2WCKA

Structure of bmori gobp2 (general odorant binding protein 2) without ligand
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wckA00
3CABA 1DQEA 3S0EA 3PJIA 3R72A 3DZTA 2L2CA 2WCMA 3D74A 2ERBA 3B87A 3V2LA 3DXLA 3K1EA 4F7FA 3L4AA 3DY9A 3CZ2A 3RZSA 2JPOA 1C3ZA 3N7HA 3OGNA 3S0BA 3D78A 2H8VA 3FE6A 3FE8A 2P71A 3S0AA 1OOFA 4FQTA 1OOHA 2QDIA 1T14A 2WC5A 2WCKA 1ORGA 3R1PA 3D77A 5EL2A 2QEHA 3VB1A 3QMEA 2WCLA 3CZ1A 3Q8IA 1OOGA 3CZ0A 3BFHA 1LS8A 2FJYA 1TWOA 3S0FA 4PT1A 2QEBA 2QEOA 3CDNA 3DYEA 3NGVA 2WC6A 1GM0A 3CYZA 3B88A 3B6XA 3L4LA 2WCHA 4INXA 1QWVA 3NHIA 3B7AA 3D73A 2P70A 3R1OA 4JD9A 3BFAA 3D75A 3L47A 3BJHA 2GTEA 2PQLA 3B86A 2KPHA 3NHTA 1C3YA 3BFBA 3D76A 1OOIX 2QEVA 1XFRA 3S0DA 3S0GA 2WCJA 1TUJA 3FE9A 4INWA 5DICA 1P28A 4OZDA 3R1VA 1OW4A
chains in the Genus database with same CATH superfamily
2LMVA 3PM8A 1RECA 1LKJA 1IH0A 2FJUB 3CABA 2H61A 1AUIB 3KPXA 3A8RA 1S6CA 1W9ZA 3S0EA 3PJIA 4C0KA 2K2AA 1YRTB 2LMUA 3AAJA 2K61A 3ICBA 1KK7Y 1Y1AA 1UHKA 3LK1A 4CFRA 3D74A 1AP4A 1A03A 4PALA 2ERBA 1SCVA 1ODBA 5HKZA 1OMRA 1PALA 1S3PA 2M49B 3DXLA 3GK4X 4P5OE 3K1EA 4Q04A 3JVTC 1QVIY 1Y1UA 1Z2CB 3RZSA 4DIRA 3A4UB 2K7BA 3VRNA 1KWOC 3BOWA 1M46A 1OE9B 3BUOB 5FYXA 3I5HB 3DVJA 4XJKB 4JQ0D 1BJFA 3FE8A 1BU3A 1CNPA 4YGEB 1CM1A 1MUXA 3S0AA 1OOFA 4PHMA 2KI4B 1Q80A 1S5GY 1SPYA 2BL0C 2F33A 3K21A 1KK8B 4FQTA 4XJKA 1UHNA 2AUCA 1XK4A 4MZLA 1OOHA 1ALWA 1X02A 1YX8A 2M97A 2OTGB 4U8DA 3O4XA 3SG7A 4GGFA 1T14A 2LUXA 2JT3A 2KNEA 1ZOTB 3R1PA 1K90D 5EL2A 1NX0A 2WCLA 1RTP1 3VGOA 1SMGA 1DGVA 4FTGA 3SIAA 3Q8IA 1JBAA 1QXPA 5HKWA 4YI9A 1LXFC 1XFYO 2ZNDA 2BNXA 1SNLA 3UO9A 3RM1A 1OZSA 2G9BA 1C7VA 1DJHA 2PMYA 1QV1A 1WRKA 4YGAA 1C7WA 3S0FA 4CLNA 5J3XA 1K96A 4AQJA 2I94A 2DOQA 1DC1A 1TUZA 2QEOA 3FS7A 3LK0A 3DYEA 3CYZA 2KBMA 2E6WA 3BQ3A 3L4LA 3SG4A 2KI6C 2JWWA 2EC6C 2Q91A 2FOTA 2WCHA 4OR9B 1JF0A 1NCYA 2K60A 3HX4A 2MRDA 4INXA 1YR5A 5ER5A 2OTGC 1JFKA 3KO0A 2G2BA 5D7FA 3NHIA 5AXIA 1FI5A 2FCDA 1IKUA 2CT9A 4QJ5B 2MLEC 1H4BA 2EGDA 2P70A 3R1OA 1ZACA 3OHMB 1SL7A 3BFAA 4MVFA 3RLZA 3PALA 4L9MA 2JT0A 3JTDB 1SR6B 3NXAA 1UHIA 1Z4HA 3FWCA 3D75A 2WORA 3O6BA 1MR8A 2JOJA 2P6BB 1BODA 1B8RA 3EK8A 4WQ3A 3PN7B 2LVJA 5KU1A 4CIDA 5ER4X 4KYNA 1CDLA 1KQMC 1NCZA 1PSRA 4P2YB 1L2OC 4YGDB 4A4CA 1BLQA 3JVTB 1H8BA 1KCYA 2BE4A 4N1GA 3EK7A 2Q4UA 2F8PA 3DVEA 1YVLA 2NLNA 2CXJA 2KI6D 2QEVA 1NIWA 2MA2A 1SSEB 1S1EA 1SCMB 4NDDA 1B47A 3VRQA 3TUYC 2A4JA 1KK8C 3FE9A 3OB2B 1BR1B 2KI4C 1WDCB 1K9PA 3R1VA 2JT8A 1BR4B 3SIBA 1UP5A 1KSMA 4IJ7A 3TS5C 1B4CA 4DCKA 3AAKA 4MN0A 1SYMA 4YRUA 4MRXA 2ISDA 3DZTA 4PHKA 2M3WA 2WCMA 2K2FA 1M63B 4CPVA 2Y1MA 1BF5A 1KFXL 4GGNA 2LANA 3BXKA 3SG2A 1OZOA 4QJ3B 3WHTB 1TOPA 2BCAA 1GJYA 2F3ZA 1D1OA 5DKQA 2BE6A 2SCPA 1DJZA 1MXEA 1G4YR 1VRKA 1CMGA 2F2OA 4NQGA 4I5NB 1B7TY 2Y4QA 3N7HA 3S0BA 4ORCB 3D78A 1J1DA 2KFHA 1XA5A 4DUQA 1F4OA 5CPVA 1YRUB 1N2DA 2I2RE 4MLWA 3BUXB 5GQQC 3O2PA 4MEWA 5G08A 2LP2A 1RWYA 2BCXA 3QRXA 2LE9B 3TS5B 1CM4A 5IBWA 4M2OA 2QDIA 1QVIZ 2F2PA 3EKJA 2WCKA 2PASA 3FWBA 1JC2A 1K9KA 3WHUB 1NSHA 5HLOA 3D0YB 1OMDA 3CZ1A 1G33A 4OKHA 2KBIA 1FW4A 1K95A 3BUWB 1HQVA 1GGWA 3EVUA 1DMOA 1J7PA 2NCOA 2LVIA 3CWGA 1DT7B 3D0YA 1TWOA 4JWQA 2L51A 1OMVA 3DF0B 1YUSA 1B1GA 1LA3A 1N0YA 2RGIA 5HKYA 1K2HA 2M9GA 3EVRA 4PE1A 2COLB 1YUTA 4GFTA 3DF0A 3NGVA 3GOFA 1F4QA 3CS1A 3TDIA 2HQ8A 3OP0A 2Y1NA 3SS3A 1YURA 3B6XA 3OX6A 1CLBA 3BUMB 4MBEA 1RROA 1XFWO 3NSOA 2H61C 1MQ1A 2BBMA 2L5YA 2OPOA 4NDBA 1Y1XA 2PYQA 1E8AA 1IJ5A 1QWVA 1NP8A 3B7AA 2ZRTA 1JUOA 2ZKMX 1DVIA 1DJXA 1OSAA 2FCEA 3NSLA 4OCIA 2KGRA 3I5GB 1RFJA 2PSRA 1ZMZA 1R6PA 3CR2A 1S6JA 1F55A 1LINA 5KTYA 1JF2A 3SG6A 1QIWA 1TNXA 3PM2A 4PDZA 3BJHA 2GTEA 2LUCA 2K0JA 2I7AA 2ZN8A 1FPWA 3I5HC 1TTXA 1WRZA 2LAPA 3NHTA 1TCFA 2M8UA 3CR5X 2O60A 3LLEA 1OOIX 1SRAA 1XYDA 1NPQA 2PVBA 3S0DA 4MZJA 2KQYA 1NX1A 3NSKA 1TNQA 4HRHA 1FI6A 2M7NA 1CLLA 5I2QA 3WNXB 4M2QA 1M31A 2LP3A 3AKAA 2GGZA 3CR4X 4YGCB 1B8CA 1DTLA 1KWOB 1DQEA 1MHOA 4N5XA 5KSZA 1AVSA 3TDUA 1PK0D 1J1EA 1CFPA 3MSEB 1HT9A 1SBJA 1SCMC 2BECA 4HRGA 2L2CA 2L5XB 1DELA 3B87A 1WDCC 1WLMA 1J7QA 1YTZC 1TNPA 2MAZA 2LVVA 3KF9A 1IQ3A 1NX3A 3EKHA 2JXCA 4ZCVA 4F7FA 1DJGA 1YVHA 3EK4A 3CZ2A 4UPGA 1A2XA 3LL8B 2KQ6A 2KGBC 1BOCA 2BAPA 4ETOA 1ALVA 3WXAA 3OGNA 3SJSA 5DKNA 1MXLC 3H4SE 1IGVA 2LVKA 3JTDC 3TDZA 1PRWA 1LA0A 2AAOA 5I8NA 5K89A 3BOWB 4MRYA 1YX7A 3GK2A 4PHJA 1TRFA 2MBXA 3O78A 3VRPA 1CFCA 4PE7A 2H2KA 1WRLA 2WOSA 1BT6A 1BMOA 5JOLA 2KAXA 4USLA 3I5GC 2KSPA 1NCXA 1XVJA 2LMTA 1NUBA 2WC5A 3VRRA 1ORGA 3D77A 4GPLB 1Y0VH 2M29A 1F70A 1K8UA 2JC2A 1KQMB 4ORAB 1C07A 1OOGA 1EG3A 3AKBA 2LLUA 3I5IB 4PE4A 1GQMA 1OOJA 2F3YA 1DGUA 5AFPA 2CTNA 5I2LA 1EJ3A 2CBLA 2L4IA 1CDNA 2I18A 1NWDA 2VRGA 4BY4A 5DKRA 5I94A 3I5FC 1JSAA 4C0JA 1KFUS 2NZ0A 1GM0A 1OQPA 1LVCD 1W7IB 2B1UA 2WCEA 3E3RA 1EL4A 2BKIB 3KEVA 2ZNEA 5HL1A 1FBVA 3BUNB 2JU0A 4ZCUA 1QX7A 5CSJA 3BYAA 1QLSA 2QACA 1S26D 1QX5B 2KYFA 2E30A 1XFUO 2ZRSA 3OB1B 2Y5IA 4WRIA 1QTXA 1TN4A 3D73A 2L98A 4GUKA 2LNKA 3OBVA 1J7OA 1F54A 3SG5A 2GV5A 2BBNA 4JD9A 1KK7Z 2MLFC 5HYDA 1KQVA 1A4PA 1V1GA 1S6IA 3CTNA 2WCBA 1K93D 1CFDA 2ZFDA 1AJ4A 1CMFA 1DJWA 4HREE 1IIOA 1IRJA 3I5IC 5B8IB 2CNPA 4MZKA 1B7TZ 2TN4A 2PQLA 3ZWHA 1B9AA 4OVNF 1XFXO 2KPHA 4QJ4B 2KAVA 1AK8A 2LLSA 1WLZA 5CSIA 1R2UA 2V53A 1SL8A 2KFGA 1PSBA 1A75B 3BFBA 1SW8A 1W7JB 2KHNA 3D76A 1C3YA 1JFJA 2WCFA 1XFRA 1J55A 1EH2A 2WC8A 1TIZA 2LCPA 3O4YA 4JKTA 1DEKA 3S0GA 2JTTA 4INWA 1CDPA 2KYCA 1P28A 4OZDA 1ZUZA 1ZFSA 2K7DA 5TNCA 3IVTA 2WNDA 1CDMA 2IS9A 4M2PA 1XFZO 3F45A 2JTZA 3KHEA 4DRWA 2GGMA 1PVBA 2BL0B 3IQQA 3PSRA 1QLKA 3R72A 1DF0B 2BCBA 3TUYB 1RK9A 1UUSA 1K94A 2JNFA 2LHIA 3HCMA 5HLVA 3V2LA 1DJIA 4AOMA 1FF1A 2PRUA 2JNXA 2KLEA 4I5JA 5PALA 1JWDA 5AERA 3DD4A 3LCPC 2HETA 3L4AA 3DY9A 1QS7A 5FI7A 2JPOA 4F0ZB 1BG1A 1L7ZA 2BKHB 4GAOA 3IQOA 1C3ZA 2JPTA 1IWQA 4I5LB 3SS5A 2JULA 4A4BA 2CCMA 2H8VA 3FE6A 1SR6C 2YGUA 2MJWB 1QX2A 1PULA 2P71A 3CGAA 1L2OB 3CZTX 1S36A 5D69A 3CLNA 5AEQA 4D1EA 1MF8B 4GBAA 1NX2A 2JQ6A 1Y6WA 4MSPA 3EVVA 4TNCA 2L50A 5JJGA 2M0RA 1A75A 1N65A 4XYNA 1QV0A 2HQWA 3D10A 5FI6A 1CFFA 1XK4C 1IG5A 1F71A 1F8HA 4PE0A 2LLTA 3TZ1A 2L2EA 2K7CA 2EC6B 1CKKA 5AANA 2LHLA 3ZNIA 1UWOA 4YGBB 1QASA 2D8NA 2QEHA 3VB1A 3QMEA 4E68A 2NCPA 1AJ5A 1IJ6A 4YI8A 2LM5A 1NYAA 3I5FB 3CZ0A 3BFHA 1SKTA 2OS8B 4AQIA 3UNWA 3OX5A 1SK6D 1EG4A 1LS8A 1U5IB 1GGZA 2KOTA 3PLFB 2FJYA 4OV2A 4PCWA 1K9UA 2AMIA 4N1FA 3VROA 1DF0A 1S5GZ 1DJYA 1QATA 1SY9A 1QIVA 1U5IA 4ORBB 1B8LA 1XFVO 3PN7C 4GGFC 2KAYA 2SASA 3PFVA 2QEBA 4PT1A 1G8IA 4WQ2A 3CDNA 2LC5A 1TNWA 2O5GA 2WC6A 4HSZA 3B88A 3GK1A 4NDCA 3SG3A 3DVMA 1M45A 2HPSA 1CTRA 3C1VA 2L0PA 2ZN9A 3M0WA 2K7OA 2PALA 4DS7A 4R1EA 3DVKA 1SL9A 1RJVA 1XO5A 1KFUL 1A29A 1WY9A 2QPTA 3EG5B 3IF7A 4GNKB 1UHJA 1QJTA 5D3OA 1KSOA 2R2IA 5CSNA 2MHHA 5BPJA 1KFXS 1CLMA 3L47A 2M7LA 5F6TA 2LV7A 2KLDA 2OS8C 5I2OA 1UHHA 3FIAA 1YUUA 3B86A 4I5KA 5CSFA 2KDHA 3NSIA 4YBHB 2HF5A 1CB1A 2L4HA 1V1FA 2JXLA 3SS4A 2EHBA 3PATA 2M1UA 2KFFA 1PVAA 2M1KB 1AHRA 4JPZB 1J7RA 2K8MB 1IQ5A 1TCOB 2JRFA 1M39A 1TUJA 2WCJA 4FQOA 5DICA 5FI2A 1EXRA 2NXQA 4PHNA 4CFQA 1MWNA 4IL1A 2JZIA 4BY5A 4ICBA 4C0LA 1OW4A 1UURA
chains in the Genus database with same CATH topology
3CABA 1DQEA 3S0EA 3PJIA 3R72A 3DZTA 2L2CA 2WCMA 3D74A 2ERBA 3B87A 3V2LA 3DXLA 3K1EA 4F7FA 3L4AA 3DY9A 3CZ2A 3RZSA 2JPOA 1C3ZA 3N7HA 3OGNA 3S0BA 3D78A 2H8VA 3FE6A 3FE8A 2P71A 3S0AA 1OOFA 4FQTA 1OOHA 2QDIA 1T14A 2WC5A 2WCKA 1ORGA 3R1PA 3D77A 5EL2A 2QEHA 3VB1A 3QMEA 2WCLA 3CZ1A 3Q8IA 1OOGA 3CZ0A 3BFHA 1LS8A 2FJYA 1TWOA 3S0FA 4PT1A 2QEBA 2QEOA 3CDNA 3DYEA 3NGVA 2WC6A 1GM0A 3CYZA 3B88A 3B6XA 3L4LA 2WCHA 4INXA 1QWVA 3NHIA 3B7AA 3D73A 2P70A 3R1OA 4JD9A 3BFAA 3D75A 3L47A 3BJHA 2GTEA 2PQLA 3B86A 2KPHA 3NHTA 1C3YA 3BFBA 3D76A 1OOIX 2QEVA 1XFRA 3S0DA 3S0GA 2WCJA 1TUJA 3FE9A 4INWA 5DICA 1P28A 4OZDA 3R1VA 1OW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAB A;  1DQE A;  3S0E A;  3PJI A;  3R72 A;  3DZT A;  2L2C A;  2WCM A;  3D74 A;  2ERB A;  3B87 A;  3V2L A;  3DXL A;  3K1E A;  4F7F A;  3L4A A;  3DY9 A;  3CZ2 A;  3RZS A;  2JPO A;  1C3Z A;  3N7H A;  3OGN A;  3S0B A;  3D78 A;  2H8V A;  3FE6 A;  3FE8 A;  2P71 A;  3S0A A;  1OOF A;  4FQT A;  1OOH A;  2QDI A;  1T14 A;  2WC5 A;  2WCK A;  1ORG A;  3R1P A;  3D77 A;  5EL2 A;  2QEH A;  3VB1 A;  3QME A;  2WCL A;  3CZ1 A;  3Q8I A;  1OOG A;  3CZ0 A;  3BFH A;  1LS8 A;  2FJY A;  1TWO A;  3S0F A;  4PT1 A;  2QEB A;  2QEO A;  3CDN A;  3DYE A;  3NGV A;  2WC6 A;  1GM0 A;  3CYZ A;  3B88 A;  3B6X A;  3L4L A;  2WCH A;  4INX A;  1QWV A;  3NHI A;  3B7A A;  3D73 A;  2P70 A;  3R1O A;  4JD9 A;  3BFA A;  3D75 A;  3L47 A;  3BJH A;  2GTE A;  2PQL A;  3B86 A;  2KPH A;  3NHT A;  1C3Y A;  3BFB A;  3D76 A;  1OOI X;  2QEV A;  1XFR A;  3S0D A;  3S0G A;  2WCJ A;  1TUJ A;  3FE9 A;  4INW A;  5DIC A;  1P28 A;  4OZD A;  3R1V A;  1OW4 A; 
#chains in the Genus database with same CATH topology
 2LMV A;  3PM8 A;  1REC A;  1LKJ A;  1IH0 A;  2FJU B;  3CAB A;  2H61 A;  1AUI B;  3KPX A;  3A8R A;  1S6C A;  1W9Z A;  3S0E A;  3PJI A;  4C0K A;  2K2A A;  1YRT B;  2LMU A;  3AAJ A;  2K61 A;  3ICB A;  1KK7 Y;  1Y1A A;  1UHK A;  3LK1 A;  4CFR A;  3D74 A;  1AP4 A;  1A03 A;  4PAL A;  2ERB A;  1SCV A;  1ODB A;  5HKZ A;  1OMR A;  1PAL A;  1S3P A;  2M49 B;  3DXL A;  3GK4 X;  4P5O E;  3K1E A;  4Q04 A;  3JVT C;  1QVI Y;  1Y1U A;  1Z2C B;  3RZS A;  4DIR A;  3A4U B;  2K7B A;  3VRN A;  1KWO C;  3BOW A;  1M46 A;  1OE9 B;  3BUO B;  5FYX A;  3I5H B;  3DVJ A;  4XJK B;  4JQ0 D;  1BJF A;  3FE8 A;  1BU3 A;  1CNP A;  4YGE B;  1CM1 A;  1MUX A;  3S0A A;  1OOF A;  4PHM A;  2KI4 B;  1Q80 A;  1S5G Y;  1SPY A;  2BL0 C;  2F33 A;  3K21 A;  1KK8 B;  4FQT A;  4XJK A;  1UHN A;  2AUC A;  1XK4 A;  4MZL A;  1OOH A;  1ALW A;  1X02 A;  1YX8 A;  2M97 A;  2OTG B;  4U8D A;  3O4X A;  3SG7 A;  4GGF A;  1T14 A;  2LUX A;  2JT3 A;  2KNE A;  1ZOT B;  3R1P A;  1K90 D;  5EL2 A;  1NX0 A;  2WCL A;  1RTP 1;  3VGO A;  1SMG A;  1DGV A;  4FTG A;  3SIA A;  3Q8I A;  1JBA A;  1QXP A;  5HKW A;  4YI9 A;  1LXF C;  1XFY O;  2ZND A;  2BNX A;  1SNL A;  3UO9 A;  3RM1 A;  1OZS A;  2G9B A;  1C7V A;  1DJH A;  2PMY A;  1QV1 A;  1WRK A;  4YGA A;  1C7W A;  3S0F A;  4CLN A;  5J3X A;  1K96 A;  4AQJ A;  2I94 A;  2DOQ A;  1DC1 A;  1TUZ A;  2QEO A;  3FS7 A;  3LK0 A;  3DYE A;  3CYZ A;  2KBM A;  2E6W A;  3BQ3 A;  3L4L A;  3SG4 A;  2KI6 C;  2JWW A;  2EC6 C;  2Q91 A;  2FOT A;  2WCH A;  4OR9 B;  1JF0 A;  1NCY A;  2K60 A;  3HX4 A;  2MRD A;  4INX A;  1YR5 A;  5ER5 A;  2OTG C;  1JFK A;  3KO0 A;  2G2B A;  5D7F A;  3NHI A;  5AXI A;  1FI5 A;  2FCD A;  1IKU A;  2CT9 A;  4QJ5 B;  2MLE C;  1H4B A;  2EGD A;  2P70 A;  3R1O A;  1ZAC A;  3OHM B;  1SL7 A;  3BFA A;  4MVF A;  3RLZ A;  3PAL A;  4L9M A;  2JT0 A;  3JTD B;  1SR6 B;  3NXA A;  1UHI A;  1Z4H A;  3FWC A;  3D75 A;  2WOR A;  3O6B A;  1MR8 A;  2JOJ A;  2P6B B;  1BOD A;  1B8R A;  3EK8 A;  4WQ3 A;  3PN7 B;  2LVJ A;  5KU1 A;  4CID A;  5ER4 X;  4KYN A;  1CDL A;  1KQM C;  1NCZ A;  1PSR A;  4P2Y B;  1L2O C;  4YGD B;  4A4C A;  1BLQ A;  3JVT B;  1H8B A;  1KCY A;  2BE4 A;  4N1G A;  3EK7 A;  2Q4U A;  2F8P A;  3DVE A;  1YVL A;  2NLN A;  2CXJ A;  2KI6 D;  2QEV A;  1NIW A;  2MA2 A;  1SSE B;  1S1E A;  1SCM B;  4NDD A;  1B47 A;  3VRQ A;  3TUY C;  2A4J A;  1KK8 C;  3FE9 A;  3OB2 B;  1BR1 B;  2KI4 C;  1WDC B;  1K9P A;  3R1V A;  2JT8 A;  1BR4 B;  3SIB A;  1UP5 A;  1KSM A;  4IJ7 A;  3TS5 C;  1B4C A;  4DCK A;  3AAK A;  4MN0 A;  1SYM A;  4YRU A;  4MRX A;  2ISD A;  3DZT A;  4PHK A;  2M3W A;  2WCM A;  2K2F A;  1M63 B;  4CPV A;  2Y1M A;  1BF5 A;  1KFX L;  4GGN A;  2LAN A;  3BXK A;  3SG2 A;  1OZO A;  4QJ3 B;  3WHT B;  1TOP A;  2BCA A;  1GJY A;  2F3Z A;  1D1O A;  5DKQ A;  2BE6 A;  2SCP A;  1DJZ A;  1MXE A;  1G4Y R;  1VRK A;  1CMG A;  2F2O A;  4NQG A;  4I5N B;  1B7T Y;  2Y4Q A;  3N7H A;  3S0B A;  4ORC B;  3D78 A;  1J1D A;  2KFH A;  1XA5 A;  4DUQ A;  1F4O A;  5CPV A;  1YRU B;  1N2D A;  2I2R E;  4MLW A;  3BUX B;  5GQQ C;  3O2P A;  4MEW A;  5G08 A;  2LP2 A;  1RWY A;  2BCX A;  3QRX A;  2LE9 B;  3TS5 B;  1CM4 A;  5IBW A;  4M2O A;  2QDI A;  1QVI Z;  2F2P A;  3EKJ A;  2WCK A;  2PAS A;  3FWB A;  1JC2 A;  1K9K A;  3WHU B;  1NSH A;  5HLO A;  3D0Y B;  1OMD A;  3CZ1 A;  1G33 A;  4OKH A;  2KBI A;  1FW4 A;  1K95 A;  3BUW B;  1HQV A;  1GGW A;  3EVU A;  1DMO A;  1J7P A;  2NCO A;  2LVI A;  3CWG A;  1DT7 B;  3D0Y A;  1TWO A;  4JWQ A;  2L51 A;  1OMV A;  3DF0 B;  1YUS A;  1B1G A;  1LA3 A;  1N0Y A;  2RGI A;  5HKY A;  1K2H A;  2M9G A;  3EVR A;  4PE1 A;  2COL B;  1YUT A;  4GFT A;  3DF0 A;  3NGV A;  3GOF A;  1F4Q A;  3CS1 A;  3TDI A;  2HQ8 A;  3OP0 A;  2Y1N A;  3SS3 A;  1YUR A;  3B6X A;  3OX6 A;  1CLB A;  3BUM B;  4MBE A;  1RRO A;  1XFW O;  3NSO A;  2H61 C;  1MQ1 A;  2BBM A;  2L5Y A;  2OPO A;  4NDB A;  1Y1X A;  2PYQ A;  1E8A A;  1IJ5 A;  1QWV A;  1NP8 A;  3B7A A;  2ZRT A;  1JUO A;  2ZKM X;  1DVI A;  1DJX A;  1OSA A;  2FCE A;  3NSL A;  4OCI A;  2KGR A;  3I5G B;  1RFJ A;  2PSR A;  1ZMZ A;  1R6P A;  3CR2 A;  1S6J A;  1F55 A;  1LIN A;  5KTY A;  1JF2 A;  3SG6 A;  1QIW A;  1TNX A;  3PM2 A;  4PDZ A;  3BJH A;  2GTE A;  2LUC A;  2K0J A;  2I7A A;  2ZN8 A;  1FPW A;  3I5H C;  1TTX A;  1WRZ A;  2LAP A;  3NHT A;  1TCF A;  2M8U A;  3CR5 X;  2O60 A;  3LLE A;  1OOI X;  1SRA A;  1XYD A;  1NPQ A;  2PVB A;  3S0D A;  4MZJ A;  2KQY A;  1NX1 A;  3NSK A;  1TNQ A;  4HRH A;  1FI6 A;  2M7N A;  1CLL A;  5I2Q A;  3WNX B;  4M2Q A;  1M31 A;  2LP3 A;  3AKA A;  2GGZ A;  3CR4 X;  4YGC B;  1B8C A;  1DTL A;  1KWO B;  1DQE A;  1MHO A;  4N5X A;  5KSZ A;  1AVS A;  3TDU A;  1PK0 D;  1J1E A;  1CFP A;  3MSE B;  1HT9 A;  1SBJ A;  1SCM C;  2BEC A;  4HRG A;  2L2C A;  2L5X B;  1DEL A;  3B87 A;  1WDC C;  1WLM A;  1J7Q A;  1YTZ C;  1TNP A;  2MAZ A;  2LVV A;  3KF9 A;  1IQ3 A;  1NX3 A;  3EKH A;  2JXC A;  4ZCV A;  4F7F A;  1DJG A;  1YVH A;  3EK4 A;  3CZ2 A;  4UPG A;  1A2X A;  3LL8 B;  2KQ6 A;  2KGB C;  1BOC A;  2BAP A;  4ETO A;  1ALV A;  3WXA A;  3OGN A;  3SJS A;  5DKN A;  1MXL C;  3H4S E;  1IGV A;  2LVK A;  3JTD C;  3TDZ A;  1PRW A;  1LA0 A;  2AAO A;  5I8N A;  5K89 A;  3BOW B;  4MRY A;  1YX7 A;  3GK2 A;  4PHJ A;  1TRF A;  2MBX A;  3O78 A;  3VRP A;  1CFC A;  4PE7 A;  2H2K A;  1WRL A;  2WOS A;  1BT6 A;  1BMO A;  5JOL A;  2KAX A;  4USL A;  3I5G C;  2KSP A;  1NCX A;  1XVJ A;  2LMT A;  1NUB A;  2WC5 A;  3VRR A;  1ORG A;  3D77 A;  4GPL B;  1Y0V H;  2M29 A;  1F70 A;  1K8U A;  2JC2 A;  1KQM B;  4ORA B;  1C07 A;  1OOG A;  1EG3 A;  3AKB A;  2LLU A;  3I5I B;  4PE4 A;  1GQM A;  1OOJ A;  2F3Y A;  1DGU A;  5AFP A;  2CTN A;  5I2L A;  1EJ3 A;  2CBL A;  2L4I A;  1CDN A;  2I18 A;  1NWD A;  2VRG A;  4BY4 A;  5DKR A;  5I94 A;  3I5F C;  1JSA A;  4C0J A;  1KFU S;  2NZ0 A;  1GM0 A;  1OQP A;  1LVC D;  1W7I B;  2B1U A;  2WCE A;  3E3R A;  1EL4 A;  2BKI B;  3KEV A;  2ZNE A;  5HL1 A;  1FBV A;  3BUN B;  2JU0 A;  4ZCU A;  1QX7 A;  5CSJ A;  3BYA A;  1QLS A;  2QAC A;  1S26 D;  1QX5 B;  2KYF A;  2E30 A;  1XFU O;  2ZRS A;  3OB1 B;  2Y5I A;  4WRI A;  1QTX A;  1TN4 A;  3D73 A;  2L98 A;  4GUK A;  2LNK A;  3OBV A;  1J7O A;  1F54 A;  3SG5 A;  2GV5 A;  2BBN A;  4JD9 A;  1KK7 Z;  2MLF C;  5HYD A;  1KQV A;  1A4P A;  1V1G A;  1S6I A;  3CTN A;  2WCB A;  1K93 D;  1CFD A;  2ZFD A;  1AJ4 A;  1CMF A;  1DJW A;  4HRE E;  1IIO A;  1IRJ A;  3I5I C;  5B8I B;  2CNP A;  4MZK A;  1B7T Z;  2TN4 A;  2PQL A;  3ZWH A;  1B9A A;  4OVN F;  1XFX O;  2KPH A;  4QJ4 B;  2KAV A;  1AK8 A;  2LLS A;  1WLZ A;  5CSI A;  1R2U A;  2V53 A;  1SL8 A;  2KFG A;  1PSB A;  1A75 B;  3BFB A;  1SW8 A;  1W7J B;  2KHN A;  3D76 A;  1C3Y A;  1JFJ A;  2WCF A;  1XFR A;  1J55 A;  1EH2 A;  2WC8 A;  1TIZ A;  2LCP A;  3O4Y A;  4JKT A;  1DEK A;  3S0G A;  2JTT A;  4INW A;  1CDP A;  2KYC A;  1P28 A;  4OZD A;  1ZUZ A;  1ZFS A;  2K7D A;  5TNC A;  3IVT A;  2WND A;  1CDM A;  2IS9 A;  4M2P A;  1XFZ O;  3F45 A;  2JTZ A;  3KHE A;  4DRW A;  2GGM A;  1PVB A;  2BL0 B;  3IQQ A;  3PSR A;  1QLK A;  3R72 A;  1DF0 B;  2BCB A;  3TUY B;  1RK9 A;  1UUS A;  1K94 A;  2JNF A;  2LHI A;  3HCM A;  5HLV A;  3V2L A;  1DJI A;  4AOM A;  1FF1 A;  2PRU A;  2JNX A;  2KLE A;  4I5J A;  5PAL A;  1JWD A;  5AER A;  3DD4 A;  3LCP C;  2HET A;  3L4A A;  3DY9 A;  1QS7 A;  5FI7 A;  2JPO A;  4F0Z B;  1BG1 A;  1L7Z A;  2BKH B;  4GAO A;  3IQO A;  1C3Z A;  2JPT A;  1IWQ A;  4I5L B;  3SS5 A;  2JUL A;  4A4B A;  2CCM A;  2H8V A;  3FE6 A;  1SR6 C;  2YGU A;  2MJW B;  1QX2 A;  1PUL A;  2P71 A;  3CGA A;  1L2O B;  3CZT X;  1S36 A;  5D69 A;  3CLN A;  5AEQ A;  4D1E A;  1MF8 B;  4GBA A;  1NX2 A;  2JQ6 A;  1Y6W A;  4MSP A;  3EVV A;  4TNC A;  2L50 A;  5JJG A;  2M0R A;  1A75 A;  1N65 A;  4XYN A;  1QV0 A;  2HQW A;  3D10 A;  5FI6 A;  1CFF A;  1XK4 C;  1IG5 A;  1F71 A;  1F8H A;  4PE0 A;  2LLT A;  3TZ1 A;  2L2E A;  2K7C A;  2EC6 B;  1CKK A;  5AAN A;  2LHL A;  3ZNI A;  1UWO A;  4YGB B;  1QAS A;  2D8N A;  2QEH A;  3VB1 A;  3QME A;  4E68 A;  2NCP A;  1AJ5 A;  1IJ6 A;  4YI8 A;  2LM5 A;  1NYA A;  3I5F B;  3CZ0 A;  3BFH A;  1SKT A;  2OS8 B;  4AQI A;  3UNW A;  3OX5 A;  1SK6 D;  1EG4 A;  1LS8 A;  1U5I B;  1GGZ A;  2KOT A;  3PLF B;  2FJY A;  4OV2 A;  4PCW A;  1K9U A;  2AMI A;  4N1F A;  3VRO A;  1DF0 A;  1S5G Z;  1DJY A;  1QAT A;  1SY9 A;  1QIV A;  1U5I A;  4ORB B;  1B8L A;  1XFV O;  3PN7 C;  4GGF C;  2KAY A;  2SAS A;  3PFV A;  2QEB A;  4PT1 A;  1G8I A;  4WQ2 A;  3CDN A;  2LC5 A;  1TNW A;  2O5G A;  2WC6 A;  4HSZ A;  3B88 A;  3GK1 A;  4NDC A;  3SG3 A;  3DVM A;  1M45 A;  2HPS A;  1CTR A;  3C1V A;  2L0P A;  2ZN9 A;  3M0W A;  2K7O A;  2PAL A;  4DS7 A;  4R1E A;  3DVK A;  1SL9 A;  1RJV A;  1XO5 A;  1KFU L;  1A29 A;  1WY9 A;  2QPT A;  3EG5 B;  3IF7 A;  4GNK B;  1UHJ A;  1QJT A;  5D3O A;  1KSO A;  2R2I A;  5CSN A;  2MHH A;  5BPJ A;  1KFX S;  1CLM A;  3L47 A;  2M7L A;  5F6T A;  2LV7 A;  2KLD A;  2OS8 C;  5I2O A;  1UHH A;  3FIA A;  1YUU A;  3B86 A;  4I5K A;  5CSF A;  2KDH A;  3NSI A;  4YBH B;  2HF5 A;  1CB1 A;  2L4H A;  1V1F A;  2JXL A;  3SS4 A;  2EHB A;  3PAT A;  2M1U A;  2KFF A;  1PVA A;  2M1K B;  1AHR A;  4JPZ B;  1J7R A;  2K8M B;  1IQ5 A;  1TCO B;  2JRF A;  1M39 A;  1TUJ A;  2WCJ A;  4FQO A;  5DIC A;  5FI2 A;  1EXR A;  2NXQ A;  4PHN A;  4CFQ A;  1MWN A;  4IL1 A;  2JZI A;  4BY5 A;  4ICB A;  4C0L A;  1OW4 A;  1UUR A; 
#chains in the Genus database with same CATH homology
 3CAB A;  1DQE A;  3S0E A;  3PJI A;  3R72 A;  3DZT A;  2L2C A;  2WCM A;  3D74 A;  2ERB A;  3B87 A;  3V2L A;  3DXL A;  3K1E A;  4F7F A;  3L4A A;  3DY9 A;  3CZ2 A;  3RZS A;  2JPO A;  1C3Z A;  3N7H A;  3OGN A;  3S0B A;  3D78 A;  2H8V A;  3FE6 A;  3FE8 A;  2P71 A;  3S0A A;  1OOF A;  4FQT A;  1OOH A;  2QDI A;  1T14 A;  2WC5 A;  2WCK A;  1ORG A;  3R1P A;  3D77 A;  5EL2 A;  2QEH A;  3VB1 A;  3QME A;  2WCL A;  3CZ1 A;  3Q8I A;  1OOG A;  3CZ0 A;  3BFH A;  1LS8 A;  2FJY A;  1TWO A;  3S0F A;  4PT1 A;  2QEB A;  2QEO A;  3CDN A;  3DYE A;  3NGV A;  2WC6 A;  1GM0 A;  3CYZ A;  3B88 A;  3B6X A;  3L4L A;  2WCH A;  4INX A;  1QWV A;  3NHI A;  3B7A A;  3D73 A;  2P70 A;  3R1O A;  4JD9 A;  3BFA A;  3D75 A;  3L47 A;  3BJH A;  2GTE A;  2PQL A;  3B86 A;  2KPH A;  3NHT A;  1C3Y A;  3BFB A;  3D76 A;  1OOI X;  2QEV A;  1XFR A;  3S0D A;  3S0G A;  2WCJ A;  1TUJ A;  3FE9 A;  4INW A;  5DIC A;  1P28 A;  4OZD A;  3R1V A;  1OW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...