1XK4C

Crystal structure of human calprotectin(s100a8/s100a9)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the human (S100A8/S100A9)2 heterotetramer, calprotectin, illustrates how conformational changes of interacting alpha-helices can determine specific association of two EF-hand proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Calgranulin A
total genus 34
structure length 89
sequence length 89
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2004-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xk4C00
2K7BA 4NQGA 5AANA 1KK7Z 2JNFA 4I5NB 5FYXA 2SASA 1PALA 1QX7A 1Y1XA 2LNKA 3FS7A 3VROA 1SW8A 1QXPA 1J55A 1WDCB 1SCMB 1QVIZ 2M1KB 5DKQA 1CLLA 1S1EA 1SPYA 3NSIA 3CWGA 1DJWA 4PE7A 1QLSA 1L7ZA 2D8NA 2Y4QA 2KAYA 1BU3A 2KHNA 3GK1A 1M39A 3O2PA 3DVEA 4IL1A 4WQ3A 1J7QA 1KK8B 2BCAA 2KYCA 2L51A 3WXAA 2PMYA 1FF1A 1EJ3A 2BKIB 1BF5A 3IQQA 4DIRA 1KWOC 2M1UA 1YRUB 5HKYA 1D1OA 1KFUL 2AUCA 4C0JA 1J7OA 1EG4A 5D7FA 2K7CA 3GOFA 2LUCA 1KQMB 2LMTA 3KEVA 3PFVA 2IS9A 1PRWA 2OS8C 3TS5B 3BUWB 2JXLA 2JULA 2I18A 3SG7A 1CLBA 3OB1B 1BG1A 2PVBA 5CSFA 5GQQC 1MHOA 1CFCA 2AMIA 1IKUA 5K89A 5AEQA 1SMGA 1J1DA 1MXEA 1JF2A 4GPLB 2K8MB 1QVIY 1B9AA 1B8RA 2HQ8A 2LUXA 1K90D 1UWOA 1UURA 2P6BB 2CBLA 2M9GA 5G08A 4ORBB 3OP0A 1SL9A 3TUYB 2L4HA 4GNKB 1BMOA 1U5IB 4YI9A 1WLZA 3BUXB 2LMVA 4GUKA 4JWQA 3MSEB 3SG2A 1QATA 1K8UA 2ISDA 5F6TA 1MWNA 3JTDB 2ZRSA 4ETOA 2A4JA 2PSRA 1GQMA 3D0YB 1DGVA 1XFVO 3TS5C 2COLB 4GGFA 1A75A 3CS1A 4GFTA 1IRJA 2I94A 3LL8B 2HF5A 4GGFC 1F8HA 4XYNA 4PHNA 2LP2A 2M3WA 3I5FB 1NYAA 1TRFA 4ZCUA 4BY4A 2KI6D 4WQ2A 1NUBA 2M97A 4M2PA 1CDPA 1W7JB 1CLMA 1PSBA 1W7IB 3DVKA 2I2RE 1QV0A 1FI5A 2GGZA 4PCWA 3SG3A 2KAXA 4PHMA 2KI6C 1EH2A 1S26D 2KOTA 1UHJA 1M46A 1UHHA 1ALVA 1BOCA 2I7AA 1NP8A 5J3XA 2O5GA 3DD4A 1S36A 4L9MA 2FJUB 1S5GZ 2M49B 5HKWA 3WHUB 1AK8A 4MVFA 2HQWA 1B7TY 4E68A 2BCBA 1F71A 1DJZA 1OZSA 2K2FA 1ZACA 1K96A 1BR1B 2LE9B 4MRYA 4PHJA 1AUIB 1B4CA 1KK7Y 1DT7B 4MN0A 1FPWA 4YGCB 2LMUA 2K2AA 1MUXA 1KFXL 2M7NA 4NDBA 1YUSA 1ZMZA 2QACA 1CMFA 2L0PA 4CLNA 1IWQA 2JT8A 1XK4C 3PN7B 1CDLA 1HT9A 5D69A 2HETA 1SR6B 3K21A 4M2QA 1JUOA 4DCKA 1YUTA 1KFUS 5JJGA 1CKKA 1DJIA 2L50A 3A8RA 1DJGA 1RROA 5DKNA 1F70A 1C7VA 1N2DA 1QX2A 1KFXS 4XJKB 5PALA 3TDIA 2F2PA 1S6IA 1J7RA 1SYMA 2M8UA 4NDCA 2HPSA 2KNEA 1IJ5A 1K9PA 1WRKA 3ZWHA 2EHBA 1RTP1 3NXAA 2JQ6A 2WORA 1LA0A 2Q4UA 2KDHA 5HYDA 1F54A 1AJ4A 2WNDA 4N5XA 2PRUA 2E6WA 3TDUA 1QIWA 2L2EA 4CFRA 3A4UB 3EVUA 3H4SE 3IQOA 1KQMC 1F4OA 2H2KA 3I5HB 4C0KA 5CSJA 1OMRA 2TN4A 1A03A 4GAOA 1XA5A 4OVNF 1JF0A 1ALWA 4YI8A 1N0YA 5I2QA 2KAVA 1M63B 1RFJA 2KQYA 1LKJA 4YGAA 3PN7C 1CNPA 1PK0D 1TN4A 2CCMA 4OCIA 1GJYA 2BE4A 3KO0A 3SG5A 2LVJA 2MA2A 3RM1A 1YUUA 2LLUA 3TDZA 1YX7A 2L98A 1OZOA 2Y5IA 1IJ6A 1LVCD 3M0WA 4AOMA 3AAKA 3D10A 2ZFDA 3NSKA 1SBJA 1A29A 5BPJA 1XVJA 3PSRA 3I5GC 4P2YB 4USLA 2MHHA 2ZN8A 3O78A 1A4PA 4CIDA 1YVLA 1F55A 2LVIA 2Y1NA 4ORCB 1QLKA 3OX5A 1RWYA 3JTDC 1RJVA 4I5LB 4PALA 2MJWB 2R2IA 4MBEA 1TNXA 2JC2A 2CXJA 3FWBA 1CDNA 3BXKA 3WNXB 2LLSA 1B1GA 4CFQA 1UHNA 2JTZA 3AKAA 5JOLA 5I2OA 5I2LA 1C07A 2CTNA 4YRUA 2E30A 1IGVA 2AAOA 3I5FC 1X02A 3F45A 2FCDA 1SL8A 2V53A 1GGZA 1WRZA 3NSOA 2BBMA 3ICBA 3QRXA 1QTXA 3C1VA 1EG3A 4BY5A 1ZOTB 3VRRA 4OR9B 1IQ3A 2WCEA 1YR5A 3OB2B 1KCYA 4PE1A 1S5GY 4QJ4B 3TZ1A 3CZTX 1IH0A 4DS7A 4QJ5B 2L4IA 3EKHA 3PATA 1G8IA 1ZFSA 2K7OA 1EXRA 1QASA 1S6JA 4TNCA 2KI4C 4N1FA 5HLVA 1CB1A 1S6CA 2WC8A 1CM1A 2FOTA 1OMVA 4MEWA 2ZRTA 4MZJA 1S3PA 1DJXA 3VRPA 3SIAA 2BL0B 2VRGA 1OE9B 5KSZA 2OTGB 1FI6A 2LCPA 5TNCA 1TNWA 1A2XA 2Y1MA 2LVVA 1WY9A 3BUOB 4MZKA 1PVAA 2KFHA 1QV1A 4FTGA 3ZNIA 1OQPA 2LM5A 1AP4A 3CR2A 2B1UA 2LHLA 1B47A 1BLQA 3KHEA 1EL4A 2KBMA 1TTXA 1Y1AA 3FIAA 4YGBB 3EVVA 1SR6C 3RLZA 2JT3A 1JSAA 1K93D 3PLFB 1TIZA 4JQ0D 1UUSA 2WOSA 4U8DA 3DVMA 1LXFC 1A75B 3VRNA 2M7LA 1DGUA 1BR4B 2F2OA 2NCPA 3I5IC 1YURA 2JZIA 1K95A 1JFKA 1ODBA 2KBIA 5ER4X 1LA3A 4QJ3B 3SG4A 2KQ6A 2MAZA 2PASA 3EKJA 5KU1A 2JXCA 3PM8A 4GBAA 1DJYA 1NSHA 1XFUO 1M45A 1TNPA 1XFYO 1Y1UA 3IF7A 2L5XB 1JFJA 2GV5A 5AERA 1GGWA 1YX8A 2MLFC 1FBVA 1IG5A 3I5HC 4Q04A 4A4BA 4YBHB 1QS7A 4HRHA 3KPXA 2NCOA 3CR4X 4OV2A 1XO5A 4R1EA 3BUNB 1SK6D 1JWDA 4UPGA 4NDDA 5I8NA 1NX0A 2LAPA 4MZLA 3WHTB 1OMDA 1NCZA 2CT9A 1LINA 2JT0A 4GGNA 1YRTB 2H61C 2M0RA 1XK4A 1M31A 1PULA 2F33A 1UHIA 2LANA 3LLEA 2G9BA 3EVRA 4N1GA 4DUQA 3VGOA 2LHIA 4JPZB 1RECA 4YGEB 1OOJA 2JNXA 4PHKA 4MSPA 1H8BA 1KSOA 1MR8A 1B8CA 2ZNDA 3I5GB 4I5JA 3AAJA 2PALA 4HRGA 2BBNA 2KGRA 1SKTA 4OKHA 2NXQA 2K0JA 2KYFA 3CTNA 3SIBA 1K2HA 2KFGA 2EC6B 4PDZA 1B8LA 4ZCVA 3BOWB 2JOJA 4MLWA 4AQIA 1QJTA 1SY9A 2NLNA 1NCXA 2JTTA 1Y6WA 1K9KA 2MLEC 4PE0A 3HX4A 3LCPC 3OHMB 1UHKA 1H4BA 1DVIA 2CNPA 3LK1A 2F8PA 5AFPA 1G4YR 3KF9A 2JU0A 2GGMA 2M29A 1XFZO 1L2OB 2LP3A 3DF0B 2LLTA 3PALA 1ZUZA 3AKBA 5DKRA 2O60A 1F4QA 1BT6A 2LVKA 1HQVA 1OSAA 2MRDA 3LK0A 5CPVA 1KQVA 1DTLA 2K7DA 4WRIA 2FCEA 4PE4A 2NZ0A 1CTRA 1AVSA 2QPTA 1YVHA 5B8IB 1CDMA 1CFDA 2KI4B 1NCYA 2Q91A 5CSNA 1DF0B 5ER5A 4MRXA 4YGDB 3CLNA 1J1EA 1NWDA 1TCFA 1IQ5A 2EC6C 1MF8B 3BYAA 2WCFA 3JVTC 1BJFA 2BL0C 1SNLA 2OTGC 1QX5B 1Q80A 2K61A 1V1GA 2JPTA 1XFWO 4XJKA 1MXLC 1DF0A 2F3YA 1C7WA 2KFFA 3O4YA 1VRKA 1CFFA 1RK9A 1QIVA 1L2OC 1NPQA 2JRFA 3TUYC 3BUMB 3HCMA 1CMGA 4ORAB 4HREE 5CSIA 2G2BA 4A4CA 1R2UA 3I5IB 2EGDA 1SL7A 1AJ5A 1DJHA 1YTZC 1J7PA 2BECA 4P5OE 1PVBA 3EK7A 3EK4A 1NIWA 1E8AA 2OPOA 1TCOB 1WRLA 1B7TZ 5HLOA 3BQ3A 4HSZA 4C0LA 1FW4A 1WLMA 2DOQA 1G33A 2SCPA 3SG6A 2LV7A 1DMOA 3DF0A 3FWCA 4CPVA 1NX3A 1U5IA 3JVTB 1XYDA 1K9UA 1TNQA 1WDCC 1SCMC 3DVJA 5IBWA 3EK8A 4D1EA 3BOWA 2BKHB 2KSPA 1K94A 1UP5A 2RGIA 2MBXA 1N65A 1CFPA 3E3RA 1BODA 1R6PA 4FQOA 2LC5A 2WCBA 1KK8C 3GK4X 3CGAA 4AQJA 1XFXO 4DRWA 1TOPA 3OX6A 4F0ZB 1AHRA 2ZKMX 4ICBA 2F3ZA 1KWOB 1MQ1A 4M2OA 5KTYA 3GK2A 2BCXA 1JC2A 1CM4A 1JBAA 3NSLA 2KGBC 1SRAA 5AXIA 1V1FA 5HKZA 2ZN9A 4I5KA 1Y0VH 1SCVA 1KSMA 3CR5X 2BE6A 3VRQA 3D0YA 2H61A 2OS8B 3SJSA 1NX1A 3O6BA 1NX2A 2JWWA 2ZNEA 1PSRA
chains in the Genus database with same CATH superfamily
2K7BA 4NQGA 5AANA 1KK7Z 2JNFA 4I5NB 4FQTA 2SASA 5FYXA 1PALA 2KPHA 1QX7A 1Y1XA 2LNKA 3FS7A 3OGNA 3VROA 1SW8A 1QXPA 3B6XA 1J55A 1WDCB 1SCMB 1QVIZ 2M1KB 3D75A 5DKQA 1CLLA 3S0EA 1S1EA 1SPYA 3NSIA 3CWGA 1DJWA 4PE7A 1QLSA 1L7ZA 2D8NA 2Y4QA 2KAYA 1BU3A 2KHNA 3GK1A 1M39A 3O2PA 3DVEA 4IL1A 5D3OA 4WQ3A 1J7QA 1KK8B 2BCAA 2KYCA 2L51A 3WXAA 2PMYA 3R1VA 1FF1A 1EJ3A 2BKIB 1BF5A 4F7FA 3IQQA 4DIRA 1KWOC 2M1UA 1YRUB 5HKYA 1P28A 5FI7A 1D1OA 1KFUL 2AUCA 4C0JA 1J7OA 1EG4A 5D7FA 2K7CA 3GOFA 2LUCA 1KQMB 2LMTA 3KEVA 3N7HA 3PFVA 2IS9A 3SS4A 1PRWA 2OS8C 3TS5B 3BUWB 2P70A 2JXLA 2JULA 2I18A 3SG7A 1CLBA 3CABA 3OB1B 2PVBA 1BG1A 5CSFA 5GQQC 1MHOA 1CFCA 2AMIA 1IKUA 5K89A 5AEQA 1SMGA 1J1DA 1MXEA 1JF2A 3CDNA 4GPLB 2K8MB 3L4AA 1GM0A 1QVIY 1B9AA 1B8RA 2HQ8A 2LUXA 1K90D 1UWOA 1UURA 2P6BB 2CBLA 2M9GA 3K1EA 5G08A 2QEHA 4ORBB 3OP0A 1SL9A 3TUYB 2L4HA 4GNKB 1BMOA 1U5IB 4YI9A 1WLZA 3BUXB 2LMVA 4GUKA 4JWQA 3MSEB 3SG2A 3R1PA 3S0GA 1QATA 1K8UA 2ISDA 5F6TA 1MWNA 3JTDB 2ZRSA 1DELA 3NHIA 2A4JA 4ETOA 2PSRA 1GQMA 3D0YB 1DGVA 3CZ0A 1XFVO 3TS5C 2COLB 4GGFA 1A75A 3CS1A 4GFTA 1IRJA 2I94A 3LL8B 2HF5A 4GGFC 1F8HA 3D73A 4XYNA 4PHNA 3DY9A 2LP2A 2M3WA 3I5FB 1NYAA 1TRFA 4ZCUA 4BY4A 3D74A 2KI6D 3EG5B 4WQ2A 1NUBA 2M97A 4M2PA 1CDPA 1W7JB 1CLMA 1PSBA 1W7IB 3DVKA 2I2RE 1QV0A 3FE8A 2GGZA 4PCWA 3SG3A 2FJYA 1FI5A 2KAXA 4PHMA 2KI6C 1EH2A 1S26D 2KOTA 1UHJA 1M46A 1UHHA 1ALVA 1BOCA 2I7AA 1NP8A 2QEOA 5J3XA 2O5GA 3DD4A 1S36A 4L9MA 2FJUB 1S5GZ 2M49B 5HKWA 3WHUB 1OOIX 2JPOA 4MVFA 1W9ZA 2HQWA 1AK8A 1B7TY 2PQLA 4E68A 2BCBA 1F71A 1DJZA 2QEVA 1OZSA 2K2FA 1ZACA 1K96A 1BR1B 2LE9B 4MRYA 4PHJA 1AUIB 1B4CA 1KK7Y 1DT7B 3DZTA 4MN0A 1FPWA 4YGCB 2LMUA 2K2AA 1MUXA 1KFXL 2M7NA 3UO9A 4NDBA 1YUSA 1ZMZA 2QACA 1CMFA 2L0PA 4CLNA 1IWQA 2JT8A 1XK4C 2BAPA 3BFHA 3PN7B 2QEBA 1CDLA 1HT9A 5D69A 2HETA 1SR6B 3K21A 4M2QA 1JUOA 3VB1A 1YUTA 4DCKA 1KFUS 5JJGA 1CKKA 1DJIA 2L50A 3A8RA 1DJGA 1RROA 2WCJA 5DKNA 1F70A 1C7VA 3B88A 1N2DA 1QX2A 1KFXS 4XJKB 5PALA 3TDIA 2F2PA 1S6IA 1J7RA 1SYMA 2M8UA 4JD9A 2HPSA 4NDCA 3B86A 1TWOA 2KNEA 1IJ5A 1K9PA 1WRKA 3ZWHA 5I94A 2EHBA 1RTP1 4IJ7A 3NXAA 2JQ6A 2ERBA 2WORA 1LA0A 2Q4UA 2KDHA 5HYDA 1F54A 1AJ4A 2WNDA 4N5XA 2PRUA 2E6WA 3TDUA 1QIWA 2L2EA 4CFRA 3A4UB 3EVUA 3H4SE 3IQOA 1KQMC 1F4OA 2GTEA 2H2KA 3I5HB 5CSJA 4C0KA 1DC1A 1OMRA 2TN4A 1A03A 4GAOA 1XA5A 4OVNF 1JF0A 1ALWA 4YI8A 1N0YA 5I2QA 2KAVA 1M63B 1RFJA 2KQYA 1LKJA 4YGAA 3PN7C 1CNPA 1PK0D 1SSEB 1TN4A 2CCMA 4OCIA 1GJYA 2BE4A 3KO0A 3SG5A 2LVJA 2MA2A 3RM1A 1YUUA 2LLUA 3TDZA 4OZDA 1LS8A 1YX7A 1XFRA 2L98A 1OZOA 2Y5IA 1IJ6A 1LVCD 3M0WA 4AOMA 3AAKA 3D10A 2ZFDA 3NSKA 1SBJA 1A29A 5BPJA 1XVJA 3PSRA 3I5GC 2H8VA 4P2YB 4USLA 2WCKA 2MHHA 1DQEA 2ZN8A 3O78A 1A4PA 4CIDA 1YVLA 1F55A 2LVIA 3R72A 2P71A 2Y1NA 4ORCB 1QLKA 3OX5A 1RWYA 2PYQA 1RJVA 3JTDC 4I5LB 4PALA 2MJWB 2R2IA 3BJHA 4MBEA 1TNXA 5FI2A 2JC2A 2WCLA 2CXJA 3FWBA 1CDNA 3BXKA 3WNXB 2LLSA 1B1GA 4CFQA 1UHNA 2JTZA 3AKAA 5JOLA 5I2OA 5I2LA 1C07A 2CTNA 4YRUA 2E30A 1IGVA 2AAOA 3I5FC 1X02A 3F45A 2FCDA 1SL8A 2V53A 1GGZA 1WRZA 3NSOA 2BBMA 3ICBA 3QRXA 1QTXA 3C1VA 1EG3A 3PM2A 4BY5A 3NGVA 1ZOTB 3VRRA 4OR9B 1IQ3A 2WCEA 1YR5A 3OB2B 1KCYA 4PE1A 1S5GY 3CYZA 4QJ4B 3TZ1A 3CZTX 1IH0A 4DS7A 4KYNA 4QJ5B 2L4IA 3EKHA 3PATA 1G8IA 1ZFSA 2K7OA 1EXRA 1QASA 1TUJA 1S6JA 4TNCA 2KI4C 4N1FA 5HLVA 1CB1A 1S6CA 2WC8A 1CM1A 2FOTA 1OMVA 2WCHA 4MEWA 2ZRTA 4MZJA 1S3PA 1DJXA 3VRPA 3SIAA 2BL0B 2VRGA 1OE9B 5KSZA 2OTGB 5HL1A 1FI6A 2LCPA 5TNCA 1TNWA 1A2XA 2Y1MA 2LVVA 1WY9A 3BUOB 4MZKA 1PVAA 2KFHA 1QV1A 4FTGA 3ZNIA 1OQPA 2LM5A 1AP4A 3CR2A 2B1UA 2LHLA 1B47A 1BLQA 3KHEA 1EL4A 2KBMA 1TTXA 3L4LA 1Y1AA 3FIAA 4INWA 3EVVA 1SR6C 2KLEA 2JT3A 4YGBB 1K93D 3RLZA 1JSAA 3PLFB 1TIZA 3S0FA 4JQ0D 1UUSA 2WOSA 4U8DA 3DVMA 1LXFC 1A75B 3D78A 5EL2A 2WC5A 2M7LA 3VRNA 1DGUA 1BR4B 2F2OA 2NCPA 3I5IC 1YURA 2JZIA 1K95A 1JFKA 1ODBA 2KBIA 5ER4X 1LA3A 4QJ3B 2L5YA 4JKTA 3SG4A 2KQ6A 2MAZA 2PASA 3B87A 3EKJA 5KU1A 1OOFA 2JXCA 3BFAA 3PM8A 4GBAA 1DJYA 1NSHA 1XFUO 1M45A 1TNPA 1XFYO 5DICA 1Y1UA 3IF7A 2L5XB 1JFJA 2GV5A 5AERA 1GGWA 2WCMA 1YX8A 2MLFC 1FBVA 1IG5A 3I5HC 4Q04A 4A4BA 4YBHB 1QS7A 4HRHA 3KPXA 2NCOA 3CR4X 4OV2A 1XO5A 3SS3A 1TUZA 3O4XA 4R1EA 3BUNB 1SK6D 1JWDA 4UPGA 4NDDA 5I8NA 1NX0A 2LAPA 4MZLA 3WHTB 1OMDA 1NCZA 4PT1A 2CT9A 1LINA 2JT0A 4GGNA 1YRTB 2H61C 2M0RA 3RZSA 1XK4A 1M31A 1PULA 3DYEA 2F33A 3V2LA 1UHIA 2LANA 3LLEA 2G9BA 3EVRA 4N1GA 4DUQA 3VGOA 2LHIA 4JPZB 1OOGA 1RECA 4YGEB 1OOJA 3S0AA 2JNXA 4PHKA 4MSPA 1H8BA 1KSOA 1MR8A 1B8CA 2ZNDA 3I5GB 4I5JA 3AAJA 2PALA 4HRGA 3PJIA 1DEKA 2BBNA 2KGRA 1SKTA 4OKHA 3SS5A 2NXQA 2K0JA 2KYFA 3CTNA 3SIBA 1K2HA 2BNXA 2KFGA 2EC6B 4PDZA 1B8LA 4ZCVA 3BOWB 2JOJA 4MLWA 4AQIA 1QJTA 1SY9A 2NLNA 1NCXA 2JTTA 3R1OA 1Y6WA 1K9KA 2MLEC 4PE0A 3CZ1A 3HX4A 3LCPC 3OHMB 2WC6A 1UHKA 1H4BA 1DVIA 2CNPA 3LK1A 2F8PA 2QDIA 5AFPA 1G4YR 3KF9A 3QMEA 2JU0A 2GGMA 2M29A 1C3YA 1IIOA 1XFZO 1L2OB 2LP3A 3B7AA 3DF0B 2LLTA 3PALA 1ZUZA 3AKBA 5DKRA 3S0DA 2O60A 1F4QA 1BT6A 2LVKA 1HQVA 3D77A 1OSAA 2MRDA 3LK0A 5CPVA 1KQVA 1DTLA 2K7DA 4WRIA 2FCEA 1QWVA 4PE4A 2NZ0A 1CTRA 1AVSA 2QPTA 1YVHA 1ORGA 5B8IB 1CDMA 1CFDA 2KI4B 1NCYA 2Q91A 5CSNA 1DF0B 5ER5A 4MRXA 4YGDB 3CLNA 1J1EA 1NWDA 1TCFA 1IQ5A 2EC6C 1MF8B 3BYAA 2WCFA 3JVTC 1BJFA 1Z2CB 2BL0C 1SNLA 2OTGC 1QX5B 3S0BA 1Q80A 2K61A 1V1GA 2JPTA 1XFWO 4XJKA 1MXLC 1DF0A 2F3YA 1C7WA 2KFFA 3O4YA 1VRKA 1CFFA 1RK9A 1QIVA 1L2OC 1NPQA 3OBVA 2JRFA 3TUYC 3BUMB 3HCMA 1CMGA 4ORAB 4HREE 2KLDA 5CSIA 2G2BA 1OOHA 1R2UA 4A4CA 2L2CA 3I5IB 2EGDA 1SL7A 1AJ5A 1DJHA 1YTZC 1J7PA 2BECA 5FI6A 1C3ZA 4P5OE 1PVBA 3EK7A 3EK4A 1NIWA 1E8AA 2OPOA 1TCOB 1WRLA 1B7TZ 5HLOA 3BQ3A 3FE6A 1OW4A 4HSZA 4C0LA 3DXLA 1FW4A 1WLMA 3NHTA 2DOQA 1G33A 2SCPA 3SG6A 2LV7A 1DMOA 3DF0A 3FWCA 4CPVA 3L47A 1NX3A 1U5IA 3JVTB 1XYDA 1K9UA 1TNQA 1WDCC 3CZ2A 3UNWA 1SCMC 3DVJA 5IBWA 3EK8A 4D1EA 3BOWA 2BKHB 1Z4HA 4INXA 2KSPA 1K94A 1UP5A 2RGIA 2MBXA 1N65A 1CFPA 1T14A 3E3RA 3FE9A 3Q8IA 3IVTA 1R6PA 1BODA 2K60A 4FQOA 2LC5A 2WCBA 1KK8C 3GK4X 3CGAA 4AQJA 1XFXO 4DRWA 3BFBA 1TOPA 3OX6A 4F0ZB 1AHRA 2ZKMX 4ICBA 2F3ZA 1KWOB 1MQ1A 4M2OA 5KTYA 3GK2A 2BCXA 1JC2A 1CM4A 1JBAA 3NSLA 2KGBC 2YGUA 1SRAA 5AXIA 1V1FA 5HKZA 2ZN9A 4I5KA 1Y0VH 1SCVA 1KSMA 3CR5X 2BE6A 3VRQA 3D0YA 2H61A 3D76A 2OS8B 3SJSA 1NX1A 3O6BA 1NX2A 2JWWA 2ZNEA 1PSRA
chains in the Genus database with same CATH topology
2K7BA 4NQGA 5AANA 1KK7Z 2JNFA 4I5NB 5FYXA 2SASA 1PALA 1QX7A 1Y1XA 2LNKA 3FS7A 3VROA 1SW8A 1QXPA 1J55A 1WDCB 1SCMB 1QVIZ 2M1KB 5DKQA 1CLLA 1S1EA 1SPYA 3NSIA 3CWGA 1DJWA 4PE7A 1QLSA 1L7ZA 2D8NA 2Y4QA 2KAYA 1BU3A 2KHNA 3GK1A 1M39A 3O2PA 3DVEA 4IL1A 4WQ3A 1J7QA 1KK8B 2BCAA 2KYCA 2L51A 3WXAA 2PMYA 1FF1A 1EJ3A 2BKIB 1BF5A 3IQQA 4DIRA 1KWOC 2M1UA 1YRUB 5HKYA 1D1OA 1KFUL 2AUCA 4C0JA 1J7OA 1EG4A 5D7FA 2K7CA 3GOFA 2LUCA 1KQMB 2LMTA 3KEVA 3PFVA 2IS9A 1PRWA 2OS8C 3TS5B 3BUWB 2JXLA 2JULA 2I18A 3SG7A 1CLBA 3OB1B 1BG1A 2PVBA 5CSFA 5GQQC 1MHOA 1CFCA 2AMIA 1IKUA 5K89A 5AEQA 1SMGA 1J1DA 1MXEA 1JF2A 4GPLB 2K8MB 1QVIY 1B9AA 1B8RA 2HQ8A 2LUXA 1K90D 1UWOA 1UURA 2P6BB 2CBLA 2M9GA 5G08A 4ORBB 3OP0A 1SL9A 3TUYB 2L4HA 4GNKB 1BMOA 1U5IB 4YI9A 1WLZA 3BUXB 2LMVA 4GUKA 4JWQA 3MSEB 3SG2A 1QATA 1K8UA 2ISDA 5F6TA 1MWNA 3JTDB 2ZRSA 4ETOA 2A4JA 2PSRA 1GQMA 3D0YB 1DGVA 1XFVO 3TS5C 2COLB 4GGFA 1A75A 3CS1A 4GFTA 1IRJA 2I94A 3LL8B 2HF5A 4GGFC 1F8HA 4XYNA 4PHNA 2LP2A 2M3WA 3I5FB 1NYAA 1TRFA 4ZCUA 4BY4A 2KI6D 4WQ2A 1NUBA 2M97A 4M2PA 1CDPA 1W7JB 1CLMA 1PSBA 1W7IB 3DVKA 2I2RE 1QV0A 1FI5A 2GGZA 4PCWA 3SG3A 2KAXA 4PHMA 2KI6C 1EH2A 1S26D 2KOTA 1UHJA 1M46A 1UHHA 1ALVA 1BOCA 2I7AA 1NP8A 5J3XA 2O5GA 3DD4A 1S36A 4L9MA 2FJUB 1S5GZ 2M49B 5HKWA 3WHUB 1AK8A 4MVFA 2HQWA 1B7TY 4E68A 2BCBA 1F71A 1DJZA 1OZSA 2K2FA 1ZACA 1K96A 1BR1B 2LE9B 4MRYA 4PHJA 1AUIB 1B4CA 1KK7Y 1DT7B 4MN0A 1FPWA 4YGCB 2LMUA 2K2AA 1MUXA 1KFXL 2M7NA 4NDBA 1YUSA 1ZMZA 2QACA 1CMFA 2L0PA 4CLNA 1IWQA 2JT8A 1XK4C 3PN7B 1CDLA 1HT9A 5D69A 2HETA 1SR6B 3K21A 4M2QA 1JUOA 4DCKA 1YUTA 1KFUS 5JJGA 1CKKA 1DJIA 2L50A 3A8RA 1DJGA 1RROA 5DKNA 1F70A 1C7VA 1N2DA 1QX2A 1KFXS 4XJKB 5PALA 3TDIA 2F2PA 1S6IA 1J7RA 1SYMA 2M8UA 4NDCA 2HPSA 2KNEA 1IJ5A 1K9PA 1WRKA 3ZWHA 2EHBA 1RTP1 3NXAA 2JQ6A 2WORA 1LA0A 2Q4UA 2KDHA 5HYDA 1F54A 1AJ4A 2WNDA 4N5XA 2PRUA 2E6WA 3TDUA 1QIWA 2L2EA 4CFRA 3A4UB 3EVUA 3H4SE 3IQOA 1KQMC 1F4OA 2H2KA 3I5HB 4C0KA 5CSJA 1OMRA 2TN4A 1A03A 4GAOA 1XA5A 4OVNF 1JF0A 1ALWA 4YI8A 1N0YA 5I2QA 2KAVA 1M63B 1RFJA 2KQYA 1LKJA 4YGAA 3PN7C 1CNPA 1PK0D 1TN4A 2CCMA 4OCIA 1GJYA 2BE4A 3KO0A 3SG5A 2LVJA 2MA2A 3RM1A 1YUUA 2LLUA 3TDZA 1YX7A 2L98A 1OZOA 2Y5IA 1IJ6A 1LVCD 3M0WA 4AOMA 3AAKA 3D10A 2ZFDA 3NSKA 1SBJA 1A29A 5BPJA 1XVJA 3PSRA 3I5GC 4P2YB 4USLA 2MHHA 2ZN8A 3O78A 1A4PA 4CIDA 1YVLA 1F55A 2LVIA 2Y1NA 4ORCB 1QLKA 3OX5A 1RWYA 3JTDC 1RJVA 4I5LB 4PALA 2MJWB 2R2IA 4MBEA 1TNXA 2JC2A 2CXJA 3FWBA 1CDNA 3BXKA 3WNXB 2LLSA 1B1GA 4CFQA 1UHNA 2JTZA 3AKAA 5JOLA 5I2OA 5I2LA 1C07A 2CTNA 4YRUA 2E30A 1IGVA 2AAOA 3I5FC 1X02A 3F45A 2FCDA 1SL8A 2V53A 1GGZA 1WRZA 3NSOA 2BBMA 3ICBA 3QRXA 1QTXA 3C1VA 1EG3A 4BY5A 1ZOTB 3VRRA 4OR9B 1IQ3A 2WCEA 1YR5A 3OB2B 1KCYA 4PE1A 1S5GY 4QJ4B 3TZ1A 3CZTX 1IH0A 4DS7A 4QJ5B 2L4IA 3EKHA 3PATA 1G8IA 1ZFSA 2K7OA 1EXRA 1QASA 1S6JA 4TNCA 2KI4C 4N1FA 5HLVA 1CB1A 1S6CA 2WC8A 1CM1A 2FOTA 1OMVA 4MEWA 2ZRTA 4MZJA 1S3PA 1DJXA 3VRPA 3SIAA 2BL0B 2VRGA 1OE9B 5KSZA 2OTGB 1FI6A 2LCPA 5TNCA 1TNWA 1A2XA 2Y1MA 2LVVA 1WY9A 3BUOB 4MZKA 1PVAA 2KFHA 1QV1A 4FTGA 3ZNIA 1OQPA 2LM5A 1AP4A 3CR2A 2B1UA 2LHLA 1B47A 1BLQA 3KHEA 1EL4A 2KBMA 1TTXA 1Y1AA 3FIAA 4YGBB 3EVVA 1SR6C 3RLZA 2JT3A 1JSAA 1K93D 3PLFB 1TIZA 4JQ0D 1UUSA 2WOSA 4U8DA 3DVMA 1LXFC 1A75B 3VRNA 2M7LA 1DGUA 1BR4B 2F2OA 2NCPA 3I5IC 1YURA 2JZIA 1K95A 1JFKA 1ODBA 2KBIA 5ER4X 1LA3A 4QJ3B 3SG4A 2KQ6A 2MAZA 2PASA 3EKJA 5KU1A 2JXCA 3PM8A 4GBAA 1DJYA 1NSHA 1XFUO 1M45A 1TNPA 1XFYO 1Y1UA 3IF7A 2L5XB 1JFJA 2GV5A 5AERA 1GGWA 1YX8A 2MLFC 1FBVA 1IG5A 3I5HC 4Q04A 4A4BA 4YBHB 1QS7A 4HRHA 3KPXA 2NCOA 3CR4X 4OV2A 1XO5A 4R1EA 3BUNB 1SK6D 1JWDA 4UPGA 4NDDA 5I8NA 1NX0A 2LAPA 4MZLA 3WHTB 1OMDA 1NCZA 2CT9A 1LINA 2JT0A 4GGNA 1YRTB 2H61C 2M0RA 1XK4A 1M31A 1PULA 2F33A 1UHIA 2LANA 3LLEA 2G9BA 3EVRA 4N1GA 4DUQA 3VGOA 2LHIA 4JPZB 1RECA 4YGEB 1OOJA 2JNXA 4PHKA 4MSPA 1H8BA 1KSOA 1MR8A 1B8CA 2ZNDA 3I5GB 4I5JA 3AAJA 2PALA 4HRGA 2BBNA 2KGRA 1SKTA 4OKHA 2NXQA 2K0JA 2KYFA 3CTNA 3SIBA 1K2HA 2KFGA 2EC6B 4PDZA 1B8LA 4ZCVA 3BOWB 2JOJA 4MLWA 4AQIA 1QJTA 1SY9A 2NLNA 1NCXA 2JTTA 1Y6WA 1K9KA 2MLEC 4PE0A 3HX4A 3LCPC 3OHMB 1UHKA 1H4BA 1DVIA 2CNPA 3LK1A 2F8PA 5AFPA 1G4YR 3KF9A 2JU0A 2GGMA 2M29A 1XFZO 1L2OB 2LP3A 3DF0B 2LLTA 3PALA 1ZUZA 3AKBA 5DKRA 2O60A 1F4QA 1BT6A 2LVKA 1HQVA 1OSAA 2MRDA 3LK0A 5CPVA 1KQVA 1DTLA 2K7DA 4WRIA 2FCEA 4PE4A 2NZ0A 1CTRA 1AVSA 2QPTA 1YVHA 5B8IB 1CDMA 1CFDA 2KI4B 1NCYA 2Q91A 5CSNA 1DF0B 5ER5A 4MRXA 4YGDB 3CLNA 1J1EA 1NWDA 1TCFA 1IQ5A 2EC6C 1MF8B 3BYAA 2WCFA 3JVTC 1BJFA 2BL0C 1SNLA 2OTGC 1QX5B 1Q80A 2K61A 1V1GA 2JPTA 1XFWO 4XJKA 1MXLC 1DF0A 2F3YA 1C7WA 2KFFA 3O4YA 1VRKA 1CFFA 1RK9A 1QIVA 1L2OC 1NPQA 2JRFA 3TUYC 3BUMB 3HCMA 1CMGA 4ORAB 4HREE 5CSIA 2G2BA 4A4CA 1R2UA 3I5IB 2EGDA 1SL7A 1AJ5A 1DJHA 1YTZC 1J7PA 2BECA 4P5OE 1PVBA 3EK7A 3EK4A 1NIWA 1E8AA 2OPOA 1TCOB 1WRLA 1B7TZ 5HLOA 3BQ3A 4HSZA 4C0LA 1FW4A 1WLMA 2DOQA 1G33A 2SCPA 3SG6A 2LV7A 1DMOA 3DF0A 3FWCA 4CPVA 1NX3A 1U5IA 3JVTB 1XYDA 1K9UA 1TNQA 1WDCC 1SCMC 3DVJA 5IBWA 3EK8A 4D1EA 3BOWA 2BKHB 2KSPA 1K94A 1UP5A 2RGIA 2MBXA 1N65A 1CFPA 3E3RA 1BODA 1R6PA 4FQOA 2LC5A 2WCBA 1KK8C 3GK4X 3CGAA 4AQJA 1XFXO 4DRWA 1TOPA 3OX6A 4F0ZB 1AHRA 2ZKMX 4ICBA 2F3ZA 1KWOB 1MQ1A 4M2OA 5KTYA 3GK2A 2BCXA 1JC2A 1CM4A 1JBAA 3NSLA 2KGBC 1SRAA 5AXIA 1V1FA 5HKZA 2ZN9A 4I5KA 1Y0VH 1SCVA 1KSMA 3CR5X 2BE6A 3VRQA 3D0YA 2H61A 2OS8B 3SJSA 1NX1A 3O6BA 1NX2A 2JWWA 2ZNEA 1PSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7B A;  4NQG A;  5AAN A;  1KK7 Z;  2JNF A;  4I5N B;  5FYX A;  2SAS A;  1PAL A;  1QX7 A;  1Y1X A;  2LNK A;  3FS7 A;  3VRO A;  1SW8 A;  1QXP A;  1J55 A;  1WDC B;  1SCM B;  1QVI Z;  2M1K B;  5DKQ A;  1CLL A;  1S1E A;  1SPY A;  3NSI A;  3CWG A;  1DJW A;  4PE7 A;  1QLS A;  1L7Z A;  2D8N A;  2Y4Q A;  2KAY A;  1BU3 A;  2KHN A;  3GK1 A;  1M39 A;  3O2P A;  3DVE A;  4IL1 A;  4WQ3 A;  1J7Q A;  1KK8 B;  2BCA A;  2KYC A;  2L51 A;  3WXA A;  2PMY A;  1FF1 A;  1EJ3 A;  2BKI B;  1BF5 A;  3IQQ A;  4DIR A;  1KWO C;  2M1U A;  1YRU B;  5HKY A;  1D1O A;  1KFU L;  2AUC A;  4C0J A;  1J7O A;  1EG4 A;  5D7F A;  2K7C A;  3GOF A;  2LUC A;  1KQM B;  2LMT A;  3KEV A;  3PFV A;  2IS9 A;  1PRW A;  2OS8 C;  3TS5 B;  3BUW B;  2JXL A;  2JUL A;  2I18 A;  3SG7 A;  1CLB A;  3OB1 B;  1BG1 A;  2PVB A;  5CSF A;  5GQQ C;  1MHO A;  1CFC A;  2AMI A;  1IKU A;  5K89 A;  5AEQ A;  1SMG A;  1J1D A;  1MXE A;  1JF2 A;  4GPL B;  2K8M B;  1QVI Y;  1B9A A;  1B8R A;  2HQ8 A;  2LUX A;  1K90 D;  1UWO A;  1UUR A;  2P6B B;  2CBL A;  2M9G A;  5G08 A;  4ORB B;  3OP0 A;  1SL9 A;  3TUY B;  2L4H A;  4GNK B;  1BMO A;  1U5I B;  4YI9 A;  1WLZ A;  3BUX B;  2LMV A;  4GUK A;  4JWQ A;  3MSE B;  3SG2 A;  1QAT A;  1K8U A;  2ISD A;  5F6T A;  1MWN A;  3JTD B;  2ZRS A;  4ETO A;  2A4J A;  2PSR A;  1GQM A;  3D0Y B;  1DGV A;  1XFV O;  3TS5 C;  2COL B;  4GGF A;  1A75 A;  3CS1 A;  4GFT A;  1IRJ A;  2I94 A;  3LL8 B;  2HF5 A;  4GGF C;  1F8H A;  4XYN A;  4PHN A;  2LP2 A;  2M3W A;  3I5F B;  1NYA A;  1TRF A;  4ZCU A;  4BY4 A;  2KI6 D;  4WQ2 A;  1NUB A;  2M97 A;  4M2P A;  1CDP A;  1W7J B;  1CLM A;  1PSB A;  1W7I B;  3DVK A;  2I2R E;  1QV0 A;  1FI5 A;  2GGZ A;  4PCW A;  3SG3 A;  2KAX A;  4PHM A;  2KI6 C;  1EH2 A;  1S26 D;  2KOT A;  1UHJ A;  1M46 A;  1UHH A;  1ALV A;  1BOC A;  2I7A A;  1NP8 A;  5J3X A;  2O5G A;  3DD4 A;  1S36 A;  4L9M A;  2FJU B;  1S5G Z;  2M49 B;  5HKW A;  3WHU B;  1AK8 A;  4MVF A;  2HQW A;  1B7T Y;  4E68 A;  2BCB A;  1F71 A;  1DJZ A;  1OZS A;  2K2F A;  1ZAC A;  1K96 A;  1BR1 B;  2LE9 B;  4MRY A;  4PHJ A;  1AUI B;  1B4C A;  1KK7 Y;  1DT7 B;  4MN0 A;  1FPW A;  4YGC B;  2LMU A;  2K2A A;  1MUX A;  1KFX L;  2M7N A;  4NDB A;  1YUS A;  1ZMZ A;  2QAC A;  1CMF A;  2L0P A;  4CLN A;  1IWQ A;  2JT8 A;  1XK4 C;  3PN7 B;  1CDL A;  1HT9 A;  5D69 A;  2HET A;  1SR6 B;  3K21 A;  4M2Q A;  1JUO A;  4DCK A;  1YUT A;  1KFU S;  5JJG A;  1CKK A;  1DJI A;  2L50 A;  3A8R A;  1DJG A;  1RRO A;  5DKN A;  1F70 A;  1C7V A;  1N2D A;  1QX2 A;  1KFX S;  4XJK B;  5PAL A;  3TDI A;  2F2P A;  1S6I A;  1J7R A;  1SYM A;  2M8U A;  4NDC A;  2HPS A;  2KNE A;  1IJ5 A;  1K9P A;  1WRK A;  3ZWH A;  2EHB A;  1RTP 1;  3NXA A;  2JQ6 A;  2WOR A;  1LA0 A;  2Q4U A;  2KDH A;  5HYD A;  1F54 A;  1AJ4 A;  2WND A;  4N5X A;  2PRU A;  2E6W A;  3TDU A;  1QIW A;  2L2E A;  4CFR A;  3A4U B;  3EVU A;  3H4S E;  3IQO A;  1KQM C;  1F4O A;  2H2K A;  3I5H B;  4C0K A;  5CSJ A;  1OMR A;  2TN4 A;  1A03 A;  4GAO A;  1XA5 A;  4OVN F;  1JF0 A;  1ALW A;  4YI8 A;  1N0Y A;  5I2Q A;  2KAV A;  1M63 B;  1RFJ A;  2KQY A;  1LKJ A;  4YGA A;  3PN7 C;  1CNP A;  1PK0 D;  1TN4 A;  2CCM A;  4OCI A;  1GJY A;  2BE4 A;  3KO0 A;  3SG5 A;  2LVJ A;  2MA2 A;  3RM1 A;  1YUU A;  2LLU A;  3TDZ A;  1YX7 A;  2L98 A;  1OZO A;  2Y5I A;  1IJ6 A;  1LVC D;  3M0W A;  4AOM A;  3AAK A;  3D10 A;  2ZFD A;  3NSK A;  1SBJ A;  1A29 A;  5BPJ A;  1XVJ A;  3PSR A;  3I5G C;  4P2Y B;  4USL A;  2MHH A;  2ZN8 A;  3O78 A;  1A4P A;  4CID A;  1YVL A;  1F55 A;  2LVI A;  2Y1N A;  4ORC B;  1QLK A;  3OX5 A;  1RWY A;  3JTD C;  1RJV A;  4I5L B;  4PAL A;  2MJW B;  2R2I A;  4MBE A;  1TNX A;  2JC2 A;  2CXJ A;  3FWB A;  1CDN A;  3BXK A;  3WNX B;  2LLS A;  1B1G A;  4CFQ A;  1UHN A;  2JTZ A;  3AKA A;  5JOL A;  5I2O A;  5I2L A;  1C07 A;  2CTN A;  4YRU A;  2E30 A;  1IGV A;  2AAO A;  3I5F C;  1X02 A;  3F45 A;  2FCD A;  1SL8 A;  2V53 A;  1GGZ A;  1WRZ A;  3NSO A;  2BBM A;  3ICB A;  3QRX A;  1QTX A;  3C1V A;  1EG3 A;  4BY5 A;  1ZOT B;  3VRR A;  4OR9 B;  1IQ3 A;  2WCE A;  1YR5 A;  3OB2 B;  1KCY A;  4PE1 A;  1S5G Y;  4QJ4 B;  3TZ1 A;  3CZT X;  1IH0 A;  4DS7 A;  4QJ5 B;  2L4I A;  3EKH A;  3PAT A;  1G8I A;  1ZFS A;  2K7O A;  1EXR A;  1QAS A;  1S6J A;  4TNC A;  2KI4 C;  4N1F A;  5HLV A;  1CB1 A;  1S6C A;  2WC8 A;  1CM1 A;  2FOT A;  1OMV A;  4MEW A;  2ZRT A;  4MZJ A;  1S3P A;  1DJX A;  3VRP A;  3SIA A;  2BL0 B;  2VRG A;  1OE9 B;  5KSZ A;  2OTG B;  1FI6 A;  2LCP A;  5TNC A;  1TNW A;  1A2X A;  2Y1M A;  2LVV A;  1WY9 A;  3BUO B;  4MZK A;  1PVA A;  2KFH A;  1QV1 A;  4FTG A;  3ZNI A;  1OQP A;  2LM5 A;  1AP4 A;  3CR2 A;  2B1U A;  2LHL A;  1B47 A;  1BLQ A;  3KHE A;  1EL4 A;  2KBM A;  1TTX A;  1Y1A A;  3FIA A;  4YGB B;  3EVV A;  1SR6 C;  3RLZ A;  2JT3 A;  1JSA A;  1K93 D;  3PLF B;  1TIZ A;  4JQ0 D;  1UUS A;  2WOS A;  4U8D A;  3DVM A;  1LXF C;  1A75 B;  3VRN A;  2M7L A;  1DGU A;  1BR4 B;  2F2O A;  2NCP A;  3I5I C;  1YUR A;  2JZI A;  1K95 A;  1JFK A;  1ODB A;  2KBI A;  5ER4 X;  1LA3 A;  4QJ3 B;  3SG4 A;  2KQ6 A;  2MAZ A;  2PAS A;  3EKJ A;  5KU1 A;  2JXC A;  3PM8 A;  4GBA A;  1DJY A;  1NSH A;  1XFU O;  1M45 A;  1TNP A;  1XFY O;  1Y1U A;  3IF7 A;  2L5X B;  1JFJ A;  2GV5 A;  5AER A;  1GGW A;  1YX8 A;  2MLF C;  1FBV A;  1IG5 A;  3I5H C;  4Q04 A;  4A4B A;  4YBH B;  1QS7 A;  4HRH A;  3KPX A;  2NCO A;  3CR4 X;  4OV2 A;  1XO5 A;  4R1E A;  3BUN B;  1SK6 D;  1JWD A;  4UPG A;  4NDD A;  5I8N A;  1NX0 A;  2LAP A;  4MZL A;  3WHT B;  1OMD A;  1NCZ A;  2CT9 A;  1LIN A;  2JT0 A;  4GGN A;  1YRT B;  2H61 C;  2M0R A;  1XK4 A;  1M31 A;  1PUL A;  2F33 A;  1UHI A;  2LAN A;  3LLE A;  2G9B A;  3EVR A;  4N1G A;  4DUQ A;  3VGO A;  2LHI A;  4JPZ B;  1REC A;  4YGE B;  1OOJ A;  2JNX A;  4PHK A;  4MSP A;  1H8B A;  1KSO A;  1MR8 A;  1B8C A;  2ZND A;  3I5G B;  4I5J A;  3AAJ A;  2PAL A;  4HRG A;  2BBN A;  2KGR A;  1SKT A;  4OKH A;  2NXQ A;  2K0J A;  2KYF A;  3CTN A;  3SIB A;  1K2H A;  2KFG A;  2EC6 B;  4PDZ A;  1B8L A;  4ZCV A;  3BOW B;  2JOJ A;  4MLW A;  4AQI A;  1QJT A;  1SY9 A;  2NLN A;  1NCX A;  2JTT A;  1Y6W A;  1K9K A;  2MLE C;  4PE0 A;  3HX4 A;  3LCP C;  3OHM B;  1UHK A;  1H4B A;  1DVI A;  2CNP A;  3LK1 A;  2F8P A;  5AFP A;  1G4Y R;  3KF9 A;  2JU0 A;  2GGM A;  2M29 A;  1XFZ O;  1L2O B;  2LP3 A;  3DF0 B;  2LLT A;  3PAL A;  1ZUZ A;  3AKB A;  5DKR A;  2O60 A;  1F4Q A;  1BT6 A;  2LVK A;  1HQV A;  1OSA A;  2MRD A;  3LK0 A;  5CPV A;  1KQV A;  1DTL A;  2K7D A;  4WRI A;  2FCE A;  4PE4 A;  2NZ0 A;  1CTR A;  1AVS A;  2QPT A;  1YVH A;  5B8I B;  1CDM A;  1CFD A;  2KI4 B;  1NCY A;  2Q91 A;  5CSN A;  1DF0 B;  5ER5 A;  4MRX A;  4YGD B;  3CLN A;  1J1E A;  1NWD A;  1TCF A;  1IQ5 A;  2EC6 C;  1MF8 B;  3BYA A;  2WCF A;  3JVT C;  1BJF A;  2BL0 C;  1SNL A;  2OTG C;  1QX5 B;  1Q80 A;  2K61 A;  1V1G A;  2JPT A;  1XFW O;  4XJK A;  1MXL C;  1DF0 A;  2F3Y A;  1C7W A;  2KFF A;  3O4Y A;  1VRK A;  1CFF A;  1RK9 A;  1QIV A;  1L2O C;  1NPQ A;  2JRF A;  3TUY C;  3BUM B;  3HCM A;  1CMG A;  4ORA B;  4HRE E;  5CSI A;  2G2B A;  4A4C A;  1R2U A;  3I5I B;  2EGD A;  1SL7 A;  1AJ5 A;  1DJH A;  1YTZ C;  1J7P A;  2BEC A;  4P5O E;  1PVB A;  3EK7 A;  3EK4 A;  1NIW A;  1E8A A;  2OPO A;  1TCO B;  1WRL A;  1B7T Z;  5HLO A;  3BQ3 A;  4HSZ A;  4C0L A;  1FW4 A;  1WLM A;  2DOQ A;  1G33 A;  2SCP A;  3SG6 A;  2LV7 A;  1DMO A;  3DF0 A;  3FWC A;  4CPV A;  1NX3 A;  1U5I A;  3JVT B;  1XYD A;  1K9U A;  1TNQ A;  1WDC C;  1SCM C;  3DVJ A;  5IBW A;  3EK8 A;  4D1E A;  3BOW A;  2BKH B;  2KSP A;  1K94 A;  1UP5 A;  2RGI A;  2MBX A;  1N65 A;  1CFP A;  3E3R A;  1BOD A;  1R6P A;  4FQO A;  2LC5 A;  2WCB A;  1KK8 C;  3GK4 X;  3CGA A;  4AQJ A;  1XFX O;  4DRW A;  1TOP A;  3OX6 A;  4F0Z B;  1AHR A;  2ZKM X;  4ICB A;  2F3Z A;  1KWO B;  1MQ1 A;  4M2O A;  5KTY A;  3GK2 A;  2BCX A;  1JC2 A;  1CM4 A;  1JBA A;  3NSL A;  2KGB C;  1SRA A;  5AXI A;  1V1F A;  5HKZ A;  2ZN9 A;  4I5K A;  1Y0V H;  1SCV A;  1KSM A;  3CR5 X;  2BE6 A;  3VRQ A;  3D0Y A;  2H61 A;  2OS8 B;  3SJS A;  1NX1 A;  3O6B A;  1NX2 A;  2JWW A;  2ZNE A;  1PSR A; 
#chains in the Genus database with same CATH topology
 2K7B A;  4NQG A;  5AAN A;  1KK7 Z;  2JNF A;  4I5N B;  4FQT A;  2SAS A;  5FYX A;  1PAL A;  2KPH A;  1QX7 A;  1Y1X A;  2LNK A;  3FS7 A;  3OGN A;  3VRO A;  1SW8 A;  1QXP A;  3B6X A;  1J55 A;  1WDC B;  1SCM B;  1QVI Z;  2M1K B;  3D75 A;  5DKQ A;  1CLL A;  3S0E A;  1S1E A;  1SPY A;  3NSI A;  3CWG A;  1DJW A;  4PE7 A;  1QLS A;  1L7Z A;  2D8N A;  2Y4Q A;  2KAY A;  1BU3 A;  2KHN A;  3GK1 A;  1M39 A;  3O2P A;  3DVE A;  4IL1 A;  5D3O A;  4WQ3 A;  1J7Q A;  1KK8 B;  2BCA A;  2KYC A;  2L51 A;  3WXA A;  2PMY A;  3R1V A;  1FF1 A;  1EJ3 A;  2BKI B;  1BF5 A;  4F7F A;  3IQQ A;  4DIR A;  1KWO C;  2M1U A;  1YRU B;  5HKY A;  1P28 A;  5FI7 A;  1D1O A;  1KFU L;  2AUC A;  4C0J A;  1J7O A;  1EG4 A;  5D7F A;  2K7C A;  3GOF A;  2LUC A;  1KQM B;  2LMT A;  3KEV A;  3N7H A;  3PFV A;  2IS9 A;  3SS4 A;  1PRW A;  2OS8 C;  3TS5 B;  3BUW B;  2P70 A;  2JXL A;  2JUL A;  2I18 A;  3SG7 A;  1CLB A;  3CAB A;  3OB1 B;  2PVB A;  1BG1 A;  5CSF A;  5GQQ C;  1MHO A;  1CFC A;  2AMI A;  1IKU A;  5K89 A;  5AEQ A;  1SMG A;  1J1D A;  1MXE A;  1JF2 A;  3CDN A;  4GPL B;  2K8M B;  3L4A A;  1GM0 A;  1QVI Y;  1B9A A;  1B8R A;  2HQ8 A;  2LUX A;  1K90 D;  1UWO A;  1UUR A;  2P6B B;  2CBL A;  2M9G A;  3K1E A;  5G08 A;  2QEH A;  4ORB B;  3OP0 A;  1SL9 A;  3TUY B;  2L4H A;  4GNK B;  1BMO A;  1U5I B;  4YI9 A;  1WLZ A;  3BUX B;  2LMV A;  4GUK A;  4JWQ A;  3MSE B;  3SG2 A;  3R1P A;  3S0G A;  1QAT A;  1K8U A;  2ISD A;  5F6T A;  1MWN A;  3JTD B;  2ZRS A;  1DEL A;  3NHI A;  2A4J A;  4ETO A;  2PSR A;  1GQM A;  3D0Y B;  1DGV A;  3CZ0 A;  1XFV O;  3TS5 C;  2COL B;  4GGF A;  1A75 A;  3CS1 A;  4GFT A;  1IRJ A;  2I94 A;  3LL8 B;  2HF5 A;  4GGF C;  1F8H A;  3D73 A;  4XYN A;  4PHN A;  3DY9 A;  2LP2 A;  2M3W A;  3I5F B;  1NYA A;  1TRF A;  4ZCU A;  4BY4 A;  3D74 A;  2KI6 D;  3EG5 B;  4WQ2 A;  1NUB A;  2M97 A;  4M2P A;  1CDP A;  1W7J B;  1CLM A;  1PSB A;  1W7I B;  3DVK A;  2I2R E;  1QV0 A;  3FE8 A;  2GGZ A;  4PCW A;  3SG3 A;  2FJY A;  1FI5 A;  2KAX A;  4PHM A;  2KI6 C;  1EH2 A;  1S26 D;  2KOT A;  1UHJ A;  1M46 A;  1UHH A;  1ALV A;  1BOC A;  2I7A A;  1NP8 A;  2QEO A;  5J3X A;  2O5G A;  3DD4 A;  1S36 A;  4L9M A;  2FJU B;  1S5G Z;  2M49 B;  5HKW A;  3WHU B;  1OOI X;  2JPO A;  4MVF A;  1W9Z A;  2HQW A;  1AK8 A;  1B7T Y;  2PQL A;  4E68 A;  2BCB A;  1F71 A;  1DJZ A;  2QEV A;  1OZS A;  2K2F A;  1ZAC A;  1K96 A;  1BR1 B;  2LE9 B;  4MRY A;  4PHJ A;  1AUI B;  1B4C A;  1KK7 Y;  1DT7 B;  3DZT A;  4MN0 A;  1FPW A;  4YGC B;  2LMU A;  2K2A A;  1MUX A;  1KFX L;  2M7N A;  3UO9 A;  4NDB A;  1YUS A;  1ZMZ A;  2QAC A;  1CMF A;  2L0P A;  4CLN A;  1IWQ A;  2JT8 A;  1XK4 C;  2BAP A;  3BFH A;  3PN7 B;  2QEB A;  1CDL A;  1HT9 A;  5D69 A;  2HET A;  1SR6 B;  3K21 A;  4M2Q A;  1JUO A;  3VB1 A;  1YUT A;  4DCK A;  1KFU S;  5JJG A;  1CKK A;  1DJI A;  2L50 A;  3A8R A;  1DJG A;  1RRO A;  2WCJ A;  5DKN A;  1F70 A;  1C7V A;  3B88 A;  1N2D A;  1QX2 A;  1KFX S;  4XJK B;  5PAL A;  3TDI A;  2F2P A;  1S6I A;  1J7R A;  1SYM A;  2M8U A;  4JD9 A;  2HPS A;  4NDC A;  3B86 A;  1TWO A;  2KNE A;  1IJ5 A;  1K9P A;  1WRK A;  3ZWH A;  5I94 A;  2EHB A;  1RTP 1;  4IJ7 A;  3NXA A;  2JQ6 A;  2ERB A;  2WOR A;  1LA0 A;  2Q4U A;  2KDH A;  5HYD A;  1F54 A;  1AJ4 A;  2WND A;  4N5X A;  2PRU A;  2E6W A;  3TDU A;  1QIW A;  2L2E A;  4CFR A;  3A4U B;  3EVU A;  3H4S E;  3IQO A;  1KQM C;  1F4O A;  2GTE A;  2H2K A;  3I5H B;  5CSJ A;  4C0K A;  1DC1 A;  1OMR A;  2TN4 A;  1A03 A;  4GAO A;  1XA5 A;  4OVN F;  1JF0 A;  1ALW A;  4YI8 A;  1N0Y A;  5I2Q A;  2KAV A;  1M63 B;  1RFJ A;  2KQY A;  1LKJ A;  4YGA A;  3PN7 C;  1CNP A;  1PK0 D;  1SSE B;  1TN4 A;  2CCM A;  4OCI A;  1GJY A;  2BE4 A;  3KO0 A;  3SG5 A;  2LVJ A;  2MA2 A;  3RM1 A;  1YUU A;  2LLU A;  3TDZ A;  4OZD A;  1LS8 A;  1YX7 A;  1XFR A;  2L98 A;  1OZO A;  2Y5I A;  1IJ6 A;  1LVC D;  3M0W A;  4AOM A;  3AAK A;  3D10 A;  2ZFD A;  3NSK A;  1SBJ A;  1A29 A;  5BPJ A;  1XVJ A;  3PSR A;  3I5G C;  2H8V A;  4P2Y B;  4USL A;  2WCK A;  2MHH A;  1DQE A;  2ZN8 A;  3O78 A;  1A4P A;  4CID A;  1YVL A;  1F55 A;  2LVI A;  3R72 A;  2P71 A;  2Y1N A;  4ORC B;  1QLK A;  3OX5 A;  1RWY A;  2PYQ A;  1RJV A;  3JTD C;  4I5L B;  4PAL A;  2MJW B;  2R2I A;  3BJH A;  4MBE A;  1TNX A;  5FI2 A;  2JC2 A;  2WCL A;  2CXJ A;  3FWB A;  1CDN A;  3BXK A;  3WNX B;  2LLS A;  1B1G A;  4CFQ A;  1UHN A;  2JTZ A;  3AKA A;  5JOL A;  5I2O A;  5I2L A;  1C07 A;  2CTN A;  4YRU A;  2E30 A;  1IGV A;  2AAO A;  3I5F C;  1X02 A;  3F45 A;  2FCD A;  1SL8 A;  2V53 A;  1GGZ A;  1WRZ A;  3NSO A;  2BBM A;  3ICB A;  3QRX A;  1QTX A;  3C1V A;  1EG3 A;  3PM2 A;  4BY5 A;  3NGV A;  1ZOT B;  3VRR A;  4OR9 B;  1IQ3 A;  2WCE A;  1YR5 A;  3OB2 B;  1KCY A;  4PE1 A;  1S5G Y;  3CYZ A;  4QJ4 B;  3TZ1 A;  3CZT X;  1IH0 A;  4DS7 A;  4KYN A;  4QJ5 B;  2L4I A;  3EKH A;  3PAT A;  1G8I A;  1ZFS A;  2K7O A;  1EXR A;  1QAS A;  1TUJ A;  1S6J A;  4TNC A;  2KI4 C;  4N1F A;  5HLV A;  1CB1 A;  1S6C A;  2WC8 A;  1CM1 A;  2FOT A;  1OMV A;  2WCH A;  4MEW A;  2ZRT A;  4MZJ A;  1S3P A;  1DJX A;  3VRP A;  3SIA A;  2BL0 B;  2VRG A;  1OE9 B;  5KSZ A;  2OTG B;  5HL1 A;  1FI6 A;  2LCP A;  5TNC A;  1TNW A;  1A2X A;  2Y1M A;  2LVV A;  1WY9 A;  3BUO B;  4MZK A;  1PVA A;  2KFH A;  1QV1 A;  4FTG A;  3ZNI A;  1OQP A;  2LM5 A;  1AP4 A;  3CR2 A;  2B1U A;  2LHL A;  1B47 A;  1BLQ A;  3KHE A;  1EL4 A;  2KBM A;  1TTX A;  3L4L A;  1Y1A A;  3FIA A;  4INW A;  3EVV A;  1SR6 C;  2KLE A;  2JT3 A;  4YGB B;  1K93 D;  3RLZ A;  1JSA A;  3PLF B;  1TIZ A;  3S0F A;  4JQ0 D;  1UUS A;  2WOS A;  4U8D A;  3DVM A;  1LXF C;  1A75 B;  3D78 A;  5EL2 A;  2WC5 A;  2M7L A;  3VRN A;  1DGU A;  1BR4 B;  2F2O A;  2NCP A;  3I5I C;  1YUR A;  2JZI A;  1K95 A;  1JFK A;  1ODB A;  2KBI A;  5ER4 X;  1LA3 A;  4QJ3 B;  2L5Y A;  4JKT A;  3SG4 A;  2KQ6 A;  2MAZ A;  2PAS A;  3B87 A;  3EKJ A;  5KU1 A;  1OOF A;  2JXC A;  3BFA A;  3PM8 A;  4GBA A;  1DJY A;  1NSH A;  1XFU O;  1M45 A;  1TNP A;  1XFY O;  5DIC A;  1Y1U A;  3IF7 A;  2L5X B;  1JFJ A;  2GV5 A;  5AER A;  1GGW A;  2WCM A;  1YX8 A;  2MLF C;  1FBV A;  1IG5 A;  3I5H C;  4Q04 A;  4A4B A;  4YBH B;  1QS7 A;  4HRH A;  3KPX A;  2NCO A;  3CR4 X;  4OV2 A;  1XO5 A;  3SS3 A;  1TUZ A;  3O4X A;  4R1E A;  3BUN B;  1SK6 D;  1JWD A;  4UPG A;  4NDD A;  5I8N A;  1NX0 A;  2LAP A;  4MZL A;  3WHT B;  1OMD A;  1NCZ A;  4PT1 A;  2CT9 A;  1LIN A;  2JT0 A;  4GGN A;  1YRT B;  2H61 C;  2M0R A;  3RZS A;  1XK4 A;  1M31 A;  1PUL A;  3DYE A;  2F33 A;  3V2L A;  1UHI A;  2LAN A;  3LLE A;  2G9B A;  3EVR A;  4N1G A;  4DUQ A;  3VGO A;  2LHI A;  4JPZ B;  1OOG A;  1REC A;  4YGE B;  1OOJ A;  3S0A A;  2JNX A;  4PHK A;  4MSP A;  1H8B A;  1KSO A;  1MR8 A;  1B8C A;  2ZND A;  3I5G B;  4I5J A;  3AAJ A;  2PAL A;  4HRG A;  3PJI A;  1DEK A;  2BBN A;  2KGR A;  1SKT A;  4OKH A;  3SS5 A;  2NXQ A;  2K0J A;  2KYF A;  3CTN A;  3SIB A;  1K2H A;  2BNX A;  2KFG A;  2EC6 B;  4PDZ A;  1B8L A;  4ZCV A;  3BOW B;  2JOJ A;  4MLW A;  4AQI A;  1QJT A;  1SY9 A;  2NLN A;  1NCX A;  2JTT A;  3R1O A;  1Y6W A;  1K9K A;  2MLE C;  4PE0 A;  3CZ1 A;  3HX4 A;  3LCP C;  3OHM B;  2WC6 A;  1UHK A;  1H4B A;  1DVI A;  2CNP A;  3LK1 A;  2F8P A;  2QDI A;  5AFP A;  1G4Y R;  3KF9 A;  3QME A;  2JU0 A;  2GGM A;  2M29 A;  1C3Y A;  1IIO A;  1XFZ O;  1L2O B;  2LP3 A;  3B7A A;  3DF0 B;  2LLT A;  3PAL A;  1ZUZ A;  3AKB A;  5DKR A;  3S0D A;  2O60 A;  1F4Q A;  1BT6 A;  2LVK A;  1HQV A;  3D77 A;  1OSA A;  2MRD A;  3LK0 A;  5CPV A;  1KQV A;  1DTL A;  2K7D A;  4WRI A;  2FCE A;  1QWV A;  4PE4 A;  2NZ0 A;  1CTR A;  1AVS A;  2QPT A;  1YVH A;  1ORG A;  5B8I B;  1CDM A;  1CFD A;  2KI4 B;  1NCY A;  2Q91 A;  5CSN A;  1DF0 B;  5ER5 A;  4MRX A;  4YGD B;  3CLN A;  1J1E A;  1NWD A;  1TCF A;  1IQ5 A;  2EC6 C;  1MF8 B;  3BYA A;  2WCF A;  3JVT C;  1BJF A;  1Z2C B;  2BL0 C;  1SNL A;  2OTG C;  1QX5 B;  3S0B A;  1Q80 A;  2K61 A;  1V1G A;  2JPT A;  1XFW O;  4XJK A;  1MXL C;  1DF0 A;  2F3Y A;  1C7W A;  2KFF A;  3O4Y A;  1VRK A;  1CFF A;  1RK9 A;  1QIV A;  1L2O C;  1NPQ A;  3OBV A;  2JRF A;  3TUY C;  3BUM B;  3HCM A;  1CMG A;  4ORA B;  4HRE E;  2KLD A;  5CSI A;  2G2B A;  1OOH A;  1R2U A;  4A4C A;  2L2C A;  3I5I B;  2EGD A;  1SL7 A;  1AJ5 A;  1DJH A;  1YTZ C;  1J7P A;  2BEC A;  5FI6 A;  1C3Z A;  4P5O E;  1PVB A;  3EK7 A;  3EK4 A;  1NIW A;  1E8A A;  2OPO A;  1TCO B;  1WRL A;  1B7T Z;  5HLO A;  3BQ3 A;  3FE6 A;  1OW4 A;  4HSZ A;  4C0L A;  3DXL A;  1FW4 A;  1WLM A;  3NHT A;  2DOQ A;  1G33 A;  2SCP A;  3SG6 A;  2LV7 A;  1DMO A;  3DF0 A;  3FWC A;  4CPV A;  3L47 A;  1NX3 A;  1U5I A;  3JVT B;  1XYD A;  1K9U A;  1TNQ A;  1WDC C;  3CZ2 A;  3UNW A;  1SCM C;  3DVJ A;  5IBW A;  3EK8 A;  4D1E A;  3BOW A;  2BKH B;  1Z4H A;  4INX A;  2KSP A;  1K94 A;  1UP5 A;  2RGI A;  2MBX A;  1N65 A;  1CFP A;  1T14 A;  3E3R A;  3FE9 A;  3Q8I A;  3IVT A;  1R6P A;  1BOD A;  2K60 A;  4FQO A;  2LC5 A;  2WCB A;  1KK8 C;  3GK4 X;  3CGA A;  4AQJ A;  1XFX O;  4DRW A;  3BFB A;  1TOP A;  3OX6 A;  4F0Z B;  1AHR A;  2ZKM X;  4ICB A;  2F3Z A;  1KWO B;  1MQ1 A;  4M2O A;  5KTY A;  3GK2 A;  2BCX A;  1JC2 A;  1CM4 A;  1JBA A;  3NSL A;  2KGB C;  2YGU A;  1SRA A;  5AXI A;  1V1F A;  5HKZ A;  2ZN9 A;  4I5K A;  1Y0V H;  1SCV A;  1KSM A;  3CR5 X;  2BE6 A;  3VRQ A;  3D0Y A;  2H61 A;  3D76 A;  2OS8 B;  3SJS A;  1NX1 A;  3O6B A;  1NX2 A;  2JWW A;  2ZNE A;  1PSR A; 
#chains in the Genus database with same CATH homology
 2K7B A;  4NQG A;  5AAN A;  1KK7 Z;  2JNF A;  4I5N B;  5FYX A;  2SAS A;  1PAL A;  1QX7 A;  1Y1X A;  2LNK A;  3FS7 A;  3VRO A;  1SW8 A;  1QXP A;  1J55 A;  1WDC B;  1SCM B;  1QVI Z;  2M1K B;  5DKQ A;  1CLL A;  1S1E A;  1SPY A;  3NSI A;  3CWG A;  1DJW A;  4PE7 A;  1QLS A;  1L7Z A;  2D8N A;  2Y4Q A;  2KAY A;  1BU3 A;  2KHN A;  3GK1 A;  1M39 A;  3O2P A;  3DVE A;  4IL1 A;  4WQ3 A;  1J7Q A;  1KK8 B;  2BCA A;  2KYC A;  2L51 A;  3WXA A;  2PMY A;  1FF1 A;  1EJ3 A;  2BKI B;  1BF5 A;  3IQQ A;  4DIR A;  1KWO C;  2M1U A;  1YRU B;  5HKY A;  1D1O A;  1KFU L;  2AUC A;  4C0J A;  1J7O A;  1EG4 A;  5D7F A;  2K7C A;  3GOF A;  2LUC A;  1KQM B;  2LMT A;  3KEV A;  3PFV A;  2IS9 A;  1PRW A;  2OS8 C;  3TS5 B;  3BUW B;  2JXL A;  2JUL A;  2I18 A;  3SG7 A;  1CLB A;  3OB1 B;  1BG1 A;  2PVB A;  5CSF A;  5GQQ C;  1MHO A;  1CFC A;  2AMI A;  1IKU A;  5K89 A;  5AEQ A;  1SMG A;  1J1D A;  1MXE A;  1JF2 A;  4GPL B;  2K8M B;  1QVI Y;  1B9A A;  1B8R A;  2HQ8 A;  2LUX A;  1K90 D;  1UWO A;  1UUR A;  2P6B B;  2CBL A;  2M9G A;  5G08 A;  4ORB B;  3OP0 A;  1SL9 A;  3TUY B;  2L4H A;  4GNK B;  1BMO A;  1U5I B;  4YI9 A;  1WLZ A;  3BUX B;  2LMV A;  4GUK A;  4JWQ A;  3MSE B;  3SG2 A;  1QAT A;  1K8U A;  2ISD A;  5F6T A;  1MWN A;  3JTD B;  2ZRS A;  4ETO A;  2A4J A;  2PSR A;  1GQM A;  3D0Y B;  1DGV A;  1XFV O;  3TS5 C;  2COL B;  4GGF A;  1A75 A;  3CS1 A;  4GFT A;  1IRJ A;  2I94 A;  3LL8 B;  2HF5 A;  4GGF C;  1F8H A;  4XYN A;  4PHN A;  2LP2 A;  2M3W A;  3I5F B;  1NYA A;  1TRF A;  4ZCU A;  4BY4 A;  2KI6 D;  4WQ2 A;  1NUB A;  2M97 A;  4M2P A;  1CDP A;  1W7J B;  1CLM A;  1PSB A;  1W7I B;  3DVK A;  2I2R E;  1QV0 A;  1FI5 A;  2GGZ A;  4PCW A;  3SG3 A;  2KAX A;  4PHM A;  2KI6 C;  1EH2 A;  1S26 D;  2KOT A;  1UHJ A;  1M46 A;  1UHH A;  1ALV A;  1BOC A;  2I7A A;  1NP8 A;  5J3X A;  2O5G A;  3DD4 A;  1S36 A;  4L9M A;  2FJU B;  1S5G Z;  2M49 B;  5HKW A;  3WHU B;  1AK8 A;  4MVF A;  2HQW A;  1B7T Y;  4E68 A;  2BCB A;  1F71 A;  1DJZ A;  1OZS A;  2K2F A;  1ZAC A;  1K96 A;  1BR1 B;  2LE9 B;  4MRY A;  4PHJ A;  1AUI B;  1B4C A;  1KK7 Y;  1DT7 B;  4MN0 A;  1FPW A;  4YGC B;  2LMU A;  2K2A A;  1MUX A;  1KFX L;  2M7N A;  4NDB A;  1YUS A;  1ZMZ A;  2QAC A;  1CMF A;  2L0P A;  4CLN A;  1IWQ A;  2JT8 A;  1XK4 C;  3PN7 B;  1CDL A;  1HT9 A;  5D69 A;  2HET A;  1SR6 B;  3K21 A;  4M2Q A;  1JUO A;  4DCK A;  1YUT A;  1KFU S;  5JJG A;  1CKK A;  1DJI A;  2L50 A;  3A8R A;  1DJG A;  1RRO A;  5DKN A;  1F70 A;  1C7V A;  1N2D A;  1QX2 A;  1KFX S;  4XJK B;  5PAL A;  3TDI A;  2F2P A;  1S6I A;  1J7R A;  1SYM A;  2M8U A;  4NDC A;  2HPS A;  2KNE A;  1IJ5 A;  1K9P A;  1WRK A;  3ZWH A;  2EHB A;  1RTP 1;  3NXA A;  2JQ6 A;  2WOR A;  1LA0 A;  2Q4U A;  2KDH A;  5HYD A;  1F54 A;  1AJ4 A;  2WND A;  4N5X A;  2PRU A;  2E6W A;  3TDU A;  1QIW A;  2L2E A;  4CFR A;  3A4U B;  3EVU A;  3H4S E;  3IQO A;  1KQM C;  1F4O A;  2H2K A;  3I5H B;  4C0K A;  5CSJ A;  1OMR A;  2TN4 A;  1A03 A;  4GAO A;  1XA5 A;  4OVN F;  1JF0 A;  1ALW A;  4YI8 A;  1N0Y A;  5I2Q A;  2KAV A;  1M63 B;  1RFJ A;  2KQY A;  1LKJ A;  4YGA A;  3PN7 C;  1CNP A;  1PK0 D;  1TN4 A;  2CCM A;  4OCI A;  1GJY A;  2BE4 A;  3KO0 A;  3SG5 A;  2LVJ A;  2MA2 A;  3RM1 A;  1YUU A;  2LLU A;  3TDZ A;  1YX7 A;  2L98 A;  1OZO A;  2Y5I A;  1IJ6 A;  1LVC D;  3M0W A;  4AOM A;  3AAK A;  3D10 A;  2ZFD A;  3NSK A;  1SBJ A;  1A29 A;  5BPJ A;  1XVJ A;  3PSR A;  3I5G C;  4P2Y B;  4USL A;  2MHH A;  2ZN8 A;  3O78 A;  1A4P A;  4CID A;  1YVL A;  1F55 A;  2LVI A;  2Y1N A;  4ORC B;  1QLK A;  3OX5 A;  1RWY A;  3JTD C;  1RJV A;  4I5L B;  4PAL A;  2MJW B;  2R2I A;  4MBE A;  1TNX A;  2JC2 A;  2CXJ A;  3FWB A;  1CDN A;  3BXK A;  3WNX B;  2LLS A;  1B1G A;  4CFQ A;  1UHN A;  2JTZ A;  3AKA A;  5JOL A;  5I2O A;  5I2L A;  1C07 A;  2CTN A;  4YRU A;  2E30 A;  1IGV A;  2AAO A;  3I5F C;  1X02 A;  3F45 A;  2FCD A;  1SL8 A;  2V53 A;  1GGZ A;  1WRZ A;  3NSO A;  2BBM A;  3ICB A;  3QRX A;  1QTX A;  3C1V A;  1EG3 A;  4BY5 A;  1ZOT B;  3VRR A;  4OR9 B;  1IQ3 A;  2WCE A;  1YR5 A;  3OB2 B;  1KCY A;  4PE1 A;  1S5G Y;  4QJ4 B;  3TZ1 A;  3CZT X;  1IH0 A;  4DS7 A;  4QJ5 B;  2L4I A;  3EKH A;  3PAT A;  1G8I A;  1ZFS A;  2K7O A;  1EXR A;  1QAS A;  1S6J A;  4TNC A;  2KI4 C;  4N1F A;  5HLV A;  1CB1 A;  1S6C A;  2WC8 A;  1CM1 A;  2FOT A;  1OMV A;  4MEW A;  2ZRT A;  4MZJ A;  1S3P A;  1DJX A;  3VRP A;  3SIA A;  2BL0 B;  2VRG A;  1OE9 B;  5KSZ A;  2OTG B;  1FI6 A;  2LCP A;  5TNC A;  1TNW A;  1A2X A;  2Y1M A;  2LVV A;  1WY9 A;  3BUO B;  4MZK A;  1PVA A;  2KFH A;  1QV1 A;  4FTG A;  3ZNI A;  1OQP A;  2LM5 A;  1AP4 A;  3CR2 A;  2B1U A;  2LHL A;  1B47 A;  1BLQ A;  3KHE A;  1EL4 A;  2KBM A;  1TTX A;  1Y1A A;  3FIA A;  4YGB B;  3EVV A;  1SR6 C;  3RLZ A;  2JT3 A;  1JSA A;  1K93 D;  3PLF B;  1TIZ A;  4JQ0 D;  1UUS A;  2WOS A;  4U8D A;  3DVM A;  1LXF C;  1A75 B;  3VRN A;  2M7L A;  1DGU A;  1BR4 B;  2F2O A;  2NCP A;  3I5I C;  1YUR A;  2JZI A;  1K95 A;  1JFK A;  1ODB A;  2KBI A;  5ER4 X;  1LA3 A;  4QJ3 B;  3SG4 A;  2KQ6 A;  2MAZ A;  2PAS A;  3EKJ A;  5KU1 A;  2JXC A;  3PM8 A;  4GBA A;  1DJY A;  1NSH A;  1XFU O;  1M45 A;  1TNP A;  1XFY O;  1Y1U A;  3IF7 A;  2L5X B;  1JFJ A;  2GV5 A;  5AER A;  1GGW A;  1YX8 A;  2MLF C;  1FBV A;  1IG5 A;  3I5H C;  4Q04 A;  4A4B A;  4YBH B;  1QS7 A;  4HRH A;  3KPX A;  2NCO A;  3CR4 X;  4OV2 A;  1XO5 A;  4R1E A;  3BUN B;  1SK6 D;  1JWD A;  4UPG A;  4NDD A;  5I8N A;  1NX0 A;  2LAP A;  4MZL A;  3WHT B;  1OMD A;  1NCZ A;  2CT9 A;  1LIN A;  2JT0 A;  4GGN A;  1YRT B;  2H61 C;  2M0R A;  1XK4 A;  1M31 A;  1PUL A;  2F33 A;  1UHI A;  2LAN A;  3LLE A;  2G9B A;  3EVR A;  4N1G A;  4DUQ A;  3VGO A;  2LHI A;  4JPZ B;  1REC A;  4YGE B;  1OOJ A;  2JNX A;  4PHK A;  4MSP A;  1H8B A;  1KSO A;  1MR8 A;  1B8C A;  2ZND A;  3I5G B;  4I5J A;  3AAJ A;  2PAL A;  4HRG A;  2BBN A;  2KGR A;  1SKT A;  4OKH A;  2NXQ A;  2K0J A;  2KYF A;  3CTN A;  3SIB A;  1K2H A;  2KFG A;  2EC6 B;  4PDZ A;  1B8L A;  4ZCV A;  3BOW B;  2JOJ A;  4MLW A;  4AQI A;  1QJT A;  1SY9 A;  2NLN A;  1NCX A;  2JTT A;  1Y6W A;  1K9K A;  2MLE C;  4PE0 A;  3HX4 A;  3LCP C;  3OHM B;  1UHK A;  1H4B A;  1DVI A;  2CNP A;  3LK1 A;  2F8P A;  5AFP A;  1G4Y R;  3KF9 A;  2JU0 A;  2GGM A;  2M29 A;  1XFZ O;  1L2O B;  2LP3 A;  3DF0 B;  2LLT A;  3PAL A;  1ZUZ A;  3AKB A;  5DKR A;  2O60 A;  1F4Q A;  1BT6 A;  2LVK A;  1HQV A;  1OSA A;  2MRD A;  3LK0 A;  5CPV A;  1KQV A;  1DTL A;  2K7D A;  4WRI A;  2FCE A;  4PE4 A;  2NZ0 A;  1CTR A;  1AVS A;  2QPT A;  1YVH A;  5B8I B;  1CDM A;  1CFD A;  2KI4 B;  1NCY A;  2Q91 A;  5CSN A;  1DF0 B;  5ER5 A;  4MRX A;  4YGD B;  3CLN A;  1J1E A;  1NWD A;  1TCF A;  1IQ5 A;  2EC6 C;  1MF8 B;  3BYA A;  2WCF A;  3JVT C;  1BJF A;  2BL0 C;  1SNL A;  2OTG C;  1QX5 B;  1Q80 A;  2K61 A;  1V1G A;  2JPT A;  1XFW O;  4XJK A;  1MXL C;  1DF0 A;  2F3Y A;  1C7W A;  2KFF A;  3O4Y A;  1VRK A;  1CFF A;  1RK9 A;  1QIV A;  1L2O C;  1NPQ A;  2JRF A;  3TUY C;  3BUM B;  3HCM A;  1CMG A;  4ORA B;  4HRE E;  5CSI A;  2G2B A;  4A4C A;  1R2U A;  3I5I B;  2EGD A;  1SL7 A;  1AJ5 A;  1DJH A;  1YTZ C;  1J7P A;  2BEC A;  4P5O E;  1PVB A;  3EK7 A;  3EK4 A;  1NIW A;  1E8A A;  2OPO A;  1TCO B;  1WRL A;  1B7T Z;  5HLO A;  3BQ3 A;  4HSZ A;  4C0L A;  1FW4 A;  1WLM A;  2DOQ A;  1G33 A;  2SCP A;  3SG6 A;  2LV7 A;  1DMO A;  3DF0 A;  3FWC A;  4CPV A;  1NX3 A;  1U5I A;  3JVT B;  1XYD A;  1K9U A;  1TNQ A;  1WDC C;  1SCM C;  3DVJ A;  5IBW A;  3EK8 A;  4D1E A;  3BOW A;  2BKH B;  2KSP A;  1K94 A;  1UP5 A;  2RGI A;  2MBX A;  1N65 A;  1CFP A;  3E3R A;  1BOD A;  1R6P A;  4FQO A;  2LC5 A;  2WCB A;  1KK8 C;  3GK4 X;  3CGA A;  4AQJ A;  1XFX O;  4DRW A;  1TOP A;  3OX6 A;  4F0Z B;  1AHR A;  2ZKM X;  4ICB A;  2F3Z A;  1KWO B;  1MQ1 A;  4M2O A;  5KTY A;  3GK2 A;  2BCX A;  1JC2 A;  1CM4 A;  1JBA A;  3NSL A;  2KGB C;  1SRA A;  5AXI A;  1V1F A;  5HKZ A;  2ZN9 A;  4I5K A;  1Y0V H;  1SCV A;  1KSM A;  3CR5 X;  2BE6 A;  3VRQ A;  3D0Y A;  2H61 A;  2OS8 B;  3SJS A;  1NX1 A;  3O6B A;  1NX2 A;  2JWW A;  2ZNE A;  1PSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...