1XK4C

Crystal structure of human calprotectin(s100a8/s100a9)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
KMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calgranulin A
publication title The crystal structure of the human (S100A8/S100A9)2 heterotetramer, calprotectin, illustrates how conformational changes of interacting alpha-helices can determine specific association of two EF-hand proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 34
structure length 89
sequence length 89
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2004-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xk4C00
2JTZA 3F45A 5DKNA 1J55A 2NCPA 1B47A 2LVIA 5DKQA 1V1GA 1CTRA 1MF8B 2M29A 1DGUA 3DF0B 1G4YR 1Y1XA 3D0YA 3I5IC 4GGFC 4DS7A 4QJ3B 4D1EA 1JFJA 5HLVA 2KHNA 1G8IA 4PHNA 1QIWA 1YX8A 2SCPA 1YVLA 1A2XA 1CFDA 3GK4X 1C7VA 1QLSA 2BKIB 2FOTA 3ZWHA 1ALVA 3KPXA 2MLFC 1A75A 3SG6A 1Y1AA 3O2PA 1GJYA 4MRYA 2O60A 1B8LA 2WORA 2M49B 1A03A 2AAOA 1MXEA 2KDHA 4HSZA 2LLTA 1XFVO 5KU1A 1FI5A 2F33A 2B1UA 2KFGA 3PALA 2L51A 4I5NB 2ZRSA 2LP2A 5IBWA 1QASA 4Q04A 5AEQA 3CS1A 3JTDB 4CIDA 3WNXB 1K8UA 1J1EA 3D0YB 1WLMA 3DVJA 2JT3A 4N5XA 3C1VA 2I18A 2K2AA 5AXIA 3CGAA 3KO0A 3RM1A 2Y1NA 2HQ8A 1RJVA 5CSIA 1NX2A 2LLUA 4MSPA 2KFHA 1YVHA 2LHIA 1DJXA 1A75B 4M2PA 1MXLC 1WDCB 4L9MA 3SG4A 1S5GY 2K61A 4ORBB 2MJWB 1IWQA 2MHHA 3HX4A 1SL9A 1TRFA 2KQYA 1PULA 4OKHA 2L50A 2KBMA 2ZRTA 3WXAA 1DJWA 3H4SE 1FI6A 4XJKA 1DVIA 1KQMC 1SCMC 2P6BB 1AVSA 1R6PA 1TN4A 1BMOA 2K7BA 4R1EA 1XO5A 3SJSA 3TUYB 1CLBA 3DVMA 4MZKA 3JTDC 5CSJA 1F54A 4M2OA 3I5HB 4AQIA 1NCXA 2NCOA 1CDPA 3I5FC 3NSOA 3NSLA 2M7LA 1IGVA 3IF7A 1M63B 1XFWO 3OHMB 1CB1A 2KQ6A 3PM8A 4PALA 1IJ5A 2ZN9A 2KGRA 1KCYA 1IQ5A 1M45A 1WDCC 3LLEA 2HETA 4CPVA 4DIRA 1WY9A 2WC8A 3OB1B 1BR1B 3RLZA 4HRHA 1KWOC 1ZACA 2LVJA 1MHOA 1DT7B 1ZOTB 4HRGA 4HREE 1UHHA 3LCPC 4OCIA 1TCFA 2PALA 5CSFA 4BY4A 5TNCA 1QATA 1ZMZA 2V53A 3FIAA 2MAZA 1OQPA 3CR2A 2LV7A 1XYDA 3DF0A 5J3XA 4PHJA 1IRJA 2AUCA 2SASA 3EVUA 2JU0A 3PN7C 1QJTA 1JUOA 5I8NA 1OMVA 1S26D 3DD4A 1K95A 1NCZA 1OZSA 1YRUB 2LM5A 4CFQA 2L4HA 2D8NA 2K7OA 4NDBA 1A4PA 1CFFA 1BR4B 1YRTB 2LUCA 3NSIA 3TDZA 3TS5B 4GAOA 2Y1MA 4GUKA 2JULA 1SYMA 1L2OB 2BCAA 1GQMA 2AMIA 1WRLA 2EC6C 3NSKA 3OX6A 5HLOA 2BCBA 4XYNA 2LMUA 5F6TA 1L7ZA 1CFPA 2LVKA 4PE7A 4OV2A 1X02A 2A4JA 1NWDA 2OTGB 3FWBA 3TZ1A 4IL1A 1EH2A 2JNXA 1AJ5A 1KK8C 1S5GZ 3EKHA 1D1OA 1J7QA 2F3ZA 2F3YA 3JVTB 3LL8B 4NQGA 1FPWA 1JWDA 2BKHB 3SG2A 1Q80A 1FBVA 1DMOA 3SG7A 4NDDA 1FW4A 1UHNA 2KI4C 3A8RA 3KF9A 1CFCA 1SR6B 3FWCA 1CMGA 5JOLA 2EGDA 1B7TY 1W7JB 2FCDA 3K21A 1IKUA 2M0RA 1WRZA 4I5KA 3MSEB 3BQ3A 1H8BA 1CMFA 4OVNF 1MR8A 1AJ4A 1BT6A 1M46A 1UHJA 1XK4A 3AAJA 1TNXA 1DGVA 1SMGA 1U5IA 2CBLA 2I7AA 3BUWB 1JSAA 4BY5A 1AP4A 2HQWA 2IS9A 2JXLA 1V1FA 2H61A 1KFXL 2O5GA 5K89A 5AERA 5I2OA 2WNDA 1JF0A 1DTLA 3AAKA 1SK6D 2WCFA 3TDIA 1PVBA 1NX3A 1XVJA 4QJ5B 1EXRA 2BE4A 2L2EA 1SPYA 2MRDA 4A4CA 4GPLB 2BL0B 1NX0A 2E30A 2LCPA 4AOMA 1BJFA 1J7PA 1YUUA 2WCEA 2F2OA 4DUQA 1QV1A 1VRKA 2JNFA 3I5GB 2Y4QA 1TNWA 3E3RA 4MRXA 2KI6C 4F0ZB 1S36A 4YGCB 3WHUB 1UHKA 1LA0A 3GOFA 4PHMA 2HF5A 1FF1A 5PALA 4C0KA 3EK4A 1A29A 1F55A 1SW8A 3A4UB 2ZFDA 3BUMB 1JBAA 4PDZA 1U5IB 5BPJA 1OMDA 1EG3A 5G08A 1RFJA 1TNQA 1TCOB 2KOTA 1RK9A 2LNKA 1C07A 1KFUL 5DKRA 1F8HA 1K93D 2NLNA 4JQ0D 1N0YA 1Y6WA 1QVIY 1XFUO 1RROA 4AQJA 4JPZB 3PLFB 5B8IB 1IH0A 1S6IA 2CTNA 3WHTB 1B8RA 1EL4A 1PVAA 1QTXA 2JQ6A 2L5XB 1CLLA 3LK1A 4P5OE 1TOPA 1EJ3A 2LLSA 2H2KA 1W7IB 1G33A 3NXAA 5AANA 1S3PA 4MZJA 5FYXA 3O78A 2F8PA 3VGOA 1KK7Y 4YGEB 2WCBA 3AKBA 3CR5X 1OOJA 5D7FA 1SCVA 4PE4A 2JT0A 2FCEA 3CZTX 5ER5A 1XK4C 2JRFA 1GGZA 4CLNA 2K8MB 1N65A 1WLZA 4I5JA 3TUYC 2H61C 5HKWA 1DF0A 4E68A 3CR4X 1S6JA 2BECA 2JTTA 2OS8B 2KI6D 2CNPA 3I5HC 4PHKA 1OZOA 1B7TZ 1QXPA 1BF5A 1IG5A 1E8AA 3CLNA 1UWOA 4P2YB 4C0JA 3O4YA 1K90D 1YUTA 1H4BA 1K9PA 1QX7A 3D10A 2QPTA 4NDCA 4QJ4B 2I94A 2M3WA 3PATA 3HCMA 2M9GA 2CXJA 4C0LA 1YURA 1XFYO 1CDLA 3BUXB 1K96A 3SIBA 1RTP1 2EHBA 3CTNA 1SKTA 3I5IB 1QLKA 4M2QA 1UP5A 2L0PA 2E6WA 1DF0B 1QS7A 4GNKB 3SIAA 2DOQA 3GK2A 1DJGA 5I2QA 4FQOA 2FJUB 1LKJA 2Y5IA 4YGDB 5HKYA 2ZKMX 3VROA 1IJ6A 1NIWA 2LVVA 1J1DA 2KNEA 4TNCA 3VRPA 1LXFC 1F4OA 1K9KA 4ICBA 1K9UA 2JT8A 1YX7A 2LANA 2LHLA 1CLMA 1DJHA 5KTYA 1SNLA 3EK7A 4ZCVA 1BOCA 1K2HA 1MQ1A 3BOWA 1BG1A 1CNPA 2COLB 1DJZA 3EKJA 2KAVA 4GFTA 3TS5C 2F2PA 3BUOB 3EVVA 4DCKA 2L98A 2OPOA 2MLEC 1L2OC 5HYDA 1QVIZ 3DVEA 5D69A 2RGIA 1M31A 3VRQA 2ZNEA 4DRWA 1F71A 3EK8A 1NPQA 2JWWA 1ZFSA 1PSBA 1CM1A 2OTGC 3DVKA 2VRGA 1YUSA 4MEWA 1PSRA 4PE0A 4N1GA 1Y0VH 1S1EA 2ISDA 3JVTC 1SBJA 4YI9A 5HKZA 1LVCD 1KK7Z 4I5LB 1CDNA 1F70A 1DJIA 3GK1A 1KFXS 1SR6C 3BOWB 2Q4UA 1MUXA 1PK0D 1KSOA 1ALWA 1SRAA 1KQMB 1F4QA 1SCMB 3OB2B 4CFRA 2K2FA 3IQQA 1TIZA 1QIVA 4OR9B 3LK0A 2WOSA 1MWNA 4WQ3A 1HQVA 2LE9B 2M8UA 2KGBC 2K7DA 1J7RA 3I5FB 1KSMA 2PMYA 1QV0A 1PALA 1UURA 3KHEA 2MBXA 3EVRA 3AKAA 4YI8A 1BU3A 1JF2A 2KSPA 4GGNA 3O6BA 1UHIA 1NUBA 1Y1UA 5AFPA 1RECA 1AUIB 4USLA 2NXQA 1S6CA 2BCXA 1KWOB 1KFUS 1GGWA 1LA3A 1TTXA 2BL0C 2M1UA 1NCYA 3BUNB 2CCMA 4PE1A 4ORAB 1NYAA 1C7WA 3I5GC 2LC5A 2I2RE 1B1GA 1B4CA 1XA5A 4YGBB 2G2BA 1OSAA 3SG5A 1SY9A 2BE6A 1CKKA 3IQOA 4YRUA 3PSRA 2KFFA 1OMRA 1BLQA 4GGFA 2LAPA 5I2LA 4ZCUA 2ZNDA 3BYAA 3ZNIA 2K0JA 2KYFA 1XFXO 2R2IA 2ZN8A 4PCWA 1YTZC 3PN7B 1YR5A 2KAYA 2LUXA 3FS7A 1QX5B 1NX1A 4JWQA 1RWYA 1TNPA 3BXKA 5JJGA 2GGZA 1SL7A 2GV5A 3M0WA 5GQQC 1M39A 1J7OA 1CDMA 2LP3A 5ER4X 3KEVA 4FTGA 4MN0A 4UPGA 1OE9B 1LINA 3CWGA 2CT9A 2EC6B 3OX5A 1IQ3A 3QRXA 4MZLA 4YBHB 4A4BA 2KBIA 1EG4A 1R2UA 1SL8A 2PRUA 4XJKB 5CPVA 2M1KB 3SG3A 3TDUA 2K7CA 4MVFA 5KSZA 4GBAA 2JZIA 2LMVA 2QACA 4ORCB 4N1FA 1HT9A 2Q91A 4MLWA 1NSHA 1UUSA 1XFZO 3ICBA 1B9AA 2GGMA 2PSRA 4WRIA 1ODBA 1KK8B 2HPSA 4WQ2A 2NZ0A 2JXCA 1ZUZA 2KI4B 2OS8C 1N2DA 2L4IA 4U8DA 3OP0A 2BBNA 1NP8A 2JC2A 2KAXA 3VRRA 2KYCA 4YGAA 1B8CA 1BODA 1WRKA 2BBMA 1CM4A 2TN4A 2M97A 3VRNA 1JFKA 5CSNA 2PVBA 2PASA 4ETOA 2G9BA 2MA2A 1QX2A 2LMTA 4MBEA 1K94A 1AK8A 2JPTA 1KQVA 1PRWA 3PFVA 1DJYA 2JOJA 1AHRA 1JC2A 2M7NA
chains in the Genus database with same CATH superfamily
2JTZA 2WCKA 3F45A 5DKNA 1J55A 2NCPA 1B47A 2LVIA 3B87A 3DZTA 5DKQA 2P70A 1V1GA 1CTRA 1MF8B 2M29A 3BFHA 1DGUA 3DF0B 1G4YR 1Y1XA 3D0YA 3I5IC 4GGFC 4DS7A 4QJ3B 4D1EA 2WCLA 5FI6A 5HLVA 1JFJA 2KHNA 1DELA 1G8IA 1OW4A 4PHNA 1QIWA 1YX8A 2SCPA 1YVLA 1A2XA 1CFDA 2K60A 3GK4X 1C7VA 1QLSA 2BKIB 2FOTA 3ZWHA 1ALVA 3KPXA 2MLFC 1A75A 3SG6A 2YGUA 1Y1AA 3O2PA 1GJYA 4MRYA 3PJIA 2O60A 1B8LA 1Z4HA 2M49B 2WORA 1A03A 2AAOA 1MXEA 2KDHA 3FE8A 4HSZA 2LLTA 1XFVO 5KU1A 1FI5A 2F33A 2B1UA 2KFGA 3PALA 2L51A 4I5NB 2ZRSA 3NGVA 2LP2A 5IBWA 1QASA 4INXA 4Q04A 3CZ0A 5AEQA 3CS1A 3JTDB 4CIDA 3WNXB 1K8UA 1J1EA 3D0YB 1WLMA 3DVJA 2JT3A 4N5XA 3C1VA 2I18A 2K2AA 5AXIA 3CGAA 3KO0A 3RM1A 2Y1NA 2HQ8A 1RJVA 5CSIA 1NX2A 2LLUA 4MSPA 5I94A 2KFHA 1YVHA 2LHIA 1DJXA 1A75B 4M2PA 1MXLC 1WDCB 4L9MA 3SG4A 1S5GY 2K61A 4ORBB 2MJWB 1IWQA 2MHHA 3HX4A 1SL9A 1TRFA 2KQYA 1PULA 1IIOA 4OKHA 2L50A 3K1EA 2KBMA 2ZRTA 3WXAA 1DJWA 3H4SE 1FI6A 4XJKA 3R1VA 1DVIA 1KQMC 1SCMC 2BAPA 2P6BB 1AVSA 1DC1A 1R6PA 1TN4A 1BMOA 2K7BA 4R1EA 1XO5A 3SJSA 3TUYB 1CLBA 3DVMA 4MZKA 1P28A 3JTDC 5CSJA 1F54A 4M2OA 3I5HB 1LS8A 1NCXA 2QEOA 4AQIA 3S0EA 2NCOA 1CDPA 3I5FC 3NSOA 3NSLA 2M7LA 1IGVA 3IF7A 1M63B 1XFWO 3OHMB 1CB1A 2KQ6A 3PM8A 4PALA 1IJ5A 2ZN9A 2KGRA 4INWA 1KCYA 1IQ5A 1M45A 1WDCC 3LLEA 2HETA 4CPVA 4DIRA 3CZ1A 1WY9A 2WC8A 3OB1B 3B6XA 1BR1B 3B86A 3RLZA 4HRHA 1KWOC 1ZACA 2LVJA 1MHOA 1DT7B 1ZOTB 4HRGA 3BJHA 4HREE 1UHHA 3SS4A 3LCPC 4OCIA 1TCFA 2JPOA 2PALA 5CSFA 4BY4A 1W9ZA 3PM2A 5TNCA 1QATA 1ZMZA 2V53A 3FIAA 2MAZA 1OQPA 3CR2A 2LV7A 3S0AA 1XYDA 3DF0A 5J3XA 3OBVA 4PHJA 1IRJA 2AUCA 2SASA 3EVUA 2JU0A 3N7HA 3D73A 3PN7C 1QJTA 1JUOA 5I8NA 1OMVA 1S26D 3DD4A 1K95A 1NCZA 1OZSA 1YRUB 3VB1A 2LM5A 4CFQA 2L4HA 2D8NA 3D76A 2K7OA 4NDBA 1A4PA 1CFFA 1BR4B 1YRTB 2LUCA 3NSIA 3TDZA 3TS5B 4GAOA 1TWOA 2Y1MA 4GUKA 3V2LA 2JULA 1SYMA 1L2OB 2BCAA 1GQMA 2AMIA 1WRLA 2EC6C 3DYEA 3NSKA 4YI8A 3OX6A 5HLOA 2BCBA 3SS5A 3D78A 4XYNA 2LMUA 5F6TA 1L7ZA 1CFPA 2LVKA 4PE7A 4OV2A 1X02A 2A4JA 1NWDA 2OTGB 3FWBA 3TZ1A 4IL1A 1EH2A 2JNXA 1AJ5A 1KK8C 1S5GZ 3EKHA 1D1OA 1J7QA 2F3ZA 2F3YA 3JVTB 3LL8B 4NQGA 1FPWA 1JWDA 2BKHB 3SG2A 1Q80A 1FBVA 1DMOA 3SG7A 4NDDA 1FW4A 1UHNA 2KI4C 3A8RA 3KF9A 3FE9A 1CFCA 1SR6B 3FWCA 1CMGA 5JOLA 2EGDA 1B7TY 1W7JB 2FCDA 3K21A 1IKUA 2M0RA 1WRZA 4I5KA 3MSEB 3BQ3A 3L47A 1H8BA 1CMFA 4OVNF 3RZSA 1MR8A 3D75A 1AJ4A 1BT6A 3IVTA 1M46A 1UHJA 1XK4A 3AAJA 1TNXA 1DGVA 1SMGA 1U5IA 2CBLA 2I7AA 3BUWB 4FQTA 2L2CA 1JSAA 4BY5A 1AP4A 2HQWA 2IS9A 2JXLA 1V1FA 2H61A 1KFXL 2O5GA 3S0DA 5K89A 5AERA 2WC5A 2H8VA 5I2OA 2WNDA 1JF0A 3TDUA 1DTLA 3AAKA 1SK6D 2WCFA 3TDIA 1PVBA 1NX3A 1XVJA 4QJ5B 1EXRA 2BE4A 2L2EA 1SPYA 2MRDA 4A4CA 4GPLB 2BL0B 1NX0A 2E30A 2LCPA 4AOMA 1BJFA 1J7PA 1YUUA 2WCEA 2F2OA 4DUQA 1QV1A 1VRKA 2JNFA 3I5GB 2Y4QA 1TNWA 3E3RA 4MRXA 2KI6C 4F0ZB 1S36A 2L5YA 4YGCB 3WHUB 1UHKA 1LA0A 1OOGA 3GOFA 4PHMA 1OOIX 2HF5A 3QMEA 1FF1A 5PALA 4C0KA 3EK4A 1A29A 1F55A 1SW8A 3A4UB 3EG5B 2ZFDA 3BUMB 1JBAA 4PDZA 1U5IB 5BPJA 1OMDA 1EG3A 5G08A 1RFJA 2P71A 1TNQA 1TCOB 2KOTA 1RK9A 2LNKA 2WC6A 1C07A 1KFUL 5DKRA 1F8HA 1K93D 2NLNA 4JQ0D 1N0YA 1Y6WA 1QVIY 1XFUO 1RROA 4AQJA 4JPZB 3PLFB 5B8IB 1IH0A 1S6IA 2CTNA 2QEBA 3WHTB 1B8RA 1EL4A 1PVAA 1QTXA 2JQ6A 2L5XB 2QEHA 1CLLA 1TUJA 3LK1A 4P5OE 1TOPA 1EJ3A 2LLSA 2H2KA 1W7IB 1G33A 3NXAA 5AANA 1S3PA 4MZJA 5FYXA 3O78A 2F8PA 3VGOA 3CABA 1KK7Y 4YGEB 2WCBA 3AKBA 3CR5X 1OOJA 5D7FA 1SCVA 4PE4A 2JT0A 2FCEA 3CZTX 5ER5A 1XK4C 2JRFA 3Q8IA 1GGZA 2WCHA 4CLNA 2K8MB 1N65A 1WLZA 4I5JA 3TUYC 2H61C 5HKWA 1DF0A 4E68A 3CR4X 1S6JA 2BECA 2JTTA 2OS8B 2KI6D 2CNPA 5FI7A 2WCMA 3R1OA 3I5HC 4PHKA 1OZOA 5HL1A 1B7TZ 1QXPA 2QDIA 3R72A 1BF5A 1IG5A 1E8AA 3CLNA 3CYZA 1UWOA 4P2YB 4C0JA 3UO9A 3O4YA 1K90D 1YUTA 1H4BA 1K9PA 1QX7A 3D10A 2QPTA 4NDCA 4QJ4B 2I94A 2M3WA 3PATA 3HCMA 2M9GA 2CXJA 4C0LA 3S0FA 1YURA 1XFYO 1CDLA 3BUXB 1K96A 3SIBA 4PT1A 1RTP1 2EHBA 4JKTA 3CTNA 1SKTA 3I5IB 1QLKA 4M2QA 1UP5A 2L0PA 2E6WA 1DF0B 1QS7A 4GNKB 3SIAA 2DOQA 1T14A 3GK2A 1DJGA 5I2QA 4FQOA 2FJUB 1LKJA 2Y5IA 4YGDB 5HKYA 2ZKMX 3VROA 1IJ6A 1NIWA 2LVVA 1DQEA 1J1DA 2KNEA 4TNCA 1OOHA 3VRPA 1LXFC 1F4OA 1K9KA 4ICBA 1K9UA 2JT8A 1YX7A 2LANA 2LHLA 3BFBA 1CLMA 1DJHA 2QEVA 3R1PA 1Z2CB 1SNLA 3EK7A 4ZCVA 5KTYA 1BOCA 1K2HA 1MQ1A 3BOWA 3B7AA 1BG1A 1CNPA 2COLB 1DJZA 3EKJA 2KAVA 4GFTA 3B88A 3TS5C 2F2PA 3BUOB 3EVVA 4DCKA 2L98A 2OPOA 2MLEC 1L2OC 5HYDA 1QVIZ 3DVEA 5D69A 2RGIA 1M31A 3VRQA 2ZNEA 3UNWA 4DRWA 1F71A 3EK8A 1NPQA 2JWWA 1ZFSA 1PSBA 1CM1A 2OTGC 3DVKA 5D3OA 2VRGA 1YUSA 4MEWA 1PSRA 4PE0A 4N1GA 2BNXA 3D77A 1Y0VH 1S1EA 2ISDA 5FI2A 3JVTC 1SBJA 2PQLA 4YI9A 1LVCD 5HKZA 1KK7Z 4I5LB 2KLEA 1CDNA 1F70A 1DJIA 3GK1A 1KFXS 1SR6C 3BOWB 2Q4UA 1DEKA 1MUXA 1PK0D 1KSOA 1ALWA 1SRAA 1KQMB 1F4QA 1SCMB 3OB2B 4CFRA 2K2FA 3IQQA 1TIZA 1QIVA 4OR9B 3LK0A 2WOSA 1MWNA 4WQ3A 1HQVA 2LE9B 2M8UA 2KGBC 2K7DA 1C3YA 1J7RA 3I5FB 5EL2A 1KSMA 2PMYA 1QV0A 1PALA 1UURA 2FJYA 3KHEA 2MBXA 1ORGA 3EVRA 3AKAA 3L4LA 1BU3A 1JF2A 2KSPA 3BFAA 4GGNA 1QWVA 3O6BA 1UHIA 4KYNA 1NUBA 1Y1UA 5AFPA 1RECA 1AUIB 4USLA 2NXQA 3CZ2A 3DXLA 1S6CA 3D74A 2BCXA 1KWOB 4IJ7A 1KFUS 1GGWA 1LA3A 1TTXA 2BL0C 2M1UA 1SSEB 1NCYA 3BUNB 3OGNA 2CCMA 3O4XA 4PE1A 4ORAB 1NYAA 1C7WA 3I5GC 2LC5A 2I2RE 1B1GA 1B4CA 1XA5A 4YGBB 2G2BA 1OSAA 3SG5A 1SY9A 2BE6A 1CKKA 3IQOA 4YRUA 3PSRA 2KFFA 1OMRA 1BLQA 4GGFA 2LAPA 5I2LA 4ZCUA 2ZNDA 3BYAA 3ZNIA 2K0JA 2KYFA 1XFXO 2R2IA 4F7FA 2ZN8A 4PCWA 1YTZC 3PN7B 1YR5A 2KAYA 1GM0A 2LUXA 3FS7A 1QX5B 1NX1A 4JWQA 1RWYA 1TNPA 3BXKA 3S0BA 5JJGA 2GGZA 1SL7A 2GV5A 3M0WA 5GQQC 1M39A 1J7OA 1CDMA 2LP3A 5ER4X 3KEVA 4FTGA 4MN0A 4UPGA 1OE9B 1LINA 3CWGA 2CT9A 2EC6B 1C3ZA 2ERBA 3OX5A 3S0GA 1IQ3A 3QRXA 4MZLA 4YBHB 4A4BA 2KBIA 1EG4A 1R2UA 1SL8A 2PRUA 4OZDA 4XJKB 2M1KB 2PYQA 5CPVA 5DICA 2K7CA 4MVFA 3SG3A 5KSZA 4GBAA 2JZIA 1OOFA 2LMVA 2QACA 4N1FA 4ORCB 1HT9A 2GTEA 2Q91A 1NSHA 1UUSA 1XFZO 3ICBA 3NHTA 4MLWA 1B9AA 2GGMA 2PSRA 4WRIA 1ODBA 1KK8B 2HPSA 4WQ2A 2NZ0A 3DY9A 3L4AA 2JXCA 2KLDA 1XFRA 1ZUZA 2KPHA 2KI4B 2OS8C 1N2DA 2L4IA 4U8DA 3OP0A 2BBNA 1NP8A 3SS3A 2JC2A 2KAXA 4JD9A 3VRRA 2KYCA 3FE6A 2WCJA 1B8CA 4YGAA 1BODA 1WRKA 2BBMA 3NHIA 1CM4A 2TN4A 2M97A 3VRNA 1JFKA 3CDNA 1TUZA 2PVBA 2PASA 5CSNA 4ETOA 2G9BA 2MA2A 1QX2A 2LMTA 4MBEA 1K94A 1AK8A 2JPTA 1KQVA 1PRWA 3PFVA 1DJYA 2JOJA 1AHRA 1JC2A 2M7NA
chains in the Genus database with same CATH topology
2JTZA 3F45A 5DKNA 1J55A 2NCPA 1B47A 2LVIA 5DKQA 1V1GA 1CTRA 1MF8B 2M29A 1DGUA 3DF0B 1G4YR 1Y1XA 3D0YA 3I5IC 4GGFC 4DS7A 4QJ3B 4D1EA 1JFJA 5HLVA 2KHNA 1G8IA 4PHNA 1QIWA 1YX8A 2SCPA 1YVLA 1A2XA 1CFDA 3GK4X 1C7VA 1QLSA 2BKIB 2FOTA 3ZWHA 1ALVA 3KPXA 2MLFC 1A75A 3SG6A 1Y1AA 3O2PA 1GJYA 4MRYA 2O60A 1B8LA 2WORA 2M49B 1A03A 2AAOA 1MXEA 2KDHA 4HSZA 2LLTA 1XFVO 5KU1A 1FI5A 2F33A 2B1UA 2KFGA 3PALA 2L51A 4I5NB 2ZRSA 2LP2A 5IBWA 1QASA 4Q04A 5AEQA 3CS1A 3JTDB 4CIDA 3WNXB 1K8UA 1J1EA 3D0YB 1WLMA 3DVJA 2JT3A 4N5XA 3C1VA 2I18A 2K2AA 5AXIA 3CGAA 3KO0A 3RM1A 2Y1NA 2HQ8A 1RJVA 5CSIA 1NX2A 2LLUA 4MSPA 2KFHA 1YVHA 2LHIA 1DJXA 1A75B 4M2PA 1MXLC 1WDCB 4L9MA 3SG4A 1S5GY 2K61A 4ORBB 2MJWB 1IWQA 2MHHA 3HX4A 1SL9A 1TRFA 2KQYA 1PULA 4OKHA 2L50A 2KBMA 2ZRTA 3WXAA 1DJWA 3H4SE 1FI6A 4XJKA 1DVIA 1KQMC 1SCMC 2P6BB 1AVSA 1R6PA 1TN4A 1BMOA 2K7BA 4R1EA 1XO5A 3SJSA 3TUYB 1CLBA 3DVMA 4MZKA 3JTDC 5CSJA 1F54A 4M2OA 3I5HB 4AQIA 1NCXA 2NCOA 1CDPA 3I5FC 3NSOA 3NSLA 2M7LA 1IGVA 3IF7A 1M63B 1XFWO 3OHMB 1CB1A 2KQ6A 3PM8A 4PALA 1IJ5A 2ZN9A 2KGRA 1KCYA 1IQ5A 1M45A 1WDCC 3LLEA 2HETA 4CPVA 4DIRA 1WY9A 2WC8A 3OB1B 1BR1B 3RLZA 4HRHA 1KWOC 1ZACA 2LVJA 1MHOA 1DT7B 1ZOTB 4HRGA 4HREE 1UHHA 3LCPC 4OCIA 1TCFA 2PALA 5CSFA 4BY4A 5TNCA 1QATA 1ZMZA 2V53A 3FIAA 2MAZA 1OQPA 3CR2A 2LV7A 1XYDA 3DF0A 5J3XA 4PHJA 1IRJA 2AUCA 2SASA 3EVUA 2JU0A 3PN7C 1QJTA 1JUOA 5I8NA 1OMVA 1S26D 3DD4A 1K95A 1NCZA 1OZSA 1YRUB 2LM5A 4CFQA 2L4HA 2D8NA 2K7OA 4NDBA 1A4PA 1CFFA 1BR4B 1YRTB 2LUCA 3NSIA 3TDZA 3TS5B 4GAOA 2Y1MA 4GUKA 2JULA 1SYMA 1L2OB 2BCAA 1GQMA 2AMIA 1WRLA 2EC6C 3NSKA 3OX6A 5HLOA 2BCBA 4XYNA 2LMUA 5F6TA 1L7ZA 1CFPA 2LVKA 4PE7A 4OV2A 1X02A 2A4JA 1NWDA 2OTGB 3FWBA 3TZ1A 4IL1A 1EH2A 2JNXA 1AJ5A 1KK8C 1S5GZ 3EKHA 1D1OA 1J7QA 2F3ZA 2F3YA 3JVTB 3LL8B 4NQGA 1FPWA 1JWDA 2BKHB 3SG2A 1Q80A 1FBVA 1DMOA 3SG7A 4NDDA 1FW4A 1UHNA 2KI4C 3A8RA 3KF9A 1CFCA 1SR6B 3FWCA 1CMGA 5JOLA 2EGDA 1B7TY 1W7JB 2FCDA 3K21A 1IKUA 2M0RA 1WRZA 4I5KA 3MSEB 3BQ3A 1H8BA 1CMFA 4OVNF 1MR8A 1AJ4A 1BT6A 1M46A 1UHJA 1XK4A 3AAJA 1TNXA 1DGVA 1SMGA 1U5IA 2CBLA 2I7AA 3BUWB 1JSAA 4BY5A 1AP4A 2HQWA 2IS9A 2JXLA 1V1FA 2H61A 1KFXL 2O5GA 5K89A 5AERA 5I2OA 2WNDA 1JF0A 1DTLA 3AAKA 1SK6D 2WCFA 3TDIA 1PVBA 1NX3A 1XVJA 4QJ5B 1EXRA 2BE4A 2L2EA 1SPYA 2MRDA 4A4CA 4GPLB 2BL0B 1NX0A 2E30A 2LCPA 4AOMA 1BJFA 1J7PA 1YUUA 2WCEA 2F2OA 4DUQA 1QV1A 1VRKA 2JNFA 3I5GB 2Y4QA 1TNWA 3E3RA 4MRXA 2KI6C 4F0ZB 1S36A 4YGCB 3WHUB 1UHKA 1LA0A 3GOFA 4PHMA 2HF5A 1FF1A 5PALA 4C0KA 3EK4A 1A29A 1F55A 1SW8A 3A4UB 2ZFDA 3BUMB 1JBAA 4PDZA 1U5IB 5BPJA 1OMDA 1EG3A 5G08A 1RFJA 1TNQA 1TCOB 2KOTA 1RK9A 2LNKA 1C07A 1KFUL 5DKRA 1F8HA 1K93D 2NLNA 4JQ0D 1N0YA 1Y6WA 1QVIY 1XFUO 1RROA 4AQJA 4JPZB 3PLFB 5B8IB 1IH0A 1S6IA 2CTNA 3WHTB 1B8RA 1EL4A 1PVAA 1QTXA 2JQ6A 2L5XB 1CLLA 3LK1A 4P5OE 1TOPA 1EJ3A 2LLSA 2H2KA 1W7IB 1G33A 3NXAA 5AANA 1S3PA 4MZJA 5FYXA 3O78A 2F8PA 3VGOA 1KK7Y 4YGEB 2WCBA 3AKBA 3CR5X 1OOJA 5D7FA 1SCVA 4PE4A 2JT0A 2FCEA 3CZTX 5ER5A 1XK4C 2JRFA 1GGZA 4CLNA 2K8MB 1N65A 1WLZA 4I5JA 3TUYC 2H61C 5HKWA 1DF0A 4E68A 3CR4X 1S6JA 2BECA 2JTTA 2OS8B 2KI6D 2CNPA 3I5HC 4PHKA 1OZOA 1B7TZ 1QXPA 1BF5A 1IG5A 1E8AA 3CLNA 1UWOA 4P2YB 4C0JA 3O4YA 1K90D 1YUTA 1H4BA 1K9PA 1QX7A 3D10A 2QPTA 4NDCA 4QJ4B 2I94A 2M3WA 3PATA 3HCMA 2M9GA 2CXJA 4C0LA 1YURA 1XFYO 1CDLA 3BUXB 1K96A 3SIBA 1RTP1 2EHBA 3CTNA 1SKTA 3I5IB 1QLKA 4M2QA 1UP5A 2L0PA 2E6WA 1DF0B 1QS7A 4GNKB 3SIAA 2DOQA 3GK2A 1DJGA 5I2QA 4FQOA 2FJUB 1LKJA 2Y5IA 4YGDB 5HKYA 2ZKMX 3VROA 1IJ6A 1NIWA 2LVVA 1J1DA 2KNEA 4TNCA 3VRPA 1LXFC 1F4OA 1K9KA 4ICBA 1K9UA 2JT8A 1YX7A 2LANA 2LHLA 1CLMA 1DJHA 5KTYA 1SNLA 3EK7A 4ZCVA 1BOCA 1K2HA 1MQ1A 3BOWA 1BG1A 1CNPA 2COLB 1DJZA 3EKJA 2KAVA 4GFTA 3TS5C 2F2PA 3BUOB 3EVVA 4DCKA 2L98A 2OPOA 2MLEC 1L2OC 5HYDA 1QVIZ 3DVEA 5D69A 2RGIA 1M31A 3VRQA 2ZNEA 4DRWA 1F71A 3EK8A 1NPQA 2JWWA 1ZFSA 1PSBA 1CM1A 2OTGC 3DVKA 2VRGA 1YUSA 4MEWA 1PSRA 4PE0A 4N1GA 1Y0VH 1S1EA 2ISDA 3JVTC 1SBJA 4YI9A 5HKZA 1LVCD 1KK7Z 4I5LB 1CDNA 1F70A 1DJIA 3GK1A 1KFXS 1SR6C 3BOWB 2Q4UA 1MUXA 1PK0D 1KSOA 1ALWA 1SRAA 1KQMB 1F4QA 1SCMB 3OB2B 4CFRA 2K2FA 3IQQA 1TIZA 1QIVA 4OR9B 3LK0A 2WOSA 1MWNA 4WQ3A 1HQVA 2LE9B 2M8UA 2KGBC 2K7DA 1J7RA 3I5FB 1KSMA 2PMYA 1QV0A 1PALA 1UURA 3KHEA 2MBXA 3EVRA 3AKAA 4YI8A 1BU3A 1JF2A 2KSPA 4GGNA 3O6BA 1UHIA 1NUBA 1Y1UA 5AFPA 1RECA 1AUIB 4USLA 2NXQA 1S6CA 2BCXA 1KWOB 1KFUS 1GGWA 1LA3A 1TTXA 2BL0C 2M1UA 1NCYA 3BUNB 2CCMA 4PE1A 4ORAB 1NYAA 1C7WA 3I5GC 2LC5A 2I2RE 1B1GA 1B4CA 1XA5A 4YGBB 2G2BA 1OSAA 3SG5A 1SY9A 2BE6A 1CKKA 3IQOA 4YRUA 3PSRA 2KFFA 1OMRA 1BLQA 4GGFA 2LAPA 5I2LA 4ZCUA 2ZNDA 3BYAA 3ZNIA 2K0JA 2KYFA 1XFXO 2R2IA 2ZN8A 4PCWA 1YTZC 3PN7B 1YR5A 2KAYA 2LUXA 3FS7A 1QX5B 1NX1A 4JWQA 1RWYA 1TNPA 3BXKA 5JJGA 2GGZA 1SL7A 2GV5A 3M0WA 5GQQC 1M39A 1J7OA 1CDMA 2LP3A 5ER4X 3KEVA 4FTGA 4MN0A 4UPGA 1OE9B 1LINA 3CWGA 2CT9A 2EC6B 3OX5A 1IQ3A 3QRXA 4MZLA 4YBHB 4A4BA 2KBIA 1EG4A 1R2UA 1SL8A 2PRUA 4XJKB 5CPVA 2M1KB 3SG3A 3TDUA 2K7CA 4MVFA 5KSZA 4GBAA 2JZIA 2LMVA 2QACA 4ORCB 4N1FA 1HT9A 2Q91A 4MLWA 1NSHA 1UUSA 1XFZO 3ICBA 1B9AA 2GGMA 2PSRA 4WRIA 1ODBA 1KK8B 2HPSA 4WQ2A 2NZ0A 2JXCA 1ZUZA 2KI4B 2OS8C 1N2DA 2L4IA 4U8DA 3OP0A 2BBNA 1NP8A 2JC2A 2KAXA 3VRRA 2KYCA 4YGAA 1B8CA 1BODA 1WRKA 2BBMA 1CM4A 2TN4A 2M97A 3VRNA 1JFKA 5CSNA 2PVBA 2PASA 4ETOA 2G9BA 2MA2A 1QX2A 2LMTA 4MBEA 1K94A 1AK8A 2JPTA 1KQVA 1PRWA 3PFVA 1DJYA 2JOJA 1AHRA 1JC2A 2M7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTZ A;  3F45 A;  5DKN A;  1J55 A;  2NCP A;  1B47 A;  2LVI A;  5DKQ A;  1V1G A;  1CTR A;  1MF8 B;  2M29 A;  1DGU A;  3DF0 B;  1G4Y R;  1Y1X A;  3D0Y A;  3I5I C;  4GGF C;  4DS7 A;  4QJ3 B;  4D1E A;  1JFJ A;  5HLV A;  2KHN A;  1G8I A;  4PHN A;  1QIW A;  1YX8 A;  2SCP A;  1YVL A;  1A2X A;  1CFD A;  3GK4 X;  1C7V A;  1QLS A;  2BKI B;  2FOT A;  3ZWH A;  1ALV A;  3KPX A;  2MLF C;  1A75 A;  3SG6 A;  1Y1A A;  3O2P A;  1GJY A;  4MRY A;  2O60 A;  1B8L A;  2WOR A;  2M49 B;  1A03 A;  2AAO A;  1MXE A;  2KDH A;  4HSZ A;  2LLT A;  1XFV O;  5KU1 A;  1FI5 A;  2F33 A;  2B1U A;  2KFG A;  3PAL A;  2L51 A;  4I5N B;  2ZRS A;  2LP2 A;  5IBW A;  1QAS A;  4Q04 A;  5AEQ A;  3CS1 A;  3JTD B;  4CID A;  3WNX B;  1K8U A;  1J1E A;  3D0Y B;  1WLM A;  3DVJ A;  2JT3 A;  4N5X A;  3C1V A;  2I18 A;  2K2A A;  5AXI A;  3CGA A;  3KO0 A;  3RM1 A;  2Y1N A;  2HQ8 A;  1RJV A;  5CSI A;  1NX2 A;  2LLU A;  4MSP A;  2KFH A;  1YVH A;  2LHI A;  1DJX A;  1A75 B;  4M2P A;  1MXL C;  1WDC B;  4L9M A;  3SG4 A;  1S5G Y;  2K61 A;  4ORB B;  2MJW B;  1IWQ A;  2MHH A;  3HX4 A;  1SL9 A;  1TRF A;  2KQY A;  1PUL A;  4OKH A;  2L50 A;  2KBM A;  2ZRT A;  3WXA A;  1DJW A;  3H4S E;  1FI6 A;  4XJK A;  1DVI A;  1KQM C;  1SCM C;  2P6B B;  1AVS A;  1R6P A;  1TN4 A;  1BMO A;  2K7B A;  4R1E A;  1XO5 A;  3SJS A;  3TUY B;  1CLB A;  3DVM A;  4MZK A;  3JTD C;  5CSJ A;  1F54 A;  4M2O A;  3I5H B;  4AQI A;  1NCX A;  2NCO A;  1CDP A;  3I5F C;  3NSO A;  3NSL A;  2M7L A;  1IGV A;  3IF7 A;  1M63 B;  1XFW O;  3OHM B;  1CB1 A;  2KQ6 A;  3PM8 A;  4PAL A;  1IJ5 A;  2ZN9 A;  2KGR A;  1KCY A;  1IQ5 A;  1M45 A;  1WDC C;  3LLE A;  2HET A;  4CPV A;  4DIR A;  1WY9 A;  2WC8 A;  3OB1 B;  1BR1 B;  3RLZ A;  4HRH A;  1KWO C;  1ZAC A;  2LVJ A;  1MHO A;  1DT7 B;  1ZOT B;  4HRG A;  4HRE E;  1UHH A;  3LCP C;  4OCI A;  1TCF A;  2PAL A;  5CSF A;  4BY4 A;  5TNC A;  1QAT A;  1ZMZ A;  2V53 A;  3FIA A;  2MAZ A;  1OQP A;  3CR2 A;  2LV7 A;  1XYD A;  3DF0 A;  5J3X A;  4PHJ A;  1IRJ A;  2AUC A;  2SAS A;  3EVU A;  2JU0 A;  3PN7 C;  1QJT A;  1JUO A;  5I8N A;  1OMV A;  1S26 D;  3DD4 A;  1K95 A;  1NCZ A;  1OZS A;  1YRU B;  2LM5 A;  4CFQ A;  2L4H A;  2D8N A;  2K7O A;  4NDB A;  1A4P A;  1CFF A;  1BR4 B;  1YRT B;  2LUC A;  3NSI A;  3TDZ A;  3TS5 B;  4GAO A;  2Y1M A;  4GUK A;  2JUL A;  1SYM A;  1L2O B;  2BCA A;  1GQM A;  2AMI A;  1WRL A;  2EC6 C;  3NSK A;  3OX6 A;  5HLO A;  2BCB A;  4XYN A;  2LMU A;  5F6T A;  1L7Z A;  1CFP A;  2LVK A;  4PE7 A;  4OV2 A;  1X02 A;  2A4J A;  1NWD A;  2OTG B;  3FWB A;  3TZ1 A;  4IL1 A;  1EH2 A;  2JNX A;  1AJ5 A;  1KK8 C;  1S5G Z;  3EKH A;  1D1O A;  1J7Q A;  2F3Z A;  2F3Y A;  3JVT B;  3LL8 B;  4NQG A;  1FPW A;  1JWD A;  2BKH B;  3SG2 A;  1Q80 A;  1FBV A;  1DMO A;  3SG7 A;  4NDD A;  1FW4 A;  1UHN A;  2KI4 C;  3A8R A;  3KF9 A;  1CFC A;  1SR6 B;  3FWC A;  1CMG A;  5JOL A;  2EGD A;  1B7T Y;  1W7J B;  2FCD A;  3K21 A;  1IKU A;  2M0R A;  1WRZ A;  4I5K A;  3MSE B;  3BQ3 A;  1H8B A;  1CMF A;  4OVN F;  1MR8 A;  1AJ4 A;  1BT6 A;  1M46 A;  1UHJ A;  1XK4 A;  3AAJ A;  1TNX A;  1DGV A;  1SMG A;  1U5I A;  2CBL A;  2I7A A;  3BUW B;  1JSA A;  4BY5 A;  1AP4 A;  2HQW A;  2IS9 A;  2JXL A;  1V1F A;  2H61 A;  1KFX L;  2O5G A;  5K89 A;  5AER A;  5I2O A;  2WND A;  1JF0 A;  1DTL A;  3AAK A;  1SK6 D;  2WCF A;  3TDI A;  1PVB A;  1NX3 A;  1XVJ A;  4QJ5 B;  1EXR A;  2BE4 A;  2L2E A;  1SPY A;  2MRD A;  4A4C A;  4GPL B;  2BL0 B;  1NX0 A;  2E30 A;  2LCP A;  4AOM A;  1BJF A;  1J7P A;  1YUU A;  2WCE A;  2F2O A;  4DUQ A;  1QV1 A;  1VRK A;  2JNF A;  3I5G B;  2Y4Q A;  1TNW A;  3E3R A;  4MRX A;  2KI6 C;  4F0Z B;  1S36 A;  4YGC B;  3WHU B;  1UHK A;  1LA0 A;  3GOF A;  4PHM A;  2HF5 A;  1FF1 A;  5PAL A;  4C0K A;  3EK4 A;  1A29 A;  1F55 A;  1SW8 A;  3A4U B;  2ZFD A;  3BUM B;  1JBA A;  4PDZ A;  1U5I B;  5BPJ A;  1OMD A;  1EG3 A;  5G08 A;  1RFJ A;  1TNQ A;  1TCO B;  2KOT A;  1RK9 A;  2LNK A;  1C07 A;  1KFU L;  5DKR A;  1F8H A;  1K93 D;  2NLN A;  4JQ0 D;  1N0Y A;  1Y6W A;  1QVI Y;  1XFU O;  1RRO A;  4AQJ A;  4JPZ B;  3PLF B;  5B8I B;  1IH0 A;  1S6I A;  2CTN A;  3WHT B;  1B8R A;  1EL4 A;  1PVA A;  1QTX A;  2JQ6 A;  2L5X B;  1CLL A;  3LK1 A;  4P5O E;  1TOP A;  1EJ3 A;  2LLS A;  2H2K A;  1W7I B;  1G33 A;  3NXA A;  5AAN A;  1S3P A;  4MZJ A;  5FYX A;  3O78 A;  2F8P A;  3VGO A;  1KK7 Y;  4YGE B;  2WCB A;  3AKB A;  3CR5 X;  1OOJ A;  5D7F A;  1SCV A;  4PE4 A;  2JT0 A;  2FCE A;  3CZT X;  5ER5 A;  1XK4 C;  2JRF A;  1GGZ A;  4CLN A;  2K8M B;  1N65 A;  1WLZ A;  4I5J A;  3TUY C;  2H61 C;  5HKW A;  1DF0 A;  4E68 A;  3CR4 X;  1S6J A;  2BEC A;  2JTT A;  2OS8 B;  2KI6 D;  2CNP A;  3I5H C;  4PHK A;  1OZO A;  1B7T Z;  1QXP A;  1BF5 A;  1IG5 A;  1E8A A;  3CLN A;  1UWO A;  4P2Y B;  4C0J A;  3O4Y A;  1K90 D;  1YUT A;  1H4B A;  1K9P A;  1QX7 A;  3D10 A;  2QPT A;  4NDC A;  4QJ4 B;  2I94 A;  2M3W A;  3PAT A;  3HCM A;  2M9G A;  2CXJ A;  4C0L A;  1YUR A;  1XFY O;  1CDL A;  3BUX B;  1K96 A;  3SIB A;  1RTP 1;  2EHB A;  3CTN A;  1SKT A;  3I5I B;  1QLK A;  4M2Q A;  1UP5 A;  2L0P A;  2E6W A;  1DF0 B;  1QS7 A;  4GNK B;  3SIA A;  2DOQ A;  3GK2 A;  1DJG A;  5I2Q A;  4FQO A;  2FJU B;  1LKJ A;  2Y5I A;  4YGD B;  5HKY A;  2ZKM X;  3VRO A;  1IJ6 A;  1NIW A;  2LVV A;  1J1D A;  2KNE A;  4TNC A;  3VRP A;  1LXF C;  1F4O A;  1K9K A;  4ICB A;  1K9U A;  2JT8 A;  1YX7 A;  2LAN A;  2LHL A;  1CLM A;  1DJH A;  5KTY A;  1SNL A;  3EK7 A;  4ZCV A;  1BOC A;  1K2H A;  1MQ1 A;  3BOW A;  1BG1 A;  1CNP A;  2COL B;  1DJZ A;  3EKJ A;  2KAV A;  4GFT A;  3TS5 C;  2F2P A;  3BUO B;  3EVV A;  4DCK A;  2L98 A;  2OPO A;  2MLE C;  1L2O C;  5HYD A;  1QVI Z;  3DVE A;  5D69 A;  2RGI A;  1M31 A;  3VRQ A;  2ZNE A;  4DRW A;  1F71 A;  3EK8 A;  1NPQ A;  2JWW A;  1ZFS A;  1PSB A;  1CM1 A;  2OTG C;  3DVK A;  2VRG A;  1YUS A;  4MEW A;  1PSR A;  4PE0 A;  4N1G A;  1Y0V H;  1S1E A;  2ISD A;  3JVT C;  1SBJ A;  4YI9 A;  5HKZ A;  1LVC D;  1KK7 Z;  4I5L B;  1CDN A;  1F70 A;  1DJI A;  3GK1 A;  1KFX S;  1SR6 C;  3BOW B;  2Q4U A;  1MUX A;  1PK0 D;  1KSO A;  1ALW A;  1SRA A;  1KQM B;  1F4Q A;  1SCM B;  3OB2 B;  4CFR A;  2K2F A;  3IQQ A;  1TIZ A;  1QIV A;  4OR9 B;  3LK0 A;  2WOS A;  1MWN A;  4WQ3 A;  1HQV A;  2LE9 B;  2M8U A;  2KGB C;  2K7D A;  1J7R A;  3I5F B;  1KSM A;  2PMY A;  1QV0 A;  1PAL A;  1UUR A;  3KHE A;  2MBX A;  3EVR A;  3AKA A;  4YI8 A;  1BU3 A;  1JF2 A;  2KSP A;  4GGN A;  3O6B A;  1UHI A;  1NUB A;  1Y1U A;  5AFP A;  1REC A;  1AUI B;  4USL A;  2NXQ A;  1S6C A;  2BCX A;  1KWO B;  1KFU S;  1GGW A;  1LA3 A;  1TTX A;  2BL0 C;  2M1U A;  1NCY A;  3BUN B;  2CCM A;  4PE1 A;  4ORA B;  1NYA A;  1C7W A;  3I5G C;  2LC5 A;  2I2R E;  1B1G A;  1B4C A;  1XA5 A;  4YGB B;  2G2B A;  1OSA A;  3SG5 A;  1SY9 A;  2BE6 A;  1CKK A;  3IQO A;  4YRU A;  3PSR A;  2KFF A;  1OMR A;  1BLQ A;  4GGF A;  2LAP A;  5I2L A;  4ZCU A;  2ZND A;  3BYA A;  3ZNI A;  2K0J A;  2KYF A;  1XFX O;  2R2I A;  2ZN8 A;  4PCW A;  1YTZ C;  3PN7 B;  1YR5 A;  2KAY A;  2LUX A;  3FS7 A;  1QX5 B;  1NX1 A;  4JWQ A;  1RWY A;  1TNP A;  3BXK A;  5JJG A;  2GGZ A;  1SL7 A;  2GV5 A;  3M0W A;  5GQQ C;  1M39 A;  1J7O A;  1CDM A;  2LP3 A;  5ER4 X;  3KEV A;  4FTG A;  4MN0 A;  4UPG A;  1OE9 B;  1LIN A;  3CWG A;  2CT9 A;  2EC6 B;  3OX5 A;  1IQ3 A;  3QRX A;  4MZL A;  4YBH B;  4A4B A;  2KBI A;  1EG4 A;  1R2U A;  1SL8 A;  2PRU A;  4XJK B;  5CPV A;  2M1K B;  3SG3 A;  3TDU A;  2K7C A;  4MVF A;  5KSZ A;  4GBA A;  2JZI A;  2LMV A;  2QAC A;  4ORC B;  4N1F A;  1HT9 A;  2Q91 A;  4MLW A;  1NSH A;  1UUS A;  1XFZ O;  3ICB A;  1B9A A;  2GGM A;  2PSR A;  4WRI A;  1ODB A;  1KK8 B;  2HPS A;  4WQ2 A;  2NZ0 A;  2JXC A;  1ZUZ A;  2KI4 B;  2OS8 C;  1N2D A;  2L4I A;  4U8D A;  3OP0 A;  2BBN A;  1NP8 A;  2JC2 A;  2KAX A;  3VRR A;  2KYC A;  4YGA A;  1B8C A;  1BOD A;  1WRK A;  2BBM A;  1CM4 A;  2TN4 A;  2M97 A;  3VRN A;  1JFK A;  5CSN A;  2PVB A;  2PAS A;  4ETO A;  2G9B A;  2MA2 A;  1QX2 A;  2LMT A;  4MBE A;  1K94 A;  1AK8 A;  2JPT A;  1KQV A;  1PRW A;  3PFV A;  1DJY A;  2JOJ A;  1AHR A;  1JC2 A;  2M7N A; 
#chains in the Genus database with same CATH topology
 2JTZ A;  2WCK A;  3F45 A;  5DKN A;  1J55 A;  2NCP A;  1B47 A;  2LVI A;  3B87 A;  3DZT A;  5DKQ A;  2P70 A;  1V1G A;  1CTR A;  1MF8 B;  2M29 A;  3BFH A;  1DGU A;  3DF0 B;  1G4Y R;  1Y1X A;  3D0Y A;  3I5I C;  4GGF C;  4DS7 A;  4QJ3 B;  4D1E A;  2WCL A;  5FI6 A;  5HLV A;  1JFJ A;  2KHN A;  1DEL A;  1G8I A;  1OW4 A;  4PHN A;  1QIW A;  1YX8 A;  2SCP A;  1YVL A;  1A2X A;  1CFD A;  2K60 A;  3GK4 X;  1C7V A;  1QLS A;  2BKI B;  2FOT A;  3ZWH A;  1ALV A;  3KPX A;  2MLF C;  1A75 A;  3SG6 A;  2YGU A;  1Y1A A;  3O2P A;  1GJY A;  4MRY A;  3PJI A;  2O60 A;  1B8L A;  1Z4H A;  2M49 B;  2WOR A;  1A03 A;  2AAO A;  1MXE A;  2KDH A;  3FE8 A;  4HSZ A;  2LLT A;  1XFV O;  5KU1 A;  1FI5 A;  2F33 A;  2B1U A;  2KFG A;  3PAL A;  2L51 A;  4I5N B;  2ZRS A;  3NGV A;  2LP2 A;  5IBW A;  1QAS A;  4INX A;  4Q04 A;  3CZ0 A;  5AEQ A;  3CS1 A;  3JTD B;  4CID A;  3WNX B;  1K8U A;  1J1E A;  3D0Y B;  1WLM A;  3DVJ A;  2JT3 A;  4N5X A;  3C1V A;  2I18 A;  2K2A A;  5AXI A;  3CGA A;  3KO0 A;  3RM1 A;  2Y1N A;  2HQ8 A;  1RJV A;  5CSI A;  1NX2 A;  2LLU A;  4MSP A;  5I94 A;  2KFH A;  1YVH A;  2LHI A;  1DJX A;  1A75 B;  4M2P A;  1MXL C;  1WDC B;  4L9M A;  3SG4 A;  1S5G Y;  2K61 A;  4ORB B;  2MJW B;  1IWQ A;  2MHH A;  3HX4 A;  1SL9 A;  1TRF A;  2KQY A;  1PUL A;  1IIO A;  4OKH A;  2L50 A;  3K1E A;  2KBM A;  2ZRT A;  3WXA A;  1DJW A;  3H4S E;  1FI6 A;  4XJK A;  3R1V A;  1DVI A;  1KQM C;  1SCM C;  2BAP A;  2P6B B;  1AVS A;  1DC1 A;  1R6P A;  1TN4 A;  1BMO A;  2K7B A;  4R1E A;  1XO5 A;  3SJS A;  3TUY B;  1CLB A;  3DVM A;  4MZK A;  1P28 A;  3JTD C;  5CSJ A;  1F54 A;  4M2O A;  3I5H B;  1LS8 A;  1NCX A;  2QEO A;  4AQI A;  3S0E A;  2NCO A;  1CDP A;  3I5F C;  3NSO A;  3NSL A;  2M7L A;  1IGV A;  3IF7 A;  1M63 B;  1XFW O;  3OHM B;  1CB1 A;  2KQ6 A;  3PM8 A;  4PAL A;  1IJ5 A;  2ZN9 A;  2KGR A;  4INW A;  1KCY A;  1IQ5 A;  1M45 A;  1WDC C;  3LLE A;  2HET A;  4CPV A;  4DIR A;  3CZ1 A;  1WY9 A;  2WC8 A;  3OB1 B;  3B6X A;  1BR1 B;  3B86 A;  3RLZ A;  4HRH A;  1KWO C;  1ZAC A;  2LVJ A;  1MHO A;  1DT7 B;  1ZOT B;  4HRG A;  3BJH A;  4HRE E;  1UHH A;  3SS4 A;  3LCP C;  4OCI A;  1TCF A;  2JPO A;  2PAL A;  5CSF A;  4BY4 A;  1W9Z A;  3PM2 A;  5TNC A;  1QAT A;  1ZMZ A;  2V53 A;  3FIA A;  2MAZ A;  1OQP A;  3CR2 A;  2LV7 A;  3S0A A;  1XYD A;  3DF0 A;  5J3X A;  3OBV A;  4PHJ A;  1IRJ A;  2AUC A;  2SAS A;  3EVU A;  2JU0 A;  3N7H A;  3D73 A;  3PN7 C;  1QJT A;  1JUO A;  5I8N A;  1OMV A;  1S26 D;  3DD4 A;  1K95 A;  1NCZ A;  1OZS A;  1YRU B;  3VB1 A;  2LM5 A;  4CFQ A;  2L4H A;  2D8N A;  3D76 A;  2K7O A;  4NDB A;  1A4P A;  1CFF A;  1BR4 B;  1YRT B;  2LUC A;  3NSI A;  3TDZ A;  3TS5 B;  4GAO A;  1TWO A;  2Y1M A;  4GUK A;  3V2L A;  2JUL A;  1SYM A;  1L2O B;  2BCA A;  1GQM A;  2AMI A;  1WRL A;  2EC6 C;  3DYE A;  3NSK A;  4YI8 A;  3OX6 A;  5HLO A;  2BCB A;  3SS5 A;  3D78 A;  4XYN A;  2LMU A;  5F6T A;  1L7Z A;  1CFP A;  2LVK A;  4PE7 A;  4OV2 A;  1X02 A;  2A4J A;  1NWD A;  2OTG B;  3FWB A;  3TZ1 A;  4IL1 A;  1EH2 A;  2JNX A;  1AJ5 A;  1KK8 C;  1S5G Z;  3EKH A;  1D1O A;  1J7Q A;  2F3Z A;  2F3Y A;  3JVT B;  3LL8 B;  4NQG A;  1FPW A;  1JWD A;  2BKH B;  3SG2 A;  1Q80 A;  1FBV A;  1DMO A;  3SG7 A;  4NDD A;  1FW4 A;  1UHN A;  2KI4 C;  3A8R A;  3KF9 A;  3FE9 A;  1CFC A;  1SR6 B;  3FWC A;  1CMG A;  5JOL A;  2EGD A;  1B7T Y;  1W7J B;  2FCD A;  3K21 A;  1IKU A;  2M0R A;  1WRZ A;  4I5K A;  3MSE B;  3BQ3 A;  3L47 A;  1H8B A;  1CMF A;  4OVN F;  3RZS A;  1MR8 A;  3D75 A;  1AJ4 A;  1BT6 A;  3IVT A;  1M46 A;  1UHJ A;  1XK4 A;  3AAJ A;  1TNX A;  1DGV A;  1SMG A;  1U5I A;  2CBL A;  2I7A A;  3BUW B;  4FQT A;  2L2C A;  1JSA A;  4BY5 A;  1AP4 A;  2HQW A;  2IS9 A;  2JXL A;  1V1F A;  2H61 A;  1KFX L;  2O5G A;  3S0D A;  5K89 A;  5AER A;  2WC5 A;  2H8V A;  5I2O A;  2WND A;  1JF0 A;  3TDU A;  1DTL A;  3AAK A;  1SK6 D;  2WCF A;  3TDI A;  1PVB A;  1NX3 A;  1XVJ A;  4QJ5 B;  1EXR A;  2BE4 A;  2L2E A;  1SPY A;  2MRD A;  4A4C A;  4GPL B;  2BL0 B;  1NX0 A;  2E30 A;  2LCP A;  4AOM A;  1BJF A;  1J7P A;  1YUU A;  2WCE A;  2F2O A;  4DUQ A;  1QV1 A;  1VRK A;  2JNF A;  3I5G B;  2Y4Q A;  1TNW A;  3E3R A;  4MRX A;  2KI6 C;  4F0Z B;  1S36 A;  2L5Y A;  4YGC B;  3WHU B;  1UHK A;  1LA0 A;  1OOG A;  3GOF A;  4PHM A;  1OOI X;  2HF5 A;  3QME A;  1FF1 A;  5PAL A;  4C0K A;  3EK4 A;  1A29 A;  1F55 A;  1SW8 A;  3A4U B;  3EG5 B;  2ZFD A;  3BUM B;  1JBA A;  4PDZ A;  1U5I B;  5BPJ A;  1OMD A;  1EG3 A;  5G08 A;  1RFJ A;  2P71 A;  1TNQ A;  1TCO B;  2KOT A;  1RK9 A;  2LNK A;  2WC6 A;  1C07 A;  1KFU L;  5DKR A;  1F8H A;  1K93 D;  2NLN A;  4JQ0 D;  1N0Y A;  1Y6W A;  1QVI Y;  1XFU O;  1RRO A;  4AQJ A;  4JPZ B;  3PLF B;  5B8I B;  1IH0 A;  1S6I A;  2CTN A;  2QEB A;  3WHT B;  1B8R A;  1EL4 A;  1PVA A;  1QTX A;  2JQ6 A;  2L5X B;  2QEH A;  1CLL A;  1TUJ A;  3LK1 A;  4P5O E;  1TOP A;  1EJ3 A;  2LLS A;  2H2K A;  1W7I B;  1G33 A;  3NXA A;  5AAN A;  1S3P A;  4MZJ A;  5FYX A;  3O78 A;  2F8P A;  3VGO A;  3CAB A;  1KK7 Y;  4YGE B;  2WCB A;  3AKB A;  3CR5 X;  1OOJ A;  5D7F A;  1SCV A;  4PE4 A;  2JT0 A;  2FCE A;  3CZT X;  5ER5 A;  1XK4 C;  2JRF A;  3Q8I A;  1GGZ A;  2WCH A;  4CLN A;  2K8M B;  1N65 A;  1WLZ A;  4I5J A;  3TUY C;  2H61 C;  5HKW A;  1DF0 A;  4E68 A;  3CR4 X;  1S6J A;  2BEC A;  2JTT A;  2OS8 B;  2KI6 D;  2CNP A;  5FI7 A;  2WCM A;  3R1O A;  3I5H C;  4PHK A;  1OZO A;  5HL1 A;  1B7T Z;  1QXP A;  2QDI A;  3R72 A;  1BF5 A;  1IG5 A;  1E8A A;  3CLN A;  3CYZ A;  1UWO A;  4P2Y B;  4C0J A;  3UO9 A;  3O4Y A;  1K90 D;  1YUT A;  1H4B A;  1K9P A;  1QX7 A;  3D10 A;  2QPT A;  4NDC A;  4QJ4 B;  2I94 A;  2M3W A;  3PAT A;  3HCM A;  2M9G A;  2CXJ A;  4C0L A;  3S0F A;  1YUR A;  1XFY O;  1CDL A;  3BUX B;  1K96 A;  3SIB A;  4PT1 A;  1RTP 1;  2EHB A;  4JKT A;  3CTN A;  1SKT A;  3I5I B;  1QLK A;  4M2Q A;  1UP5 A;  2L0P A;  2E6W A;  1DF0 B;  1QS7 A;  4GNK B;  3SIA A;  2DOQ A;  1T14 A;  3GK2 A;  1DJG A;  5I2Q A;  4FQO A;  2FJU B;  1LKJ A;  2Y5I A;  4YGD B;  5HKY A;  2ZKM X;  3VRO A;  1IJ6 A;  1NIW A;  2LVV A;  1DQE A;  1J1D A;  2KNE A;  4TNC A;  1OOH A;  3VRP A;  1LXF C;  1F4O A;  1K9K A;  4ICB A;  1K9U A;  2JT8 A;  1YX7 A;  2LAN A;  2LHL A;  3BFB A;  1CLM A;  1DJH A;  2QEV A;  3R1P A;  1Z2C B;  1SNL A;  3EK7 A;  4ZCV A;  5KTY A;  1BOC A;  1K2H A;  1MQ1 A;  3BOW A;  3B7A A;  1BG1 A;  1CNP A;  2COL B;  1DJZ A;  3EKJ A;  2KAV A;  4GFT A;  3B88 A;  3TS5 C;  2F2P A;  3BUO B;  3EVV A;  4DCK A;  2L98 A;  2OPO A;  2MLE C;  1L2O C;  5HYD A;  1QVI Z;  3DVE A;  5D69 A;  2RGI A;  1M31 A;  3VRQ A;  2ZNE A;  3UNW A;  4DRW A;  1F71 A;  3EK8 A;  1NPQ A;  2JWW A;  1ZFS A;  1PSB A;  1CM1 A;  2OTG C;  3DVK A;  5D3O A;  2VRG A;  1YUS A;  4MEW A;  1PSR A;  4PE0 A;  4N1G A;  2BNX A;  3D77 A;  1Y0V H;  1S1E A;  2ISD A;  5FI2 A;  3JVT C;  1SBJ A;  2PQL A;  4YI9 A;  1LVC D;  5HKZ A;  1KK7 Z;  4I5L B;  2KLE A;  1CDN A;  1F70 A;  1DJI A;  3GK1 A;  1KFX S;  1SR6 C;  3BOW B;  2Q4U A;  1DEK A;  1MUX A;  1PK0 D;  1KSO A;  1ALW A;  1SRA A;  1KQM B;  1F4Q A;  1SCM B;  3OB2 B;  4CFR A;  2K2F A;  3IQQ A;  1TIZ A;  1QIV A;  4OR9 B;  3LK0 A;  2WOS A;  1MWN A;  4WQ3 A;  1HQV A;  2LE9 B;  2M8U A;  2KGB C;  2K7D A;  1C3Y A;  1J7R A;  3I5F B;  5EL2 A;  1KSM A;  2PMY A;  1QV0 A;  1PAL A;  1UUR A;  2FJY A;  3KHE A;  2MBX A;  1ORG A;  3EVR A;  3AKA A;  3L4L A;  1BU3 A;  1JF2 A;  2KSP A;  3BFA A;  4GGN A;  1QWV A;  3O6B A;  1UHI A;  4KYN A;  1NUB A;  1Y1U A;  5AFP A;  1REC A;  1AUI B;  4USL A;  2NXQ A;  3CZ2 A;  3DXL A;  1S6C A;  3D74 A;  2BCX A;  1KWO B;  4IJ7 A;  1KFU S;  1GGW A;  1LA3 A;  1TTX A;  2BL0 C;  2M1U A;  1SSE B;  1NCY A;  3BUN B;  3OGN A;  2CCM A;  3O4X A;  4PE1 A;  4ORA B;  1NYA A;  1C7W A;  3I5G C;  2LC5 A;  2I2R E;  1B1G A;  1B4C A;  1XA5 A;  4YGB B;  2G2B A;  1OSA A;  3SG5 A;  1SY9 A;  2BE6 A;  1CKK A;  3IQO A;  4YRU A;  3PSR A;  2KFF A;  1OMR A;  1BLQ A;  4GGF A;  2LAP A;  5I2L A;  4ZCU A;  2ZND A;  3BYA A;  3ZNI A;  2K0J A;  2KYF A;  1XFX O;  2R2I A;  4F7F A;  2ZN8 A;  4PCW A;  1YTZ C;  3PN7 B;  1YR5 A;  2KAY A;  1GM0 A;  2LUX A;  3FS7 A;  1QX5 B;  1NX1 A;  4JWQ A;  1RWY A;  1TNP A;  3BXK A;  3S0B A;  5JJG A;  2GGZ A;  1SL7 A;  2GV5 A;  3M0W A;  5GQQ C;  1M39 A;  1J7O A;  1CDM A;  2LP3 A;  5ER4 X;  3KEV A;  4FTG A;  4MN0 A;  4UPG A;  1OE9 B;  1LIN A;  3CWG A;  2CT9 A;  2EC6 B;  1C3Z A;  2ERB A;  3OX5 A;  3S0G A;  1IQ3 A;  3QRX A;  4MZL A;  4YBH B;  4A4B A;  2KBI A;  1EG4 A;  1R2U A;  1SL8 A;  2PRU A;  4OZD A;  4XJK B;  2M1K B;  2PYQ A;  5CPV A;  5DIC A;  2K7C A;  4MVF A;  3SG3 A;  5KSZ A;  4GBA A;  2JZI A;  1OOF A;  2LMV A;  2QAC A;  4N1F A;  4ORC B;  1HT9 A;  2GTE A;  2Q91 A;  1NSH A;  1UUS A;  1XFZ O;  3ICB A;  3NHT A;  4MLW A;  1B9A A;  2GGM A;  2PSR A;  4WRI A;  1ODB A;  1KK8 B;  2HPS A;  4WQ2 A;  2NZ0 A;  3DY9 A;  3L4A A;  2JXC A;  2KLD A;  1XFR A;  1ZUZ A;  2KPH A;  2KI4 B;  2OS8 C;  1N2D A;  2L4I A;  4U8D A;  3OP0 A;  2BBN A;  1NP8 A;  3SS3 A;  2JC2 A;  2KAX A;  4JD9 A;  3VRR A;  2KYC A;  3FE6 A;  2WCJ A;  1B8C A;  4YGA A;  1BOD A;  1WRK A;  2BBM A;  3NHI A;  1CM4 A;  2TN4 A;  2M97 A;  3VRN A;  1JFK A;  3CDN A;  1TUZ A;  2PVB A;  2PAS A;  5CSN A;  4ETO A;  2G9B A;  2MA2 A;  1QX2 A;  2LMT A;  4MBE A;  1K94 A;  1AK8 A;  2JPT A;  1KQV A;  1PRW A;  3PFV A;  1DJY A;  2JOJ A;  1AHR A;  1JC2 A;  2M7N A; 
#chains in the Genus database with same CATH homology
 2JTZ A;  3F45 A;  5DKN A;  1J55 A;  2NCP A;  1B47 A;  2LVI A;  5DKQ A;  1V1G A;  1CTR A;  1MF8 B;  2M29 A;  1DGU A;  3DF0 B;  1G4Y R;  1Y1X A;  3D0Y A;  3I5I C;  4GGF C;  4DS7 A;  4QJ3 B;  4D1E A;  1JFJ A;  5HLV A;  2KHN A;  1G8I A;  4PHN A;  1QIW A;  1YX8 A;  2SCP A;  1YVL A;  1A2X A;  1CFD A;  3GK4 X;  1C7V A;  1QLS A;  2BKI B;  2FOT A;  3ZWH A;  1ALV A;  3KPX A;  2MLF C;  1A75 A;  3SG6 A;  1Y1A A;  3O2P A;  1GJY A;  4MRY A;  2O60 A;  1B8L A;  2WOR A;  2M49 B;  1A03 A;  2AAO A;  1MXE A;  2KDH A;  4HSZ A;  2LLT A;  1XFV O;  5KU1 A;  1FI5 A;  2F33 A;  2B1U A;  2KFG A;  3PAL A;  2L51 A;  4I5N B;  2ZRS A;  2LP2 A;  5IBW A;  1QAS A;  4Q04 A;  5AEQ A;  3CS1 A;  3JTD B;  4CID A;  3WNX B;  1K8U A;  1J1E A;  3D0Y B;  1WLM A;  3DVJ A;  2JT3 A;  4N5X A;  3C1V A;  2I18 A;  2K2A A;  5AXI A;  3CGA A;  3KO0 A;  3RM1 A;  2Y1N A;  2HQ8 A;  1RJV A;  5CSI A;  1NX2 A;  2LLU A;  4MSP A;  2KFH A;  1YVH A;  2LHI A;  1DJX A;  1A75 B;  4M2P A;  1MXL C;  1WDC B;  4L9M A;  3SG4 A;  1S5G Y;  2K61 A;  4ORB B;  2MJW B;  1IWQ A;  2MHH A;  3HX4 A;  1SL9 A;  1TRF A;  2KQY A;  1PUL A;  4OKH A;  2L50 A;  2KBM A;  2ZRT A;  3WXA A;  1DJW A;  3H4S E;  1FI6 A;  4XJK A;  1DVI A;  1KQM C;  1SCM C;  2P6B B;  1AVS A;  1R6P A;  1TN4 A;  1BMO A;  2K7B A;  4R1E A;  1XO5 A;  3SJS A;  3TUY B;  1CLB A;  3DVM A;  4MZK A;  3JTD C;  5CSJ A;  1F54 A;  4M2O A;  3I5H B;  4AQI A;  1NCX A;  2NCO A;  1CDP A;  3I5F C;  3NSO A;  3NSL A;  2M7L A;  1IGV A;  3IF7 A;  1M63 B;  1XFW O;  3OHM B;  1CB1 A;  2KQ6 A;  3PM8 A;  4PAL A;  1IJ5 A;  2ZN9 A;  2KGR A;  1KCY A;  1IQ5 A;  1M45 A;  1WDC C;  3LLE A;  2HET A;  4CPV A;  4DIR A;  1WY9 A;  2WC8 A;  3OB1 B;  1BR1 B;  3RLZ A;  4HRH A;  1KWO C;  1ZAC A;  2LVJ A;  1MHO A;  1DT7 B;  1ZOT B;  4HRG A;  4HRE E;  1UHH A;  3LCP C;  4OCI A;  1TCF A;  2PAL A;  5CSF A;  4BY4 A;  5TNC A;  1QAT A;  1ZMZ A;  2V53 A;  3FIA A;  2MAZ A;  1OQP A;  3CR2 A;  2LV7 A;  1XYD A;  3DF0 A;  5J3X A;  4PHJ A;  1IRJ A;  2AUC A;  2SAS A;  3EVU A;  2JU0 A;  3PN7 C;  1QJT A;  1JUO A;  5I8N A;  1OMV A;  1S26 D;  3DD4 A;  1K95 A;  1NCZ A;  1OZS A;  1YRU B;  2LM5 A;  4CFQ A;  2L4H A;  2D8N A;  2K7O A;  4NDB A;  1A4P A;  1CFF A;  1BR4 B;  1YRT B;  2LUC A;  3NSI A;  3TDZ A;  3TS5 B;  4GAO A;  2Y1M A;  4GUK A;  2JUL A;  1SYM A;  1L2O B;  2BCA A;  1GQM A;  2AMI A;  1WRL A;  2EC6 C;  3NSK A;  3OX6 A;  5HLO A;  2BCB A;  4XYN A;  2LMU A;  5F6T A;  1L7Z A;  1CFP A;  2LVK A;  4PE7 A;  4OV2 A;  1X02 A;  2A4J A;  1NWD A;  2OTG B;  3FWB A;  3TZ1 A;  4IL1 A;  1EH2 A;  2JNX A;  1AJ5 A;  1KK8 C;  1S5G Z;  3EKH A;  1D1O A;  1J7Q A;  2F3Z A;  2F3Y A;  3JVT B;  3LL8 B;  4NQG A;  1FPW A;  1JWD A;  2BKH B;  3SG2 A;  1Q80 A;  1FBV A;  1DMO A;  3SG7 A;  4NDD A;  1FW4 A;  1UHN A;  2KI4 C;  3A8R A;  3KF9 A;  1CFC A;  1SR6 B;  3FWC A;  1CMG A;  5JOL A;  2EGD A;  1B7T Y;  1W7J B;  2FCD A;  3K21 A;  1IKU A;  2M0R A;  1WRZ A;  4I5K A;  3MSE B;  3BQ3 A;  1H8B A;  1CMF A;  4OVN F;  1MR8 A;  1AJ4 A;  1BT6 A;  1M46 A;  1UHJ A;  1XK4 A;  3AAJ A;  1TNX A;  1DGV A;  1SMG A;  1U5I A;  2CBL A;  2I7A A;  3BUW B;  1JSA A;  4BY5 A;  1AP4 A;  2HQW A;  2IS9 A;  2JXL A;  1V1F A;  2H61 A;  1KFX L;  2O5G A;  5K89 A;  5AER A;  5I2O A;  2WND A;  1JF0 A;  1DTL A;  3AAK A;  1SK6 D;  2WCF A;  3TDI A;  1PVB A;  1NX3 A;  1XVJ A;  4QJ5 B;  1EXR A;  2BE4 A;  2L2E A;  1SPY A;  2MRD A;  4A4C A;  4GPL B;  2BL0 B;  1NX0 A;  2E30 A;  2LCP A;  4AOM A;  1BJF A;  1J7P A;  1YUU A;  2WCE A;  2F2O A;  4DUQ A;  1QV1 A;  1VRK A;  2JNF A;  3I5G B;  2Y4Q A;  1TNW A;  3E3R A;  4MRX A;  2KI6 C;  4F0Z B;  1S36 A;  4YGC B;  3WHU B;  1UHK A;  1LA0 A;  3GOF A;  4PHM A;  2HF5 A;  1FF1 A;  5PAL A;  4C0K A;  3EK4 A;  1A29 A;  1F55 A;  1SW8 A;  3A4U B;  2ZFD A;  3BUM B;  1JBA A;  4PDZ A;  1U5I B;  5BPJ A;  1OMD A;  1EG3 A;  5G08 A;  1RFJ A;  1TNQ A;  1TCO B;  2KOT A;  1RK9 A;  2LNK A;  1C07 A;  1KFU L;  5DKR A;  1F8H A;  1K93 D;  2NLN A;  4JQ0 D;  1N0Y A;  1Y6W A;  1QVI Y;  1XFU O;  1RRO A;  4AQJ A;  4JPZ B;  3PLF B;  5B8I B;  1IH0 A;  1S6I A;  2CTN A;  3WHT B;  1B8R A;  1EL4 A;  1PVA A;  1QTX A;  2JQ6 A;  2L5X B;  1CLL A;  3LK1 A;  4P5O E;  1TOP A;  1EJ3 A;  2LLS A;  2H2K A;  1W7I B;  1G33 A;  3NXA A;  5AAN A;  1S3P A;  4MZJ A;  5FYX A;  3O78 A;  2F8P A;  3VGO A;  1KK7 Y;  4YGE B;  2WCB A;  3AKB A;  3CR5 X;  1OOJ A;  5D7F A;  1SCV A;  4PE4 A;  2JT0 A;  2FCE A;  3CZT X;  5ER5 A;  1XK4 C;  2JRF A;  1GGZ A;  4CLN A;  2K8M B;  1N65 A;  1WLZ A;  4I5J A;  3TUY C;  2H61 C;  5HKW A;  1DF0 A;  4E68 A;  3CR4 X;  1S6J A;  2BEC A;  2JTT A;  2OS8 B;  2KI6 D;  2CNP A;  3I5H C;  4PHK A;  1OZO A;  1B7T Z;  1QXP A;  1BF5 A;  1IG5 A;  1E8A A;  3CLN A;  1UWO A;  4P2Y B;  4C0J A;  3O4Y A;  1K90 D;  1YUT A;  1H4B A;  1K9P A;  1QX7 A;  3D10 A;  2QPT A;  4NDC A;  4QJ4 B;  2I94 A;  2M3W A;  3PAT A;  3HCM A;  2M9G A;  2CXJ A;  4C0L A;  1YUR A;  1XFY O;  1CDL A;  3BUX B;  1K96 A;  3SIB A;  1RTP 1;  2EHB A;  3CTN A;  1SKT A;  3I5I B;  1QLK A;  4M2Q A;  1UP5 A;  2L0P A;  2E6W A;  1DF0 B;  1QS7 A;  4GNK B;  3SIA A;  2DOQ A;  3GK2 A;  1DJG A;  5I2Q A;  4FQO A;  2FJU B;  1LKJ A;  2Y5I A;  4YGD B;  5HKY A;  2ZKM X;  3VRO A;  1IJ6 A;  1NIW A;  2LVV A;  1J1D A;  2KNE A;  4TNC A;  3VRP A;  1LXF C;  1F4O A;  1K9K A;  4ICB A;  1K9U A;  2JT8 A;  1YX7 A;  2LAN A;  2LHL A;  1CLM A;  1DJH A;  5KTY A;  1SNL A;  3EK7 A;  4ZCV A;  1BOC A;  1K2H A;  1MQ1 A;  3BOW A;  1BG1 A;  1CNP A;  2COL B;  1DJZ A;  3EKJ A;  2KAV A;  4GFT A;  3TS5 C;  2F2P A;  3BUO B;  3EVV A;  4DCK A;  2L98 A;  2OPO A;  2MLE C;  1L2O C;  5HYD A;  1QVI Z;  3DVE A;  5D69 A;  2RGI A;  1M31 A;  3VRQ A;  2ZNE A;  4DRW A;  1F71 A;  3EK8 A;  1NPQ A;  2JWW A;  1ZFS A;  1PSB A;  1CM1 A;  2OTG C;  3DVK A;  2VRG A;  1YUS A;  4MEW A;  1PSR A;  4PE0 A;  4N1G A;  1Y0V H;  1S1E A;  2ISD A;  3JVT C;  1SBJ A;  4YI9 A;  5HKZ A;  1LVC D;  1KK7 Z;  4I5L B;  1CDN A;  1F70 A;  1DJI A;  3GK1 A;  1KFX S;  1SR6 C;  3BOW B;  2Q4U A;  1MUX A;  1PK0 D;  1KSO A;  1ALW A;  1SRA A;  1KQM B;  1F4Q A;  1SCM B;  3OB2 B;  4CFR A;  2K2F A;  3IQQ A;  1TIZ A;  1QIV A;  4OR9 B;  3LK0 A;  2WOS A;  1MWN A;  4WQ3 A;  1HQV A;  2LE9 B;  2M8U A;  2KGB C;  2K7D A;  1J7R A;  3I5F B;  1KSM A;  2PMY A;  1QV0 A;  1PAL A;  1UUR A;  3KHE A;  2MBX A;  3EVR A;  3AKA A;  4YI8 A;  1BU3 A;  1JF2 A;  2KSP A;  4GGN A;  3O6B A;  1UHI A;  1NUB A;  1Y1U A;  5AFP A;  1REC A;  1AUI B;  4USL A;  2NXQ A;  1S6C A;  2BCX A;  1KWO B;  1KFU S;  1GGW A;  1LA3 A;  1TTX A;  2BL0 C;  2M1U A;  1NCY A;  3BUN B;  2CCM A;  4PE1 A;  4ORA B;  1NYA A;  1C7W A;  3I5G C;  2LC5 A;  2I2R E;  1B1G A;  1B4C A;  1XA5 A;  4YGB B;  2G2B A;  1OSA A;  3SG5 A;  1SY9 A;  2BE6 A;  1CKK A;  3IQO A;  4YRU A;  3PSR A;  2KFF A;  1OMR A;  1BLQ A;  4GGF A;  2LAP A;  5I2L A;  4ZCU A;  2ZND A;  3BYA A;  3ZNI A;  2K0J A;  2KYF A;  1XFX O;  2R2I A;  2ZN8 A;  4PCW A;  1YTZ C;  3PN7 B;  1YR5 A;  2KAY A;  2LUX A;  3FS7 A;  1QX5 B;  1NX1 A;  4JWQ A;  1RWY A;  1TNP A;  3BXK A;  5JJG A;  2GGZ A;  1SL7 A;  2GV5 A;  3M0W A;  5GQQ C;  1M39 A;  1J7O A;  1CDM A;  2LP3 A;  5ER4 X;  3KEV A;  4FTG A;  4MN0 A;  4UPG A;  1OE9 B;  1LIN A;  3CWG A;  2CT9 A;  2EC6 B;  3OX5 A;  1IQ3 A;  3QRX A;  4MZL A;  4YBH B;  4A4B A;  2KBI A;  1EG4 A;  1R2U A;  1SL8 A;  2PRU A;  4XJK B;  5CPV A;  2M1K B;  3SG3 A;  3TDU A;  2K7C A;  4MVF A;  5KSZ A;  4GBA A;  2JZI A;  2LMV A;  2QAC A;  4ORC B;  4N1F A;  1HT9 A;  2Q91 A;  4MLW A;  1NSH A;  1UUS A;  1XFZ O;  3ICB A;  1B9A A;  2GGM A;  2PSR A;  4WRI A;  1ODB A;  1KK8 B;  2HPS A;  4WQ2 A;  2NZ0 A;  2JXC A;  1ZUZ A;  2KI4 B;  2OS8 C;  1N2D A;  2L4I A;  4U8D A;  3OP0 A;  2BBN A;  1NP8 A;  2JC2 A;  2KAX A;  3VRR A;  2KYC A;  4YGA A;  1B8C A;  1BOD A;  1WRK A;  2BBM A;  1CM4 A;  2TN4 A;  2M97 A;  3VRN A;  1JFK A;  5CSN A;  2PVB A;  2PAS A;  4ETO A;  2G9B A;  2MA2 A;  1QX2 A;  2LMT A;  4MBE A;  1K94 A;  1AK8 A;  2JPT A;  1KQV A;  1PRW A;  3PFV A;  1DJY A;  2JOJ A;  1AHR A;  1JC2 A;  2M7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...