2OPOA

Crystal structure of the calcium-binding pollen allergen che a 3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
TPQDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDGFISFDEFTDFARANRGLVKDVSKIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polcalcin Che a 3
publication title Three-dimensional structure of the cross-reactive pollen allergen Che a 3: visualizing cross-reactivity on the molecular surfaces of weed, grass, and tree pollen allergens.
pubmed rcsb
source organism Chenopodium album
molecule tags Allergen
total genus 30
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2opoA00
1B47A 4M2QA 5D69A 5G08A 4NDCA 1UUSA 2KI4B 1AK8A 1XVJA 3BUWB 1PVBA 1QJTA 3SG4A 1YUSA 1YRTB 3C1VA 1TN4A 2EGDA 3A8RA 1K94A 3MSEB 4MN0A 3CTNA 1IQ5A 4NQGA 1CLMA 2P6BB 1CM4A 2L0PA 4MLWA 1N2DA 3BOWA 3LK1A 1FBVA 3KHEA 1YX7A 2KBMA 2KSPA 4PHKA 1YVHA 1J1EA 1BF5A 1CLBA 1ZMZA 4N1FA 1JWDA 2M3WA 3HCMA 1YVLA 3PATA 1KQVA 3HX4A 5KTYA 3SJSA 1K90D 1C7VA 2AUCA 1WLZA 2NLNA 2A4JA 3LK0A 3SG6A 5B8IB 4P2YB 2JT8A 1NIWA 1YRUB 2LVKA 1PRWA 3SIAA 4DRWA 2JNFA 2HQWA 2EC6C 3VRNA 2Q91A 1ALWA 1U5IA 1OMVA 1X02A 3FS7A 1CFFA 1SKTA 2KFHA 1SL7A 5BPJA 3OP0A 5CSFA 1DJYA 2H2KA 1M45A 3OHMB 4JPZB 1K9KA 1FW4A 2BCXA 2I7AA 1WDCB 2LM5A 3ICBA 1A03A 2M0RA 2ZRTA 3DF0A 3I5HC 3WHTB 3JTDC 1OQPA 3OX6A 1XA5A 4I5JA 1KFXS 4MEWA 1QVIZ 1S5GZ 2WCEA 1K8UA 4WRIA 1XFVO 3BUNB 4ORCB 3EKHA 3PSRA 3DVJA 1SMGA 1EL4A 1E8AA 1U5IB 2JQ6A 2KYFA 2V53A 2ZNEA 1GJYA 5DKNA 2OTGB 2L4IA 4TNCA 3I5GC 5HKZA 1BOCA 3O6BA 3I5IC 3EVRA 1K93D 3GOFA 4PE7A 2B1UA 4DUQA 2LLSA 2OS8B 1CKKA 2M7NA 2PRUA 1IH0A 2CTNA 1DF0B 3VGOA 1SL8A 3TUYC 1TOPA 4FTGA 1RFJA 2I2RE 2JTTA 1K96A 3DVKA 1AJ5A 1MQ1A 1DJXA 1S26D 1KSOA 1UHHA 1KQMB 1JF0A 1UHJA 1SY9A 3GK1A 2MA2A 1YTZC 1XFXO 2JC2A 4FQOA 5AERA 5I2LA 1EH2A 3D10A 2D8NA 5CSJA 3PFVA 3ZNIA 1RWYA 2LMVA 4ZCUA 3VRPA 5IBWA 5KSZA 2Y1MA 1H8BA 2LMTA 4C0LA 2IS9A 1NX2A 1W7IB 1QLKA 5I2QA 1XK4A 1D1OA 1SR6C 4U8DA 1FI5A 4PE0A 5DKRA 1A4PA 4JWQA 1CMGA 1JC2A 1NYAA 2PALA 1R2UA 1ODBA 2NZ0A 3WHUB 2MHHA 3BYAA 4NDDA 2H61A 1IKUA 1CDNA 5HLVA 2JXLA 1J7PA 2OPOA 3WNXB 1AVSA 1NX0A 4GUKA 2WCBA 2GV5A 1QATA 2WOSA 1DJGA 1BR4B 4PHMA 3VRQA 3E3RA 1SL9A 3IF7A 2BL0B 1QASA 2JWWA 4AQJA 1KK8C 3CLNA 4C0KA 1DVIA 1MUXA 1SK6D 3K21A 1TNWA 1NUBA 1OOJA 3IQQA 1IQ3A 1N65A 1BMOA 5CSNA 5HLOA 2KAVA 4GGFA 3TS5C 1QX7A 3CR2A 1WLMA 1NX1A 2SCPA 2GGZA 3EK4A 4E68A 2GGMA 1S6JA 3RLZA 1M63B 1Y1XA 3BXKA 1B1GA 2JOJA 5JJGA 1L2OC 3FIAA 1YR5A 2HF5A 1KCYA 1DJHA 2WC8A 3FWBA 4MVFA 4QJ4B 1H4BA 1CM1A 3D0YB 4XYNA 3EVUA 1DJIA 4DS7A 1KSMA 1MWNA 1EJ3A 2LHIA 3KO0A 4MRXA 1K95A 4C0JA 4PALA 1WRKA 4PE4A 3DVMA 3EVVA 1TNPA 1KWOB 1NCXA 1SCVA 1AJ4A 1EG4A 1TIZA 2LVVA 3IQOA 1OZOA 3KPXA 5HKWA 3SG2A 5CSIA 1S6IA 2F8PA 1KK7Z 1SBJA 2BBMA 5HYDA 1CB1A 1UWOA 3LLEA 2L4HA 2ISDA 1SYMA 2K7DA 4M2PA 3CR5X 4NDBA 2BKHB 5JOLA 1MXEA 1A75A 1KFXL 1QLSA 2CBLA 1QX5B 2BECA 5D7FA 2CXJA 2LLUA 1QV1A 2JT3A 1AHRA 1XFYO 2Y5IA 3H4SE 4PHNA 3KF9A 1LXFC 5F6TA 3AKBA 1LINA 1J55A 2RGIA 1FPWA 1YX8A 2COLB 4GFTA 1SCMC 2LV7A 1B7TZ 3PN7B 1RJVA 5FYXA 2KHNA 3JVTB 1DF0A 1CTRA 1WRLA 2JXCA 3O4YA 2KAYA 2JTZA 1XK4C 2ZN8A 3I5FB 4GAOA 1A75B 4HRGA 5PALA 1JF2A 2LLTA 2LANA 1CDMA 1BG1A 3PALA 5ER5A 4YI8A 3QRXA 1NX3A 4HREE 3TDIA 3SIBA 1F70A 2H61C 1F71A 4OR9B 2KI6C 2KFFA 2Q4UA 4Q04A 1KFUS 1QIVA 2PASA 3M0WA 4F0ZB 5KU1A 2L2EA 1OE9B 2KI4C 2JPTA 1OSAA 4I5LB 4N1GA 1CNPA 2MLFC 2PMYA 2NXQA 4PDZA 2K7CA 4BY5A 1LKJA 2I18A 3CWGA 4CLNA 1UP5A 1F4QA 2K0JA 1GGZA 3CS1A 3NSOA 2BE4A 1V1GA 2F2OA 4ORAB 4AOMA 1TTXA 1XYDA 4CFQA 2QACA 2PVBA 4MSPA 1BT6A 1Y1UA 2ZRSA 1BJFA 1UHNA 4PHJA 2LNKA 5DKQA 1Y0VH 1NCYA 1J7OA 1SNLA 2F3ZA 1NWDA 3CGAA 1B8RA 3NXAA 1AP4A 4YGEB 4GNKB 4MZJA 1JSAA 4ZCVA 1AUIB 2Y4QA 1Y6WA 1XFZO 1N0YA 1B8LA 2L50A 2KDHA 2LP3A 2BBNA 2ZNDA 4R1EA 1J7QA 2JZIA 3ZWHA 2G9BA 5CPVA 1OMDA 1SRAA 3WXAA 1K2HA 2WORA 2BCBA 4MBEA 4ORBB 4I5NB 4WQ3A 4OKHA 3F45A 2TN4A 3PLFB 2M29A 3CZTX 1PALA 2FCDA 3D0YA 2EHBA 1WDCC 2K7BA 4UPGA 2EC6B 2M9GA 1ALVA 2LE9B 1TRFA 1CMFA 1J1DA 1QIWA 1IWQA 4DCKA 1R6PA 1PK0D 1TNXA 1BLQA 1ZACA 2LVJA 3GK4X 1MR8A 2JNXA 1UURA 2LHLA 3SG5A 4BY4A 4OCIA 1NP8A 5TNCA 2Y1NA 1B9AA 1PSBA 4I5KA 1G4YR 5GQQC 2OTGC 3OB2B 1IG5A 3DD4A 2HETA 3I5HB 3JTDB 1CFCA 1XFUO 2M8UA 2M97A 3SG3A 2AAOA 1GQMA 2JULA 1F55A 2OS8C 2K7OA 2L51A 4QJ5B 1QV0A 2KI6D 1RK9A 2JRFA 4CFRA 2K2AA 1ZOTB 1TCFA 2MRDA 3NSKA 5HKYA 1F8HA 1QVIY 1S5GY 1KQMC 5ER4X 1MF8B 3I5GB 1NSHA 1QX2A 3DVEA 3I5IB 4XJKB 1RROA 4QJ3B 3BUXB 1WY9A 3A4UB 4L9MA 1JBAA 4P5OE 1LVCD 2WNDA 4OV2A 1PVAA 3TUYB 1YURA 2MAZA 1DGVA 1TCOB 2E30A 1S1EA 1QTXA 2LAPA 2M1KB 2F3YA 1W7JB 2JT0A 1IGVA 2FCEA 1IRJA 3TDZA 2VRGA 2KFGA 2KQYA 4A4CA 1Y1AA 5AEQA 3EK7A 4GBAA 1FF1A 2L5XB 1DJWA 1IJ6A 3O2PA 2KYCA 1KFUL 1PSRA 1SR6B 1G33A 1G8IA 4MRYA 1ZUZA 2O5GA 2ZFDA 1BODA 2E6WA 1S3PA 1DMOA 1K9UA 2CT9A 5I8NA 4A4BA 2KAXA 1DT7B 4USLA 4PCWA 2CNPA 2K2FA 3BOWB 1UHKA 2BL0C 2NCPA 1L7ZA 1SPYA 4CIDA 2K61A 4DIRA 1K9PA 2BKIB 2JU0A 1CLLA 3PM8A 4WQ2A 3TDUA 2BCAA 1Q80A 2KNEA 3CR4X 1M39A 1A29A 4IL1A 5I2OA 4HRHA 4ICBA 4MZLA 4YGBB 2KQ6A 4JQ0D 2L98A 1JUOA 1OMRA 2ZKMX 4GPLB 1RTP1 2LUXA 1YUUA 1WRZA 1NCZA 2BE6A 2KGRA 2M1UA 1HT9A 1J7RA 1KK8B 3BQ3A 2LVIA 2FJUB 2O60A 2PSRA 1TNQA 4N5XA 4YGCB 1C07A 4YBHB 1B8CA 1OZSA 3TS5B 2KOTA 2G2BA 1CDPA 1PULA 4ETOA 1S6CA 2NCOA 4OVNF 4PE1A 1EXRA 3NSLA 1MXLC 2F2PA 2MBXA 3VROA 4GGFC 4D1EA 2HQ8A 5K89A 1KWOC 1L2OB 4HSZA 2HPSA 2LCPA 2MJWB 1S36A 1M46A 2LC5A 1F54A 3DF0B 3LL8B 1XFWO 2F33A 4YI9A 3LCPC 1JFJA 2CCMA 1DTLA 3RM1A 1B4CA 2LMUA 2MLEC 3GK2A 3AKAA 1GGWA 5AANA 1ZFSA 2R2IA 4GGNA 1YUTA 2K8MB 1DGUA 2DOQA 2SASA 4M2OA 1C7WA 3VRRA 1BR1B 1VRKA 1F4OA 1V1FA 3NSIA 1M31A 2LP2A 2QPTA 3EKJA 1KK7Y 3PN7C 1UHIA 5J3XA 1MHOA 3JVTC 1LA0A 3BUMB 2M49B 4MZKA 1QXPA 4YRUA 3I5FC 3O78A 1XO5A 2AMIA 2KGBC 3SG7A 4XJKA 4YGAA 1DJZA 3AAJA 1SCMB 3FWCA 1NPQA 3TZ1A 2FOTA 1CFDA 3BUOB 3OX5A 4CPVA 5AFPA 5AXIA 1SW8A 1BU3A 2M7LA 2WCFA 1HQVA 2ZN9A 1CFPA 1RECA 1EG3A 1CDLA 2KBIA 3KEVA 1B7TY 3OB1B 3AAKA 1JFKA 1LA3A 1QS7A 3EK8A 1FI6A 2LUCA 4AQIA 1IJ5A 2I94A 1A2XA 4YGDB
chains in the Genus database with same CATH superfamily
1B47A 2WCHA 4M2QA 5D69A 5G08A 4NDCA 1UUSA 2KI4B 2P71A 1AK8A 1XVJA 3BUWB 1PVBA 1QJTA 3B87A 1YUSA 3SG4A 1YRTB 3C1VA 4PT1A 1TN4A 2EGDA 3A8RA 3DYEA 1K94A 3MSEB 3CABA 4MN0A 3CTNA 1IQ5A 4NQGA 1CLMA 1DEKA 2P6BB 1CM4A 2L0PA 4MLWA 1N2DA 3BOWA 3LK1A 1FBVA 3KHEA 1YX7A 2KBMA 1XFRA 2KSPA 1YVHA 1J1EA 4PHKA 1BF5A 1GM0A 1CLBA 1ZMZA 4N1FA 1JWDA 2M3WA 3HCMA 1YVLA 3N7HA 3PATA 1KQVA 3D75A 3HX4A 1OOGA 3SJSA 1K90D 1OOIX 5KTYA 1C7VA 2AUCA 1WLZA 2NLNA 2A4JA 3LK0A 3SG6A 5B8IB 4P2YB 1ORGA 2JT8A 2P70A 1NIWA 1DC1A 1YRUB 2LVKA 1PRWA 2KLEA 3SIAA 3FE9A 4DRWA 2JNFA 2HQWA 2EC6C 4INWA 3VRNA 2Q91A 1ALWA 1U5IA 1OMVA 1X02A 3FS7A 1CFFA 1SKTA 2KFHA 1SL7A 5BPJA 3CZ1A 3OP0A 5CSFA 1DJYA 2H2KA 1M45A 3OHMB 4JPZB 1K9KA 1FW4A 2BCXA 2QEBA 2I7AA 1WDCB 2LM5A 3ICBA 1A03A 2M0RA 2ZRTA 3DF0A 3I5HC 3WHTB 3JTDC 1OQPA 3OX6A 1XA5A 4I5JA 1KFXS 4MEWA 1QVIZ 1S5GZ 3B88A 2WCEA 1K8UA 4WRIA 1XFVO 3BUNB 4ORCB 3EKHA 3PSRA 3DVJA 3RZSA 1SMGA 1EL4A 1E8AA 1U5IB 2JQ6A 2KYFA 2V53A 2ZNEA 1GJYA 5DKNA 2OTGB 2L4IA 4TNCA 3I5GC 5HKZA 1BOCA 3O6BA 3I5IC 3EVRA 1K93D 3GOFA 4PE7A 2B1UA 3V2LA 3S0AA 4DUQA 2LLSA 1C3ZA 2OS8B 1CKKA 2M7NA 2PRUA 2BNXA 1IH0A 2CTNA 1DF0B 3VGOA 1SL8A 3TUYC 1TOPA 4FTGA 5FI6A 1RFJA 2I2RE 2JTTA 1K96A 3DVKA 1AJ5A 1MQ1A 1DJXA 1S26D 1KSOA 3D74A 1UHHA 1KQMB 1TWOA 1UHJA 1JF0A 1SY9A 3GK1A 2MA2A 1YTZC 1XFXO 2JC2A 4FQOA 5AERA 5I2LA 1EH2A 3D10A 2D8NA 5CSJA 3PFVA 3ZNIA 1RWYA 2LMVA 4ZCUA 3VRPA 5IBWA 5KSZA 2Y1MA 1H8BA 2LMTA 4C0LA 2IS9A 1NX2A 1W7IB 3FE6A 1QLKA 5I2QA 1XK4A 1D1OA 1SR6C 4U8DA 1FI5A 5I94A 3S0GA 4PE0A 5DKRA 1A4PA 4JWQA 1CMGA 1JC2A 1NYAA 2PALA 1R2UA 1ODBA 2NZ0A 3WHUB 2MHHA 3BYAA 4NDDA 2H61A 2KLDA 1IKUA 1CDNA 5HLVA 2JXLA 1J7PA 2OPOA 3WNXB 1AVSA 1NX0A 4GUKA 2WCBA 2GV5A 1QATA 2WOSA 1DJGA 3IVTA 1BR4B 4PHMA 3VRQA 3E3RA 1SL9A 3IF7A 2BL0B 1QASA 3EG5B 3CZ0A 2JWWA 4AQJA 1KK8C 3CLNA 4C0KA 1DVIA 1MUXA 1SK6D 3K21A 1TNWA 1NUBA 1OOJA 3IQQA 4JD9A 1N65A 1IQ3A 1BMOA 5CSNA 2WCLA 5HLOA 2KAVA 4GGFA 2K60A 1QX7A 3TS5C 2QEVA 3CR2A 1WLMA 5HL1A 1NX1A 2SCPA 2GGZA 3EK4A 4E68A 2GGMA 1S6JA 1LS8A 3RLZA 1M63B 1Y1XA 3BXKA 1B1GA 2JOJA 5JJGA 1L2OC 3FIAA 4IJ7A 1YR5A 2HF5A 2WCJA 1DJHA 2WC8A 3FWBA 4MVFA 1KCYA 4QJ4B 3PM2A 3D78A 1H4BA 1CM1A 3D0YB 4XYNA 3EVUA 1DJIA 4DS7A 1KSMA 1MWNA 1EJ3A 4INXA 3UO9A 2LHIA 3CDNA 3KO0A 4MRXA 1K95A 3NGVA 2WCMA 4C0JA 4PALA 1WRKA 3OBVA 4PE4A 3DVMA 3EVVA 1TNPA 1KWOB 1NCXA 1SCVA 1AJ4A 1EG4A 1TIZA 2LVVA 3IQOA 1OZOA 3KPXA 5HKWA 3SG2A 5CSIA 1S6IA 2F8PA 1KK7Z 1SBJA 2BBMA 5HYDA 1CB1A 1UWOA 3LLEA 2L4HA 2ISDA 1SYMA 2K7DA 4M2PA 3CR5X 4NDBA 2BKHB 5JOLA 3UNWA 1MXEA 1A75A 1KFXL 1QLSA 2CBLA 3OGNA 1QX5B 2BECA 5D7FA 3S0DA 2CXJA 2LLUA 4F7FA 1QV1A 2JT3A 3R1OA 1AHRA 1XFYO 2Y5IA 3H4SE 4PHNA 3KF9A 1LXFC 5F6TA 3AKBA 1LINA 1J55A 2RGIA 1FPWA 1YX8A 2COLB 4GFTA 1SCMC 2LV7A 1B7TZ 3PN7B 1RJVA 3R1VA 2KHNA 3JVTB 5FYXA 1DF0A 1CTRA 3D76A 1WRLA 2JXCA 3O4YA 2KAYA 2JTZA 1XK4C 2ZN8A 3I5FB 4GAOA 1A75B 4HRGA 5PALA 1JF2A 2LLTA 2LANA 1CDMA 1BG1A 3PALA 5ER5A 4YI8A 5DICA 3SS5A 3QRXA 1NX3A 4HREE 3TDIA 3SIBA 1TUZA 1F70A 2H61C 1F71A 4OR9B 2KI6C 2KFFA 2Q4UA 4Q04A 1KFUS 1QIVA 2PASA 3DXLA 3M0WA 4F0ZB 5KU1A 2L2EA 1OE9B 2KI4C 2JPTA 3CZ2A 1OSAA 4I5LB 4N1GA 1CNPA 2MLFC 2PMYA 4JKTA 2NXQA 4PDZA 2K7CA 4BY5A 1LKJA 2I18A 3B86A 3CWGA 1UP5A 4CLNA 1OW4A 1F4QA 2PQLA 2K0JA 1GGZA 3CS1A 3S0BA 3NSOA 1DQEA 2QEHA 2BE4A 2H8VA 1V1GA 2F2OA 4ORAB 3VB1A 4AOMA 1TTXA 1XYDA 4CFQA 2QACA 2PVBA 4MSPA 1BT6A 1Y1UA 2ZRSA 3BFHA 1BJFA 1UHNA 4PHJA 1C3YA 2LNKA 5DKQA 1Y0VH 1NCYA 1J7OA 1SNLA 2F3ZA 3K1EA 1NWDA 3CGAA 1B8RA 3NXAA 1AP4A 3D77A 2L2CA 4YGEB 4GNKB 4MZJA 1JSAA 4ZCVA 1AUIB 2Y4QA 1Y6WA 1XFZO 5FI2A 1N0YA 1B8LA 2L50A 2KDHA 2LP3A 2BBNA 2ZNDA 3L4AA 3R1PA 4R1EA 3SS4A 1J7QA 2JZIA 3S0FA 3ZWHA 2G9BA 3NHTA 5CPVA 1Z2CB 3DZTA 1OMDA 1SRAA 3WXAA 1K2HA 2WORA 2BCBA 4MBEA 4ORBB 4I5NB 4WQ3A 4OKHA 3F45A 2TN4A 3PLFB 2BAPA 2M29A 3CZTX 1PALA 2FCDA 3D0YA 3SS3A 2EHBA 1WDCC 2K7BA 4UPGA 1Z4HA 2EC6B 2M9GA 1ALVA 2LE9B 1TRFA 1CMFA 1J1DA 1QIWA 1IWQA 4DCKA 1R6PA 1PK0D 1TNXA 1BLQA 1ZACA 2LVJA 3GK4X 1MR8A 4KYNA 1W9ZA 1UURA 2JNXA 2LHLA 3SG5A 4BY4A 4OCIA 1NP8A 5TNCA 2Y1NA 1B9AA 1PSBA 4I5KA 1G4YR 5GQQC 2OTGC 3OB2B 1IG5A 2YGUA 3DD4A 2HETA 3I5HB 3JTDB 1CFCA 1XFUO 2PYQA 2M8UA 2M97A 3Q8IA 1GQMA 2AAOA 2JULA 3SG3A 1F55A 2L5YA 1T14A 2OS8C 2K7OA 2L51A 4QJ5B 1QV0A 2KI6D 1RK9A 2JRFA 4CFRA 5D3OA 2K2AA 1ZOTB 1TCFA 2MRDA 3CYZA 1QWVA 3NSKA 5HKYA 1QVIY 1S5GY 1KQMC 5ER4X 1MF8B 3I5GB 1F8HA 1NSHA 1QX2A 3DVEA 3I5IB 4XJKB 1RROA 4QJ3B 3BUXB 1WY9A 3A4UB 4L9MA 1JBAA 4P5OE 1LVCD 2WCKA 2WNDA 4OV2A 1PVAA 3TUYB 1YURA 2MAZA 1DGVA 1TCOB 1TUJA 2E30A 1S1EA 1QTXA 2LAPA 2M1KB 2F3YA 1W7JB 2JT0A 1IIOA 1IGVA 2QDIA 2FCEA 1IRJA 2KPHA 3TDZA 2VRGA 2KFGA 2KQYA 4A4CA 1Y1AA 5AEQA 3EK7A 4GBAA 3QMEA 1FF1A 2QEOA 2L5XB 1DJWA 1IJ6A 2GTEA 3O2PA 3S0EA 2KYCA 1KFUL 1PSRA 1SR6B 1G33A 1G8IA 4MRYA 1ZUZA 2O5GA 2ZFDA 1BODA 2E6WA 1S3PA 2WC5A 1DELA 4OZDA 1DMOA 1K9UA 2CT9A 2JPOA 5I8NA 4A4BA 2KAXA 3NHIA 1DT7B 4USLA 3R72A 2CNPA 2K2FA 4PCWA 3BOWB 1UHKA 2BL0C 2NCPA 1L7ZA 1SPYA 4CIDA 2K61A 4DIRA 1K9PA 2BKIB 4FQTA 2JU0A 1CLLA 3PM8A 4WQ2A 3TDUA 3BFAA 2BCAA 1Q80A 2KNEA 3CR4X 1M39A 1A29A 4IL1A 5I2OA 4HRHA 4ICBA 4MZLA 4YGBB 2KQ6A 4JQ0D 2L98A 1JUOA 1OMRA 2ZKMX 4GPLB 1RTP1 2LUXA 1YUUA 1WRZA 1NCZA 2BE6A 2KGRA 2M1UA 1HT9A 1J7RA 1KK8B 3BQ3A 2LVIA 2FJUB 2O60A 2PSRA 1TNQA 4N5XA 4YGCB 1C07A 4YBHB 1B8CA 1P28A 1OZSA 3TS5B 2KOTA 2G2BA 1CDPA 1PULA 4ETOA 1S6CA 2NCOA 4OVNF 4PE1A 1EXRA 3BFBA 1MXLC 3NSLA 2F2PA 2MBXA 3VROA 4GGFC 4D1EA 2HQ8A 5K89A 1KWOC 1L2OB 1OOFA 3B7AA 2HPSA 4HSZA 2LCPA 2MJWB 3L47A 1S36A 1M46A 2LC5A 1F54A 3DF0B 3FE8A 3LL8B 1XFWO 2F33A 4YI9A 3LCPC 1OOHA 1JFJA 2CCMA 1DTLA 3RM1A 1B4CA 2LMUA 2MLEC 3GK2A 3AKAA 1GGWA 5AANA 1ZFSA 2R2IA 4GGNA 1YUTA 2K8MB 1SSEB 1DGUA 2DOQA 2SASA 4M2OA 1C7WA 3VRRA 1BR1B 5FI7A 1VRKA 1F4OA 1V1FA 3NSIA 1M31A 2LP2A 2QPTA 3EKJA 1KK7Y 3PN7C 1UHIA 5J3XA 1MHOA 3JVTC 1LA0A 3BUMB 2M49B 2ERBA 3O4XA 4MZKA 1QXPA 4YRUA 3I5FC 3L4LA 3O78A 1XO5A 2AMIA 3PJIA 2KGBC 3SG7A 4XJKA 2FJYA 4YGAA 1DJZA 5EL2A 3AAJA 1SCMB 3DY9A 3FWCA 1NPQA 3TZ1A 2FOTA 1CFDA 3BUOB 3OX5A 4CPVA 5AFPA 5AXIA 1SW8A 1BU3A 2M7LA 2WCFA 1HQVA 2ZN9A 3B6XA 1CFPA 1RECA 1EG3A 1CDLA 2KBIA 3KEVA 1B7TY 3OB1B 3AAKA 1JFKA 3D73A 1LA3A 3BJHA 1QS7A 2WC6A 3EK8A 2LUCA 4AQIA 1IJ5A 2I94A 1FI6A 1A2XA 4YGDB
chains in the Genus database with same CATH topology
1B47A 4M2QA 5D69A 5G08A 4NDCA 1UUSA 2KI4B 1AK8A 1XVJA 3BUWB 1PVBA 1QJTA 3SG4A 1YUSA 1YRTB 3C1VA 1TN4A 2EGDA 3A8RA 1K94A 3MSEB 4MN0A 3CTNA 1IQ5A 4NQGA 1CLMA 2P6BB 1CM4A 2L0PA 4MLWA 1N2DA 3BOWA 3LK1A 1FBVA 3KHEA 1YX7A 2KBMA 2KSPA 4PHKA 1YVHA 1J1EA 1BF5A 1CLBA 1ZMZA 4N1FA 1JWDA 2M3WA 3HCMA 1YVLA 3PATA 1KQVA 3HX4A 5KTYA 3SJSA 1K90D 1C7VA 2AUCA 1WLZA 2NLNA 2A4JA 3LK0A 3SG6A 5B8IB 4P2YB 2JT8A 1NIWA 1YRUB 2LVKA 1PRWA 3SIAA 4DRWA 2JNFA 2HQWA 2EC6C 3VRNA 2Q91A 1ALWA 1U5IA 1OMVA 1X02A 3FS7A 1CFFA 1SKTA 2KFHA 1SL7A 5BPJA 3OP0A 5CSFA 1DJYA 2H2KA 1M45A 3OHMB 4JPZB 1K9KA 1FW4A 2BCXA 2I7AA 1WDCB 2LM5A 3ICBA 1A03A 2M0RA 2ZRTA 3DF0A 3I5HC 3WHTB 3JTDC 1OQPA 3OX6A 1XA5A 4I5JA 1KFXS 4MEWA 1QVIZ 1S5GZ 2WCEA 1K8UA 4WRIA 1XFVO 3BUNB 4ORCB 3EKHA 3PSRA 3DVJA 1SMGA 1EL4A 1E8AA 1U5IB 2JQ6A 2KYFA 2V53A 2ZNEA 1GJYA 5DKNA 2OTGB 2L4IA 4TNCA 3I5GC 5HKZA 1BOCA 3O6BA 3I5IC 3EVRA 1K93D 3GOFA 4PE7A 2B1UA 4DUQA 2LLSA 2OS8B 1CKKA 2M7NA 2PRUA 1IH0A 2CTNA 1DF0B 3VGOA 1SL8A 3TUYC 1TOPA 4FTGA 1RFJA 2I2RE 2JTTA 1K96A 3DVKA 1AJ5A 1MQ1A 1DJXA 1S26D 1KSOA 1UHHA 1KQMB 1JF0A 1UHJA 1SY9A 3GK1A 2MA2A 1YTZC 1XFXO 2JC2A 4FQOA 5AERA 5I2LA 1EH2A 3D10A 2D8NA 5CSJA 3PFVA 3ZNIA 1RWYA 2LMVA 4ZCUA 3VRPA 5IBWA 5KSZA 2Y1MA 1H8BA 2LMTA 4C0LA 2IS9A 1NX2A 1W7IB 1QLKA 5I2QA 1XK4A 1D1OA 1SR6C 4U8DA 1FI5A 4PE0A 5DKRA 1A4PA 4JWQA 1CMGA 1JC2A 1NYAA 2PALA 1R2UA 1ODBA 2NZ0A 3WHUB 2MHHA 3BYAA 4NDDA 2H61A 1IKUA 1CDNA 5HLVA 2JXLA 1J7PA 2OPOA 3WNXB 1AVSA 1NX0A 4GUKA 2WCBA 2GV5A 1QATA 2WOSA 1DJGA 1BR4B 4PHMA 3VRQA 3E3RA 1SL9A 3IF7A 2BL0B 1QASA 2JWWA 4AQJA 1KK8C 3CLNA 4C0KA 1DVIA 1MUXA 1SK6D 3K21A 1TNWA 1NUBA 1OOJA 3IQQA 1IQ3A 1N65A 1BMOA 5CSNA 5HLOA 2KAVA 4GGFA 3TS5C 1QX7A 3CR2A 1WLMA 1NX1A 2SCPA 2GGZA 3EK4A 4E68A 2GGMA 1S6JA 3RLZA 1M63B 1Y1XA 3BXKA 1B1GA 2JOJA 5JJGA 1L2OC 3FIAA 1YR5A 2HF5A 1KCYA 1DJHA 2WC8A 3FWBA 4MVFA 4QJ4B 1H4BA 1CM1A 3D0YB 4XYNA 3EVUA 1DJIA 4DS7A 1KSMA 1MWNA 1EJ3A 2LHIA 3KO0A 4MRXA 1K95A 4C0JA 4PALA 1WRKA 4PE4A 3DVMA 3EVVA 1TNPA 1KWOB 1NCXA 1SCVA 1AJ4A 1EG4A 1TIZA 2LVVA 3IQOA 1OZOA 3KPXA 5HKWA 3SG2A 5CSIA 1S6IA 2F8PA 1KK7Z 1SBJA 2BBMA 5HYDA 1CB1A 1UWOA 3LLEA 2L4HA 2ISDA 1SYMA 2K7DA 4M2PA 3CR5X 4NDBA 2BKHB 5JOLA 1MXEA 1A75A 1KFXL 1QLSA 2CBLA 1QX5B 2BECA 5D7FA 2CXJA 2LLUA 1QV1A 2JT3A 1AHRA 1XFYO 2Y5IA 3H4SE 4PHNA 3KF9A 1LXFC 5F6TA 3AKBA 1LINA 1J55A 2RGIA 1FPWA 1YX8A 2COLB 4GFTA 1SCMC 2LV7A 1B7TZ 3PN7B 1RJVA 5FYXA 2KHNA 3JVTB 1DF0A 1CTRA 1WRLA 2JXCA 3O4YA 2KAYA 2JTZA 1XK4C 2ZN8A 3I5FB 4GAOA 1A75B 4HRGA 5PALA 1JF2A 2LLTA 2LANA 1CDMA 1BG1A 3PALA 5ER5A 4YI8A 3QRXA 1NX3A 4HREE 3TDIA 3SIBA 1F70A 2H61C 1F71A 4OR9B 2KI6C 2KFFA 2Q4UA 4Q04A 1KFUS 1QIVA 2PASA 3M0WA 4F0ZB 5KU1A 2L2EA 1OE9B 2KI4C 2JPTA 1OSAA 4I5LB 4N1GA 1CNPA 2MLFC 2PMYA 2NXQA 4PDZA 2K7CA 4BY5A 1LKJA 2I18A 3CWGA 4CLNA 1UP5A 1F4QA 2K0JA 1GGZA 3CS1A 3NSOA 2BE4A 1V1GA 2F2OA 4ORAB 4AOMA 1TTXA 1XYDA 4CFQA 2QACA 2PVBA 4MSPA 1BT6A 1Y1UA 2ZRSA 1BJFA 1UHNA 4PHJA 2LNKA 5DKQA 1Y0VH 1NCYA 1J7OA 1SNLA 2F3ZA 1NWDA 3CGAA 1B8RA 3NXAA 1AP4A 4YGEB 4GNKB 4MZJA 1JSAA 4ZCVA 1AUIB 2Y4QA 1Y6WA 1XFZO 1N0YA 1B8LA 2L50A 2KDHA 2LP3A 2BBNA 2ZNDA 4R1EA 1J7QA 2JZIA 3ZWHA 2G9BA 5CPVA 1OMDA 1SRAA 3WXAA 1K2HA 2WORA 2BCBA 4MBEA 4ORBB 4I5NB 4WQ3A 4OKHA 3F45A 2TN4A 3PLFB 2M29A 3CZTX 1PALA 2FCDA 3D0YA 2EHBA 1WDCC 2K7BA 4UPGA 2EC6B 2M9GA 1ALVA 2LE9B 1TRFA 1CMFA 1J1DA 1QIWA 1IWQA 4DCKA 1R6PA 1PK0D 1TNXA 1BLQA 1ZACA 2LVJA 3GK4X 1MR8A 2JNXA 1UURA 2LHLA 3SG5A 4BY4A 4OCIA 1NP8A 5TNCA 2Y1NA 1B9AA 1PSBA 4I5KA 1G4YR 5GQQC 2OTGC 3OB2B 1IG5A 3DD4A 2HETA 3I5HB 3JTDB 1CFCA 1XFUO 2M8UA 2M97A 3SG3A 2AAOA 1GQMA 2JULA 1F55A 2OS8C 2K7OA 2L51A 4QJ5B 1QV0A 2KI6D 1RK9A 2JRFA 4CFRA 2K2AA 1ZOTB 1TCFA 2MRDA 3NSKA 5HKYA 1F8HA 1QVIY 1S5GY 1KQMC 5ER4X 1MF8B 3I5GB 1NSHA 1QX2A 3DVEA 3I5IB 4XJKB 1RROA 4QJ3B 3BUXB 1WY9A 3A4UB 4L9MA 1JBAA 4P5OE 1LVCD 2WNDA 4OV2A 1PVAA 3TUYB 1YURA 2MAZA 1DGVA 1TCOB 2E30A 1S1EA 1QTXA 2LAPA 2M1KB 2F3YA 1W7JB 2JT0A 1IGVA 2FCEA 1IRJA 3TDZA 2VRGA 2KFGA 2KQYA 4A4CA 1Y1AA 5AEQA 3EK7A 4GBAA 1FF1A 2L5XB 1DJWA 1IJ6A 3O2PA 2KYCA 1KFUL 1PSRA 1SR6B 1G33A 1G8IA 4MRYA 1ZUZA 2O5GA 2ZFDA 1BODA 2E6WA 1S3PA 1DMOA 1K9UA 2CT9A 5I8NA 4A4BA 2KAXA 1DT7B 4USLA 4PCWA 2CNPA 2K2FA 3BOWB 1UHKA 2BL0C 2NCPA 1L7ZA 1SPYA 4CIDA 2K61A 4DIRA 1K9PA 2BKIB 2JU0A 1CLLA 3PM8A 4WQ2A 3TDUA 2BCAA 1Q80A 2KNEA 3CR4X 1M39A 1A29A 4IL1A 5I2OA 4HRHA 4ICBA 4MZLA 4YGBB 2KQ6A 4JQ0D 2L98A 1JUOA 1OMRA 2ZKMX 4GPLB 1RTP1 2LUXA 1YUUA 1WRZA 1NCZA 2BE6A 2KGRA 2M1UA 1HT9A 1J7RA 1KK8B 3BQ3A 2LVIA 2FJUB 2O60A 2PSRA 1TNQA 4N5XA 4YGCB 1C07A 4YBHB 1B8CA 1OZSA 3TS5B 2KOTA 2G2BA 1CDPA 1PULA 4ETOA 1S6CA 2NCOA 4OVNF 4PE1A 1EXRA 3NSLA 1MXLC 2F2PA 2MBXA 3VROA 4GGFC 4D1EA 2HQ8A 5K89A 1KWOC 1L2OB 4HSZA 2HPSA 2LCPA 2MJWB 1S36A 1M46A 2LC5A 1F54A 3DF0B 3LL8B 1XFWO 2F33A 4YI9A 3LCPC 1JFJA 2CCMA 1DTLA 3RM1A 1B4CA 2LMUA 2MLEC 3GK2A 3AKAA 1GGWA 5AANA 1ZFSA 2R2IA 4GGNA 1YUTA 2K8MB 1DGUA 2DOQA 2SASA 4M2OA 1C7WA 3VRRA 1BR1B 1VRKA 1F4OA 1V1FA 3NSIA 1M31A 2LP2A 2QPTA 3EKJA 1KK7Y 3PN7C 1UHIA 5J3XA 1MHOA 3JVTC 1LA0A 3BUMB 2M49B 4MZKA 1QXPA 4YRUA 3I5FC 3O78A 1XO5A 2AMIA 2KGBC 3SG7A 4XJKA 4YGAA 1DJZA 3AAJA 1SCMB 3FWCA 1NPQA 3TZ1A 2FOTA 1CFDA 3BUOB 3OX5A 4CPVA 5AFPA 5AXIA 1SW8A 1BU3A 2M7LA 2WCFA 1HQVA 2ZN9A 1CFPA 1RECA 1EG3A 1CDLA 2KBIA 3KEVA 1B7TY 3OB1B 3AAKA 1JFKA 1LA3A 1QS7A 3EK8A 1FI6A 2LUCA 4AQIA 1IJ5A 2I94A 1A2XA 4YGDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B47 A;  4M2Q A;  5D69 A;  5G08 A;  4NDC A;  1UUS A;  2KI4 B;  1AK8 A;  1XVJ A;  3BUW B;  1PVB A;  1QJT A;  3SG4 A;  1YUS A;  1YRT B;  3C1V A;  1TN4 A;  2EGD A;  3A8R A;  1K94 A;  3MSE B;  4MN0 A;  3CTN A;  1IQ5 A;  4NQG A;  1CLM A;  2P6B B;  1CM4 A;  2L0P A;  4MLW A;  1N2D A;  3BOW A;  3LK1 A;  1FBV A;  3KHE A;  1YX7 A;  2KBM A;  2KSP A;  4PHK A;  1YVH A;  1J1E A;  1BF5 A;  1CLB A;  1ZMZ A;  4N1F A;  1JWD A;  2M3W A;  3HCM A;  1YVL A;  3PAT A;  1KQV A;  3HX4 A;  5KTY A;  3SJS A;  1K90 D;  1C7V A;  2AUC A;  1WLZ A;  2NLN A;  2A4J A;  3LK0 A;  3SG6 A;  5B8I B;  4P2Y B;  2JT8 A;  1NIW A;  1YRU B;  2LVK A;  1PRW A;  3SIA A;  4DRW A;  2JNF A;  2HQW A;  2EC6 C;  3VRN A;  2Q91 A;  1ALW A;  1U5I A;  1OMV A;  1X02 A;  3FS7 A;  1CFF A;  1SKT A;  2KFH A;  1SL7 A;  5BPJ A;  3OP0 A;  5CSF A;  1DJY A;  2H2K A;  1M45 A;  3OHM B;  4JPZ B;  1K9K A;  1FW4 A;  2BCX A;  2I7A A;  1WDC B;  2LM5 A;  3ICB A;  1A03 A;  2M0R A;  2ZRT A;  3DF0 A;  3I5H C;  3WHT B;  3JTD C;  1OQP A;  3OX6 A;  1XA5 A;  4I5J A;  1KFX S;  4MEW A;  1QVI Z;  1S5G Z;  2WCE A;  1K8U A;  4WRI A;  1XFV O;  3BUN B;  4ORC B;  3EKH A;  3PSR A;  3DVJ A;  1SMG A;  1EL4 A;  1E8A A;  1U5I B;  2JQ6 A;  2KYF A;  2V53 A;  2ZNE A;  1GJY A;  5DKN A;  2OTG B;  2L4I A;  4TNC A;  3I5G C;  5HKZ A;  1BOC A;  3O6B A;  3I5I C;  3EVR A;  1K93 D;  3GOF A;  4PE7 A;  2B1U A;  4DUQ A;  2LLS A;  2OS8 B;  1CKK A;  2M7N A;  2PRU A;  1IH0 A;  2CTN A;  1DF0 B;  3VGO A;  1SL8 A;  3TUY C;  1TOP A;  4FTG A;  1RFJ A;  2I2R E;  2JTT A;  1K96 A;  3DVK A;  1AJ5 A;  1MQ1 A;  1DJX A;  1S26 D;  1KSO A;  1UHH A;  1KQM B;  1JF0 A;  1UHJ A;  1SY9 A;  3GK1 A;  2MA2 A;  1YTZ C;  1XFX O;  2JC2 A;  4FQO A;  5AER A;  5I2L A;  1EH2 A;  3D10 A;  2D8N A;  5CSJ A;  3PFV A;  3ZNI A;  1RWY A;  2LMV A;  4ZCU A;  3VRP A;  5IBW A;  5KSZ A;  2Y1M A;  1H8B A;  2LMT A;  4C0L A;  2IS9 A;  1NX2 A;  1W7I B;  1QLK A;  5I2Q A;  1XK4 A;  1D1O A;  1SR6 C;  4U8D A;  1FI5 A;  4PE0 A;  5DKR A;  1A4P A;  4JWQ A;  1CMG A;  1JC2 A;  1NYA A;  2PAL A;  1R2U A;  1ODB A;  2NZ0 A;  3WHU B;  2MHH A;  3BYA A;  4NDD A;  2H61 A;  1IKU A;  1CDN A;  5HLV A;  2JXL A;  1J7P A;  2OPO A;  3WNX B;  1AVS A;  1NX0 A;  4GUK A;  2WCB A;  2GV5 A;  1QAT A;  2WOS A;  1DJG A;  1BR4 B;  4PHM A;  3VRQ A;  3E3R A;  1SL9 A;  3IF7 A;  2BL0 B;  1QAS A;  2JWW A;  4AQJ A;  1KK8 C;  3CLN A;  4C0K A;  1DVI A;  1MUX A;  1SK6 D;  3K21 A;  1TNW A;  1NUB A;  1OOJ A;  3IQQ A;  1IQ3 A;  1N65 A;  1BMO A;  5CSN A;  5HLO A;  2KAV A;  4GGF A;  3TS5 C;  1QX7 A;  3CR2 A;  1WLM A;  1NX1 A;  2SCP A;  2GGZ A;  3EK4 A;  4E68 A;  2GGM A;  1S6J A;  3RLZ A;  1M63 B;  1Y1X A;  3BXK A;  1B1G A;  2JOJ A;  5JJG A;  1L2O C;  3FIA A;  1YR5 A;  2HF5 A;  1KCY A;  1DJH A;  2WC8 A;  3FWB A;  4MVF A;  4QJ4 B;  1H4B A;  1CM1 A;  3D0Y B;  4XYN A;  3EVU A;  1DJI A;  4DS7 A;  1KSM A;  1MWN A;  1EJ3 A;  2LHI A;  3KO0 A;  4MRX A;  1K95 A;  4C0J A;  4PAL A;  1WRK A;  4PE4 A;  3DVM A;  3EVV A;  1TNP A;  1KWO B;  1NCX A;  1SCV A;  1AJ4 A;  1EG4 A;  1TIZ A;  2LVV A;  3IQO A;  1OZO A;  3KPX A;  5HKW A;  3SG2 A;  5CSI A;  1S6I A;  2F8P A;  1KK7 Z;  1SBJ A;  2BBM A;  5HYD A;  1CB1 A;  1UWO A;  3LLE A;  2L4H A;  2ISD A;  1SYM A;  2K7D A;  4M2P A;  3CR5 X;  4NDB A;  2BKH B;  5JOL A;  1MXE A;  1A75 A;  1KFX L;  1QLS A;  2CBL A;  1QX5 B;  2BEC A;  5D7F A;  2CXJ A;  2LLU A;  1QV1 A;  2JT3 A;  1AHR A;  1XFY O;  2Y5I A;  3H4S E;  4PHN A;  3KF9 A;  1LXF C;  5F6T A;  3AKB A;  1LIN A;  1J55 A;  2RGI A;  1FPW A;  1YX8 A;  2COL B;  4GFT A;  1SCM C;  2LV7 A;  1B7T Z;  3PN7 B;  1RJV A;  5FYX A;  2KHN A;  3JVT B;  1DF0 A;  1CTR A;  1WRL A;  2JXC A;  3O4Y A;  2KAY A;  2JTZ A;  1XK4 C;  2ZN8 A;  3I5F B;  4GAO A;  1A75 B;  4HRG A;  5PAL A;  1JF2 A;  2LLT A;  2LAN A;  1CDM A;  1BG1 A;  3PAL A;  5ER5 A;  4YI8 A;  3QRX A;  1NX3 A;  4HRE E;  3TDI A;  3SIB A;  1F70 A;  2H61 C;  1F71 A;  4OR9 B;  2KI6 C;  2KFF A;  2Q4U A;  4Q04 A;  1KFU S;  1QIV A;  2PAS A;  3M0W A;  4F0Z B;  5KU1 A;  2L2E A;  1OE9 B;  2KI4 C;  2JPT A;  1OSA A;  4I5L B;  4N1G A;  1CNP A;  2MLF C;  2PMY A;  2NXQ A;  4PDZ A;  2K7C A;  4BY5 A;  1LKJ A;  2I18 A;  3CWG A;  4CLN A;  1UP5 A;  1F4Q A;  2K0J A;  1GGZ A;  3CS1 A;  3NSO A;  2BE4 A;  1V1G A;  2F2O A;  4ORA B;  4AOM A;  1TTX A;  1XYD A;  4CFQ A;  2QAC A;  2PVB A;  4MSP A;  1BT6 A;  1Y1U A;  2ZRS A;  1BJF A;  1UHN A;  4PHJ A;  2LNK A;  5DKQ A;  1Y0V H;  1NCY A;  1J7O A;  1SNL A;  2F3Z A;  1NWD A;  3CGA A;  1B8R A;  3NXA A;  1AP4 A;  4YGE B;  4GNK B;  4MZJ A;  1JSA A;  4ZCV A;  1AUI B;  2Y4Q A;  1Y6W A;  1XFZ O;  1N0Y A;  1B8L A;  2L50 A;  2KDH A;  2LP3 A;  2BBN A;  2ZND A;  4R1E A;  1J7Q A;  2JZI A;  3ZWH A;  2G9B A;  5CPV A;  1OMD A;  1SRA A;  3WXA A;  1K2H A;  2WOR A;  2BCB A;  4MBE A;  4ORB B;  4I5N B;  4WQ3 A;  4OKH A;  3F45 A;  2TN4 A;  3PLF B;  2M29 A;  3CZT X;  1PAL A;  2FCD A;  3D0Y A;  2EHB A;  1WDC C;  2K7B A;  4UPG A;  2EC6 B;  2M9G A;  1ALV A;  2LE9 B;  1TRF A;  1CMF A;  1J1D A;  1QIW A;  1IWQ A;  4DCK A;  1R6P A;  1PK0 D;  1TNX A;  1BLQ A;  1ZAC A;  2LVJ A;  3GK4 X;  1MR8 A;  2JNX A;  1UUR A;  2LHL A;  3SG5 A;  4BY4 A;  4OCI A;  1NP8 A;  5TNC A;  2Y1N A;  1B9A A;  1PSB A;  4I5K A;  1G4Y R;  5GQQ C;  2OTG C;  3OB2 B;  1IG5 A;  3DD4 A;  2HET A;  3I5H B;  3JTD B;  1CFC A;  1XFU O;  2M8U A;  2M97 A;  3SG3 A;  2AAO A;  1GQM A;  2JUL A;  1F55 A;  2OS8 C;  2K7O A;  2L51 A;  4QJ5 B;  1QV0 A;  2KI6 D;  1RK9 A;  2JRF A;  4CFR A;  2K2A A;  1ZOT B;  1TCF A;  2MRD A;  3NSK A;  5HKY A;  1F8H A;  1QVI Y;  1S5G Y;  1KQM C;  5ER4 X;  1MF8 B;  3I5G B;  1NSH A;  1QX2 A;  3DVE A;  3I5I B;  4XJK B;  1RRO A;  4QJ3 B;  3BUX B;  1WY9 A;  3A4U B;  4L9M A;  1JBA A;  4P5O E;  1LVC D;  2WND A;  4OV2 A;  1PVA A;  3TUY B;  1YUR A;  2MAZ A;  1DGV A;  1TCO B;  2E30 A;  1S1E A;  1QTX A;  2LAP A;  2M1K B;  2F3Y A;  1W7J B;  2JT0 A;  1IGV A;  2FCE A;  1IRJ A;  3TDZ A;  2VRG A;  2KFG A;  2KQY A;  4A4C A;  1Y1A A;  5AEQ A;  3EK7 A;  4GBA A;  1FF1 A;  2L5X B;  1DJW A;  1IJ6 A;  3O2P A;  2KYC A;  1KFU L;  1PSR A;  1SR6 B;  1G33 A;  1G8I A;  4MRY A;  1ZUZ A;  2O5G A;  2ZFD A;  1BOD A;  2E6W A;  1S3P A;  1DMO A;  1K9U A;  2CT9 A;  5I8N A;  4A4B A;  2KAX A;  1DT7 B;  4USL A;  4PCW A;  2CNP A;  2K2F A;  3BOW B;  1UHK A;  2BL0 C;  2NCP A;  1L7Z A;  1SPY A;  4CID A;  2K61 A;  4DIR A;  1K9P A;  2BKI B;  2JU0 A;  1CLL A;  3PM8 A;  4WQ2 A;  3TDU A;  2BCA A;  1Q80 A;  2KNE A;  3CR4 X;  1M39 A;  1A29 A;  4IL1 A;  5I2O A;  4HRH A;  4ICB A;  4MZL A;  4YGB B;  2KQ6 A;  4JQ0 D;  2L98 A;  1JUO A;  1OMR A;  2ZKM X;  4GPL B;  1RTP 1;  2LUX A;  1YUU A;  1WRZ A;  1NCZ A;  2BE6 A;  2KGR A;  2M1U A;  1HT9 A;  1J7R A;  1KK8 B;  3BQ3 A;  2LVI A;  2FJU B;  2O60 A;  2PSR A;  1TNQ A;  4N5X A;  4YGC B;  1C07 A;  4YBH B;  1B8C A;  1OZS A;  3TS5 B;  2KOT A;  2G2B A;  1CDP A;  1PUL A;  4ETO A;  1S6C A;  2NCO A;  4OVN F;  4PE1 A;  1EXR A;  3NSL A;  1MXL C;  2F2P A;  2MBX A;  3VRO A;  4GGF C;  4D1E A;  2HQ8 A;  5K89 A;  1KWO C;  1L2O B;  4HSZ A;  2HPS A;  2LCP A;  2MJW B;  1S36 A;  1M46 A;  2LC5 A;  1F54 A;  3DF0 B;  3LL8 B;  1XFW O;  2F33 A;  4YI9 A;  3LCP C;  1JFJ A;  2CCM A;  1DTL A;  3RM1 A;  1B4C A;  2LMU A;  2MLE C;  3GK2 A;  3AKA A;  1GGW A;  5AAN A;  1ZFS A;  2R2I A;  4GGN A;  1YUT A;  2K8M B;  1DGU A;  2DOQ A;  2SAS A;  4M2O A;  1C7W A;  3VRR A;  1BR1 B;  1VRK A;  1F4O A;  1V1F A;  3NSI A;  1M31 A;  2LP2 A;  2QPT A;  3EKJ A;  1KK7 Y;  3PN7 C;  1UHI A;  5J3X A;  1MHO A;  3JVT C;  1LA0 A;  3BUM B;  2M49 B;  4MZK A;  1QXP A;  4YRU A;  3I5F C;  3O78 A;  1XO5 A;  2AMI A;  2KGB C;  3SG7 A;  4XJK A;  4YGA A;  1DJZ A;  3AAJ A;  1SCM B;  3FWC A;  1NPQ A;  3TZ1 A;  2FOT A;  1CFD A;  3BUO B;  3OX5 A;  4CPV A;  5AFP A;  5AXI A;  1SW8 A;  1BU3 A;  2M7L A;  2WCF A;  1HQV A;  2ZN9 A;  1CFP A;  1REC A;  1EG3 A;  1CDL A;  2KBI A;  3KEV A;  1B7T Y;  3OB1 B;  3AAK A;  1JFK A;  1LA3 A;  1QS7 A;  3EK8 A;  1FI6 A;  2LUC A;  4AQI A;  1IJ5 A;  2I94 A;  1A2X A;  4YGD B; 
#chains in the Genus database with same CATH topology
 1B47 A;  2WCH A;  4M2Q A;  5D69 A;  5G08 A;  4NDC A;  1UUS A;  2KI4 B;  2P71 A;  1AK8 A;  1XVJ A;  3BUW B;  1PVB A;  1QJT A;  3B87 A;  1YUS A;  3SG4 A;  1YRT B;  3C1V A;  4PT1 A;  1TN4 A;  2EGD A;  3A8R A;  3DYE A;  1K94 A;  3MSE B;  3CAB A;  4MN0 A;  3CTN A;  1IQ5 A;  4NQG A;  1CLM A;  1DEK A;  2P6B B;  1CM4 A;  2L0P A;  4MLW A;  1N2D A;  3BOW A;  3LK1 A;  1FBV A;  3KHE A;  1YX7 A;  2KBM A;  1XFR A;  2KSP A;  1YVH A;  1J1E A;  4PHK A;  1BF5 A;  1GM0 A;  1CLB A;  1ZMZ A;  4N1F A;  1JWD A;  2M3W A;  3HCM A;  1YVL A;  3N7H A;  3PAT A;  1KQV A;  3D75 A;  3HX4 A;  1OOG A;  3SJS A;  1K90 D;  1OOI X;  5KTY A;  1C7V A;  2AUC A;  1WLZ A;  2NLN A;  2A4J A;  3LK0 A;  3SG6 A;  5B8I B;  4P2Y B;  1ORG A;  2JT8 A;  2P70 A;  1NIW A;  1DC1 A;  1YRU B;  2LVK A;  1PRW A;  2KLE A;  3SIA A;  3FE9 A;  4DRW A;  2JNF A;  2HQW A;  2EC6 C;  4INW A;  3VRN A;  2Q91 A;  1ALW A;  1U5I A;  1OMV A;  1X02 A;  3FS7 A;  1CFF A;  1SKT A;  2KFH A;  1SL7 A;  5BPJ A;  3CZ1 A;  3OP0 A;  5CSF A;  1DJY A;  2H2K A;  1M45 A;  3OHM B;  4JPZ B;  1K9K A;  1FW4 A;  2BCX A;  2QEB A;  2I7A A;  1WDC B;  2LM5 A;  3ICB A;  1A03 A;  2M0R A;  2ZRT A;  3DF0 A;  3I5H C;  3WHT B;  3JTD C;  1OQP A;  3OX6 A;  1XA5 A;  4I5J A;  1KFX S;  4MEW A;  1QVI Z;  1S5G Z;  3B88 A;  2WCE A;  1K8U A;  4WRI A;  1XFV O;  3BUN B;  4ORC B;  3EKH A;  3PSR A;  3DVJ A;  3RZS A;  1SMG A;  1EL4 A;  1E8A A;  1U5I B;  2JQ6 A;  2KYF A;  2V53 A;  2ZNE A;  1GJY A;  5DKN A;  2OTG B;  2L4I A;  4TNC A;  3I5G C;  5HKZ A;  1BOC A;  3O6B A;  3I5I C;  3EVR A;  1K93 D;  3GOF A;  4PE7 A;  2B1U A;  3V2L A;  3S0A A;  4DUQ A;  2LLS A;  1C3Z A;  2OS8 B;  1CKK A;  2M7N A;  2PRU A;  2BNX A;  1IH0 A;  2CTN A;  1DF0 B;  3VGO A;  1SL8 A;  3TUY C;  1TOP A;  4FTG A;  5FI6 A;  1RFJ A;  2I2R E;  2JTT A;  1K96 A;  3DVK A;  1AJ5 A;  1MQ1 A;  1DJX A;  1S26 D;  1KSO A;  3D74 A;  1UHH A;  1KQM B;  1TWO A;  1UHJ A;  1JF0 A;  1SY9 A;  3GK1 A;  2MA2 A;  1YTZ C;  1XFX O;  2JC2 A;  4FQO A;  5AER A;  5I2L A;  1EH2 A;  3D10 A;  2D8N A;  5CSJ A;  3PFV A;  3ZNI A;  1RWY A;  2LMV A;  4ZCU A;  3VRP A;  5IBW A;  5KSZ A;  2Y1M A;  1H8B A;  2LMT A;  4C0L A;  2IS9 A;  1NX2 A;  1W7I B;  3FE6 A;  1QLK A;  5I2Q A;  1XK4 A;  1D1O A;  1SR6 C;  4U8D A;  1FI5 A;  5I94 A;  3S0G A;  4PE0 A;  5DKR A;  1A4P A;  4JWQ A;  1CMG A;  1JC2 A;  1NYA A;  2PAL A;  1R2U A;  1ODB A;  2NZ0 A;  3WHU B;  2MHH A;  3BYA A;  4NDD A;  2H61 A;  2KLD A;  1IKU A;  1CDN A;  5HLV A;  2JXL A;  1J7P A;  2OPO A;  3WNX B;  1AVS A;  1NX0 A;  4GUK A;  2WCB A;  2GV5 A;  1QAT A;  2WOS A;  1DJG A;  3IVT A;  1BR4 B;  4PHM A;  3VRQ A;  3E3R A;  1SL9 A;  3IF7 A;  2BL0 B;  1QAS A;  3EG5 B;  3CZ0 A;  2JWW A;  4AQJ A;  1KK8 C;  3CLN A;  4C0K A;  1DVI A;  1MUX A;  1SK6 D;  3K21 A;  1TNW A;  1NUB A;  1OOJ A;  3IQQ A;  4JD9 A;  1N65 A;  1IQ3 A;  1BMO A;  5CSN A;  2WCL A;  5HLO A;  2KAV A;  4GGF A;  2K60 A;  1QX7 A;  3TS5 C;  2QEV A;  3CR2 A;  1WLM A;  5HL1 A;  1NX1 A;  2SCP A;  2GGZ A;  3EK4 A;  4E68 A;  2GGM A;  1S6J A;  1LS8 A;  3RLZ A;  1M63 B;  1Y1X A;  3BXK A;  1B1G A;  2JOJ A;  5JJG A;  1L2O C;  3FIA A;  4IJ7 A;  1YR5 A;  2HF5 A;  2WCJ A;  1DJH A;  2WC8 A;  3FWB A;  4MVF A;  1KCY A;  4QJ4 B;  3PM2 A;  3D78 A;  1H4B A;  1CM1 A;  3D0Y B;  4XYN A;  3EVU A;  1DJI A;  4DS7 A;  1KSM A;  1MWN A;  1EJ3 A;  4INX A;  3UO9 A;  2LHI A;  3CDN A;  3KO0 A;  4MRX A;  1K95 A;  3NGV A;  2WCM A;  4C0J A;  4PAL A;  1WRK A;  3OBV A;  4PE4 A;  3DVM A;  3EVV A;  1TNP A;  1KWO B;  1NCX A;  1SCV A;  1AJ4 A;  1EG4 A;  1TIZ A;  2LVV A;  3IQO A;  1OZO A;  3KPX A;  5HKW A;  3SG2 A;  5CSI A;  1S6I A;  2F8P A;  1KK7 Z;  1SBJ A;  2BBM A;  5HYD A;  1CB1 A;  1UWO A;  3LLE A;  2L4H A;  2ISD A;  1SYM A;  2K7D A;  4M2P A;  3CR5 X;  4NDB A;  2BKH B;  5JOL A;  3UNW A;  1MXE A;  1A75 A;  1KFX L;  1QLS A;  2CBL A;  3OGN A;  1QX5 B;  2BEC A;  5D7F A;  3S0D A;  2CXJ A;  2LLU A;  4F7F A;  1QV1 A;  2JT3 A;  3R1O A;  1AHR A;  1XFY O;  2Y5I A;  3H4S E;  4PHN A;  3KF9 A;  1LXF C;  5F6T A;  3AKB A;  1LIN A;  1J55 A;  2RGI A;  1FPW A;  1YX8 A;  2COL B;  4GFT A;  1SCM C;  2LV7 A;  1B7T Z;  3PN7 B;  1RJV A;  3R1V A;  2KHN A;  3JVT B;  5FYX A;  1DF0 A;  1CTR A;  3D76 A;  1WRL A;  2JXC A;  3O4Y A;  2KAY A;  2JTZ A;  1XK4 C;  2ZN8 A;  3I5F B;  4GAO A;  1A75 B;  4HRG A;  5PAL A;  1JF2 A;  2LLT A;  2LAN A;  1CDM A;  1BG1 A;  3PAL A;  5ER5 A;  4YI8 A;  5DIC A;  3SS5 A;  3QRX A;  1NX3 A;  4HRE E;  3TDI A;  3SIB A;  1TUZ A;  1F70 A;  2H61 C;  1F71 A;  4OR9 B;  2KI6 C;  2KFF A;  2Q4U A;  4Q04 A;  1KFU S;  1QIV A;  2PAS A;  3DXL A;  3M0W A;  4F0Z B;  5KU1 A;  2L2E A;  1OE9 B;  2KI4 C;  2JPT A;  3CZ2 A;  1OSA A;  4I5L B;  4N1G A;  1CNP A;  2MLF C;  2PMY A;  4JKT A;  2NXQ A;  4PDZ A;  2K7C A;  4BY5 A;  1LKJ A;  2I18 A;  3B86 A;  3CWG A;  1UP5 A;  4CLN A;  1OW4 A;  1F4Q A;  2PQL A;  2K0J A;  1GGZ A;  3CS1 A;  3S0B A;  3NSO A;  1DQE A;  2QEH A;  2BE4 A;  2H8V A;  1V1G A;  2F2O A;  4ORA B;  3VB1 A;  4AOM A;  1TTX A;  1XYD A;  4CFQ A;  2QAC A;  2PVB A;  4MSP A;  1BT6 A;  1Y1U A;  2ZRS A;  3BFH A;  1BJF A;  1UHN A;  4PHJ A;  1C3Y A;  2LNK A;  5DKQ A;  1Y0V H;  1NCY A;  1J7O A;  1SNL A;  2F3Z A;  3K1E A;  1NWD A;  3CGA A;  1B8R A;  3NXA A;  1AP4 A;  3D77 A;  2L2C A;  4YGE B;  4GNK B;  4MZJ A;  1JSA A;  4ZCV A;  1AUI B;  2Y4Q A;  1Y6W A;  1XFZ O;  5FI2 A;  1N0Y A;  1B8L A;  2L50 A;  2KDH A;  2LP3 A;  2BBN A;  2ZND A;  3L4A A;  3R1P A;  4R1E A;  3SS4 A;  1J7Q A;  2JZI A;  3S0F A;  3ZWH A;  2G9B A;  3NHT A;  5CPV A;  1Z2C B;  3DZT A;  1OMD A;  1SRA A;  3WXA A;  1K2H A;  2WOR A;  2BCB A;  4MBE A;  4ORB B;  4I5N B;  4WQ3 A;  4OKH A;  3F45 A;  2TN4 A;  3PLF B;  2BAP A;  2M29 A;  3CZT X;  1PAL A;  2FCD A;  3D0Y A;  3SS3 A;  2EHB A;  1WDC C;  2K7B A;  4UPG A;  1Z4H A;  2EC6 B;  2M9G A;  1ALV A;  2LE9 B;  1TRF A;  1CMF A;  1J1D A;  1QIW A;  1IWQ A;  4DCK A;  1R6P A;  1PK0 D;  1TNX A;  1BLQ A;  1ZAC A;  2LVJ A;  3GK4 X;  1MR8 A;  4KYN A;  1W9Z A;  1UUR A;  2JNX A;  2LHL A;  3SG5 A;  4BY4 A;  4OCI A;  1NP8 A;  5TNC A;  2Y1N A;  1B9A A;  1PSB A;  4I5K A;  1G4Y R;  5GQQ C;  2OTG C;  3OB2 B;  1IG5 A;  2YGU A;  3DD4 A;  2HET A;  3I5H B;  3JTD B;  1CFC A;  1XFU O;  2PYQ A;  2M8U A;  2M97 A;  3Q8I A;  1GQM A;  2AAO A;  2JUL A;  3SG3 A;  1F55 A;  2L5Y A;  1T14 A;  2OS8 C;  2K7O A;  2L51 A;  4QJ5 B;  1QV0 A;  2KI6 D;  1RK9 A;  2JRF A;  4CFR A;  5D3O A;  2K2A A;  1ZOT B;  1TCF A;  2MRD A;  3CYZ A;  1QWV A;  3NSK A;  5HKY A;  1QVI Y;  1S5G Y;  1KQM C;  5ER4 X;  1MF8 B;  3I5G B;  1F8H A;  1NSH A;  1QX2 A;  3DVE A;  3I5I B;  4XJK B;  1RRO A;  4QJ3 B;  3BUX B;  1WY9 A;  3A4U B;  4L9M A;  1JBA A;  4P5O E;  1LVC D;  2WCK A;  2WND A;  4OV2 A;  1PVA A;  3TUY B;  1YUR A;  2MAZ A;  1DGV A;  1TCO B;  1TUJ A;  2E30 A;  1S1E A;  1QTX A;  2LAP A;  2M1K B;  2F3Y A;  1W7J B;  2JT0 A;  1IIO A;  1IGV A;  2QDI A;  2FCE A;  1IRJ A;  2KPH A;  3TDZ A;  2VRG A;  2KFG A;  2KQY A;  4A4C A;  1Y1A A;  5AEQ A;  3EK7 A;  4GBA A;  3QME A;  1FF1 A;  2QEO A;  2L5X B;  1DJW A;  1IJ6 A;  2GTE A;  3O2P A;  3S0E A;  2KYC A;  1KFU L;  1PSR A;  1SR6 B;  1G33 A;  1G8I A;  4MRY A;  1ZUZ A;  2O5G A;  2ZFD A;  1BOD A;  2E6W A;  1S3P A;  2WC5 A;  1DEL A;  4OZD A;  1DMO A;  1K9U A;  2CT9 A;  2JPO A;  5I8N A;  4A4B A;  2KAX A;  3NHI A;  1DT7 B;  4USL A;  3R72 A;  2CNP A;  2K2F A;  4PCW A;  3BOW B;  1UHK A;  2BL0 C;  2NCP A;  1L7Z A;  1SPY A;  4CID A;  2K61 A;  4DIR A;  1K9P A;  2BKI B;  4FQT A;  2JU0 A;  1CLL A;  3PM8 A;  4WQ2 A;  3TDU A;  3BFA A;  2BCA A;  1Q80 A;  2KNE A;  3CR4 X;  1M39 A;  1A29 A;  4IL1 A;  5I2O A;  4HRH A;  4ICB A;  4MZL A;  4YGB B;  2KQ6 A;  4JQ0 D;  2L98 A;  1JUO A;  1OMR A;  2ZKM X;  4GPL B;  1RTP 1;  2LUX A;  1YUU A;  1WRZ A;  1NCZ A;  2BE6 A;  2KGR A;  2M1U A;  1HT9 A;  1J7R A;  1KK8 B;  3BQ3 A;  2LVI A;  2FJU B;  2O60 A;  2PSR A;  1TNQ A;  4N5X A;  4YGC B;  1C07 A;  4YBH B;  1B8C A;  1P28 A;  1OZS A;  3TS5 B;  2KOT A;  2G2B A;  1CDP A;  1PUL A;  4ETO A;  1S6C A;  2NCO A;  4OVN F;  4PE1 A;  1EXR A;  3BFB A;  1MXL C;  3NSL A;  2F2P A;  2MBX A;  3VRO A;  4GGF C;  4D1E A;  2HQ8 A;  5K89 A;  1KWO C;  1L2O B;  1OOF A;  3B7A A;  2HPS A;  4HSZ A;  2LCP A;  2MJW B;  3L47 A;  1S36 A;  1M46 A;  2LC5 A;  1F54 A;  3DF0 B;  3FE8 A;  3LL8 B;  1XFW O;  2F33 A;  4YI9 A;  3LCP C;  1OOH A;  1JFJ A;  2CCM A;  1DTL A;  3RM1 A;  1B4C A;  2LMU A;  2MLE C;  3GK2 A;  3AKA A;  1GGW A;  5AAN A;  1ZFS A;  2R2I A;  4GGN A;  1YUT A;  2K8M B;  1SSE B;  1DGU A;  2DOQ A;  2SAS A;  4M2O A;  1C7W A;  3VRR A;  1BR1 B;  5FI7 A;  1VRK A;  1F4O A;  1V1F A;  3NSI A;  1M31 A;  2LP2 A;  2QPT A;  3EKJ A;  1KK7 Y;  3PN7 C;  1UHI A;  5J3X A;  1MHO A;  3JVT C;  1LA0 A;  3BUM B;  2M49 B;  2ERB A;  3O4X A;  4MZK A;  1QXP A;  4YRU A;  3I5F C;  3L4L A;  3O78 A;  1XO5 A;  2AMI A;  3PJI A;  2KGB C;  3SG7 A;  4XJK A;  2FJY A;  4YGA A;  1DJZ A;  5EL2 A;  3AAJ A;  1SCM B;  3DY9 A;  3FWC A;  1NPQ A;  3TZ1 A;  2FOT A;  1CFD A;  3BUO B;  3OX5 A;  4CPV A;  5AFP A;  5AXI A;  1SW8 A;  1BU3 A;  2M7L A;  2WCF A;  1HQV A;  2ZN9 A;  3B6X A;  1CFP A;  1REC A;  1EG3 A;  1CDL A;  2KBI A;  3KEV A;  1B7T Y;  3OB1 B;  3AAK A;  1JFK A;  3D73 A;  1LA3 A;  3BJH A;  1QS7 A;  2WC6 A;  3EK8 A;  2LUC A;  4AQI A;  1IJ5 A;  2I94 A;  1FI6 A;  1A2X A;  4YGD B; 
#chains in the Genus database with same CATH homology
 1B47 A;  4M2Q A;  5D69 A;  5G08 A;  4NDC A;  1UUS A;  2KI4 B;  1AK8 A;  1XVJ A;  3BUW B;  1PVB A;  1QJT A;  3SG4 A;  1YUS A;  1YRT B;  3C1V A;  1TN4 A;  2EGD A;  3A8R A;  1K94 A;  3MSE B;  4MN0 A;  3CTN A;  1IQ5 A;  4NQG A;  1CLM A;  2P6B B;  1CM4 A;  2L0P A;  4MLW A;  1N2D A;  3BOW A;  3LK1 A;  1FBV A;  3KHE A;  1YX7 A;  2KBM A;  2KSP A;  4PHK A;  1YVH A;  1J1E A;  1BF5 A;  1CLB A;  1ZMZ A;  4N1F A;  1JWD A;  2M3W A;  3HCM A;  1YVL A;  3PAT A;  1KQV A;  3HX4 A;  5KTY A;  3SJS A;  1K90 D;  1C7V A;  2AUC A;  1WLZ A;  2NLN A;  2A4J A;  3LK0 A;  3SG6 A;  5B8I B;  4P2Y B;  2JT8 A;  1NIW A;  1YRU B;  2LVK A;  1PRW A;  3SIA A;  4DRW A;  2JNF A;  2HQW A;  2EC6 C;  3VRN A;  2Q91 A;  1ALW A;  1U5I A;  1OMV A;  1X02 A;  3FS7 A;  1CFF A;  1SKT A;  2KFH A;  1SL7 A;  5BPJ A;  3OP0 A;  5CSF A;  1DJY A;  2H2K A;  1M45 A;  3OHM B;  4JPZ B;  1K9K A;  1FW4 A;  2BCX A;  2I7A A;  1WDC B;  2LM5 A;  3ICB A;  1A03 A;  2M0R A;  2ZRT A;  3DF0 A;  3I5H C;  3WHT B;  3JTD C;  1OQP A;  3OX6 A;  1XA5 A;  4I5J A;  1KFX S;  4MEW A;  1QVI Z;  1S5G Z;  2WCE A;  1K8U A;  4WRI A;  1XFV O;  3BUN B;  4ORC B;  3EKH A;  3PSR A;  3DVJ A;  1SMG A;  1EL4 A;  1E8A A;  1U5I B;  2JQ6 A;  2KYF A;  2V53 A;  2ZNE A;  1GJY A;  5DKN A;  2OTG B;  2L4I A;  4TNC A;  3I5G C;  5HKZ A;  1BOC A;  3O6B A;  3I5I C;  3EVR A;  1K93 D;  3GOF A;  4PE7 A;  2B1U A;  4DUQ A;  2LLS A;  2OS8 B;  1CKK A;  2M7N A;  2PRU A;  1IH0 A;  2CTN A;  1DF0 B;  3VGO A;  1SL8 A;  3TUY C;  1TOP A;  4FTG A;  1RFJ A;  2I2R E;  2JTT A;  1K96 A;  3DVK A;  1AJ5 A;  1MQ1 A;  1DJX A;  1S26 D;  1KSO A;  1UHH A;  1KQM B;  1JF0 A;  1UHJ A;  1SY9 A;  3GK1 A;  2MA2 A;  1YTZ C;  1XFX O;  2JC2 A;  4FQO A;  5AER A;  5I2L A;  1EH2 A;  3D10 A;  2D8N A;  5CSJ A;  3PFV A;  3ZNI A;  1RWY A;  2LMV A;  4ZCU A;  3VRP A;  5IBW A;  5KSZ A;  2Y1M A;  1H8B A;  2LMT A;  4C0L A;  2IS9 A;  1NX2 A;  1W7I B;  1QLK A;  5I2Q A;  1XK4 A;  1D1O A;  1SR6 C;  4U8D A;  1FI5 A;  4PE0 A;  5DKR A;  1A4P A;  4JWQ A;  1CMG A;  1JC2 A;  1NYA A;  2PAL A;  1R2U A;  1ODB A;  2NZ0 A;  3WHU B;  2MHH A;  3BYA A;  4NDD A;  2H61 A;  1IKU A;  1CDN A;  5HLV A;  2JXL A;  1J7P A;  2OPO A;  3WNX B;  1AVS A;  1NX0 A;  4GUK A;  2WCB A;  2GV5 A;  1QAT A;  2WOS A;  1DJG A;  1BR4 B;  4PHM A;  3VRQ A;  3E3R A;  1SL9 A;  3IF7 A;  2BL0 B;  1QAS A;  2JWW A;  4AQJ A;  1KK8 C;  3CLN A;  4C0K A;  1DVI A;  1MUX A;  1SK6 D;  3K21 A;  1TNW A;  1NUB A;  1OOJ A;  3IQQ A;  1IQ3 A;  1N65 A;  1BMO A;  5CSN A;  5HLO A;  2KAV A;  4GGF A;  3TS5 C;  1QX7 A;  3CR2 A;  1WLM A;  1NX1 A;  2SCP A;  2GGZ A;  3EK4 A;  4E68 A;  2GGM A;  1S6J A;  3RLZ A;  1M63 B;  1Y1X A;  3BXK A;  1B1G A;  2JOJ A;  5JJG A;  1L2O C;  3FIA A;  1YR5 A;  2HF5 A;  1KCY A;  1DJH A;  2WC8 A;  3FWB A;  4MVF A;  4QJ4 B;  1H4B A;  1CM1 A;  3D0Y B;  4XYN A;  3EVU A;  1DJI A;  4DS7 A;  1KSM A;  1MWN A;  1EJ3 A;  2LHI A;  3KO0 A;  4MRX A;  1K95 A;  4C0J A;  4PAL A;  1WRK A;  4PE4 A;  3DVM A;  3EVV A;  1TNP A;  1KWO B;  1NCX A;  1SCV A;  1AJ4 A;  1EG4 A;  1TIZ A;  2LVV A;  3IQO A;  1OZO A;  3KPX A;  5HKW A;  3SG2 A;  5CSI A;  1S6I A;  2F8P A;  1KK7 Z;  1SBJ A;  2BBM A;  5HYD A;  1CB1 A;  1UWO A;  3LLE A;  2L4H A;  2ISD A;  1SYM A;  2K7D A;  4M2P A;  3CR5 X;  4NDB A;  2BKH B;  5JOL A;  1MXE A;  1A75 A;  1KFX L;  1QLS A;  2CBL A;  1QX5 B;  2BEC A;  5D7F A;  2CXJ A;  2LLU A;  1QV1 A;  2JT3 A;  1AHR A;  1XFY O;  2Y5I A;  3H4S E;  4PHN A;  3KF9 A;  1LXF C;  5F6T A;  3AKB A;  1LIN A;  1J55 A;  2RGI A;  1FPW A;  1YX8 A;  2COL B;  4GFT A;  1SCM C;  2LV7 A;  1B7T Z;  3PN7 B;  1RJV A;  5FYX A;  2KHN A;  3JVT B;  1DF0 A;  1CTR A;  1WRL A;  2JXC A;  3O4Y A;  2KAY A;  2JTZ A;  1XK4 C;  2ZN8 A;  3I5F B;  4GAO A;  1A75 B;  4HRG A;  5PAL A;  1JF2 A;  2LLT A;  2LAN A;  1CDM A;  1BG1 A;  3PAL A;  5ER5 A;  4YI8 A;  3QRX A;  1NX3 A;  4HRE E;  3TDI A;  3SIB A;  1F70 A;  2H61 C;  1F71 A;  4OR9 B;  2KI6 C;  2KFF A;  2Q4U A;  4Q04 A;  1KFU S;  1QIV A;  2PAS A;  3M0W A;  4F0Z B;  5KU1 A;  2L2E A;  1OE9 B;  2KI4 C;  2JPT A;  1OSA A;  4I5L B;  4N1G A;  1CNP A;  2MLF C;  2PMY A;  2NXQ A;  4PDZ A;  2K7C A;  4BY5 A;  1LKJ A;  2I18 A;  3CWG A;  4CLN A;  1UP5 A;  1F4Q A;  2K0J A;  1GGZ A;  3CS1 A;  3NSO A;  2BE4 A;  1V1G A;  2F2O A;  4ORA B;  4AOM A;  1TTX A;  1XYD A;  4CFQ A;  2QAC A;  2PVB A;  4MSP A;  1BT6 A;  1Y1U A;  2ZRS A;  1BJF A;  1UHN A;  4PHJ A;  2LNK A;  5DKQ A;  1Y0V H;  1NCY A;  1J7O A;  1SNL A;  2F3Z A;  1NWD A;  3CGA A;  1B8R A;  3NXA A;  1AP4 A;  4YGE B;  4GNK B;  4MZJ A;  1JSA A;  4ZCV A;  1AUI B;  2Y4Q A;  1Y6W A;  1XFZ O;  1N0Y A;  1B8L A;  2L50 A;  2KDH A;  2LP3 A;  2BBN A;  2ZND A;  4R1E A;  1J7Q A;  2JZI A;  3ZWH A;  2G9B A;  5CPV A;  1OMD A;  1SRA A;  3WXA A;  1K2H A;  2WOR A;  2BCB A;  4MBE A;  4ORB B;  4I5N B;  4WQ3 A;  4OKH A;  3F45 A;  2TN4 A;  3PLF B;  2M29 A;  3CZT X;  1PAL A;  2FCD A;  3D0Y A;  2EHB A;  1WDC C;  2K7B A;  4UPG A;  2EC6 B;  2M9G A;  1ALV A;  2LE9 B;  1TRF A;  1CMF A;  1J1D A;  1QIW A;  1IWQ A;  4DCK A;  1R6P A;  1PK0 D;  1TNX A;  1BLQ A;  1ZAC A;  2LVJ A;  3GK4 X;  1MR8 A;  2JNX A;  1UUR A;  2LHL A;  3SG5 A;  4BY4 A;  4OCI A;  1NP8 A;  5TNC A;  2Y1N A;  1B9A A;  1PSB A;  4I5K A;  1G4Y R;  5GQQ C;  2OTG C;  3OB2 B;  1IG5 A;  3DD4 A;  2HET A;  3I5H B;  3JTD B;  1CFC A;  1XFU O;  2M8U A;  2M97 A;  3SG3 A;  2AAO A;  1GQM A;  2JUL A;  1F55 A;  2OS8 C;  2K7O A;  2L51 A;  4QJ5 B;  1QV0 A;  2KI6 D;  1RK9 A;  2JRF A;  4CFR A;  2K2A A;  1ZOT B;  1TCF A;  2MRD A;  3NSK A;  5HKY A;  1F8H A;  1QVI Y;  1S5G Y;  1KQM C;  5ER4 X;  1MF8 B;  3I5G B;  1NSH A;  1QX2 A;  3DVE A;  3I5I B;  4XJK B;  1RRO A;  4QJ3 B;  3BUX B;  1WY9 A;  3A4U B;  4L9M A;  1JBA A;  4P5O E;  1LVC D;  2WND A;  4OV2 A;  1PVA A;  3TUY B;  1YUR A;  2MAZ A;  1DGV A;  1TCO B;  2E30 A;  1S1E A;  1QTX A;  2LAP A;  2M1K B;  2F3Y A;  1W7J B;  2JT0 A;  1IGV A;  2FCE A;  1IRJ A;  3TDZ A;  2VRG A;  2KFG A;  2KQY A;  4A4C A;  1Y1A A;  5AEQ A;  3EK7 A;  4GBA A;  1FF1 A;  2L5X B;  1DJW A;  1IJ6 A;  3O2P A;  2KYC A;  1KFU L;  1PSR A;  1SR6 B;  1G33 A;  1G8I A;  4MRY A;  1ZUZ A;  2O5G A;  2ZFD A;  1BOD A;  2E6W A;  1S3P A;  1DMO A;  1K9U A;  2CT9 A;  5I8N A;  4A4B A;  2KAX A;  1DT7 B;  4USL A;  4PCW A;  2CNP A;  2K2F A;  3BOW B;  1UHK A;  2BL0 C;  2NCP A;  1L7Z A;  1SPY A;  4CID A;  2K61 A;  4DIR A;  1K9P A;  2BKI B;  2JU0 A;  1CLL A;  3PM8 A;  4WQ2 A;  3TDU A;  2BCA A;  1Q80 A;  2KNE A;  3CR4 X;  1M39 A;  1A29 A;  4IL1 A;  5I2O A;  4HRH A;  4ICB A;  4MZL A;  4YGB B;  2KQ6 A;  4JQ0 D;  2L98 A;  1JUO A;  1OMR A;  2ZKM X;  4GPL B;  1RTP 1;  2LUX A;  1YUU A;  1WRZ A;  1NCZ A;  2BE6 A;  2KGR A;  2M1U A;  1HT9 A;  1J7R A;  1KK8 B;  3BQ3 A;  2LVI A;  2FJU B;  2O60 A;  2PSR A;  1TNQ A;  4N5X A;  4YGC B;  1C07 A;  4YBH B;  1B8C A;  1OZS A;  3TS5 B;  2KOT A;  2G2B A;  1CDP A;  1PUL A;  4ETO A;  1S6C A;  2NCO A;  4OVN F;  4PE1 A;  1EXR A;  3NSL A;  1MXL C;  2F2P A;  2MBX A;  3VRO A;  4GGF C;  4D1E A;  2HQ8 A;  5K89 A;  1KWO C;  1L2O B;  4HSZ A;  2HPS A;  2LCP A;  2MJW B;  1S36 A;  1M46 A;  2LC5 A;  1F54 A;  3DF0 B;  3LL8 B;  1XFW O;  2F33 A;  4YI9 A;  3LCP C;  1JFJ A;  2CCM A;  1DTL A;  3RM1 A;  1B4C A;  2LMU A;  2MLE C;  3GK2 A;  3AKA A;  1GGW A;  5AAN A;  1ZFS A;  2R2I A;  4GGN A;  1YUT A;  2K8M B;  1DGU A;  2DOQ A;  2SAS A;  4M2O A;  1C7W A;  3VRR A;  1BR1 B;  1VRK A;  1F4O A;  1V1F A;  3NSI A;  1M31 A;  2LP2 A;  2QPT A;  3EKJ A;  1KK7 Y;  3PN7 C;  1UHI A;  5J3X A;  1MHO A;  3JVT C;  1LA0 A;  3BUM B;  2M49 B;  4MZK A;  1QXP A;  4YRU A;  3I5F C;  3O78 A;  1XO5 A;  2AMI A;  2KGB C;  3SG7 A;  4XJK A;  4YGA A;  1DJZ A;  3AAJ A;  1SCM B;  3FWC A;  1NPQ A;  3TZ1 A;  2FOT A;  1CFD A;  3BUO B;  3OX5 A;  4CPV A;  5AFP A;  5AXI A;  1SW8 A;  1BU3 A;  2M7L A;  2WCF A;  1HQV A;  2ZN9 A;  1CFP A;  1REC A;  1EG3 A;  1CDL A;  2KBI A;  3KEV A;  1B7T Y;  3OB1 B;  3AAK A;  1JFK A;  1LA3 A;  1QS7 A;  3EK8 A;  1FI6 A;  2LUC A;  4AQI A;  1IJ5 A;  2I94 A;  1A2X A;  4YGD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...