2OPOA

Crystal structure of the calcium-binding pollen allergen che a 3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
TPQDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDGFISFDEFTDFARANRGLVKDVSKIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polcalcin Che a 3
publication title Three-dimensional structure of the cross-reactive pollen allergen Che a 3: visualizing cross-reactivity on the molecular surfaces of weed, grass, and tree pollen allergens.
pubmed rcsb
source organism Chenopodium album
molecule tags Allergen
total genus 30
structure length 81
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2opoA00
1PVAA 1B47A 2H61A 3CLNA 4A4CA 1JFJA 1QS7A 2HF5A 3KO0A 4WRIA 1CFCA 1MWNA 1JF0A 4XYNA 1B9AA 4NDDA 1SRAA 1YURA 2L98A 3BYAA 2WC8A 2ZRTA 5JJGA 1CFDA 1A75A 1NX2A 2L4IA 5HKYA 1LINA 1CFPA 1K93D 1A2XA 2BE4A 4BY4A 2H61C 2M7NA 2JULA 3DD4A 4PCWA 4C0LA 1RROA 4PE0A 1G8IA 1CDPA 1H4BA 2F8PA 1KFXL 3NSLA 1R6PA 1MHOA 2KFHA 1TCFA 4WQ3A 3F45A 4CPVA 1K90D 1XFXO 3I5HC 2OS8C 1FF1A 1BJFA 5AERA 2LMVA 1NX0A 3EVUA 2HQWA 4GPLB 4NDBA 3VRRA 2LC5A 3SIAA 1CDNA 3WHTB 1N0YA 4HRHA 1AUIB 1IKUA 1MF8B 1UP5A 4N1GA 3BQ3A 1M46A 2K8MB 2LHLA 4C0KA 2WCEA 4JQ0D 1C7WA 2SASA 1DF0A 1GGWA 5HLOA 1CDMA 1YRTB 3O78A 1BMOA 1HT9A 4ORCB 3TS5C 1KQVA 1UHIA 1FBVA 5AFPA 1DJYA 2BL0B 1J7QA 1RFJA 1S5GZ 1QLKA 2NLNA 1QV0A 3JVTC 4FQOA 3I5IB 3K21A 1UHKA 2LV7A 4GGNA 3CTNA 1NIWA 3TUYC 2BKIB 1SYMA 1KK7Y 2MA2A 2BECA 1XFWO 3DVKA 3JTDB 3I5GC 1L2OC 1PVBA 2LLUA 1AK8A 2KI6C 1SR6C 1XFVO 2LUXA 1OZOA 2M3WA 4OVNF 3OB2B 1SW8A 2I94A 1X02A 2JTTA 5KSZA 2MHHA 4GUKA 4GNKB 5DKNA 1RWYA 5CSNA 1DT7B 1TCOB 1J1DA 2M1UA 3SG7A 2E30A 2NCPA 3LCPC 5CSFA 4D1EA 5CSIA 3CS1A 3PM8A 3BUOB 2PRUA 1K94A 2ZN8A 3MSEB 4M2OA 2KAXA 3O4YA 2O60A 4XJKA 1N65A 2KI6D 2KQ6A 4ORBB 2F33A 5K89A 1F8HA 3LLEA 1BG1A 1GGZA 1CNPA 2BCBA 2KQYA 1FW4A 1M45A 1NCYA 2KI4C 4M2QA 3FWCA 1XVJA 1KQMB 3WNXB 4UPGA 4YRUA 1Y0VH 1CM4A 1JF2A 2F2OA 4ZCUA 2Y4QA 1PSBA 1AVSA 2F3YA 2KDHA 3ICBA 4PE4A 2JQ6A 2M0RA 1SCMC 3AKBA 3O2PA 1JSAA 2NZ0A 4PHJA 4OKHA 1JWDA 2LVJA 2WORA 2M7LA 2D8NA 4DUQA 1JUOA 1F71A 4NDCA 1B4CA 1NX1A 1CMFA 2WNDA 1RJVA 4GGFC 4I5JA 4MN0A 4HREE 1Y1UA 4YBHB 1NCXA 3BUWB 1WLZA 5I2QA 1LA3A 1Q80A 1QV1A 3EVRA 5ER4X 2Y1MA 1BF5A 1NSHA 2R2IA 2K61A 1DJIA 1RECA 3OX6A 2OTGB 5AEQA 3FWBA 2WCFA 1ZACA 3DF0B 2OPOA 1IRJA 2K2FA 1W7JB 1IQ5A 3NSOA 1Y1AA 3KPXA 1EH2A 1IG5A 1S3PA 1RK9A 2MLEC 3D0YB 4YI8A 3BUXB 3PSRA 4P5OE 2ZRSA 1OE9B 3VRQA 1TNPA 2KNEA 2LE9B 4PHMA 1NX3A 2G9BA 4MZKA 2KFFA 1TNQA 2IS9A 2WOSA 2A4JA 2ZKMX 4CIDA 1A03A 5CSJA 3OX5A 1J55A 2BBNA 2FCDA 1IH0A 2JRFA 1DJHA 3VRPA 1M31A 3AKAA 1WDCC 2PSRA 1U5IB 2PVBA 2EC6C 4BY5A 4P2YB 2L50A 2FCEA 2HETA 1BLQA 3EKHA 4ORAB 1DTLA 5DKRA 2L2EA 2P6BB 1IJ6A 1YX7A 2LVIA 1QX7A 4DCKA 4AOMA 1WRKA 1GJYA 1K95A 1MXLC 2JOJA 3CGAA 2K7DA 3FIAA 1KK8C 3WHUB 1XYDA 5AANA 3PATA 1BU3A 1KFUS 4WQ2A 3OP0A 2NXQA 2LVVA 4MEWA 2LNKA 3BOWA 4CFQA 4DIRA 3C1VA 3VGOA 1B8RA 1EJ3A 4CLNA 3BUNB 4YGCB 3IQQA 4C0JA 4DS7A 3SG3A 1PULA 4N1FA 2M97A 5PALA 1FI6A 2JZIA 1SY9A 3I5HB 1XO5A 1A75B 3OHMB 1KWOC 2GGZA 4OV2A 1OMRA 1JBAA 1EG3A 3PLFB 1RTP1 1W7IB 5AXIA 3ZWHA 1EG4A 2KSPA 2JT8A 1BT6A 2I7AA 2CCMA 3A8RA 5I8NA 4R1EA 5BPJA 2O5GA 4DRWA 2H2KA 3I5IC 2Q91A 2LLSA 1AP4A 4GFTA 2I2RE 4HSZA 4YGBB 2LP3A 3CZTX 1ODBA 3NXAA 1G33A 2E6WA 3JTDC 3LL8B 2LMTA 2G2BA 1OQPA 5J3XA 2LUCA 2LANA 1K9UA 3TS5B 1J7OA 2JT0A 1TNWA 3DVEA 3E3RA 1PALA 4USLA 1S26D 2HPSA 2Y1NA 3JVTB 2PMYA 4MSPA 2MJWB 1K2HA 4MRYA 4PE1A 1XA5A 2AAOA 2DOQA 3TUYB 1S6IA 2F2PA 1ZMZA 2MAZA 2RGIA 4YGAA 3CR4X 3VROA 5G08A 1S1EA 3LK1A 1E8AA 2LHIA 3I5FB 1XK4A 1MUXA 2KAVA 4M2PA 1IGVA 4FTGA 3AAKA 2NCOA 4YI9A 1XFYO 3SIBA 1KSOA 4MRXA 1MXEA 1F4OA 2GV5A 1CLLA 4ZCVA 1PRWA 2ZFDA 2GGMA 3SG4A 1OMVA 2AMIA 2JU0A 3DF0A 2K2AA 2KAYA 2LP2A 2PALA 2JXCA 2BCAA 3FS7A 1F4QA 1QLSA 4YGEB 1MR8A 2QACA 4PHKA 1D1OA 1YUSA 2M49B 3D0YA 1XK4C 3DVMA 1AHRA 3CWGA 5HYDA 1DJZA 1SL8A 1BR1B 1NUBA 1V1GA 1BOCA 1OSAA 2CXJA 4A4BA 3PALA 5F6TA 2LMUA 1GQMA 4MBEA 1NP8A 2MLFC 1J7PA 1YRUB 1B8LA 2EGDA 4IL1A 1TTXA 1TIZA 2CTNA 1SCMB 3PN7C 2FOTA 4I5KA 2KOTA 5DKQA 2OTGC 1JFKA 1SMGA 2L5XB 3IQOA 1YR5A 1U5IA 2QPTA 4MZLA 4GBAA 4XJKB 2CBLA 3BXKA 2BKHB 1UURA 3KHEA 2ISDA 2M29A 4E68A 2JPTA 1B7TZ 2KBIA 1AJ4A 1PK0D 1YUUA 2K7BA 2JNFA 1TNXA 3CR5X 3GK4X 3TDUA 1S5GY 2CNPA 3WXAA 1SL9A 1QJTA 1VRKA 1CLBA 2COLB 1A29A 4OR9B 1M39A 2SCPA 1QIVA 3LK0A 5TNCA 3VRNA 2K7OA 5KTYA 1TRFA 3TZ1A 4QJ5B 1DGUA 2BCXA 2JXLA 1OMDA 1G4YR 2L51A 1BODA 1IQ3A 3DVJA 1C7VA 4PHNA 5D7FA 1YTZC 1KFXS 4OCIA 5GQQC 3SJSA 5KU1A 1V1FA 4GAOA 2Y5IA 1TN4A 3AAJA 3EK8A 4JPZB 1SPYA 4AQIA 1WRLA 1J1EA 1XFZO 2FJUB 1QTXA 1WDCB 1OOJA 1SNLA 1YX8A 2LCPA 2EC6B 4QJ4B 3M0WA 1SCVA 2AUCA 4NQGA 1YVHA 3KEVA 1BR4B 3NSKA 2LLTA 2KGBC 2LAPA 3RLZA 3SG6A 2F3ZA 3NSIA 1QVIZ 1F54A 1J7RA 3RM1A 2JWWA 1NPQA 1WRZA 2KHNA 1B8CA 1CTRA 2OS8B 2M9GA 4MZJA 5ER5A 3SG5A 1KK8B 2BBMA 3D10A 4YGDB 1ZOTB 1ALWA 1DJXA 1KFUL 3QRXA 1K96A 1QASA 2LVKA 1DVIA 1QX2A 1KCYA 1H8BA 2BL0C 2M8UA 1YUTA 2K0JA 2V53A 1K8UA 2L0PA 2KFGA 2I18A 4L9MA 2ZN9A 3A4UB 1DMOA 1K9PA 3EKJA 4I5NB 1L7ZA 2PASA 3HCMA 1KWOB 4MLWA 4JWQA 2JNXA 2Q4UA 4HRGA 4F0ZB 4ICBA 1UHNA 1UWOA 3ZNIA 1KSMA 5I2LA 1S6CA 5B8IB 1WLMA 1F70A 4MVFA 2ZNEA 3BOWB 3TDIA 3HX4A 1WY9A 5IBWA 1C07A 1FI5A 2WCBA 1SBJA 3IF7A 1DJGA 1NWDA 1Y6WA 1QX5B 3BUMB 3CR2A 3EVVA 4ETOA 2KGRA 1LVCD 2JTZA 2EHBA 1B1GA 3I5GB 1K9KA 1L2OB 1SK6D 2JC2A 1DJWA 1SR6B 2ZNDA 1B7TY 1LKJA 3SG2A 1F55A 1DF0B 1PSRA 2M1KB 3I5FC 1M63B 5JOLA 1EL4A 5HKZA 5D69A 1MQ1A 1CB1A 1CFFA 5I2OA 1KQMC 1NCZA 1XFUO 1N2DA 3O6BA 1Y1XA 5HLVA 2MBXA 1UUSA 1A4PA 3GK1A 3EK4A 2BE6A 4U8DA 2VRGA 1EXRA 4PALA 1CLMA 3GK2A 4TNCA 2KYFA 1QXPA 1FPWA 4GGFA 1IWQA 5CPVA 1YVLA 1LXFC 2HQ8A 2KI4B 4I5LB 2KBMA 1AJ5A 3EK7A 2MRDA 1ZUZA 4Q04A 4QJ3B 1DGVA 1IJ5A 1ZFSA 2TN4A 2B1UA 4AQJA 2CT9A 1S36A 1SL7A 3GOFA 4PDZA 2KYCA 2LM5A 1OZSA 2K7CA 3PFVA 1JC2A 1QVIY 1SKTA 1UHHA 1QATA 2JT3A 1TOPA 1LA0A 1S6JA 3H4SE 1KK7Z 4N5XA 1NYAA 3TDZA 1CKKA 2L4HA 1UHJA 4CFRA 1CM1A 1R2UA 3KF9A 3OB1B 1CDLA 4PE7A 3PN7B 5FYXA 1ALVA 5HKWA 1CMGA 1HQVA 1QIWA
chains in the Genus database with same CATH superfamily
1PVAA 1B47A 2H61A 3CLNA 4A4CA 2ERBA 1JFJA 1QS7A 2HF5A 2JPOA 3KO0A 4WRIA 1CFCA 1MWNA 1JF0A 2KPHA 4XYNA 1B9AA 4NDDA 1SRAA 1YURA 2L98A 3BYAA 2WC8A 2ZRTA 5JJGA 3BFBA 2KLDA 1CFDA 1A75A 1NX2A 4FQTA 2L4IA 5HKYA 2QEHA 1LINA 3D78A 1CFPA 1K93D 1A2XA 2BE4A 4BY4A 2H61C 2M7NA 3SS5A 2JULA 3DD4A 4PCWA 4C0LA 1RROA 4PE0A 1G8IA 5FI7A 1CDPA 2FJYA 2F8PA 1KFXL 3UNWA 1H4BA 3SS4A 3NSLA 1R6PA 1MHOA 2KFHA 1TCFA 4WQ3A 1Z2CB 3F45A 4CPVA 1K90D 1XFXO 3I5HC 1TWOA 2OS8C 1FF1A 1BJFA 3OBVA 5AERA 3R1VA 2LMVA 1NX0A 3EVUA 2HQWA 3B6XA 4GPLB 4NDBA 3VRRA 2WCLA 2LC5A 3SIAA 3QMEA 1CDNA 3WHTB 1N0YA 4HRHA 1C3YA 1AUIB 1IKUA 1MF8B 1UP5A 3FE8A 4N1GA 3BQ3A 3S0AA 1M46A 2K8MB 2LHLA 4C0KA 2WCEA 3S0FA 3BJHA 4JQ0D 1C7WA 2SASA 1DF0A 3B86A 1GGWA 5HLOA 1CDMA 1YRTB 3O78A 1DQEA 1BMOA 1HT9A 4ORCB 3TS5C 2KLEA 1UHIA 1KQVA 1FBVA 5AFPA 1DJYA 2BL0B 1F8HA 1J7QA 1RFJA 1S5GZ 3L47A 3R1OA 1QLKA 2NLNA 1QV0A 3JVTC 4FQOA 3I5IB 3K21A 1UHKA 2LV7A 2K60A 4GGNA 1XFRA 1NIWA 3CTNA 3TUYC 2BKIB 1SYMA 1KK7Y 2MA2A 2BECA 1XFWO 3DVKA 3JTDB 1TUJA 1L2OC 1PVBA 2LLUA 3I5GC 2KI6C 2WCHA 1AK8A 1SR6C 1XFVO 2LUXA 1OZOA 2M3WA 4OVNF 3OB2B 1SW8A 2I94A 1X02A 2JTTA 5KSZA 2MHHA 4GUKA 4GNKB 5DKNA 1RWYA 5CSNA 1DT7B 1TCOB 1J1DA 3CZ1A 2M1UA 2L5YA 3SG7A 2E30A 2NCPA 3LCPC 5CSFA 4D1EA 5CSIA 3CS1A 3PM8A 3BUOB 2PRUA 1K94A 2ZN8A 3FE6A 3MSEB 4M2OA 2KAXA 3O4YA 1IIOA 2O60A 4XJKA 1N65A 2KI6D 2KQ6A 3L4LA 2F33A 4ORBB 5EL2A 5K89A 3LLEA 1BG1A 1GGZA 1CNPA 2BCBA 2KQYA 1OOHA 1FW4A 1M45A 1NCYA 2KI4C 4M2QA 3FWCA 1XVJA 1KQMB 5D3OA 3WNXB 4UPGA 4YRUA 1Y0VH 1CM4A 1JF2A 2F2OA 3B87A 4ZCUA 2Y4QA 1PSBA 1AVSA 2F3YA 3Q8IA 2KDHA 1ORGA 3ICBA 4PE4A 2JQ6A 2M0RA 1SCMC 3AKBA 2H8VA 3O2PA 3S0GA 1JSAA 2NZ0A 4PHJA 4OKHA 3PJIA 1JWDA 2LVJA 2WORA 2M7LA 2D8NA 4DUQA 1JUOA 1F71A 4NDCA 1B4CA 1NX1A 1C3ZA 1CMFA 2WNDA 1RJVA 4GGFC 4I5JA 4MN0A 4HREE 1Y1UA 4INWA 4YBHB 1NCXA 1OOGA 3BUWB 1WLZA 5I2QA 1LA3A 1Q80A 1QV1A 3EVRA 3R72A 5ER4X 2Y1MA 3BFHA 1BF5A 1NSHA 2R2IA 2K61A 1DJIA 3N7HA 1RECA 3OX6A 2OTGB 5AEQA 3FWBA 2WCFA 1ZACA 3DF0B 3RZSA 2OPOA 1IRJA 2K2FA 1W7JB 1IQ5A 3NSOA 1Y1AA 3KPXA 1EH2A 1IG5A 1S3PA 1RK9A 2MLEC 3D0YB 4YI8A 3BUXB 3EG5B 3PSRA 4P5OE 3BFAA 2ZRSA 1OE9B 3VRQA 1TNPA 2KNEA 5FI6A 2LE9B 1TUZA 4PHMA 1NX3A 2G9BA 4MZKA 3D75A 2KFFA 1TNQA 2IS9A 2WOSA 2A4JA 2ZKMX 4CIDA 3O4XA 5CSJA 1A03A 3OX5A 1J55A 2BBNA 2FCDA 1IH0A 2JRFA 1DJHA 3VRPA 1M31A 3AKAA 1WDCC 2PSRA 1U5IB 2PVBA 2EC6C 4BY5A 4P2YB 2L50A 2FCEA 2HETA 2BNXA 1BLQA 3EKHA 4ORAB 1DTLA 5DKRA 1T14A 2L2EA 3CABA 3K1EA 2P6BB 1IJ6A 1YX7A 2LVIA 1QX7A 4DCKA 4AOMA 1WRKA 1GJYA 1K95A 1MXLC 2JOJA 3CGAA 2K7DA 3FIAA 1KK8C 3WHUB 1XYDA 5AANA 3PATA 1BU3A 1KFUS 4WQ2A 3DY9A 3OP0A 2NXQA 2LVVA 4MEWA 2LNKA 3BOWA 4OZDA 4CFQA 4DIRA 3C1VA 4JKTA 1B8RA 3VGOA 1EJ3A 4CLNA 3BUNB 4YGCB 3IQQA 4C0JA 4DS7A 3SG3A 1PULA 4N1FA 2M97A 5PALA 1FI6A 2JZIA 1SY9A 3I5HB 2P71A 1XO5A 1A75B 1GM0A 3OHMB 1KWOC 1Z4HA 2GGZA 4OV2A 1LS8A 1OMRA 1JBAA 1EG3A 3PLFB 3FE9A 1RTP1 1W7IB 5AXIA 3ZWHA 1EG4A 3R1PA 2KSPA 2JT8A 3DYEA 1BT6A 2I7AA 2CCMA 3A8RA 5I8NA 4R1EA 5BPJA 2O5GA 4DRWA 2H2KA 3I5IC 2Q91A 2LLSA 1AP4A 4GFTA 2I2RE 4HSZA 4YGBB 2LP3A 3CZTX 1ODBA 3NXAA 1G33A 2E6WA 3JTDC 3LL8B 2LMTA 2G2BA 1OQPA 1OOFA 5J3XA 2LUCA 2LANA 1K9UA 3TS5B 1J7OA 2JT0A 1TNWA 4KYNA 3DVEA 3E3RA 1PALA 4USLA 1S26D 2HPSA 2Y1NA 3JVTB 2PMYA 4MSPA 3S0EA 2MJWB 1K2HA 4MRYA 4PE1A 1XA5A 2AAOA 2DOQA 3TUYB 1S6IA 2F2PA 1ZMZA 2MAZA 2PYQA 2RGIA 4YGAA 3CR4X 3NHTA 3VROA 5G08A 1S1EA 3LK1A 1E8AA 2LHIA 3I5FB 1XK4A 1MUXA 2KAVA 4M2PA 5HL1A 1IGVA 4FTGA 2PQLA 3AAKA 2QDIA 2NCOA 4YI9A 1XFYO 3SIBA 1KSOA 4MRXA 1MXEA 1F4OA 2GV5A 1CLLA 3B88A 4ZCVA 1PRWA 2ZFDA 3DXLA 2GGMA 3SG4A 2WCJA 1OMVA 2AMIA 2JU0A 3DF0A 2K2AA 2KAYA 2LP2A 2PALA 2JXCA 2BCAA 3FS7A 1F4QA 1QLSA 4YGEB 3PM2A 1MR8A 2QACA 4PHKA 1D1OA 1YUSA 2M49B 3D0YA 1XK4C 3DVMA 1AHRA 3CWGA 5HYDA 1DJZA 1SL8A 1DEKA 1BR1B 1NUBA 3IVTA 1V1GA 1BOCA 1OSAA 2CXJA 4A4BA 3D77A 3PALA 5F6TA 2LMUA 1GQMA 4MBEA 1NP8A 2MLFC 1J7PA 1YRUB 1B8LA 2EGDA 4IL1A 1TTXA 1TIZA 2GTEA 2CTNA 4F7FA 1SCMB 3PN7C 2FOTA 4I5KA 2KOTA 5DKQA 3S0DA 2OTGC 1JFKA 1SMGA 2L5XB 3IQOA 1YR5A 1U5IA 2QPTA 4MZLA 4GBAA 4XJKB 2CBLA 3BXKA 2BKHB 1UURA 3KHEA 2ISDA 2M29A 2QEOA 4E68A 2JPTA 1B7TZ 2KBIA 2QEBA 1AJ4A 1PK0D 1YUUA 2K7BA 2JNFA 1TNXA 3CR5X 1W9ZA 3GK4X 3TDUA 1S5GY 2CNPA 3WXAA 3CDNA 1SL9A 1QJTA 1VRKA 1CLBA 2COLB 1A29A 1OW4A 1M39A 2SCPA 1QIVA 3LK0A 4OR9B 5TNCA 2K7OA 3VRNA 1TRFA 5KTYA 3TZ1A 4QJ5B 4PT1A 1DGUA 2BCXA 2JXLA 3CZ0A 1OMDA 1G4YR 2L51A 1BODA 1IQ3A 3DVJA 1C7VA 1DELA 4PHNA 5D7FA 1YTZC 1KFXS 4OCIA 5GQQC 3SJSA 5KU1A 3NHIA 1V1FA 4GAOA 2Y5IA 1TN4A 3AAJA 3EK8A 4JPZB 1SPYA 4AQIA 1WRLA 1J1EA 1XFZO 2FJUB 3CYZA 1QTXA 1WDCB 1OOJA 1SNLA 1YX8A 2LCPA 3L4AA 2EC6B 4QJ4B 3M0WA 1SCVA 2AUCA 4NQGA 1YVHA 3KEVA 1BR4B 2P70A 3SS3A 3NSKA 2QEVA 2LLTA 2KGBC 2LAPA 3RLZA 3SG6A 3S0BA 2F3ZA 3NSIA 1QVIZ 1F54A 1J7RA 2L2CA 3OGNA 2JWWA 1NPQA 1WRZA 2KHNA 1B8CA 1CTRA 2OS8B 2M9GA 1P28A 2WCMA 4MZJA 5ER5A 4JD9A 3SG5A 1KK8B 2BBMA 3D10A 4YGDB 1ZOTB 1ALWA 1DJXA 1KFUL 3QRXA 1K96A 2YGUA 1QASA 1SSEB 2LVKA 4IJ7A 1DVIA 4INXA 2WC6A 1QX2A 1KCYA 1H8BA 2BL0C 2M8UA 1YUTA 2K0JA 2V53A 1K8UA 5I94A 2L0PA 2KFGA 2I18A 4L9MA 2ZN9A 3A4UB 1DMOA 1K9PA 3EKJA 4I5NB 3B7AA 1L7ZA 2PASA 3HCMA 3VB1A 1KWOB 3CZ2A 4MLWA 4JWQA 1OOIX 2JNXA 2Q4UA 4HRGA 4F0ZB 4ICBA 1UHNA 1UWOA 3D74A 3ZNIA 1KSMA 5FI2A 1S6CA 5I2LA 5B8IB 1WLMA 1F70A 4MVFA 2ZNEA 3BOWB 2WCKA 3TDIA 3DZTA 3HX4A 1WY9A 5IBWA 1C07A 1FI5A 2WCBA 1SBJA 3IF7A 1DJGA 1NWDA 1Y6WA 1QX5B 3BUMB 3CR2A 3EVVA 4ETOA 2KGRA 1LVCD 2BAPA 2JTZA 2EHBA 1B1GA 3I5GB 1K9KA 1L2OB 1SK6D 2JC2A 1DJWA 1SR6B 2ZNDA 1B7TY 1LKJA 3SG2A 1F55A 1DF0B 1PSRA 2M1KB 3I5FC 1M63B 5JOLA 1EL4A 5HKZA 5D69A 1MQ1A 1CB1A 3D76A 1CFFA 5I2OA 1KQMC 1NCZA 1XFUO 1N2DA 3O6BA 1Y1XA 5HLVA 2MBXA 1UUSA 2WC5A 1A4PA 3GK1A 3EK4A 2BE6A 4U8DA 3NGVA 2VRGA 1EXRA 4PALA 1CLMA 3GK2A 4TNCA 2KYFA 1QXPA 1FPWA 4GGFA 1IWQA 5CPVA 1YVLA 1LXFC 2HQ8A 2KI4B 4I5LB 3RM1A 2KBMA 1AJ5A 3EK7A 2MRDA 1ZUZA 4Q04A 4QJ3B 1DGVA 1IJ5A 1ZFSA 2TN4A 2B1UA 4AQJA 2CT9A 1S36A 3UO9A 1SL7A 3GOFA 4PDZA 1QWVA 2KYCA 2LM5A 3V2LA 1OZSA 2K7CA 3PFVA 1JC2A 1QVIY 1SKTA 1UHHA 1QATA 2JT3A 1TOPA 1LA0A 1S6JA 5DICA 3H4SE 1KK7Z 4N5XA 1NYAA 3TDZA 1CKKA 2L4HA 1UHJA 1DC1A 4CFRA 1CM1A 1R2UA 3D73A 3KF9A 3OB1B 1CDLA 4PE7A 3PN7B 5FYXA 1ALVA 5HKWA 1CMGA 1HQVA 1QIWA
chains in the Genus database with same CATH topology
1PVAA 1B47A 2H61A 3CLNA 4A4CA 1JFJA 1QS7A 2HF5A 3KO0A 4WRIA 1CFCA 1MWNA 1JF0A 4XYNA 1B9AA 4NDDA 1SRAA 1YURA 2L98A 3BYAA 2WC8A 2ZRTA 5JJGA 1CFDA 1A75A 1NX2A 2L4IA 5HKYA 1LINA 1CFPA 1K93D 1A2XA 2BE4A 4BY4A 2H61C 2M7NA 2JULA 3DD4A 4PCWA 4C0LA 1RROA 4PE0A 1G8IA 1CDPA 1H4BA 2F8PA 1KFXL 3NSLA 1R6PA 1MHOA 2KFHA 1TCFA 4WQ3A 3F45A 4CPVA 1K90D 1XFXO 3I5HC 2OS8C 1FF1A 1BJFA 5AERA 2LMVA 1NX0A 3EVUA 2HQWA 4GPLB 4NDBA 3VRRA 2LC5A 3SIAA 1CDNA 3WHTB 1N0YA 4HRHA 1AUIB 1IKUA 1MF8B 1UP5A 4N1GA 3BQ3A 1M46A 2K8MB 2LHLA 4C0KA 2WCEA 4JQ0D 1C7WA 2SASA 1DF0A 1GGWA 5HLOA 1CDMA 1YRTB 3O78A 1BMOA 1HT9A 4ORCB 3TS5C 1KQVA 1UHIA 1FBVA 5AFPA 1DJYA 2BL0B 1J7QA 1RFJA 1S5GZ 1QLKA 2NLNA 1QV0A 3JVTC 4FQOA 3I5IB 3K21A 1UHKA 2LV7A 4GGNA 3CTNA 1NIWA 3TUYC 2BKIB 1SYMA 1KK7Y 2MA2A 2BECA 1XFWO 3DVKA 3JTDB 3I5GC 1L2OC 1PVBA 2LLUA 1AK8A 2KI6C 1SR6C 1XFVO 2LUXA 1OZOA 2M3WA 4OVNF 3OB2B 1SW8A 2I94A 1X02A 2JTTA 5KSZA 2MHHA 4GUKA 4GNKB 5DKNA 1RWYA 5CSNA 1DT7B 1TCOB 1J1DA 2M1UA 3SG7A 2E30A 2NCPA 3LCPC 5CSFA 4D1EA 5CSIA 3CS1A 3PM8A 3BUOB 2PRUA 1K94A 2ZN8A 3MSEB 4M2OA 2KAXA 3O4YA 2O60A 4XJKA 1N65A 2KI6D 2KQ6A 4ORBB 2F33A 5K89A 1F8HA 3LLEA 1BG1A 1GGZA 1CNPA 2BCBA 2KQYA 1FW4A 1M45A 1NCYA 2KI4C 4M2QA 3FWCA 1XVJA 1KQMB 3WNXB 4UPGA 4YRUA 1Y0VH 1CM4A 1JF2A 2F2OA 4ZCUA 2Y4QA 1PSBA 1AVSA 2F3YA 2KDHA 3ICBA 4PE4A 2JQ6A 2M0RA 1SCMC 3AKBA 3O2PA 1JSAA 2NZ0A 4PHJA 4OKHA 1JWDA 2LVJA 2WORA 2M7LA 2D8NA 4DUQA 1JUOA 1F71A 4NDCA 1B4CA 1NX1A 1CMFA 2WNDA 1RJVA 4GGFC 4I5JA 4MN0A 4HREE 1Y1UA 4YBHB 1NCXA 3BUWB 1WLZA 5I2QA 1LA3A 1Q80A 1QV1A 3EVRA 5ER4X 2Y1MA 1BF5A 1NSHA 2R2IA 2K61A 1DJIA 1RECA 3OX6A 2OTGB 5AEQA 3FWBA 2WCFA 1ZACA 3DF0B 2OPOA 1IRJA 2K2FA 1W7JB 1IQ5A 3NSOA 1Y1AA 3KPXA 1EH2A 1IG5A 1S3PA 1RK9A 2MLEC 3D0YB 4YI8A 3BUXB 3PSRA 4P5OE 2ZRSA 1OE9B 3VRQA 1TNPA 2KNEA 2LE9B 4PHMA 1NX3A 2G9BA 4MZKA 2KFFA 1TNQA 2IS9A 2WOSA 2A4JA 2ZKMX 4CIDA 1A03A 5CSJA 3OX5A 1J55A 2BBNA 2FCDA 1IH0A 2JRFA 1DJHA 3VRPA 1M31A 3AKAA 1WDCC 2PSRA 1U5IB 2PVBA 2EC6C 4BY5A 4P2YB 2L50A 2FCEA 2HETA 1BLQA 3EKHA 4ORAB 1DTLA 5DKRA 2L2EA 2P6BB 1IJ6A 1YX7A 2LVIA 1QX7A 4DCKA 4AOMA 1WRKA 1GJYA 1K95A 1MXLC 2JOJA 3CGAA 2K7DA 3FIAA 1KK8C 3WHUB 1XYDA 5AANA 3PATA 1BU3A 1KFUS 4WQ2A 3OP0A 2NXQA 2LVVA 4MEWA 2LNKA 3BOWA 4CFQA 4DIRA 3C1VA 3VGOA 1B8RA 1EJ3A 4CLNA 3BUNB 4YGCB 3IQQA 4C0JA 4DS7A 3SG3A 1PULA 4N1FA 2M97A 5PALA 1FI6A 2JZIA 1SY9A 3I5HB 1XO5A 1A75B 3OHMB 1KWOC 2GGZA 4OV2A 1OMRA 1JBAA 1EG3A 3PLFB 1RTP1 1W7IB 5AXIA 3ZWHA 1EG4A 2KSPA 2JT8A 1BT6A 2I7AA 2CCMA 3A8RA 5I8NA 4R1EA 5BPJA 2O5GA 4DRWA 2H2KA 3I5IC 2Q91A 2LLSA 1AP4A 4GFTA 2I2RE 4HSZA 4YGBB 2LP3A 3CZTX 1ODBA 3NXAA 1G33A 2E6WA 3JTDC 3LL8B 2LMTA 2G2BA 1OQPA 5J3XA 2LUCA 2LANA 1K9UA 3TS5B 1J7OA 2JT0A 1TNWA 3DVEA 3E3RA 1PALA 4USLA 1S26D 2HPSA 2Y1NA 3JVTB 2PMYA 4MSPA 2MJWB 1K2HA 4MRYA 4PE1A 1XA5A 2AAOA 2DOQA 3TUYB 1S6IA 2F2PA 1ZMZA 2MAZA 2RGIA 4YGAA 3CR4X 3VROA 5G08A 1S1EA 3LK1A 1E8AA 2LHIA 3I5FB 1XK4A 1MUXA 2KAVA 4M2PA 1IGVA 4FTGA 3AAKA 2NCOA 4YI9A 1XFYO 3SIBA 1KSOA 4MRXA 1MXEA 1F4OA 2GV5A 1CLLA 4ZCVA 1PRWA 2ZFDA 2GGMA 3SG4A 1OMVA 2AMIA 2JU0A 3DF0A 2K2AA 2KAYA 2LP2A 2PALA 2JXCA 2BCAA 3FS7A 1F4QA 1QLSA 4YGEB 1MR8A 2QACA 4PHKA 1D1OA 1YUSA 2M49B 3D0YA 1XK4C 3DVMA 1AHRA 3CWGA 5HYDA 1DJZA 1SL8A 1BR1B 1NUBA 1V1GA 1BOCA 1OSAA 2CXJA 4A4BA 3PALA 5F6TA 2LMUA 1GQMA 4MBEA 1NP8A 2MLFC 1J7PA 1YRUB 1B8LA 2EGDA 4IL1A 1TTXA 1TIZA 2CTNA 1SCMB 3PN7C 2FOTA 4I5KA 2KOTA 5DKQA 2OTGC 1JFKA 1SMGA 2L5XB 3IQOA 1YR5A 1U5IA 2QPTA 4MZLA 4GBAA 4XJKB 2CBLA 3BXKA 2BKHB 1UURA 3KHEA 2ISDA 2M29A 4E68A 2JPTA 1B7TZ 2KBIA 1AJ4A 1PK0D 1YUUA 2K7BA 2JNFA 1TNXA 3CR5X 3GK4X 3TDUA 1S5GY 2CNPA 3WXAA 1SL9A 1QJTA 1VRKA 1CLBA 2COLB 1A29A 4OR9B 1M39A 2SCPA 1QIVA 3LK0A 5TNCA 3VRNA 2K7OA 5KTYA 1TRFA 3TZ1A 4QJ5B 1DGUA 2BCXA 2JXLA 1OMDA 1G4YR 2L51A 1BODA 1IQ3A 3DVJA 1C7VA 4PHNA 5D7FA 1YTZC 1KFXS 4OCIA 5GQQC 3SJSA 5KU1A 1V1FA 4GAOA 2Y5IA 1TN4A 3AAJA 3EK8A 4JPZB 1SPYA 4AQIA 1WRLA 1J1EA 1XFZO 2FJUB 1QTXA 1WDCB 1OOJA 1SNLA 1YX8A 2LCPA 2EC6B 4QJ4B 3M0WA 1SCVA 2AUCA 4NQGA 1YVHA 3KEVA 1BR4B 3NSKA 2LLTA 2KGBC 2LAPA 3RLZA 3SG6A 2F3ZA 3NSIA 1QVIZ 1F54A 1J7RA 3RM1A 2JWWA 1NPQA 1WRZA 2KHNA 1B8CA 1CTRA 2OS8B 2M9GA 4MZJA 5ER5A 3SG5A 1KK8B 2BBMA 3D10A 4YGDB 1ZOTB 1ALWA 1DJXA 1KFUL 3QRXA 1K96A 1QASA 2LVKA 1DVIA 1QX2A 1KCYA 1H8BA 2BL0C 2M8UA 1YUTA 2K0JA 2V53A 1K8UA 2L0PA 2KFGA 2I18A 4L9MA 2ZN9A 3A4UB 1DMOA 1K9PA 3EKJA 4I5NB 1L7ZA 2PASA 3HCMA 1KWOB 4MLWA 4JWQA 2JNXA 2Q4UA 4HRGA 4F0ZB 4ICBA 1UHNA 1UWOA 3ZNIA 1KSMA 5I2LA 1S6CA 5B8IB 1WLMA 1F70A 4MVFA 2ZNEA 3BOWB 3TDIA 3HX4A 1WY9A 5IBWA 1C07A 1FI5A 2WCBA 1SBJA 3IF7A 1DJGA 1NWDA 1Y6WA 1QX5B 3BUMB 3CR2A 3EVVA 4ETOA 2KGRA 1LVCD 2JTZA 2EHBA 1B1GA 3I5GB 1K9KA 1L2OB 1SK6D 2JC2A 1DJWA 1SR6B 2ZNDA 1B7TY 1LKJA 3SG2A 1F55A 1DF0B 1PSRA 2M1KB 3I5FC 1M63B 5JOLA 1EL4A 5HKZA 5D69A 1MQ1A 1CB1A 1CFFA 5I2OA 1KQMC 1NCZA 1XFUO 1N2DA 3O6BA 1Y1XA 5HLVA 2MBXA 1UUSA 1A4PA 3GK1A 3EK4A 2BE6A 4U8DA 2VRGA 1EXRA 4PALA 1CLMA 3GK2A 4TNCA 2KYFA 1QXPA 1FPWA 4GGFA 1IWQA 5CPVA 1YVLA 1LXFC 2HQ8A 2KI4B 4I5LB 2KBMA 1AJ5A 3EK7A 2MRDA 1ZUZA 4Q04A 4QJ3B 1DGVA 1IJ5A 1ZFSA 2TN4A 2B1UA 4AQJA 2CT9A 1S36A 1SL7A 3GOFA 4PDZA 2KYCA 2LM5A 1OZSA 2K7CA 3PFVA 1JC2A 1QVIY 1SKTA 1UHHA 1QATA 2JT3A 1TOPA 1LA0A 1S6JA 3H4SE 1KK7Z 4N5XA 1NYAA 3TDZA 1CKKA 2L4HA 1UHJA 4CFRA 1CM1A 1R2UA 3KF9A 3OB1B 1CDLA 4PE7A 3PN7B 5FYXA 1ALVA 5HKWA 1CMGA 1HQVA 1QIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVA A;  1B47 A;  2H61 A;  3CLN A;  4A4C A;  1JFJ A;  1QS7 A;  2HF5 A;  3KO0 A;  4WRI A;  1CFC A;  1MWN A;  1JF0 A;  4XYN A;  1B9A A;  4NDD A;  1SRA A;  1YUR A;  2L98 A;  3BYA A;  2WC8 A;  2ZRT A;  5JJG A;  1CFD A;  1A75 A;  1NX2 A;  2L4I A;  5HKY A;  1LIN A;  1CFP A;  1K93 D;  1A2X A;  2BE4 A;  4BY4 A;  2H61 C;  2M7N A;  2JUL A;  3DD4 A;  4PCW A;  4C0L A;  1RRO A;  4PE0 A;  1G8I A;  1CDP A;  1H4B A;  2F8P A;  1KFX L;  3NSL A;  1R6P A;  1MHO A;  2KFH A;  1TCF A;  4WQ3 A;  3F45 A;  4CPV A;  1K90 D;  1XFX O;  3I5H C;  2OS8 C;  1FF1 A;  1BJF A;  5AER A;  2LMV A;  1NX0 A;  3EVU A;  2HQW A;  4GPL B;  4NDB A;  3VRR A;  2LC5 A;  3SIA A;  1CDN A;  3WHT B;  1N0Y A;  4HRH A;  1AUI B;  1IKU A;  1MF8 B;  1UP5 A;  4N1G A;  3BQ3 A;  1M46 A;  2K8M B;  2LHL A;  4C0K A;  2WCE A;  4JQ0 D;  1C7W A;  2SAS A;  1DF0 A;  1GGW A;  5HLO A;  1CDM A;  1YRT B;  3O78 A;  1BMO A;  1HT9 A;  4ORC B;  3TS5 C;  1KQV A;  1UHI A;  1FBV A;  5AFP A;  1DJY A;  2BL0 B;  1J7Q A;  1RFJ A;  1S5G Z;  1QLK A;  2NLN A;  1QV0 A;  3JVT C;  4FQO A;  3I5I B;  3K21 A;  1UHK A;  2LV7 A;  4GGN A;  3CTN A;  1NIW A;  3TUY C;  2BKI B;  1SYM A;  1KK7 Y;  2MA2 A;  2BEC A;  1XFW O;  3DVK A;  3JTD B;  3I5G C;  1L2O C;  1PVB A;  2LLU A;  1AK8 A;  2KI6 C;  1SR6 C;  1XFV O;  2LUX A;  1OZO A;  2M3W A;  4OVN F;  3OB2 B;  1SW8 A;  2I94 A;  1X02 A;  2JTT A;  5KSZ A;  2MHH A;  4GUK A;  4GNK B;  5DKN A;  1RWY A;  5CSN A;  1DT7 B;  1TCO B;  1J1D A;  2M1U A;  3SG7 A;  2E30 A;  2NCP A;  3LCP C;  5CSF A;  4D1E A;  5CSI A;  3CS1 A;  3PM8 A;  3BUO B;  2PRU A;  1K94 A;  2ZN8 A;  3MSE B;  4M2O A;  2KAX A;  3O4Y A;  2O60 A;  4XJK A;  1N65 A;  2KI6 D;  2KQ6 A;  4ORB B;  2F33 A;  5K89 A;  1F8H A;  3LLE A;  1BG1 A;  1GGZ A;  1CNP A;  2BCB A;  2KQY A;  1FW4 A;  1M45 A;  1NCY A;  2KI4 C;  4M2Q A;  3FWC A;  1XVJ A;  1KQM B;  3WNX B;  4UPG A;  4YRU A;  1Y0V H;  1CM4 A;  1JF2 A;  2F2O A;  4ZCU A;  2Y4Q A;  1PSB A;  1AVS A;  2F3Y A;  2KDH A;  3ICB A;  4PE4 A;  2JQ6 A;  2M0R A;  1SCM C;  3AKB A;  3O2P A;  1JSA A;  2NZ0 A;  4PHJ A;  4OKH A;  1JWD A;  2LVJ A;  2WOR A;  2M7L A;  2D8N A;  4DUQ A;  1JUO A;  1F71 A;  4NDC A;  1B4C A;  1NX1 A;  1CMF A;  2WND A;  1RJV A;  4GGF C;  4I5J A;  4MN0 A;  4HRE E;  1Y1U A;  4YBH B;  1NCX A;  3BUW B;  1WLZ A;  5I2Q A;  1LA3 A;  1Q80 A;  1QV1 A;  3EVR A;  5ER4 X;  2Y1M A;  1BF5 A;  1NSH A;  2R2I A;  2K61 A;  1DJI A;  1REC A;  3OX6 A;  2OTG B;  5AEQ A;  3FWB A;  2WCF A;  1ZAC A;  3DF0 B;  2OPO A;  1IRJ A;  2K2F A;  1W7J B;  1IQ5 A;  3NSO A;  1Y1A A;  3KPX A;  1EH2 A;  1IG5 A;  1S3P A;  1RK9 A;  2MLE C;  3D0Y B;  4YI8 A;  3BUX B;  3PSR A;  4P5O E;  2ZRS A;  1OE9 B;  3VRQ A;  1TNP A;  2KNE A;  2LE9 B;  4PHM A;  1NX3 A;  2G9B A;  4MZK A;  2KFF A;  1TNQ A;  2IS9 A;  2WOS A;  2A4J A;  2ZKM X;  4CID A;  1A03 A;  5CSJ A;  3OX5 A;  1J55 A;  2BBN A;  2FCD A;  1IH0 A;  2JRF A;  1DJH A;  3VRP A;  1M31 A;  3AKA A;  1WDC C;  2PSR A;  1U5I B;  2PVB A;  2EC6 C;  4BY5 A;  4P2Y B;  2L50 A;  2FCE A;  2HET A;  1BLQ A;  3EKH A;  4ORA B;  1DTL A;  5DKR A;  2L2E A;  2P6B B;  1IJ6 A;  1YX7 A;  2LVI A;  1QX7 A;  4DCK A;  4AOM A;  1WRK A;  1GJY A;  1K95 A;  1MXL C;  2JOJ A;  3CGA A;  2K7D A;  3FIA A;  1KK8 C;  3WHU B;  1XYD A;  5AAN A;  3PAT A;  1BU3 A;  1KFU S;  4WQ2 A;  3OP0 A;  2NXQ A;  2LVV A;  4MEW A;  2LNK A;  3BOW A;  4CFQ A;  4DIR A;  3C1V A;  3VGO A;  1B8R A;  1EJ3 A;  4CLN A;  3BUN B;  4YGC B;  3IQQ A;  4C0J A;  4DS7 A;  3SG3 A;  1PUL A;  4N1F A;  2M97 A;  5PAL A;  1FI6 A;  2JZI A;  1SY9 A;  3I5H B;  1XO5 A;  1A75 B;  3OHM B;  1KWO C;  2GGZ A;  4OV2 A;  1OMR A;  1JBA A;  1EG3 A;  3PLF B;  1RTP 1;  1W7I B;  5AXI A;  3ZWH A;  1EG4 A;  2KSP A;  2JT8 A;  1BT6 A;  2I7A A;  2CCM A;  3A8R A;  5I8N A;  4R1E A;  5BPJ A;  2O5G A;  4DRW A;  2H2K A;  3I5I C;  2Q91 A;  2LLS A;  1AP4 A;  4GFT A;  2I2R E;  4HSZ A;  4YGB B;  2LP3 A;  3CZT X;  1ODB A;  3NXA A;  1G33 A;  2E6W A;  3JTD C;  3LL8 B;  2LMT A;  2G2B A;  1OQP A;  5J3X A;  2LUC A;  2LAN A;  1K9U A;  3TS5 B;  1J7O A;  2JT0 A;  1TNW A;  3DVE A;  3E3R A;  1PAL A;  4USL A;  1S26 D;  2HPS A;  2Y1N A;  3JVT B;  2PMY A;  4MSP A;  2MJW B;  1K2H A;  4MRY A;  4PE1 A;  1XA5 A;  2AAO A;  2DOQ A;  3TUY B;  1S6I A;  2F2P A;  1ZMZ A;  2MAZ A;  2RGI A;  4YGA A;  3CR4 X;  3VRO A;  5G08 A;  1S1E A;  3LK1 A;  1E8A A;  2LHI A;  3I5F B;  1XK4 A;  1MUX A;  2KAV A;  4M2P A;  1IGV A;  4FTG A;  3AAK A;  2NCO A;  4YI9 A;  1XFY O;  3SIB A;  1KSO A;  4MRX A;  1MXE A;  1F4O A;  2GV5 A;  1CLL A;  4ZCV A;  1PRW A;  2ZFD A;  2GGM A;  3SG4 A;  1OMV A;  2AMI A;  2JU0 A;  3DF0 A;  2K2A A;  2KAY A;  2LP2 A;  2PAL A;  2JXC A;  2BCA A;  3FS7 A;  1F4Q A;  1QLS A;  4YGE B;  1MR8 A;  2QAC A;  4PHK A;  1D1O A;  1YUS A;  2M49 B;  3D0Y A;  1XK4 C;  3DVM A;  1AHR A;  3CWG A;  5HYD A;  1DJZ A;  1SL8 A;  1BR1 B;  1NUB A;  1V1G A;  1BOC A;  1OSA A;  2CXJ A;  4A4B A;  3PAL A;  5F6T A;  2LMU A;  1GQM A;  4MBE A;  1NP8 A;  2MLF C;  1J7P A;  1YRU B;  1B8L A;  2EGD A;  4IL1 A;  1TTX A;  1TIZ A;  2CTN A;  1SCM B;  3PN7 C;  2FOT A;  4I5K A;  2KOT A;  5DKQ A;  2OTG C;  1JFK A;  1SMG A;  2L5X B;  3IQO A;  1YR5 A;  1U5I A;  2QPT A;  4MZL A;  4GBA A;  4XJK B;  2CBL A;  3BXK A;  2BKH B;  1UUR A;  3KHE A;  2ISD A;  2M29 A;  4E68 A;  2JPT A;  1B7T Z;  2KBI A;  1AJ4 A;  1PK0 D;  1YUU A;  2K7B A;  2JNF A;  1TNX A;  3CR5 X;  3GK4 X;  3TDU A;  1S5G Y;  2CNP A;  3WXA A;  1SL9 A;  1QJT A;  1VRK A;  1CLB A;  2COL B;  1A29 A;  4OR9 B;  1M39 A;  2SCP A;  1QIV A;  3LK0 A;  5TNC A;  3VRN A;  2K7O A;  5KTY A;  1TRF A;  3TZ1 A;  4QJ5 B;  1DGU A;  2BCX A;  2JXL A;  1OMD A;  1G4Y R;  2L51 A;  1BOD A;  1IQ3 A;  3DVJ A;  1C7V A;  4PHN A;  5D7F A;  1YTZ C;  1KFX S;  4OCI A;  5GQQ C;  3SJS A;  5KU1 A;  1V1F A;  4GAO A;  2Y5I A;  1TN4 A;  3AAJ A;  3EK8 A;  4JPZ B;  1SPY A;  4AQI A;  1WRL A;  1J1E A;  1XFZ O;  2FJU B;  1QTX A;  1WDC B;  1OOJ A;  1SNL A;  1YX8 A;  2LCP A;  2EC6 B;  4QJ4 B;  3M0W A;  1SCV A;  2AUC A;  4NQG A;  1YVH A;  3KEV A;  1BR4 B;  3NSK A;  2LLT A;  2KGB C;  2LAP A;  3RLZ A;  3SG6 A;  2F3Z A;  3NSI A;  1QVI Z;  1F54 A;  1J7R A;  3RM1 A;  2JWW A;  1NPQ A;  1WRZ A;  2KHN A;  1B8C A;  1CTR A;  2OS8 B;  2M9G A;  4MZJ A;  5ER5 A;  3SG5 A;  1KK8 B;  2BBM A;  3D10 A;  4YGD B;  1ZOT B;  1ALW A;  1DJX A;  1KFU L;  3QRX A;  1K96 A;  1QAS A;  2LVK A;  1DVI A;  1QX2 A;  1KCY A;  1H8B A;  2BL0 C;  2M8U A;  1YUT A;  2K0J A;  2V53 A;  1K8U A;  2L0P A;  2KFG A;  2I18 A;  4L9M A;  2ZN9 A;  3A4U B;  1DMO A;  1K9P A;  3EKJ A;  4I5N B;  1L7Z A;  2PAS A;  3HCM A;  1KWO B;  4MLW A;  4JWQ A;  2JNX A;  2Q4U A;  4HRG A;  4F0Z B;  4ICB A;  1UHN A;  1UWO A;  3ZNI A;  1KSM A;  5I2L A;  1S6C A;  5B8I B;  1WLM A;  1F70 A;  4MVF A;  2ZNE A;  3BOW B;  3TDI A;  3HX4 A;  1WY9 A;  5IBW A;  1C07 A;  1FI5 A;  2WCB A;  1SBJ A;  3IF7 A;  1DJG A;  1NWD A;  1Y6W A;  1QX5 B;  3BUM B;  3CR2 A;  3EVV A;  4ETO A;  2KGR A;  1LVC D;  2JTZ A;  2EHB A;  1B1G A;  3I5G B;  1K9K A;  1L2O B;  1SK6 D;  2JC2 A;  1DJW A;  1SR6 B;  2ZND A;  1B7T Y;  1LKJ A;  3SG2 A;  1F55 A;  1DF0 B;  1PSR A;  2M1K B;  3I5F C;  1M63 B;  5JOL A;  1EL4 A;  5HKZ A;  5D69 A;  1MQ1 A;  1CB1 A;  1CFF A;  5I2O A;  1KQM C;  1NCZ A;  1XFU O;  1N2D A;  3O6B A;  1Y1X A;  5HLV A;  2MBX A;  1UUS A;  1A4P A;  3GK1 A;  3EK4 A;  2BE6 A;  4U8D A;  2VRG A;  1EXR A;  4PAL A;  1CLM A;  3GK2 A;  4TNC A;  2KYF A;  1QXP A;  1FPW A;  4GGF A;  1IWQ A;  5CPV A;  1YVL A;  1LXF C;  2HQ8 A;  2KI4 B;  4I5L B;  2KBM A;  1AJ5 A;  3EK7 A;  2MRD A;  1ZUZ A;  4Q04 A;  4QJ3 B;  1DGV A;  1IJ5 A;  1ZFS A;  2TN4 A;  2B1U A;  4AQJ A;  2CT9 A;  1S36 A;  1SL7 A;  3GOF A;  4PDZ A;  2KYC A;  2LM5 A;  1OZS A;  2K7C A;  3PFV A;  1JC2 A;  1QVI Y;  1SKT A;  1UHH A;  1QAT A;  2JT3 A;  1TOP A;  1LA0 A;  1S6J A;  3H4S E;  1KK7 Z;  4N5X A;  1NYA A;  3TDZ A;  1CKK A;  2L4H A;  1UHJ A;  4CFR A;  1CM1 A;  1R2U A;  3KF9 A;  3OB1 B;  1CDL A;  4PE7 A;  3PN7 B;  5FYX A;  1ALV A;  5HKW A;  1CMG A;  1HQV A;  1QIW A; 
#chains in the Genus database with same CATH topology
 1PVA A;  1B47 A;  2H61 A;  3CLN A;  4A4C A;  2ERB A;  1JFJ A;  1QS7 A;  2HF5 A;  2JPO A;  3KO0 A;  4WRI A;  1CFC A;  1MWN A;  1JF0 A;  2KPH A;  4XYN A;  1B9A A;  4NDD A;  1SRA A;  1YUR A;  2L98 A;  3BYA A;  2WC8 A;  2ZRT A;  5JJG A;  3BFB A;  2KLD A;  1CFD A;  1A75 A;  1NX2 A;  4FQT A;  2L4I A;  5HKY A;  2QEH A;  1LIN A;  3D78 A;  1CFP A;  1K93 D;  1A2X A;  2BE4 A;  4BY4 A;  2H61 C;  2M7N A;  3SS5 A;  2JUL A;  3DD4 A;  4PCW A;  4C0L A;  1RRO A;  4PE0 A;  1G8I A;  5FI7 A;  1CDP A;  2FJY A;  2F8P A;  1KFX L;  3UNW A;  1H4B A;  3SS4 A;  3NSL A;  1R6P A;  1MHO A;  2KFH A;  1TCF A;  4WQ3 A;  1Z2C B;  3F45 A;  4CPV A;  1K90 D;  1XFX O;  3I5H C;  1TWO A;  2OS8 C;  1FF1 A;  1BJF A;  3OBV A;  5AER A;  3R1V A;  2LMV A;  1NX0 A;  3EVU A;  2HQW A;  3B6X A;  4GPL B;  4NDB A;  3VRR A;  2WCL A;  2LC5 A;  3SIA A;  3QME A;  1CDN A;  3WHT B;  1N0Y A;  4HRH A;  1C3Y A;  1AUI B;  1IKU A;  1MF8 B;  1UP5 A;  3FE8 A;  4N1G A;  3BQ3 A;  3S0A A;  1M46 A;  2K8M B;  2LHL A;  4C0K A;  2WCE A;  3S0F A;  3BJH A;  4JQ0 D;  1C7W A;  2SAS A;  1DF0 A;  3B86 A;  1GGW A;  5HLO A;  1CDM A;  1YRT B;  3O78 A;  1DQE A;  1BMO A;  1HT9 A;  4ORC B;  3TS5 C;  2KLE A;  1UHI A;  1KQV A;  1FBV A;  5AFP A;  1DJY A;  2BL0 B;  1F8H A;  1J7Q A;  1RFJ A;  1S5G Z;  3L47 A;  3R1O A;  1QLK A;  2NLN A;  1QV0 A;  3JVT C;  4FQO A;  3I5I B;  3K21 A;  1UHK A;  2LV7 A;  2K60 A;  4GGN A;  1XFR A;  1NIW A;  3CTN A;  3TUY C;  2BKI B;  1SYM A;  1KK7 Y;  2MA2 A;  2BEC A;  1XFW O;  3DVK A;  3JTD B;  1TUJ A;  1L2O C;  1PVB A;  2LLU A;  3I5G C;  2KI6 C;  2WCH A;  1AK8 A;  1SR6 C;  1XFV O;  2LUX A;  1OZO A;  2M3W A;  4OVN F;  3OB2 B;  1SW8 A;  2I94 A;  1X02 A;  2JTT A;  5KSZ A;  2MHH A;  4GUK A;  4GNK B;  5DKN A;  1RWY A;  5CSN A;  1DT7 B;  1TCO B;  1J1D A;  3CZ1 A;  2M1U A;  2L5Y A;  3SG7 A;  2E30 A;  2NCP A;  3LCP C;  5CSF A;  4D1E A;  5CSI A;  3CS1 A;  3PM8 A;  3BUO B;  2PRU A;  1K94 A;  2ZN8 A;  3FE6 A;  3MSE B;  4M2O A;  2KAX A;  3O4Y A;  1IIO A;  2O60 A;  4XJK A;  1N65 A;  2KI6 D;  2KQ6 A;  3L4L A;  2F33 A;  4ORB B;  5EL2 A;  5K89 A;  3LLE A;  1BG1 A;  1GGZ A;  1CNP A;  2BCB A;  2KQY A;  1OOH A;  1FW4 A;  1M45 A;  1NCY A;  2KI4 C;  4M2Q A;  3FWC A;  1XVJ A;  1KQM B;  5D3O A;  3WNX B;  4UPG A;  4YRU A;  1Y0V H;  1CM4 A;  1JF2 A;  2F2O A;  3B87 A;  4ZCU A;  2Y4Q A;  1PSB A;  1AVS A;  2F3Y A;  3Q8I A;  2KDH A;  1ORG A;  3ICB A;  4PE4 A;  2JQ6 A;  2M0R A;  1SCM C;  3AKB A;  2H8V A;  3O2P A;  3S0G A;  1JSA A;  2NZ0 A;  4PHJ A;  4OKH A;  3PJI A;  1JWD A;  2LVJ A;  2WOR A;  2M7L A;  2D8N A;  4DUQ A;  1JUO A;  1F71 A;  4NDC A;  1B4C A;  1NX1 A;  1C3Z A;  1CMF A;  2WND A;  1RJV A;  4GGF C;  4I5J A;  4MN0 A;  4HRE E;  1Y1U A;  4INW A;  4YBH B;  1NCX A;  1OOG A;  3BUW B;  1WLZ A;  5I2Q A;  1LA3 A;  1Q80 A;  1QV1 A;  3EVR A;  3R72 A;  5ER4 X;  2Y1M A;  3BFH A;  1BF5 A;  1NSH A;  2R2I A;  2K61 A;  1DJI A;  3N7H A;  1REC A;  3OX6 A;  2OTG B;  5AEQ A;  3FWB A;  2WCF A;  1ZAC A;  3DF0 B;  3RZS A;  2OPO A;  1IRJ A;  2K2F A;  1W7J B;  1IQ5 A;  3NSO A;  1Y1A A;  3KPX A;  1EH2 A;  1IG5 A;  1S3P A;  1RK9 A;  2MLE C;  3D0Y B;  4YI8 A;  3BUX B;  3EG5 B;  3PSR A;  4P5O E;  3BFA A;  2ZRS A;  1OE9 B;  3VRQ A;  1TNP A;  2KNE A;  5FI6 A;  2LE9 B;  1TUZ A;  4PHM A;  1NX3 A;  2G9B A;  4MZK A;  3D75 A;  2KFF A;  1TNQ A;  2IS9 A;  2WOS A;  2A4J A;  2ZKM X;  4CID A;  3O4X A;  5CSJ A;  1A03 A;  3OX5 A;  1J55 A;  2BBN A;  2FCD A;  1IH0 A;  2JRF A;  1DJH A;  3VRP A;  1M31 A;  3AKA A;  1WDC C;  2PSR A;  1U5I B;  2PVB A;  2EC6 C;  4BY5 A;  4P2Y B;  2L50 A;  2FCE A;  2HET A;  2BNX A;  1BLQ A;  3EKH A;  4ORA B;  1DTL A;  5DKR A;  1T14 A;  2L2E A;  3CAB A;  3K1E A;  2P6B B;  1IJ6 A;  1YX7 A;  2LVI A;  1QX7 A;  4DCK A;  4AOM A;  1WRK A;  1GJY A;  1K95 A;  1MXL C;  2JOJ A;  3CGA A;  2K7D A;  3FIA A;  1KK8 C;  3WHU B;  1XYD A;  5AAN A;  3PAT A;  1BU3 A;  1KFU S;  4WQ2 A;  3DY9 A;  3OP0 A;  2NXQ A;  2LVV A;  4MEW A;  2LNK A;  3BOW A;  4OZD A;  4CFQ A;  4DIR A;  3C1V A;  4JKT A;  1B8R A;  3VGO A;  1EJ3 A;  4CLN A;  3BUN B;  4YGC B;  3IQQ A;  4C0J A;  4DS7 A;  3SG3 A;  1PUL A;  4N1F A;  2M97 A;  5PAL A;  1FI6 A;  2JZI A;  1SY9 A;  3I5H B;  2P71 A;  1XO5 A;  1A75 B;  1GM0 A;  3OHM B;  1KWO C;  1Z4H A;  2GGZ A;  4OV2 A;  1LS8 A;  1OMR A;  1JBA A;  1EG3 A;  3PLF B;  3FE9 A;  1RTP 1;  1W7I B;  5AXI A;  3ZWH A;  1EG4 A;  3R1P A;  2KSP A;  2JT8 A;  3DYE A;  1BT6 A;  2I7A A;  2CCM A;  3A8R A;  5I8N A;  4R1E A;  5BPJ A;  2O5G A;  4DRW A;  2H2K A;  3I5I C;  2Q91 A;  2LLS A;  1AP4 A;  4GFT A;  2I2R E;  4HSZ A;  4YGB B;  2LP3 A;  3CZT X;  1ODB A;  3NXA A;  1G33 A;  2E6W A;  3JTD C;  3LL8 B;  2LMT A;  2G2B A;  1OQP A;  1OOF A;  5J3X A;  2LUC A;  2LAN A;  1K9U A;  3TS5 B;  1J7O A;  2JT0 A;  1TNW A;  4KYN A;  3DVE A;  3E3R A;  1PAL A;  4USL A;  1S26 D;  2HPS A;  2Y1N A;  3JVT B;  2PMY A;  4MSP A;  3S0E A;  2MJW B;  1K2H A;  4MRY A;  4PE1 A;  1XA5 A;  2AAO A;  2DOQ A;  3TUY B;  1S6I A;  2F2P A;  1ZMZ A;  2MAZ A;  2PYQ A;  2RGI A;  4YGA A;  3CR4 X;  3NHT A;  3VRO A;  5G08 A;  1S1E A;  3LK1 A;  1E8A A;  2LHI A;  3I5F B;  1XK4 A;  1MUX A;  2KAV A;  4M2P A;  5HL1 A;  1IGV A;  4FTG A;  2PQL A;  3AAK A;  2QDI A;  2NCO A;  4YI9 A;  1XFY O;  3SIB A;  1KSO A;  4MRX A;  1MXE A;  1F4O A;  2GV5 A;  1CLL A;  3B88 A;  4ZCV A;  1PRW A;  2ZFD A;  3DXL A;  2GGM A;  3SG4 A;  2WCJ A;  1OMV A;  2AMI A;  2JU0 A;  3DF0 A;  2K2A A;  2KAY A;  2LP2 A;  2PAL A;  2JXC A;  2BCA A;  3FS7 A;  1F4Q A;  1QLS A;  4YGE B;  3PM2 A;  1MR8 A;  2QAC A;  4PHK A;  1D1O A;  1YUS A;  2M49 B;  3D0Y A;  1XK4 C;  3DVM A;  1AHR A;  3CWG A;  5HYD A;  1DJZ A;  1SL8 A;  1DEK A;  1BR1 B;  1NUB A;  3IVT A;  1V1G A;  1BOC A;  1OSA A;  2CXJ A;  4A4B A;  3D77 A;  3PAL A;  5F6T A;  2LMU A;  1GQM A;  4MBE A;  1NP8 A;  2MLF C;  1J7P A;  1YRU B;  1B8L A;  2EGD A;  4IL1 A;  1TTX A;  1TIZ A;  2GTE A;  2CTN A;  4F7F A;  1SCM B;  3PN7 C;  2FOT A;  4I5K A;  2KOT A;  5DKQ A;  3S0D A;  2OTG C;  1JFK A;  1SMG A;  2L5X B;  3IQO A;  1YR5 A;  1U5I A;  2QPT A;  4MZL A;  4GBA A;  4XJK B;  2CBL A;  3BXK A;  2BKH B;  1UUR A;  3KHE A;  2ISD A;  2M29 A;  2QEO A;  4E68 A;  2JPT A;  1B7T Z;  2KBI A;  2QEB A;  1AJ4 A;  1PK0 D;  1YUU A;  2K7B A;  2JNF A;  1TNX A;  3CR5 X;  1W9Z A;  3GK4 X;  3TDU A;  1S5G Y;  2CNP A;  3WXA A;  3CDN A;  1SL9 A;  1QJT A;  1VRK A;  1CLB A;  2COL B;  1A29 A;  1OW4 A;  1M39 A;  2SCP A;  1QIV A;  3LK0 A;  4OR9 B;  5TNC A;  2K7O A;  3VRN A;  1TRF A;  5KTY A;  3TZ1 A;  4QJ5 B;  4PT1 A;  1DGU A;  2BCX A;  2JXL A;  3CZ0 A;  1OMD A;  1G4Y R;  2L51 A;  1BOD A;  1IQ3 A;  3DVJ A;  1C7V A;  1DEL A;  4PHN A;  5D7F A;  1YTZ C;  1KFX S;  4OCI A;  5GQQ C;  3SJS A;  5KU1 A;  3NHI A;  1V1F A;  4GAO A;  2Y5I A;  1TN4 A;  3AAJ A;  3EK8 A;  4JPZ B;  1SPY A;  4AQI A;  1WRL A;  1J1E A;  1XFZ O;  2FJU B;  3CYZ A;  1QTX A;  1WDC B;  1OOJ A;  1SNL A;  1YX8 A;  2LCP A;  3L4A A;  2EC6 B;  4QJ4 B;  3M0W A;  1SCV A;  2AUC A;  4NQG A;  1YVH A;  3KEV A;  1BR4 B;  2P70 A;  3SS3 A;  3NSK A;  2QEV A;  2LLT A;  2KGB C;  2LAP A;  3RLZ A;  3SG6 A;  3S0B A;  2F3Z A;  3NSI A;  1QVI Z;  1F54 A;  1J7R A;  2L2C A;  3OGN A;  2JWW A;  1NPQ A;  1WRZ A;  2KHN A;  1B8C A;  1CTR A;  2OS8 B;  2M9G A;  1P28 A;  2WCM A;  4MZJ A;  5ER5 A;  4JD9 A;  3SG5 A;  1KK8 B;  2BBM A;  3D10 A;  4YGD B;  1ZOT B;  1ALW A;  1DJX A;  1KFU L;  3QRX A;  1K96 A;  2YGU A;  1QAS A;  1SSE B;  2LVK A;  4IJ7 A;  1DVI A;  4INX A;  2WC6 A;  1QX2 A;  1KCY A;  1H8B A;  2BL0 C;  2M8U A;  1YUT A;  2K0J A;  2V53 A;  1K8U A;  5I94 A;  2L0P A;  2KFG A;  2I18 A;  4L9M A;  2ZN9 A;  3A4U B;  1DMO A;  1K9P A;  3EKJ A;  4I5N B;  3B7A A;  1L7Z A;  2PAS A;  3HCM A;  3VB1 A;  1KWO B;  3CZ2 A;  4MLW A;  4JWQ A;  1OOI X;  2JNX A;  2Q4U A;  4HRG A;  4F0Z B;  4ICB A;  1UHN A;  1UWO A;  3D74 A;  3ZNI A;  1KSM A;  5FI2 A;  1S6C A;  5I2L A;  5B8I B;  1WLM A;  1F70 A;  4MVF A;  2ZNE A;  3BOW B;  2WCK A;  3TDI A;  3DZT A;  3HX4 A;  1WY9 A;  5IBW A;  1C07 A;  1FI5 A;  2WCB A;  1SBJ A;  3IF7 A;  1DJG A;  1NWD A;  1Y6W A;  1QX5 B;  3BUM B;  3CR2 A;  3EVV A;  4ETO A;  2KGR A;  1LVC D;  2BAP A;  2JTZ A;  2EHB A;  1B1G A;  3I5G B;  1K9K A;  1L2O B;  1SK6 D;  2JC2 A;  1DJW A;  1SR6 B;  2ZND A;  1B7T Y;  1LKJ A;  3SG2 A;  1F55 A;  1DF0 B;  1PSR A;  2M1K B;  3I5F C;  1M63 B;  5JOL A;  1EL4 A;  5HKZ A;  5D69 A;  1MQ1 A;  1CB1 A;  3D76 A;  1CFF A;  5I2O A;  1KQM C;  1NCZ A;  1XFU O;  1N2D A;  3O6B A;  1Y1X A;  5HLV A;  2MBX A;  1UUS A;  2WC5 A;  1A4P A;  3GK1 A;  3EK4 A;  2BE6 A;  4U8D A;  3NGV A;  2VRG A;  1EXR A;  4PAL A;  1CLM A;  3GK2 A;  4TNC A;  2KYF A;  1QXP A;  1FPW A;  4GGF A;  1IWQ A;  5CPV A;  1YVL A;  1LXF C;  2HQ8 A;  2KI4 B;  4I5L B;  3RM1 A;  2KBM A;  1AJ5 A;  3EK7 A;  2MRD A;  1ZUZ A;  4Q04 A;  4QJ3 B;  1DGV A;  1IJ5 A;  1ZFS A;  2TN4 A;  2B1U A;  4AQJ A;  2CT9 A;  1S36 A;  3UO9 A;  1SL7 A;  3GOF A;  4PDZ A;  1QWV A;  2KYC A;  2LM5 A;  3V2L A;  1OZS A;  2K7C A;  3PFV A;  1JC2 A;  1QVI Y;  1SKT A;  1UHH A;  1QAT A;  2JT3 A;  1TOP A;  1LA0 A;  1S6J A;  5DIC A;  3H4S E;  1KK7 Z;  4N5X A;  1NYA A;  3TDZ A;  1CKK A;  2L4H A;  1UHJ A;  1DC1 A;  4CFR A;  1CM1 A;  1R2U A;  3D73 A;  3KF9 A;  3OB1 B;  1CDL A;  4PE7 A;  3PN7 B;  5FYX A;  1ALV A;  5HKW A;  1CMG A;  1HQV A;  1QIW A; 
#chains in the Genus database with same CATH homology
 1PVA A;  1B47 A;  2H61 A;  3CLN A;  4A4C A;  1JFJ A;  1QS7 A;  2HF5 A;  3KO0 A;  4WRI A;  1CFC A;  1MWN A;  1JF0 A;  4XYN A;  1B9A A;  4NDD A;  1SRA A;  1YUR A;  2L98 A;  3BYA A;  2WC8 A;  2ZRT A;  5JJG A;  1CFD A;  1A75 A;  1NX2 A;  2L4I A;  5HKY A;  1LIN A;  1CFP A;  1K93 D;  1A2X A;  2BE4 A;  4BY4 A;  2H61 C;  2M7N A;  2JUL A;  3DD4 A;  4PCW A;  4C0L A;  1RRO A;  4PE0 A;  1G8I A;  1CDP A;  1H4B A;  2F8P A;  1KFX L;  3NSL A;  1R6P A;  1MHO A;  2KFH A;  1TCF A;  4WQ3 A;  3F45 A;  4CPV A;  1K90 D;  1XFX O;  3I5H C;  2OS8 C;  1FF1 A;  1BJF A;  5AER A;  2LMV A;  1NX0 A;  3EVU A;  2HQW A;  4GPL B;  4NDB A;  3VRR A;  2LC5 A;  3SIA A;  1CDN A;  3WHT B;  1N0Y A;  4HRH A;  1AUI B;  1IKU A;  1MF8 B;  1UP5 A;  4N1G A;  3BQ3 A;  1M46 A;  2K8M B;  2LHL A;  4C0K A;  2WCE A;  4JQ0 D;  1C7W A;  2SAS A;  1DF0 A;  1GGW A;  5HLO A;  1CDM A;  1YRT B;  3O78 A;  1BMO A;  1HT9 A;  4ORC B;  3TS5 C;  1KQV A;  1UHI A;  1FBV A;  5AFP A;  1DJY A;  2BL0 B;  1J7Q A;  1RFJ A;  1S5G Z;  1QLK A;  2NLN A;  1QV0 A;  3JVT C;  4FQO A;  3I5I B;  3K21 A;  1UHK A;  2LV7 A;  4GGN A;  3CTN A;  1NIW A;  3TUY C;  2BKI B;  1SYM A;  1KK7 Y;  2MA2 A;  2BEC A;  1XFW O;  3DVK A;  3JTD B;  3I5G C;  1L2O C;  1PVB A;  2LLU A;  1AK8 A;  2KI6 C;  1SR6 C;  1XFV O;  2LUX A;  1OZO A;  2M3W A;  4OVN F;  3OB2 B;  1SW8 A;  2I94 A;  1X02 A;  2JTT A;  5KSZ A;  2MHH A;  4GUK A;  4GNK B;  5DKN A;  1RWY A;  5CSN A;  1DT7 B;  1TCO B;  1J1D A;  2M1U A;  3SG7 A;  2E30 A;  2NCP A;  3LCP C;  5CSF A;  4D1E A;  5CSI A;  3CS1 A;  3PM8 A;  3BUO B;  2PRU A;  1K94 A;  2ZN8 A;  3MSE B;  4M2O A;  2KAX A;  3O4Y A;  2O60 A;  4XJK A;  1N65 A;  2KI6 D;  2KQ6 A;  4ORB B;  2F33 A;  5K89 A;  1F8H A;  3LLE A;  1BG1 A;  1GGZ A;  1CNP A;  2BCB A;  2KQY A;  1FW4 A;  1M45 A;  1NCY A;  2KI4 C;  4M2Q A;  3FWC A;  1XVJ A;  1KQM B;  3WNX B;  4UPG A;  4YRU A;  1Y0V H;  1CM4 A;  1JF2 A;  2F2O A;  4ZCU A;  2Y4Q A;  1PSB A;  1AVS A;  2F3Y A;  2KDH A;  3ICB A;  4PE4 A;  2JQ6 A;  2M0R A;  1SCM C;  3AKB A;  3O2P A;  1JSA A;  2NZ0 A;  4PHJ A;  4OKH A;  1JWD A;  2LVJ A;  2WOR A;  2M7L A;  2D8N A;  4DUQ A;  1JUO A;  1F71 A;  4NDC A;  1B4C A;  1NX1 A;  1CMF A;  2WND A;  1RJV A;  4GGF C;  4I5J A;  4MN0 A;  4HRE E;  1Y1U A;  4YBH B;  1NCX A;  3BUW B;  1WLZ A;  5I2Q A;  1LA3 A;  1Q80 A;  1QV1 A;  3EVR A;  5ER4 X;  2Y1M A;  1BF5 A;  1NSH A;  2R2I A;  2K61 A;  1DJI A;  1REC A;  3OX6 A;  2OTG B;  5AEQ A;  3FWB A;  2WCF A;  1ZAC A;  3DF0 B;  2OPO A;  1IRJ A;  2K2F A;  1W7J B;  1IQ5 A;  3NSO A;  1Y1A A;  3KPX A;  1EH2 A;  1IG5 A;  1S3P A;  1RK9 A;  2MLE C;  3D0Y B;  4YI8 A;  3BUX B;  3PSR A;  4P5O E;  2ZRS A;  1OE9 B;  3VRQ A;  1TNP A;  2KNE A;  2LE9 B;  4PHM A;  1NX3 A;  2G9B A;  4MZK A;  2KFF A;  1TNQ A;  2IS9 A;  2WOS A;  2A4J A;  2ZKM X;  4CID A;  1A03 A;  5CSJ A;  3OX5 A;  1J55 A;  2BBN A;  2FCD A;  1IH0 A;  2JRF A;  1DJH A;  3VRP A;  1M31 A;  3AKA A;  1WDC C;  2PSR A;  1U5I B;  2PVB A;  2EC6 C;  4BY5 A;  4P2Y B;  2L50 A;  2FCE A;  2HET A;  1BLQ A;  3EKH A;  4ORA B;  1DTL A;  5DKR A;  2L2E A;  2P6B B;  1IJ6 A;  1YX7 A;  2LVI A;  1QX7 A;  4DCK A;  4AOM A;  1WRK A;  1GJY A;  1K95 A;  1MXL C;  2JOJ A;  3CGA A;  2K7D A;  3FIA A;  1KK8 C;  3WHU B;  1XYD A;  5AAN A;  3PAT A;  1BU3 A;  1KFU S;  4WQ2 A;  3OP0 A;  2NXQ A;  2LVV A;  4MEW A;  2LNK A;  3BOW A;  4CFQ A;  4DIR A;  3C1V A;  3VGO A;  1B8R A;  1EJ3 A;  4CLN A;  3BUN B;  4YGC B;  3IQQ A;  4C0J A;  4DS7 A;  3SG3 A;  1PUL A;  4N1F A;  2M97 A;  5PAL A;  1FI6 A;  2JZI A;  1SY9 A;  3I5H B;  1XO5 A;  1A75 B;  3OHM B;  1KWO C;  2GGZ A;  4OV2 A;  1OMR A;  1JBA A;  1EG3 A;  3PLF B;  1RTP 1;  1W7I B;  5AXI A;  3ZWH A;  1EG4 A;  2KSP A;  2JT8 A;  1BT6 A;  2I7A A;  2CCM A;  3A8R A;  5I8N A;  4R1E A;  5BPJ A;  2O5G A;  4DRW A;  2H2K A;  3I5I C;  2Q91 A;  2LLS A;  1AP4 A;  4GFT A;  2I2R E;  4HSZ A;  4YGB B;  2LP3 A;  3CZT X;  1ODB A;  3NXA A;  1G33 A;  2E6W A;  3JTD C;  3LL8 B;  2LMT A;  2G2B A;  1OQP A;  5J3X A;  2LUC A;  2LAN A;  1K9U A;  3TS5 B;  1J7O A;  2JT0 A;  1TNW A;  3DVE A;  3E3R A;  1PAL A;  4USL A;  1S26 D;  2HPS A;  2Y1N A;  3JVT B;  2PMY A;  4MSP A;  2MJW B;  1K2H A;  4MRY A;  4PE1 A;  1XA5 A;  2AAO A;  2DOQ A;  3TUY B;  1S6I A;  2F2P A;  1ZMZ A;  2MAZ A;  2RGI A;  4YGA A;  3CR4 X;  3VRO A;  5G08 A;  1S1E A;  3LK1 A;  1E8A A;  2LHI A;  3I5F B;  1XK4 A;  1MUX A;  2KAV A;  4M2P A;  1IGV A;  4FTG A;  3AAK A;  2NCO A;  4YI9 A;  1XFY O;  3SIB A;  1KSO A;  4MRX A;  1MXE A;  1F4O A;  2GV5 A;  1CLL A;  4ZCV A;  1PRW A;  2ZFD A;  2GGM A;  3SG4 A;  1OMV A;  2AMI A;  2JU0 A;  3DF0 A;  2K2A A;  2KAY A;  2LP2 A;  2PAL A;  2JXC A;  2BCA A;  3FS7 A;  1F4Q A;  1QLS A;  4YGE B;  1MR8 A;  2QAC A;  4PHK A;  1D1O A;  1YUS A;  2M49 B;  3D0Y A;  1XK4 C;  3DVM A;  1AHR A;  3CWG A;  5HYD A;  1DJZ A;  1SL8 A;  1BR1 B;  1NUB A;  1V1G A;  1BOC A;  1OSA A;  2CXJ A;  4A4B A;  3PAL A;  5F6T A;  2LMU A;  1GQM A;  4MBE A;  1NP8 A;  2MLF C;  1J7P A;  1YRU B;  1B8L A;  2EGD A;  4IL1 A;  1TTX A;  1TIZ A;  2CTN A;  1SCM B;  3PN7 C;  2FOT A;  4I5K A;  2KOT A;  5DKQ A;  2OTG C;  1JFK A;  1SMG A;  2L5X B;  3IQO A;  1YR5 A;  1U5I A;  2QPT A;  4MZL A;  4GBA A;  4XJK B;  2CBL A;  3BXK A;  2BKH B;  1UUR A;  3KHE A;  2ISD A;  2M29 A;  4E68 A;  2JPT A;  1B7T Z;  2KBI A;  1AJ4 A;  1PK0 D;  1YUU A;  2K7B A;  2JNF A;  1TNX A;  3CR5 X;  3GK4 X;  3TDU A;  1S5G Y;  2CNP A;  3WXA A;  1SL9 A;  1QJT A;  1VRK A;  1CLB A;  2COL B;  1A29 A;  4OR9 B;  1M39 A;  2SCP A;  1QIV A;  3LK0 A;  5TNC A;  3VRN A;  2K7O A;  5KTY A;  1TRF A;  3TZ1 A;  4QJ5 B;  1DGU A;  2BCX A;  2JXL A;  1OMD A;  1G4Y R;  2L51 A;  1BOD A;  1IQ3 A;  3DVJ A;  1C7V A;  4PHN A;  5D7F A;  1YTZ C;  1KFX S;  4OCI A;  5GQQ C;  3SJS A;  5KU1 A;  1V1F A;  4GAO A;  2Y5I A;  1TN4 A;  3AAJ A;  3EK8 A;  4JPZ B;  1SPY A;  4AQI A;  1WRL A;  1J1E A;  1XFZ O;  2FJU B;  1QTX A;  1WDC B;  1OOJ A;  1SNL A;  1YX8 A;  2LCP A;  2EC6 B;  4QJ4 B;  3M0W A;  1SCV A;  2AUC A;  4NQG A;  1YVH A;  3KEV A;  1BR4 B;  3NSK A;  2LLT A;  2KGB C;  2LAP A;  3RLZ A;  3SG6 A;  2F3Z A;  3NSI A;  1QVI Z;  1F54 A;  1J7R A;  3RM1 A;  2JWW A;  1NPQ A;  1WRZ A;  2KHN A;  1B8C A;  1CTR A;  2OS8 B;  2M9G A;  4MZJ A;  5ER5 A;  3SG5 A;  1KK8 B;  2BBM A;  3D10 A;  4YGD B;  1ZOT B;  1ALW A;  1DJX A;  1KFU L;  3QRX A;  1K96 A;  1QAS A;  2LVK A;  1DVI A;  1QX2 A;  1KCY A;  1H8B A;  2BL0 C;  2M8U A;  1YUT A;  2K0J A;  2V53 A;  1K8U A;  2L0P A;  2KFG A;  2I18 A;  4L9M A;  2ZN9 A;  3A4U B;  1DMO A;  1K9P A;  3EKJ A;  4I5N B;  1L7Z A;  2PAS A;  3HCM A;  1KWO B;  4MLW A;  4JWQ A;  2JNX A;  2Q4U A;  4HRG A;  4F0Z B;  4ICB A;  1UHN A;  1UWO A;  3ZNI A;  1KSM A;  5I2L A;  1S6C A;  5B8I B;  1WLM A;  1F70 A;  4MVF A;  2ZNE A;  3BOW B;  3TDI A;  3HX4 A;  1WY9 A;  5IBW A;  1C07 A;  1FI5 A;  2WCB A;  1SBJ A;  3IF7 A;  1DJG A;  1NWD A;  1Y6W A;  1QX5 B;  3BUM B;  3CR2 A;  3EVV A;  4ETO A;  2KGR A;  1LVC D;  2JTZ A;  2EHB A;  1B1G A;  3I5G B;  1K9K A;  1L2O B;  1SK6 D;  2JC2 A;  1DJW A;  1SR6 B;  2ZND A;  1B7T Y;  1LKJ A;  3SG2 A;  1F55 A;  1DF0 B;  1PSR A;  2M1K B;  3I5F C;  1M63 B;  5JOL A;  1EL4 A;  5HKZ A;  5D69 A;  1MQ1 A;  1CB1 A;  1CFF A;  5I2O A;  1KQM C;  1NCZ A;  1XFU O;  1N2D A;  3O6B A;  1Y1X A;  5HLV A;  2MBX A;  1UUS A;  1A4P A;  3GK1 A;  3EK4 A;  2BE6 A;  4U8D A;  2VRG A;  1EXR A;  4PAL A;  1CLM A;  3GK2 A;  4TNC A;  2KYF A;  1QXP A;  1FPW A;  4GGF A;  1IWQ A;  5CPV A;  1YVL A;  1LXF C;  2HQ8 A;  2KI4 B;  4I5L B;  2KBM A;  1AJ5 A;  3EK7 A;  2MRD A;  1ZUZ A;  4Q04 A;  4QJ3 B;  1DGV A;  1IJ5 A;  1ZFS A;  2TN4 A;  2B1U A;  4AQJ A;  2CT9 A;  1S36 A;  1SL7 A;  3GOF A;  4PDZ A;  2KYC A;  2LM5 A;  1OZS A;  2K7C A;  3PFV A;  1JC2 A;  1QVI Y;  1SKT A;  1UHH A;  1QAT A;  2JT3 A;  1TOP A;  1LA0 A;  1S6J A;  3H4S E;  1KK7 Z;  4N5X A;  1NYA A;  3TDZ A;  1CKK A;  2L4H A;  1UHJ A;  4CFR A;  1CM1 A;  1R2U A;  3KF9 A;  3OB1 B;  1CDL A;  4PE7 A;  3PN7 B;  5FYX A;  1ALV A;  5HKW A;  1CMG A;  1HQV A;  1QIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...