2WCKA

Structure of bmori gobp2 (general odorant binding protein 2) without ligand
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
141
structure length
141
Chain Sequence
TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL ODORANT-BINDING PROTEIN 1
publication title Characterisation of Bombyx Mori Odorant-Binding Proteins Reveals that a General Odorant-Binding Protein Discriminates between Sex Pheromone Components.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 55
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 2wckA00
4F7FA 1DQEA 3BFBA 1C3YA 4OZDA 3D75A 1OOGA 3QMEA 4INXA 4FQTA 3DZTA 3NHTA 2QEBA 3S0AA 3K1EA 3B86A 3B6XA 3BJHA 5DICA 3CABA 1OOIX 3NGVA 1T14A 2WCKA 2QDIA 3R1PA 3CDNA 4INWA 3B7AA 3N7HA 1XFRA 1OOFA 3B88A 3FE9A 3CZ1A 3B87A 3R72A 1QWVA 3DYEA 3OGNA 3L47A 1TUJA 3DXLA 1OW4A 2PQLA 2WCMA 3CZ0A 3L4AA 2FJYA 3D76A 2WCHA 1C3ZA 3FE6A 2P71A 3BFHA 3S0EA 2WC5A 2JPOA 2WCJA 3R1OA 4JD9A 2QEOA 2QEVA 3S0FA 2P70A 3PJIA 1P28A 3D78A 5EL2A 3D74A 3CZ2A 2H8VA 2QEHA 1GM0A 3FE8A 2WC6A 3S0DA 3DY9A 2KPHA 2GTEA 1OOHA 3D73A 3VB1A 2ERBA 3RZSA 3S0BA 3R1VA 3CYZA 3L4LA 3D77A 3V2LA 1ORGA 3S0GA 3Q8IA 4PT1A 2WCLA 2L2CA 3BFAA 3NHIA 1TWOA 1LS8A
chains in the Genus database with same CATH superfamily
1G4YR 1BMOA 1R2UA 4YBHB 1KK7Z 4F7FA 2F8PA 4AOMA 2LVIA 4AQJA 2ZRTA 4CFQA 1B7TZ 2FOTA 1MXEA 1S6IA 1SK6D 2KI4B 2LCPA 3FWBA 1Z4HA 1CFFA 1AUIB 1NCYA 1DJZA 4ORCB 1BOCA 1OSAA 1OMRA 1XVJA 2COLB 5FI6A 1YUSA 1K96A 2BKIB 3PALA 3GK4X 1B8LA 3B6XA 3BJHA 1IIOA 2OTGB 2BCBA 4I5KA 3CABA 2KLDA 2LUXA 1M63B 5CPVA 2JXCA 1KSMA 4UPGA 3KF9A 1Y6WA 3EK7A 3CZTX 1YR5A 1RK9A 2LM5A 1PULA 1R6PA 2JTTA 3PM8A 1QIWA 1QX2A 2MHHA 1MWNA 4GFTA 1CNPA 2WCKA 3CLNA 1PRWA 1RECA 3B7AA 2NXQA 4N1FA 2EC6B 3JVTB 1JC2A 1XFRA 1U5IB 1MUXA 2KAXA 2WORA 1LVCD 1CFPA 3JTDB 1BU3A 1QV1A 2Y1NA 1KSOA 3BYAA 3PFVA 1IQ3A 3RLZA 1ALWA 3PM2A 1NSHA 2BNXA 4P2YB 1NWDA 2PSRA 1GQMA 3OB1B 2JULA 1JUOA 2NCOA 4QJ3B 2HPSA 4OR9B 2JC2A 1F70A 3OGNA 1TUJA 5FYXA 1S3PA 2PQLA 4OCIA 2PRUA 3OBVA 5I2QA 1YX8A 2BL0B 5FI2A 1NIWA 2CT9A 2LMTA 1DVIA 2WCHA 3MSEB 1C3ZA 2SCPA 3EVVA 3LK0A 5AFPA 2L0PA 3S0EA 1E8AA 1TOPA 2AAOA 4GPLB 3VROA 3VRRA 1B9AA 3RM1A 2K7OA 2QACA 3O6BA 2KSPA 3HX4A 3D0YA 2FCDA 1QX5B 1VRKA 2KHNA 3TDZA 2JPTA 2PASA 1FBVA 5DKRA 2EHBA 2F3YA 5D69A 4YGCB 2WCFA 1F55A 1CDMA 5D7FA 3S0FA 2P70A 1J1EA 1AHRA 1IJ5A 1WDCC 5EL2A 3VRNA 3BOWB 2BECA 3CZ2A 2LVKA 1WRKA 3LL8B 1D1OA 2KAVA 1TNPA 1EXRA 1WLMA 1ALVA 1QIVA 2Q4UA 2QEHA 1CLBA 1DF0B 3FE8A 4P5OE 1C07A 1J7OA 4A4CA 3AKBA 4GGFC 3DY9A 1OMDA 2QPTA 1XK4C 1AJ4A 2HQ8A 4R1EA 1V1GA 3AAKA 4C0KA 2BE6A 4YI9A 2KI4C 1CFDA 1K94A 3D73A 1KFXL 2KFGA 1K9KA 2OPOA 1S26D 4GUKA 4MRXA 3I5FB 1TCFA 1DJHA 1IG5A 1QJTA 3S0BA 3CYZA 1SBJA 1UHHA 4ETOA 1AK8A 1S36A 2JOJA 3L4LA 3O2PA 3TDIA 3D77A 4PHKA 5GQQC 2M49B 3S0GA 1H4BA 2OTGC 4ORBB 1FI6A 1UWOA 2A4JA 2E6WA 3A8RA 5PALA 1FPWA 3BFBA 5CSJA 5I2LA 1K9PA 1YUUA 3BQ3A 1SKTA 1LXFC 2K2AA 4CLNA 2JU0A 1DGVA 3I5HB 5AXIA 5CSIA 3BUWB 3TZ1A 1ZOTB 1K93D 4MRYA 3BUXB 2V53A 2EC6C 3JVTC 3NHTA 4IJ7A 3TUYB 2ZNDA 3B86A 3JTDC 1KWOB 5DICA 5DKQA 1J7QA 1M31A 1C7VA 1W9ZA 1GGZA 3CR4X 1DTLA 1UHKA 1NCXA 4PALA 4GAOA 5J3XA 3WXAA 1NPQA 4F0ZB 1T14A 1DT7B 4I5NB 1BR4B 5AEQA 1CDPA 1W7IB 3FS7A 5I8NA 1FF1A 1SY9A 4INWA 2M7LA 3SIBA 4A4BA 1SL8A 2BKHB 1KQVA 1TIZA 2BL0C 2JTZA 2NCPA 2Y5IA 3KHEA 5CSNA 3SG6A 1RTP1 1SNLA 3CZ1A 1K2HA 3IF7A 3IQQA 2PMYA 2ZNEA 3B87A 3R72A 5HLVA 2JT0A 2MLFC 2I7AA 2LVJA 3DVEA 1YX7A 1YTZC 2K7CA 1CKKA 1NX2A 1Q80A 2DOQA 2H61C 3CTNA 1G8IA 3L47A 3WHTB 2KI6D 3DXLA 3PLFB 1AJ5A 2JXLA 2PALA 1IRJA 1Y1UA 1XFVO 2AUCA 2MAZA 1DJXA 5I94A 2I2RE 1BJFA 2G9BA 2WCMA 1OQPA 3L4AA 2FJYA 3SG4A 1S6JA 3VGOA 4TNCA 2ZRSA 3DVMA 1G33A 1QASA 1AP4A 1EG3A 2NZ0A 2WCBA 3DF0A 4MZKA 1SCMB 1OZOA 3BUNB 1J1DA 4PE7A 1IKUA 1UHJA 3KO0A 2HQWA 1SL7A 1L2OB 4GGFA 5ER5A 2GGZA 5IBWA 4XJKA 4NDCA 1MHOA 5KTYA 1DMOA 2GGMA 5HL1A 2RGIA 4AQIA 2QEVA 3OX6A 1TUZA 1F4QA 2K8MB 2KQ6A 3SG3A 3EKHA 1QV0A 1IQ5A 1CFCA 5BPJA 3I5FC 1TTXA 1P28A 1EG4A 1BT6A 2CTNA 3D78A 4PHJA 3GK2A 2OS8B 5JJGA 3D0YB 4MLWA 1KK8B 1F71A 1IJ6A 4GGNA 1MR8A 1GM0A 2WC6A 2R2IA 1RFJA 3PN7B 4C0LA 4CFRA 2K0JA 5D3OA 4NQGA 4PCWA 2TN4A 1KFUL 1SW8A 3I5HC 2JZIA 1IWQA 4ZCUA 2ZN8A 1KQMC 1SRAA 4HREE 1JFKA 1ZUZA 4MVFA 1JBAA 1MF8B 4DRWA 3HCMA 4MN0A 4NDBA 3TUYC 3I5GB 2JNFA 3KEVA 1KWOC 2LLSA 3QRXA 3V2LA 2LE9B 3SG2A 2AMIA 2CXJA 1Y1AA 1FW4A 3CZ0A 1CMFA 1TWOA 1Z2CB 2BE4A 1LS8A 2H2KA 4M2PA 1DQEA 4CIDA 1C3YA 1TNWA 1QTXA 4N5XA 1JF0A 1MXLC 4PHNA 3NSOA 2KDHA 4M2OA 2LP3A 2WNDA 4ICBA 4PE4A 2L98A 3QMEA 1C7WA 4ZCVA 1IH0A 4INXA 2M7NA 4FQTA 1ZFSA 1JF2A 3VRQA 1S5GY 3K1EA 1QXPA 1PVBA 3DVJA 3EVRA 3EKJA 4L9MA 2KNEA 1ZACA 4QJ4B 3WNXB 1OOIX 4BY5A 1KFUS 2KBIA 2KYFA 3NGVA 3SS5A 5HYDA 3SG7A 2LP2A 1DEKA 1UHNA 4MZLA 4PHMA 3OX5A 1XA5A 4GNKB 1N0YA 2F33A 2LMUA 4OV2A 4Q04A 4BY4A 1CLLA 2M97A 2MLEC 3R1PA 1CMGA 1SCVA 3IQOA 1DGUA 3ZWHA 3N7HA 2YGUA 5CSFA 3UNWA 1YVHA 1OOFA 1V1FA 1XFWO 3B88A 3FE9A 3PSRA 1LINA 4JQ0D 5KU1A 2WC8A 3BOWA 1QLSA 2NLNA 2KI6C 2Y1MA 2VRGA 1WRLA 1NX3A 2B1UA 2LNKA 3NXAA 3VRPA 4JWQA 1DJWA 1J7RA 2K7BA 3AKAA 2MA2A 1SCMC 3DYEA 3O78A 5HKZA 2KOTA 1DF0A 2M29A 1RJVA 3LLEA 1MQ1A 1JWDA 2L4HA 1LA3A 2LLTA 1YURA 3E3RA 3OB2B 5G08A 4E68A 1A4PA 3GK1A 1IGVA 1OW4A 2EGDA 1TNXA 2KFFA 2BCAA 4OVNF 1PALA 2MRDA 2F3ZA 3D76A 2L5XB 3TS5B 3PATA 5TNCA 2HF5A 4I5JA 5AANA 1BF5A 3BUMB 2ZKMX 1QS7A 3BFHA 2K60A 3FE6A 4FQOA 1BR1B 2WC5A 1FI5A 2LANA 2OS8C 4MEWA 3F45A 2JPOA 2LC5A 4IL1A 5ER4X 1KK8C 1QX7A 2F2PA 1CDNA 2I18A 2JRFA 2K2FA 2L51A 1CM1A 1DJYA 2WCJA 4YGBB 1AVSA 3H4SE 1XYDA 3ICBA 3PN7C 1NCZA 1H8BA 2KGRA 2KLEA 3OP0A 3R1OA 2LAPA 2LVVA 4HRGA 1RROA 3EK8A 3DVKA 1PVAA 1QATA 3EG5B 2M1UA 3DF0B 4USLA 2CNPA 2KYCA 1CM4A 3CR2A 3D74A 3SJSA 1TN4A 2H8VA 4XJKB 1CLMA 3I5GC 1WLZA 4MSPA 1K8UA 4YGDB 2BAPA 1A75A 2BBNA 1JSAA 5I2OA 3A4UB 1KCYA 2WOSA 2K61A 1PK0D 2LMVA 3IVTA 1OZSA 1KK7Y 3LCPC 1GJYA 1OOHA 3WHUB 1B7TY 1B8RA 1QVIZ 1XK4A 2O5GA 1SR6B 1EJ3A 2BBMA 2ERBA 3RZSA 3O4XA 3FWCA 1PSBA 4JKTA 1DELA 1XFUO 3TDUA 3R1VA 1M45A 1S1EA 1B47A 3K21A 4JPZB 2JWWA 2E30A 2M0RA 1ORGA 5HKWA 5DKNA 3Q8IA 1QVIY 1K90D 1DJGA 1SSEB 2WCLA 4YI8A 1WRZA 1F4OA 3NHIA 2KBMA 4HRHA 1YRTB 2IS9A 4OZDA 4QJ5B 3O4YA 1YUTA 2F2OA 3D75A 4MZJA 4YGEB 1B1GA 3I5IB 4DIRA 2L2EA 1A03A 5K89A 1XO5A 3DZTA 4KYNA 3SS3A 3ZNIA 1CDLA 1N65A 2JNXA 2QEBA 3S0AA 1F8HA 2L50A 2JT8A 1PSRA 3LK1A 3NSIA 1XFZO 1NYAA 1U5IA 3D10A 1K95A 4MBEA 1LA0A 1OOJA 1XFYO 1SYMA 1DJIA 5KSZA 4YGAA 1ZMZA 3NSLA 5HKYA 3M0WA 3CGAA 2QDIA 1OE9B 3DD4A 3CDNA 1SL9A 1UURA 4OKHA 3SG5A 1X02A 2M9GA 1RWYA 1S5GZ 5FI7A 2KGBC 2M1KB 3FIAA 2CCMA 2MBXA 3TS5C 5AERA 5B8IB 1WY9A 1XFXO 2MJWB 4YRUA 4XYNA 1TNQA 1NP8A 1QWVA 2L5YA 2LUCA 4PE1A 4HSZA 5HLOA 3SIAA 1UHIA 1JFJA 3C1VA 1SMGA 1M46A 1F54A 2LHLA 2Q91A 1J7PA 3CR5X 3EK4A 1J55A 2ZN9A 3KPXA 2H61A 4PDZA 2SASA 2LV7A 3EVUA 1NX1A 2GV5A 1EL4A 1CB1A 1LKJA 1A29A 1YRUB 1HQVA 3UO9A 2P71A 5F6TA 4M2QA 1B8CA 1S6CA 3AAJA 3SS4A 1EH2A 1N2DA 2L4IA 4ORAB 1B4CA 1BODA 2G2BA 3GOFA 5JOLA 1QLKA 4JD9A 1CTRA 1Y1XA 2FJUB 2QEOA 4N1GA 4GBAA 1OMVA 4DCKA 1L2OC 2ISDA 4WQ2A 1W7JB 2PYQA 1L7ZA 3NSKA 1SR6C 3PJIA 4CPVA 1Y0VH 2JT3A 1DC1A 3CS1A 2M3WA 4DUQA 3BUOB 1UP5A 3BXKA 2JQ6A 1GGWA 1KQMB 3S0DA 2FCEA 2WCEA 2KPHA 3OHMB 4FTGA 2GTEA 2KFHA 2Y4QA 1A2XA 1SPYA 4WRIA 1TRFA 2I94A 1NUBA 2LHIA 1K9UA 3CWGA 1HT9A 3I5IC 3VB1A 2PVBA 4I5LB 4PE0A 2M8UA 4U8DA 1WDCB 4C0JA 2KQYA 2ZFDA 4DS7A 2P6BB 1BLQA 4NDDA 1ODBA 1M39A 1YVLA 2LLUA 1A75B 1KFXS 2KAYA 4D1EA 1BG1A 2CBLA 1UUSA 4PT1A 2BCXA 2K7DA 1TCOB 2O60A 1OOGA 2L2CA 3BFAA 1NX0A 2D8NA 2HETA 4WQ3A
chains in the Genus database with same CATH topology
4F7FA 1DQEA 3BFBA 1C3YA 4OZDA 3D75A 1OOGA 3QMEA 4INXA 4FQTA 3DZTA 3NHTA 2QEBA 3S0AA 3K1EA 3B86A 3B6XA 3BJHA 5DICA 3CABA 1OOIX 3NGVA 1T14A 2WCKA 2QDIA 3R1PA 3CDNA 4INWA 3B7AA 3N7HA 1XFRA 1OOFA 3B88A 3FE9A 3CZ1A 3B87A 3R72A 1QWVA 3DYEA 3OGNA 3L47A 1TUJA 3DXLA 1OW4A 2PQLA 2WCMA 3CZ0A 3L4AA 2FJYA 3D76A 2WCHA 1C3ZA 3FE6A 2P71A 3BFHA 3S0EA 2WC5A 2JPOA 2WCJA 3R1OA 4JD9A 2QEOA 2QEVA 3S0FA 2P70A 3PJIA 1P28A 3D78A 5EL2A 3D74A 3CZ2A 2H8VA 2QEHA 1GM0A 3FE8A 2WC6A 3S0DA 3DY9A 2KPHA 2GTEA 1OOHA 3D73A 3VB1A 2ERBA 3RZSA 3S0BA 3R1VA 3CYZA 3L4LA 3D77A 3V2LA 1ORGA 3S0GA 3Q8IA 4PT1A 2WCLA 2L2CA 3BFAA 3NHIA 1TWOA 1LS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7F A;  1DQE A;  3BFB A;  1C3Y A;  4OZD A;  3D75 A;  1OOG A;  3QME A;  4INX A;  4FQT A;  3DZT A;  3NHT A;  2QEB A;  3S0A A;  3K1E A;  3B86 A;  3B6X A;  3BJH A;  5DIC A;  3CAB A;  1OOI X;  3NGV A;  1T14 A;  2WCK A;  2QDI A;  3R1P A;  3CDN A;  4INW A;  3B7A A;  3N7H A;  1XFR A;  1OOF A;  3B88 A;  3FE9 A;  3CZ1 A;  3B87 A;  3R72 A;  1QWV A;  3DYE A;  3OGN A;  3L47 A;  1TUJ A;  3DXL A;  1OW4 A;  2PQL A;  2WCM A;  3CZ0 A;  3L4A A;  2FJY A;  3D76 A;  2WCH A;  1C3Z A;  3FE6 A;  2P71 A;  3BFH A;  3S0E A;  2WC5 A;  2JPO A;  2WCJ A;  3R1O A;  4JD9 A;  2QEO A;  2QEV A;  3S0F A;  2P70 A;  3PJI A;  1P28 A;  3D78 A;  5EL2 A;  3D74 A;  3CZ2 A;  2H8V A;  2QEH A;  1GM0 A;  3FE8 A;  2WC6 A;  3S0D A;  3DY9 A;  2KPH A;  2GTE A;  1OOH A;  3D73 A;  3VB1 A;  2ERB A;  3RZS A;  3S0B A;  3R1V A;  3CYZ A;  3L4L A;  3D77 A;  3V2L A;  1ORG A;  3S0G A;  3Q8I A;  4PT1 A;  2WCL A;  2L2C A;  3BFA A;  3NHI A;  1TWO A;  1LS8 A; 
#chains in the Genus database with same CATH topology
 1G4Y R;  1BMO A;  1R2U A;  4YBH B;  1KK7 Z;  4F7F A;  2F8P A;  4AOM A;  2LVI A;  4AQJ A;  2ZRT A;  4CFQ A;  1B7T Z;  2FOT A;  1MXE A;  1S6I A;  1SK6 D;  2KI4 B;  2LCP A;  3FWB A;  1Z4H A;  1CFF A;  1AUI B;  1NCY A;  1DJZ A;  4ORC B;  1BOC A;  1OSA A;  1OMR A;  1XVJ A;  2COL B;  5FI6 A;  1YUS A;  1K96 A;  2BKI B;  3PAL A;  3GK4 X;  1B8L A;  3B6X A;  3BJH A;  1IIO A;  2OTG B;  2BCB A;  4I5K A;  3CAB A;  2KLD A;  2LUX A;  1M63 B;  5CPV A;  2JXC A;  1KSM A;  4UPG A;  3KF9 A;  1Y6W A;  3EK7 A;  3CZT X;  1YR5 A;  1RK9 A;  2LM5 A;  1PUL A;  1R6P A;  2JTT A;  3PM8 A;  1QIW A;  1QX2 A;  2MHH A;  1MWN A;  4GFT A;  1CNP A;  2WCK A;  3CLN A;  1PRW A;  1REC A;  3B7A A;  2NXQ A;  4N1F A;  2EC6 B;  3JVT B;  1JC2 A;  1XFR A;  1U5I B;  1MUX A;  2KAX A;  2WOR A;  1LVC D;  1CFP A;  3JTD B;  1BU3 A;  1QV1 A;  2Y1N A;  1KSO A;  3BYA A;  3PFV A;  1IQ3 A;  3RLZ A;  1ALW A;  3PM2 A;  1NSH A;  2BNX A;  4P2Y B;  1NWD A;  2PSR A;  1GQM A;  3OB1 B;  2JUL A;  1JUO A;  2NCO A;  4QJ3 B;  2HPS A;  4OR9 B;  2JC2 A;  1F70 A;  3OGN A;  1TUJ A;  5FYX A;  1S3P A;  2PQL A;  4OCI A;  2PRU A;  3OBV A;  5I2Q A;  1YX8 A;  2BL0 B;  5FI2 A;  1NIW A;  2CT9 A;  2LMT A;  1DVI A;  2WCH A;  3MSE B;  1C3Z A;  2SCP A;  3EVV A;  3LK0 A;  5AFP A;  2L0P A;  3S0E A;  1E8A A;  1TOP A;  2AAO A;  4GPL B;  3VRO A;  3VRR A;  1B9A A;  3RM1 A;  2K7O A;  2QAC A;  3O6B A;  2KSP A;  3HX4 A;  3D0Y A;  2FCD A;  1QX5 B;  1VRK A;  2KHN A;  3TDZ A;  2JPT A;  2PAS A;  1FBV A;  5DKR A;  2EHB A;  2F3Y A;  5D69 A;  4YGC B;  2WCF A;  1F55 A;  1CDM A;  5D7F A;  3S0F A;  2P70 A;  1J1E A;  1AHR A;  1IJ5 A;  1WDC C;  5EL2 A;  3VRN A;  3BOW B;  2BEC A;  3CZ2 A;  2LVK A;  1WRK A;  3LL8 B;  1D1O A;  2KAV A;  1TNP A;  1EXR A;  1WLM A;  1ALV A;  1QIV A;  2Q4U A;  2QEH A;  1CLB A;  1DF0 B;  3FE8 A;  4P5O E;  1C07 A;  1J7O A;  4A4C A;  3AKB A;  4GGF C;  3DY9 A;  1OMD A;  2QPT A;  1XK4 C;  1AJ4 A;  2HQ8 A;  4R1E A;  1V1G A;  3AAK A;  4C0K A;  2BE6 A;  4YI9 A;  2KI4 C;  1CFD A;  1K94 A;  3D73 A;  1KFX L;  2KFG A;  1K9K A;  2OPO A;  1S26 D;  4GUK A;  4MRX A;  3I5F B;  1TCF A;  1DJH A;  1IG5 A;  1QJT A;  3S0B A;  3CYZ A;  1SBJ A;  1UHH A;  4ETO A;  1AK8 A;  1S36 A;  2JOJ A;  3L4L A;  3O2P A;  3TDI A;  3D77 A;  4PHK A;  5GQQ C;  2M49 B;  3S0G A;  1H4B A;  2OTG C;  4ORB B;  1FI6 A;  1UWO A;  2A4J A;  2E6W A;  3A8R A;  5PAL A;  1FPW A;  3BFB A;  5CSJ A;  5I2L A;  1K9P A;  1YUU A;  3BQ3 A;  1SKT A;  1LXF C;  2K2A A;  4CLN A;  2JU0 A;  1DGV A;  3I5H B;  5AXI A;  5CSI A;  3BUW B;  3TZ1 A;  1ZOT B;  1K93 D;  4MRY A;  3BUX B;  2V53 A;  2EC6 C;  3JVT C;  3NHT A;  4IJ7 A;  3TUY B;  2ZND A;  3B86 A;  3JTD C;  1KWO B;  5DIC A;  5DKQ A;  1J7Q A;  1M31 A;  1C7V A;  1W9Z A;  1GGZ A;  3CR4 X;  1DTL A;  1UHK A;  1NCX A;  4PAL A;  4GAO A;  5J3X A;  3WXA A;  1NPQ A;  4F0Z B;  1T14 A;  1DT7 B;  4I5N B;  1BR4 B;  5AEQ A;  1CDP A;  1W7I B;  3FS7 A;  5I8N A;  1FF1 A;  1SY9 A;  4INW A;  2M7L A;  3SIB A;  4A4B A;  1SL8 A;  2BKH B;  1KQV A;  1TIZ A;  2BL0 C;  2JTZ A;  2NCP A;  2Y5I A;  3KHE A;  5CSN A;  3SG6 A;  1RTP 1;  1SNL A;  3CZ1 A;  1K2H A;  3IF7 A;  3IQQ A;  2PMY A;  2ZNE A;  3B87 A;  3R72 A;  5HLV A;  2JT0 A;  2MLF C;  2I7A A;  2LVJ A;  3DVE A;  1YX7 A;  1YTZ C;  2K7C A;  1CKK A;  1NX2 A;  1Q80 A;  2DOQ A;  2H61 C;  3CTN A;  1G8I A;  3L47 A;  3WHT B;  2KI6 D;  3DXL A;  3PLF B;  1AJ5 A;  2JXL A;  2PAL A;  1IRJ A;  1Y1U A;  1XFV O;  2AUC A;  2MAZ A;  1DJX A;  5I94 A;  2I2R E;  1BJF A;  2G9B A;  2WCM A;  1OQP A;  3L4A A;  2FJY A;  3SG4 A;  1S6J A;  3VGO A;  4TNC A;  2ZRS A;  3DVM A;  1G33 A;  1QAS A;  1AP4 A;  1EG3 A;  2NZ0 A;  2WCB A;  3DF0 A;  4MZK A;  1SCM B;  1OZO A;  3BUN B;  1J1D A;  4PE7 A;  1IKU A;  1UHJ A;  3KO0 A;  2HQW A;  1SL7 A;  1L2O B;  4GGF A;  5ER5 A;  2GGZ A;  5IBW A;  4XJK A;  4NDC A;  1MHO A;  5KTY A;  1DMO A;  2GGM A;  5HL1 A;  2RGI A;  4AQI A;  2QEV A;  3OX6 A;  1TUZ A;  1F4Q A;  2K8M B;  2KQ6 A;  3SG3 A;  3EKH A;  1QV0 A;  1IQ5 A;  1CFC A;  5BPJ A;  3I5F C;  1TTX A;  1P28 A;  1EG4 A;  1BT6 A;  2CTN A;  3D78 A;  4PHJ A;  3GK2 A;  2OS8 B;  5JJG A;  3D0Y B;  4MLW A;  1KK8 B;  1F71 A;  1IJ6 A;  4GGN A;  1MR8 A;  1GM0 A;  2WC6 A;  2R2I A;  1RFJ A;  3PN7 B;  4C0L A;  4CFR A;  2K0J A;  5D3O A;  4NQG A;  4PCW A;  2TN4 A;  1KFU L;  1SW8 A;  3I5H C;  2JZI A;  1IWQ A;  4ZCU A;  2ZN8 A;  1KQM C;  1SRA A;  4HRE E;  1JFK A;  1ZUZ A;  4MVF A;  1JBA A;  1MF8 B;  4DRW A;  3HCM A;  4MN0 A;  4NDB A;  3TUY C;  3I5G B;  2JNF A;  3KEV A;  1KWO C;  2LLS A;  3QRX A;  3V2L A;  2LE9 B;  3SG2 A;  2AMI A;  2CXJ A;  1Y1A A;  1FW4 A;  3CZ0 A;  1CMF A;  1TWO A;  1Z2C B;  2BE4 A;  1LS8 A;  2H2K A;  4M2P A;  1DQE A;  4CID A;  1C3Y A;  1TNW A;  1QTX A;  4N5X A;  1JF0 A;  1MXL C;  4PHN A;  3NSO A;  2KDH A;  4M2O A;  2LP3 A;  2WND A;  4ICB A;  4PE4 A;  2L98 A;  3QME A;  1C7W A;  4ZCV A;  1IH0 A;  4INX A;  2M7N A;  4FQT A;  1ZFS A;  1JF2 A;  3VRQ A;  1S5G Y;  3K1E A;  1QXP A;  1PVB A;  3DVJ A;  3EVR A;  3EKJ A;  4L9M A;  2KNE A;  1ZAC A;  4QJ4 B;  3WNX B;  1OOI X;  4BY5 A;  1KFU S;  2KBI A;  2KYF A;  3NGV A;  3SS5 A;  5HYD A;  3SG7 A;  2LP2 A;  1DEK A;  1UHN A;  4MZL A;  4PHM A;  3OX5 A;  1XA5 A;  4GNK B;  1N0Y A;  2F33 A;  2LMU A;  4OV2 A;  4Q04 A;  4BY4 A;  1CLL A;  2M97 A;  2MLE C;  3R1P A;  1CMG A;  1SCV A;  3IQO A;  1DGU A;  3ZWH A;  3N7H A;  2YGU A;  5CSF A;  3UNW A;  1YVH A;  1OOF A;  1V1F A;  1XFW O;  3B88 A;  3FE9 A;  3PSR A;  1LIN A;  4JQ0 D;  5KU1 A;  2WC8 A;  3BOW A;  1QLS A;  2NLN A;  2KI6 C;  2Y1M A;  2VRG A;  1WRL A;  1NX3 A;  2B1U A;  2LNK A;  3NXA A;  3VRP A;  4JWQ A;  1DJW A;  1J7R A;  2K7B A;  3AKA A;  2MA2 A;  1SCM C;  3DYE A;  3O78 A;  5HKZ A;  2KOT A;  1DF0 A;  2M29 A;  1RJV A;  3LLE A;  1MQ1 A;  1JWD A;  2L4H A;  1LA3 A;  2LLT A;  1YUR A;  3E3R A;  3OB2 B;  5G08 A;  4E68 A;  1A4P A;  3GK1 A;  1IGV A;  1OW4 A;  2EGD A;  1TNX A;  2KFF A;  2BCA A;  4OVN F;  1PAL A;  2MRD A;  2F3Z A;  3D76 A;  2L5X B;  3TS5 B;  3PAT A;  5TNC A;  2HF5 A;  4I5J A;  5AAN A;  1BF5 A;  3BUM B;  2ZKM X;  1QS7 A;  3BFH A;  2K60 A;  3FE6 A;  4FQO A;  1BR1 B;  2WC5 A;  1FI5 A;  2LAN A;  2OS8 C;  4MEW A;  3F45 A;  2JPO A;  2LC5 A;  4IL1 A;  5ER4 X;  1KK8 C;  1QX7 A;  2F2P A;  1CDN A;  2I18 A;  2JRF A;  2K2F A;  2L51 A;  1CM1 A;  1DJY A;  2WCJ A;  4YGB B;  1AVS A;  3H4S E;  1XYD A;  3ICB A;  3PN7 C;  1NCZ A;  1H8B A;  2KGR A;  2KLE A;  3OP0 A;  3R1O A;  2LAP A;  2LVV A;  4HRG A;  1RRO A;  3EK8 A;  3DVK A;  1PVA A;  1QAT A;  3EG5 B;  2M1U A;  3DF0 B;  4USL A;  2CNP A;  2KYC A;  1CM4 A;  3CR2 A;  3D74 A;  3SJS A;  1TN4 A;  2H8V A;  4XJK B;  1CLM A;  3I5G C;  1WLZ A;  4MSP A;  1K8U A;  4YGD B;  2BAP A;  1A75 A;  2BBN A;  1JSA A;  5I2O A;  3A4U B;  1KCY A;  2WOS A;  2K61 A;  1PK0 D;  2LMV A;  3IVT A;  1OZS A;  1KK7 Y;  3LCP C;  1GJY A;  1OOH A;  3WHU B;  1B7T Y;  1B8R A;  1QVI Z;  1XK4 A;  2O5G A;  1SR6 B;  1EJ3 A;  2BBM A;  2ERB A;  3RZS A;  3O4X A;  3FWC A;  1PSB A;  4JKT A;  1DEL A;  1XFU O;  3TDU A;  3R1V A;  1M45 A;  1S1E A;  1B47 A;  3K21 A;  4JPZ B;  2JWW A;  2E30 A;  2M0R A;  1ORG A;  5HKW A;  5DKN A;  3Q8I A;  1QVI Y;  1K90 D;  1DJG A;  1SSE B;  2WCL A;  4YI8 A;  1WRZ A;  1F4O A;  3NHI A;  2KBM A;  4HRH A;  1YRT B;  2IS9 A;  4OZD A;  4QJ5 B;  3O4Y A;  1YUT A;  2F2O A;  3D75 A;  4MZJ A;  4YGE B;  1B1G A;  3I5I B;  4DIR A;  2L2E A;  1A03 A;  5K89 A;  1XO5 A;  3DZT A;  4KYN A;  3SS3 A;  3ZNI A;  1CDL A;  1N65 A;  2JNX A;  2QEB A;  3S0A A;  1F8H A;  2L50 A;  2JT8 A;  1PSR A;  3LK1 A;  3NSI A;  1XFZ O;  1NYA A;  1U5I A;  3D10 A;  1K95 A;  4MBE A;  1LA0 A;  1OOJ A;  1XFY O;  1SYM A;  1DJI A;  5KSZ A;  4YGA A;  1ZMZ A;  3NSL A;  5HKY A;  3M0W A;  3CGA A;  2QDI A;  1OE9 B;  3DD4 A;  3CDN A;  1SL9 A;  1UUR A;  4OKH A;  3SG5 A;  1X02 A;  2M9G A;  1RWY A;  1S5G Z;  5FI7 A;  2KGB C;  2M1K B;  3FIA A;  2CCM A;  2MBX A;  3TS5 C;  5AER A;  5B8I B;  1WY9 A;  1XFX O;  2MJW B;  4YRU A;  4XYN A;  1TNQ A;  1NP8 A;  1QWV A;  2L5Y A;  2LUC A;  4PE1 A;  4HSZ A;  5HLO A;  3SIA A;  1UHI A;  1JFJ A;  3C1V A;  1SMG A;  1M46 A;  1F54 A;  2LHL A;  2Q91 A;  1J7P A;  3CR5 X;  3EK4 A;  1J55 A;  2ZN9 A;  3KPX A;  2H61 A;  4PDZ A;  2SAS A;  2LV7 A;  3EVU A;  1NX1 A;  2GV5 A;  1EL4 A;  1CB1 A;  1LKJ A;  1A29 A;  1YRU B;  1HQV A;  3UO9 A;  2P71 A;  5F6T A;  4M2Q A;  1B8C A;  1S6C A;  3AAJ A;  3SS4 A;  1EH2 A;  1N2D A;  2L4I A;  4ORA B;  1B4C A;  1BOD A;  2G2B A;  3GOF A;  5JOL A;  1QLK A;  4JD9 A;  1CTR A;  1Y1X A;  2FJU B;  2QEO A;  4N1G A;  4GBA A;  1OMV A;  4DCK A;  1L2O C;  2ISD A;  4WQ2 A;  1W7J B;  2PYQ A;  1L7Z A;  3NSK A;  1SR6 C;  3PJI A;  4CPV A;  1Y0V H;  2JT3 A;  1DC1 A;  3CS1 A;  2M3W A;  4DUQ A;  3BUO B;  1UP5 A;  3BXK A;  2JQ6 A;  1GGW A;  1KQM B;  3S0D A;  2FCE A;  2WCE A;  2KPH A;  3OHM B;  4FTG A;  2GTE A;  2KFH A;  2Y4Q A;  1A2X A;  1SPY A;  4WRI A;  1TRF A;  2I94 A;  1NUB A;  2LHI A;  1K9U A;  3CWG A;  1HT9 A;  3I5I C;  3VB1 A;  2PVB A;  4I5L B;  4PE0 A;  2M8U A;  4U8D A;  1WDC B;  4C0J A;  2KQY A;  2ZFD A;  4DS7 A;  2P6B B;  1BLQ A;  4NDD A;  1ODB A;  1M39 A;  1YVL A;  2LLU A;  1A75 B;  1KFX S;  2KAY A;  4D1E A;  1BG1 A;  2CBL A;  1UUS A;  4PT1 A;  2BCX A;  2K7D A;  1TCO B;  2O60 A;  1OOG A;  2L2C A;  3BFA A;  1NX0 A;  2D8N A;  2HET A;  4WQ3 A; 
#chains in the Genus database with same CATH homology
 4F7F A;  1DQE A;  3BFB A;  1C3Y A;  4OZD A;  3D75 A;  1OOG A;  3QME A;  4INX A;  4FQT A;  3DZT A;  3NHT A;  2QEB A;  3S0A A;  3K1E A;  3B86 A;  3B6X A;  3BJH A;  5DIC A;  3CAB A;  1OOI X;  3NGV A;  1T14 A;  2WCK A;  2QDI A;  3R1P A;  3CDN A;  4INW A;  3B7A A;  3N7H A;  1XFR A;  1OOF A;  3B88 A;  3FE9 A;  3CZ1 A;  3B87 A;  3R72 A;  1QWV A;  3DYE A;  3OGN A;  3L47 A;  1TUJ A;  3DXL A;  1OW4 A;  2PQL A;  2WCM A;  3CZ0 A;  3L4A A;  2FJY A;  3D76 A;  2WCH A;  1C3Z A;  3FE6 A;  2P71 A;  3BFH A;  3S0E A;  2WC5 A;  2JPO A;  2WCJ A;  3R1O A;  4JD9 A;  2QEO A;  2QEV A;  3S0F A;  2P70 A;  3PJI A;  1P28 A;  3D78 A;  5EL2 A;  3D74 A;  3CZ2 A;  2H8V A;  2QEH A;  1GM0 A;  3FE8 A;  2WC6 A;  3S0D A;  3DY9 A;  2KPH A;  2GTE A;  1OOH A;  3D73 A;  3VB1 A;  2ERB A;  3RZS A;  3S0B A;  3R1V A;  3CYZ A;  3L4L A;  3D77 A;  3V2L A;  1ORG A;  3S0G A;  3Q8I A;  4PT1 A;  2WCL A;  2L2C A;  3BFA A;  3NHI A;  1TWO A;  1LS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...