A;  1SL9 A;  2O60 A;  1QX2 A;  2WCK A;  3PFV A;  1DJW A;  2WCF A;  2KLE A;  3FS7 A;  1YUS A;  2BBM A;  3O6B A;  2MRD A;  1C07 A;  1NX3 A;  3PN7 C;  2L0P A;  1LS8 A;  3CZ0 A;  1DJH A;  2MA2 A;  2WOR A;  3PLF B;  1UUS A;  4GNK B;  1Y1U A;  3GK1 A;  3LCP C;  1N65 A;  3CZ1 A;  5FI2 A;  2E30 A;  2LVK A;  3BQ3 A;  2F33 A;  5KTY A;  1SR6 C;  2Q91 A;  4TNC A;  1EL4 A;  4OKH A;  4UPG A;  2ZRS A;  4OR9 B;  2MLF C;  3EK4 A;  1C7W A;  1PK0 D;  4PHM A;  1DJY A;  1OQP A;  3L4A A;  1IQ3 A;  3L47 A;  2LP3 A;  2CBL A;  1IIO A;  3BXK A;  2KI6 D;  3I5I C;  3QRX A;  3OP0 A;  3M0W A;  4PHK A;  5FI6 A;  1MF8 B;  1QXP A;  1OMD A;  3UO9 A;  2L5Y A;  3JVT B;  2KI4 C;  3R1P A;  3EVR A;  2L2C A;  1TCO B;  1YRT B;  2M1U A;  3B86 A;  2LHL A;  1PVB A;  5AER A;  4YGA A;  1B4C A;  1XK4 A;  4Q04 A;  4YI8 A;  1OSA A;  4MRX A;  1YVH A; 
#chains in the Genus database with same CATH homology
 2ZKM X;  1M46 A;  2Y4Q A;  1SCM C;  1TIZ A;  1V1F A;  4A4B A;  1NUB A;  4BY5 A;  2JPT A;  2LVI A;  4PHN A;  1F71 A;  1CLM A;  1PAL A;  3LL8 B;  1ODB A;  1DF0 B;  2QPT A;  3PAT A;  1IGV A;  1MUX A;  1IJ6 A;  2P6B B;  2KFH A;  1YTZ C;  3D0Y B;  5CSN A;  3VRP A;  2JU0 A;  1WLZ A;  1AHR A;  1KQM B;  1NCX A;  1F8H A;  4YGE B;  4ETO A;  2K7C A;  2ZFD A;  3SG3 A;  1A03 A;  1A29 A;  1CNP A;  3BYA A;  1ALV A;  1S6C A;  2JRF A;  3EVU A;  1U5I B;  1QLS A;  1SL8 A;  2JXC A;  2NCP A;  3VRQ A;  2K2A A;  2EHB A;  3A4U B;  2NXQ A;  2M49 B;  4ORC B;  2BL0 C;  3TDU A;  1QV1 A;  1JC2 A;  2LUX A;  1QVI Y;  1KWO C;  2H61 A;  1J7P A;  3CWG A;  5DKN A;  1A75 A;  4JWQ A;  1IWQ A;  2L4H A;  1MWN A;  2DOQ A;  2K0J A;  3SIA A;  1DTL A;  3EKH A;  5KSZ A;  4PE0 A;  1CFP A;  1NX0 A;  4FTG A;  1KK8 C;  4OVN F;  3FWB A;  2CCM A;  1R2U A;  1TCF A;  2AUC A;  2JT3 A;  2ZND A;  3A8R A;  4P2Y B;  4PAL A;  1AK8 A;  2LMT A;  2KAY A;  1ZAC A;  2OS8 B;  1J1D A;  2WC8 A;  1BF5 A;  1Y1A A;  1QIW A;  1SBJ A;  2EC6 C;  4F0Z B;  1XFY O;  3VRO A;  5HLO A;  2M0R A;  3KO0 A;  1SW8 A;  1XVJ A;  3VRR A;  4YRU A;  1BG1 A;  4AOM A;  4PHJ A;  1J7Q A;  1L7Z A;  1A4P A;  1QIV A;  1QAT A;  4M2P A;  2PAL A;  1BR1 B;  4YGC B;  3EKJ A;  2NZ0 A;  3CLN A;  3BUM B;  1FF1 A;  4I5N B;  1S5G Y;  3ZWH A;  1K90 D;  1QX7 A;  4E68 A;  2HQ8 A;  1RFJ A;  1YUT A;  3IF7 A;  1F55 A;  2HET A;  3AAK A;  1DJI A;  2CXJ A;  1FBV A;  2M9G A;  4MEW A;  4MZK A;  1K8U A;  1X02 A;  1GQM A;  1V1G A;  1XFU O;  2I18 A;  2JWW A;  3E3R A;  1S6J A;  3TUY B;  1CTR A;  3TZ1 A;  4I5L B;  4WQ3 A;  3DVM A;  2NLN A;  4HRH A;  2HPS A;  4MLW A;  1SKT A;  1F54 A;  4HSZ A;  2Y1N A;  1IH0 A;  1SMG A;  3TDI A;  1OOJ A;  1MXL C;  1DGU A;  3DD4 A;  4WQ2 A;  2M8U A;  5TNC A;  4XJK B;  2KAX A;  4FQO A;  2JTT A;  1R6P A;  1LA0 A;  2GGM A;  2LC5 A;  1D1O A;  2WOS A;  2JOJ A;  3BUX B;  1CLB A;  1KK7 Z;  3GK2 A;  1TNP A;  3HCM A;  5CSF A;  1B7T Z;  1F4Q A;  3JVT C;  1NCZ A;  1SCV A;  2ZN8 A;  1MHO A;  3OB1 B;  1A2X A;  2L98 A;  2JT8 A;  5DKR A;  4YI9 A;  4PDZ A;  1RRO A;  4CLN A;  4MN0 A;  1HT9 A;  1QS7 A;  4U8D A;  2G2B A;  2BEC A;  1UUR A;  4ICB A;  4MSP A;  1CDL A;  1BU3 A;  4GGF A;  1QAS A;  5CSI A;  1TOP A;  4YGD B;  3EK8 A;  1UHI A;  3LLE A;  1JFJ A;  2ZNE A;  1KQM C;  2MJW B;  1SK6 D;  1B8R A;  1QLK A;  4DIR A;  1C7V A;  2JTZ A;  3HX4 A;  3BUN B;  5IBW A;  1KFU L;  2A4J A;  2E6W A;  2KFF A;  3VGO A;  1TTX A;  3AAJ A;  4P5O E;  2LCP A;  1CMF A;  2LMV A;  2R2I A;  3WHU B;  2K61 A;  3RM1 A;  4GGN A;  4R1E A;  2KHN A;  1KFU S;  2B1U A;  1JSA A;  2KYF A;  1LA3 A;  2F2P A;  2WND A;  5D7F A;  5K89 A;  3ZNI A;  5AFP A;  1QVI Z;  2HF5 A;  1DVI A;  2ISD A;  1F70 A;  1QJT A;  1NX2 A;  5ER5 A;  2BCX A;  1IQ5 A;  1H8B A;  5HKZ A;  2KGR A;  5BPJ A;  1UWO A;  2Y5I A;  2JXL A;  3CTN A;  4GBA A;  1AVS A;  1YR5 A;  1NX1 A;  2OS8 C;  2F8P A;  3BUO B;  3OX6 A;  4CID A;  1WRK A;  1PSR A;  1REC A;  4USL A;  3BOW B;  3SJS A;  1S1E A;  1JF2 A;  1JWD A;  3DF0 B;  1CDP A;  1PVA A;  1NPQ A;  2LV7 A;  2AMI A;  2IS9 A;  3D10 A;  2BBN A;  2JNX A;  4GUK A;  3EVV A;  5I2O A;  4OCI A;  1TNQ A;  2K8M B;  2L51 A;  1L2O B;  2OTG B;  3NSK A;  1RK9 A;  4N1F A;  4ORB B;  2MBX A;  1CDM A;  1FW4 A;  2KI6 C;  1SY9 A;  4WRI A;  4A4C A;  1S5G Z;  3NSI A;  2HQW A;  2M3W A;  3TUY C;  1YRU B;  1CM4 A;  1PUL A;  1XK4 C;  1IRJ A;  3C1V A;  3O4Y A;  4CPV A;  2GV5 A;  2LNK A;  1CM1 A;  2KQY A;  3WNX B;  1XO5 A;  4AQJ A;  4CFR A;  2M1K B;  1YX8 A;  1Y6W A;  2KDH A;  1SL7 A;  1NIW A;  3CR4 X;  2L50 A;  3EK7 A;  2M7L A;  3PSR A;  1LIN A;  3ICB A;  1CKK A;  1S26 D;  2BE4 A;  3KEV A;  1K94 A;  1QX5 B;  4D1E A;  1G33 A;  3OX5 A;  3NSO A;  1BJF A;  2FCD A;  2JT0 A;  2SAS A;  1TRF A;  1BOD A;  4MVF A;  2MAZ A;  5FYX A;  1XFW O;  4DCK A;  1CFF A;  1YUR A;  3BUW B;  1MXE A;  3O78 A;  3RLZ A;  2MLE C;  1B1G A;  1K93 D;  2V53 A;  4HRG A;  2FCE A;  1G8I A;  3TS5 B;  1XA5 A;  1WDC B;  4GFT A;  5CPV A;  1AUI B;  1UHJ A;  2I94 A;  1CFC A;  3CR5 X;  4I5J A;  1GGZ A;  1K95 A;  1OZS A;  2LUC A;  1UHH A;  4L9M A;  2ZN9 A;  1QTX A;  4ORA B;  4QJ4 B;  1CMG A;  3VRN A;  4PE7 A;  2CTN A;  5JOL A;  2JQ6 A;  1OZO A;  1SRA A;  3JTD B;  3IQQ A;  1DF0 A;  3KF9 A;  2LLS A;  1IG5 A;  2L2E A;  1XYD A;  5HKW A;  2BKI B;  2KBM A;  2BCA A;  1EH2 A;  1EJ3 A;  3D0Y A;  2Y1M A;  4MRY A;  2K7B A;  1E8A A;  1DJX A;  1K9P A;  1LVC D;  4GAO A;  2G9B A;  1FI6 A;  2PMY A;  3SG5 A;  1M63 B;  3KHE A;  1NCY A;  1U5I A;  3H4S E;  1A75 B;  1BMO A;  1K9K A;  3MSE B;  2LAP A;  3WHT B;  4HRE E;  1S3P A;  4DS7 A;  4C0L A;  1GJY A;  2KSP A;  1SYM A;  2F3Z A;  1LXF C;  5GQQ C;  1DGV A;  3AKA A;  4GPL B;  1L2O C;  2OTG C;  3F45 A;  3I5F C;  3OHM B;  1WY9 A;  4NDB A;  2COL B;  4PCW A;  1WLM A;  5CSJ A;  3I5H C;  2M29 A;  1J7R A;  3GK4 X;  3PM8 A;  2LAN A;  1BT6 A;  2KAV A;  4M2O A;  4C0J A;  2LMU A;  1XFV O;  1RWY A;  4MZL A;  2KOT A;  2LP2 A;  1BLQ A;  5I2Q A;  1EXR A;  4N1G A;  1PSB A;  1NYA A;  2JNF A;  3PAL A;  2JZI A;  2K7D A;  2O5G A;  5D69 A;  1W7J B;  3LK0 A;  4C0K A;  3I5G B;  4M2Q A;  1JBA A;  2LVV A;  4BY4 A;  5KU1 A;  2NCO A;  2WCE A;  4DUQ A;  4GGF C;  2QAC A;  1KK7 Y;  5F6T A;  1B8L A;  1B7T Y;  2LLU A;  4PE1 A;  5AEQ A;  1NWD A;  5G08 A;  3NXA A;  1M31 A;  3DVE A;  1UHK A;  3SG7 A;  5I2L A;  1HQV A;  2GGZ A;  2KQ6 A;  2JC2 A;  4QJ5 B;  1EG4 A;  4OV2 A;  3I5F B;  1ZUZ A;  4JQ0 D;  2I2R E;  1NSH A;  3I5H B;  4MBE A;  5I8N A;  4DRW A;  1KCY A;  4QJ3 B;  3PN7 B;  5AXI A;  3IQO A;  5B8I B;  1WRZ A;  4XJK A;  1DJG A;  1KQV A;  3KPX A;  2H2K A;  2LLT A;  1YUU A;  1F4O A;  1SR6 B;  3TS5 C;  1WDC C;  4NDC A;  4MZJ A;  2LVJ A;  4XYN A;  4AQI A;  1FI5 A;  2BE6 A;  4YGB B;  5PAL A;  2KBI A;  2FOT A;  2KFG A;  1UP5 A;  1K96 A;  4I5K A;  2PSR A;  3SG6 A;  1Y1X A;  1S36 A;  2TN4 A;  1RJV A;  1Q80 A;  3I5I B;  3FIA A;  1JUO A;  1BOC A;  3K21 A;  1OMV A;  1BR4 B;  3FWC A;  1KSO A;  1B47 A;  1IKU A;  1KFX L;  2BKH B;  2KI4 B;  1B9A A;  2PAS A;  2L5X B;  3JTD C;  1AP4 A;  5JJG A;  4ZCV A;  3SG2 A;  1TN4 A;  1N2D A;  1K9U A;  1CFD A;  3CR2 A;  3NSL A;  3TDZ A;  4CFQ A;  1KFX S;  1H4B A;  5HLV A;  1SCM B;  2KGB C;  2ZRT A;  1TNW A;  2H61 C;  4IL1 A;  1UHN A;  3WXA A;  1FPW A;  1AJ4 A;  2KYC A;  2D8N A;  1QV0 A;  5HYD A;  2K2F A;  2BCB A;  3CZT X;  4NQG A;  3DVK A;  2JUL A;  3AKB A;  1TNX A;  1ZMZ A;  2F3Y A;  2CT9 A;  2KNE A;  5DKQ A;  1NP8 A;  1M39 A;  4YBH B;  1CDN A;  1ZFS A;  4ZCU A;  1XFZ O;  3SG4 A;  1DT7 B;  1IJ5 A;  1GGW A;  4NDD A;  1AJ5 A;  1YX7 A;  2Q4U A;  2M7N A;  5ER4 X;  3SIB A;  4JPZ B;  2FJU B;  1J1E A;  2MHH A;  2K7O A;  1LKJ A;  2L4I A;  1CB1 A;  1M45 A;  2BL0 B;  1RTP 1;  1B8C A;  1DJZ A;  1KWO B;  1SPY A;  1S6I A;  1KSM A;  1XFX O;  3CS1 A;  3CGA A;  2LHI A;  3BOW A;  1JFK A;  1K2H A;  4PE4 A;  3DF0 A;  1G4Y R;  2LE9 B;  3GOF A;  1ZOT B;  2RGI A;  1OMR A;  1YVL A;  5AAN A;  2EGD A;  1CLL A;  1PRW A;  2M97 A;  3I5G C;  1OE9 B;  1SNL A;  5J3X A;  2AAO A;  1J55 A;  5HKY A;  1KK8 B;  2I7A A;  2OPO A;  1WRL A;  3OB2 B;  1MR8 A;  2F2O A;  2VRG A;  1EG3 A;  2CNP A;  1Y0V H;  1J7O A;  1DMO A;  2EC6 B;  1MQ1 A;  1W7I B;  1VRK A;  1JF0 A;  2SCP A;  1ALW A;  2WCB A;  1N0Y A;  2PVB A;  3DVJ A;  3LK1 A;  3O2P A;  2LM5 A;  2PRU A;  4N5X A;  1SL9 A;  2O60 A;  1QX2 A;  3PFV A;  1DJW A;  2WCF A;  3FS7 A;  1YUS A;  2BBM A;  3O6B A;  2MRD A;  1C07 A;  1NX3 A;  3PN7 C;  2L0P A;  1DJH A;  2MA2 A;  2WOR A;  3PLF B;  1UUS A;  4GNK B;  1Y1U A;  3GK1 A;  3LCP C;  1N65 A;  2E30 A;  2LVK A;  3BQ3 A;  2F33 A;  5KTY A;  1SR6 C;  2Q91 A;  4TNC A;  1EL4 A;  4OKH A;  4UPG A;  2ZRS A;  4OR9 B;  2MLF C;  3EK4 A;  1C7W A;  1PK0 D;  4PHM A;  1DJY A;  1OQP A;  1IQ3 A;  2LP3 A;  2CBL A;  3BXK A;  2KI6 D;  3I5I C;  3QRX A;  3OP0 A;  3M0W A;  4PHK A;  1MF8 B;  1QXP A;  1OMD A;  3JVT B;  2KI4 C;  3EVR A;  1TCO B;  1YRT B;  2M1U A;  2LHL A;  1PVB A;  5AER A;  4YGA A;  1B4C A;  1XK4 A;  4Q04 A;  4YI8 A;  1OSA A;  4MRX A;  1YVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...