1XFVO

Crystal structure of anthrax edema factor (ef) in complex with calmodulin and 3' deoxy-atp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
146
Chain Sequence
QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDQMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-independent calmodulin binding and two-metal-ion catalytic mechanism of anthrax edema factor.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Lyase/metal binding protein
molecule keywords Calmodulin-sensitive adenylate cyclase
total genus 35
structure length 146
sequence length 146
chains with identical sequence P, Q, R, S, T
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfvO02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1xfvO01
2K8MB 2KI6D 3DVEA 3PFVA 1MXLC 3WHUB 1A29A 2CNPA 4PE1A 1MXEA 3OB1B 1IQ5A 3JTDC 3TDZA 1BLQA 1CDLA 4GPLB 1CMGA 2LAPA 2FCEA 1QJTA 1UURA 2A4JA 2K2AA 5K89A 1XFYO 4P2YB 2MLEC 2OS8B 2WOSA 1QX7A 2KAYA 4F0ZB 3KO0A 2LMUA 1PALA 3TS5C 3NSOA 2CT9A 1DMOA 1J7QA 5HKWA 1K9PA 1CLLA 2KDHA 3BUMB 1KFXL 2KI4C 4HRGA 2F2PA 1DJYA 1MHOA 5HYDA 1KFUL 1N65A 2GGZA 3CZTX 4AOMA 1NX2A 3DF0A 1FBVA 1F70A 1PSRA 2I7AA 2ZN9A 3D0YA 1LVCD 1VRKA 5CSFA 1NIWA 4N1FA 3VGOA 4CFRA 5FYXA 1TNQA 3K21A 5AANA 4YI9A 2BKHB 2EHBA 1OMDA 4M2PA 1G8IA 1HT9A 1M31A 2D8NA 5AEQA 1C7VA 4ORCB 5I2LA 4OV2A 1CFFA 2KYFA 2JTZA 1QTXA 2K61A 1WDCB 3I5HB 5DKNA 1YRTB 4OKHA 1QASA 1IQ3A 2KFHA 1UP5A 1SY9A 2PSRA 2V53A 3I5FB 1CB1A 1BJFA 1QVIY 3E3RA 1SBJA 1Y0VH 2BE6A 1LKJA 3BQ3A 2HQWA 1B4CA 1WRLA 5AERA 1S5GZ 3PALA 2LHIA 2M9GA 3LLEA 3O2PA 3RLZA 2ZRTA 1M39A 2JT0A 1DT7B 1S6CA 5KSZA 5CSIA 2AMIA 4N5XA 4NDCA 1KK7Z 1L2OC 1FF1A 1S6JA 2L98A 1KK8C 3HX4A 2KQ6A 4DRWA 1BOCA 1SR6B 1DJIA 2KBIA 2KFGA 4MZLA 1X02A 4D1EA 2COLB 4NDDA 4PHJA 2JPTA 1SPYA 3H4SE 2LLSA 4GNKB 1OMRA 3D0YB 1QIWA 2LUXA 1KK7Y 4I5JA 3DVKA 1SRAA 4FTGA 2M1UA 1LA0A 1CKKA 2SASA 2JXCA 3WXAA 1A4PA 1PVBA 1EL4A 3IF7A 2HETA 5TNCA 4NDBA 2L4HA 1IGVA 3FS7A 1TNWA 2R2IA 1G33A 4MLWA 4C0JA 1S1EA 4PE4A 3CR2A 1TCOB 3VRQA 2GGMA 1ZUZA 1UHNA 3LL8B 1NX1A 3D10A 1RFJA 4A4BA 2L5XB 2F3ZA 3WHTB 4UPGA 1E8AA 1IKUA 4P5OE 2QPTA 1FI6A 1MWNA 1XA5A 1XVJA 4MVFA 4C0LA 1SKTA 1YX7A 2JT3A 5HKZA 1ZFSA 3O4YA 1NSHA 2MLFC 2WC8A 1PRWA 1UHHA 1W7JB 1EH2A 1LINA 3TZ1A 1DGVA 1K95A 1MUXA 1TRFA 2BCBA 2LE9B 2VRGA 3CR4X 4GGFC 1F71A 4JPZB 1H8BA 1KCYA 2CXJA 2NXQA 3OX5A 2Y4QA 1A03A 1XFZO 2BL0C 1XK4C 2K7OA 2L0PA 3PLFB 1DJXA 2PALA 4CIDA 4CPVA 3ZWHA 2LVIA 1TTXA 5I2OA 4JQ0D 1F55A 3KPXA 1KQMC 2F33A 3OHMB 1QLSA 5DKRA 1SNLA 4E68A 3VRRA 1C07A 3FIAA 2KGBC 3CGAA 1K96A 5I8NA 2BL0B 4Q04A 5CSNA 3SG6A 1NUBA 1OZSA 3BYAA 2PRUA 1QV0A 2I18A 2LUCA 4ORAB 4PE7A 4YBHB 2IS9A 2E30A 1S3PA 2KI4B 2K2FA 4I5KA 1QATA 3SG5A 1B8RA 2CCMA 1K90D 1RJVA 2JQ6A 3O78A 4PE0A 4OVNF 1K8UA 3PSRA 4NQGA 4XJKB 2G9BA 3CTNA 3NSIA 4DUQA 2JT8A 5CSJA 3A8RA 4YRUA 2JOJA 3QRXA 5JJGA 1FPWA 2Y1MA 1NYAA 4AQJA 2PVBA 3OB2B 1AJ4A 3JVTB 4XJKA 1M63B 1J55A 1JF0A 5D7FA 2LANA 1Y6WA 2BKIB 2ISDA 1CFPA 1ALWA 2NCOA 2LV7A 1IRJA 1NX0A 5ER4X 3TS5B 1ZACA 3EK4A 3F45A 2BCXA 1DJHA 1SCVA 3I5HC 3ZNIA 1RECA 1XFUO 1CLMA 2BBMA 1CNPA 1S5GY 1SR6C 2BE4A 2FOTA 3BUNB 3EK8A 1ALVA 3WNXB 3PN7C 2AUCA 1YVLA 3AKAA 1TOPA 4PHNA 1B7TY 1QVIZ 4PCWA 1B9AA 5JOLA 5G08A 3EKJA 4MRYA 2K7CA 1F4OA 2M97A 4YGDB 4QJ4B 2F2OA 2LP2A 4DCKA 2L2EA 2WORA 2HQ8A 2O5GA 1YUSA 4MBEA 1JSAA 1CDPA 2MJWB 3LCPC 3TUYC 1MF8B 1XO5A 4MZKA 1F8HA 1KSOA 4YGBB 5AFPA 1K94A 1GGZA 3HCMA 2BBNA 5F6TA 1LA3A 1JUOA 1CDMA 1L7ZA 4OR9B 4TNCA 3VRNA 2TN4A 2B1UA 1WRKA 2K0JA 1V1FA 2P6BB 2KAVA 1GJYA 3IQQA 1YTZC 2FJUB 3C1VA 1EG4A 4CFQA 1NWDA 5ER5A 2MAZA 1WDCC 1WLZA 3AKBA 2ZNEA 1JWDA 1J1DA 1NPQA 1ZMZA 2H61A 2KBMA 2F8PA 1J7PA 3KEVA 4GBAA 3GK4X 1FI5A 1G4YR 2KYCA 2OTGB 5AXIA 2PASA 1KWOC 2KGRA 4ZCVA 1A2XA 1NP8A 1OMVA 1JFJA 1JBAA 1KK8B 1K93D 1KQVA 1S36A 2MHHA 4C0KA 5KTYA 1WY9A 2EC6C 2NZ0A 1SL9A 2EC6B 4MZJA 3SG3A 3GK1A 1BR4B 3IQOA 1B8CA 2H61C 3SJSA 1AP4A 2EGDA 3BUXB 1JFKA 1KWOB 1BU3A 2LNKA 1GGWA 1U5IB 2K7DA 4JWQA 1F54A 3VROA 2LHLA 1U5IA 1YR5A 4USLA 1QS7A 2Q91A 1WRZA 2SCPA 4PALA 2ZFDA 2JRFA 1IG5A 1M45A 1ODBA 2JTTA 1PVAA 5KU1A 1KFUS 1AHRA 1JF2A 2WCBA 4ICBA 2QACA 2MRDA 3O6BA 2G2BA 5I2QA 4U8DA 2FCDA 1Q80A 5PALA 1V1GA 1Y1AA 1SL7A 1R2UA 2I2RE 1F4QA 3NXAA 4WQ2A 2Y5IA 1C7WA 1SK6D 3SIBA 2M8UA 1EJ3A 2LMVA 3CLNA 1K2HA 2L4IA 1TNXA 1NCZA 1BF5A 1CLBA 1SMGA 1QIVA 1DTLA 3DVMA 1XFWO 2Q4UA 3BUOB 3VRPA 3CR5X 1N2DA 1DJZA 2BCAA 1AUIB 1YUTA 3OX6A 2OPOA 4PHMA 2ZNDA 2NCPA 5B8IB 3M0WA 2LP3A 1RWYA 1BR1B 1UWOA 1DGUA 4DS7A 1YX8A 2WCEA 5HKYA 4GAOA 2KNEA 2NLNA 2ZN8A 3CS1A 1TIZA 1ZOTB 4YGCB 4BY4A 2KAXA 1WLMA 3JTDB 3SG4A 2WCFA 3NSKA 1QLKA 3DF0B 1B8LA 5BPJA 1J7RA 1N0YA 2O60A 2KHNA 1XK4A 4N1GA 1HQVA 2LM5A 3I5IB 1YUUA 3BXKA 1J7OA 2LLUA 4GFTA 3BOWA 1Y1UA 3EVUA 2DOQA 2I94A 2ZKMX 1OSAA 4MSPA 4BY5A 1W7IB 1QV1A 2PMYA 4QJ3B 1D1OA 3EVRA 1NCXA 5GQQC 4I5LB 1SYMA 4MEWA 3RM1A 1CM4A 1Y1XA 4PHKA 1RROA 4YGAA 2M49B 2H2KA 3GK2A 4IL1A 2JNXA 3I5GB 2JULA 1SCMB 2LCPA 3TUYB 4YI8A 4DIRA 1FW4A 3AAJA 1XFVO 4M2QA 4GGFA 1YRUB 3GOFA 3TDIA 4HREE 1MR8A 1BT6A 3OP0A 3PM8A 1DF0B 1A75B 4WRIA 5IBWA 3PATA 2LC5A 2LMTA 1PULA 1TN4A 3NSLA 3EVVA 1QX5B 1AK8A 1RTP1 3PN7B 5HLOA 3JVTC 4PDZA 4GUKA 2M3WA 3DD4A 2LVKA 1MQ1A 2OS8C 2MBXA 1B1GA 4MRXA 1PK0D 4WQ3A 1PSBA 3LK1A 4R1EA 1DVIA 1IJ6A 2JC2A 1EXRA 1UHIA 1AJ5A 1EG3A 1M46A 4YGEB 1XFXO 1RK9A 2HPSA 2Y1NA 1DJGA 3SG7A 1OZOA 1S26D 1IWQA 5D69A 2LLTA 3DVJA 1B7TZ 2AAOA 2M0RA 3I5GC 4I5NB 2KQYA 4FQOA 4AQIA 1TNPA 2LVJA 3ICBA 2JWWA 3TDUA 4L9MA 1YURA 2JZIA 2MA2A 2CBLA 1J1EA 1CMFA 4A4CA 1CM1A 2RGIA 4HRHA 3EKHA 2GV5A 3SG2A 1OQPA 3BUWB 4ZCUA 1BMOA 2KSPA 4GGNA 5DKQA 1L2OB 2JNFA 2KOTA 3FWBA 2ZRSA 1K9KA 2L51A 2F3YA 1SL8A 1R6PA 1BODA 1KQMB 1OOJA 3CWGA 2OTGC 4ETOA 2KFFA 1CFDA 1H4BA 2CTNA 1SCMC 1AVSA 3A4UB 3EK7A 3SIAA 1SW8A 2HF5A 4QJ5B 1IJ5A 2M7LA 3AAKA 1QX2A 5J3XA 2M29A 1UUSA 1GQMA 1K9UA 1JC2A 3LK0A 1CDNA 3BOWB 3I5FC 4HSZA 1CFCA 1CTRA 2WNDA 4XYNA 1YVHA 1B47A 4ORBB 1TCFA 1S6IA 2JXLA 3KHEA 2BECA 5HLVA 1A75A 1NCYA 2E6WA 2M7NA 1DF0A 2M1KB 1NX3A 3FWCA 2K7BA 3KF9A 4MN0A 4OCIA 1XYDA 1UHJA 2L50A 1DJWA 4CLNA 1UHKA 1OE9B 1LXFC 3MSEB 5CPVA 1KSMA 1IH0A 1QXPA 2LVVA 1KFXS 4M2OA 2JU0A 1BG1A 3I5IC 2KI6C
chains in the Genus database with same CATH superfamily
2K8MB 2KI6D 3DVEA 3PFVA 1MXLC 3WHUB 1A29A 2CNPA 4PE1A 1MXEA 3OB1B 1IQ5A 3JTDC 3OBVA 3TDZA 1BLQA 1CDLA 4GPLB 1CMGA 2LAPA 2FCEA 1QJTA 1UURA 2A4JA 2K2AA 2WCMA 1XFYO 4P2YB 2MLEC 2OS8B 3SS3A 2WOSA 5K89A 1DC1A 1QX7A 2KAYA 4F0ZB 1IIOA 3KO0A 2LMUA 1PALA 3TS5C 3NSOA 2CT9A 1DMOA 1J7QA 5HKWA 1K9PA 3K1EA 1CLLA 2KDHA 3BUMB 1KFXL 2KI4C 4HRGA 2F2PA 1DJYA 1MHOA 5HYDA 1KFUL 1N65A 2GGZA 3CZTX 4AOMA 1NX2A 3DF0A 4F7FA 1FBVA 1F70A 1PSRA 2I7AA 2ZN9A 3D0YA 1LVCD 1VRKA 5CSFA 1NIWA 4N1FA 3VGOA 4CFRA 5FYXA 1TNQA 1XFRA 3K21A 5AANA 4YI9A 1OOGA 2BKHB 2EHBA 1OMDA 4M2PA 1G8IA 1HT9A 1M31A 2D8NA 5AEQA 1C7VA 4ORCB 5FI2A 3D78A 5I2LA 4OV2A 1CFFA 2KYFA 2JTZA 1QTXA 2K61A 1WDCB 3FE8A 3I5HB 5DKNA 1YRTB 4OKHA 1QASA 1IQ3A 2KFHA 1UP5A 1SY9A 2PSRA 2V53A 3I5FB 1CB1A 1BJFA 3IVTA 1QVIY 3E3RA 2QDIA 3D74A 1SBJA 1Y0VH 2BE6A 1LKJA 3BQ3A 2HQWA 2JPOA 1B4CA 1WRLA 5AERA 1S5GZ 3PALA 2LHIA 2M9GA 3LLEA 3O2PA 3RLZA 1Z2CB 2ZRTA 1M39A 3FE6A 2JT0A 1DT7B 3PJIA 1S6CA 3PM2A 5CSIA 1DEKA 2AMIA 5KSZA 4N5XA 4NDCA 1KK7Z 1L2OC 1FF1A 1S6JA 2L98A 1KK8C 3DYEA 3HX4A 2KQ6A 4DRWA 1BOCA 1SR6B 1DJIA 2KBIA 2KFGA 4MZLA 3B6XA 1X02A 4D1EA 2KLEA 2COLB 4NDDA 4PHJA 2JPTA 1SPYA 3NGVA 3H4SE 2LLSA 4GNKB 1OMRA 3D0YB 1QIWA 2LUXA 1P28A 1KK7Y 4I5JA 3DVKA 3S0FA 1SRAA 4FTGA 2M1UA 1LA0A 1CKKA 2SASA 2JXCA 3WXAA 1A4PA 1PVBA 1EL4A 2QEVA 3D75A 3FE9A 3IF7A 2HETA 5TNCA 2PQLA 4NDBA 2L4HA 1IGVA 3FS7A 1TNWA 2R2IA 1G33A 4MLWA 3BJHA 4C0JA 1S1EA 4PE4A 3CR2A 1TCOB 3VRQA 1ZUZA 2GGMA 1UHNA 3LL8B 1NX1A 3D10A 3DY9A 1RFJA 4A4BA 2L5XB 2F3ZA 4PT1A 3WHTB 4UPGA 1DELA 1E8AA 1IKUA 4P5OE 2QPTA 3R72A 1FI6A 1MWNA 1XA5A 1XVJA 4MVFA 4C0LA 1SKTA 1YX7A 2JT3A 5HKZA 1ZFSA 3NHTA 3O4YA 4KYNA 1NSHA 2MLFC 2WC8A 1PRWA 1UHHA 1W7JB 1EH2A 1LINA 3Q8IA 3TZ1A 2GTEA 1DGVA 1K95A 1MUXA 1TRFA 2BCBA 2LE9B 2VRGA 3B87A 3CR4X 4GGFC 4JPZB 1F71A 1H8BA 1KCYA 2CXJA 2NXQA 3OX5A 2Y4QA 1A03A 3SS5A 1XFZO 2BL0C 1XK4C 2K7OA 2L0PA 3PLFB 1DJXA 2PALA 3R1PA 4CIDA 4CPVA 3ZWHA 5HL1A 2LVIA 1TTXA 2WCHA 5I2OA 4JQ0D 1F55A 3KPXA 1KQMC 2F33A 3OHMB 1QLSA 5DKRA 1SNLA 4E68A 3VRRA 1C07A 3FIAA 2KGBC 3CGAA 1K96A 5I8NA 2BL0B 2WCJA 4Q04A 5CSNA 3SG6A 1NUBA 1OZSA 3BYAA 2PRUA 1QV0A 3N7HA 2I18A 2LUCA 4ORAB 4PE7A 4YBHB 2IS9A 2E30A 1S3PA 2KI4B 2K2FA 2QEHA 1QATA 3L4LA 1B8RA 4I5KA 3SG5A 2CCMA 1C3ZA 3O4XA 1K90D 1RJVA 2JQ6A 3O78A 4PE0A 4OVNF 1K8UA 3PSRA 4NQGA 4XJKB 2G9BA 3CTNA 3NSIA 4DUQA 2JT8A 5CSJA 3A8RA 4YRUA 2JOJA 3QRXA 5JJGA 1FPWA 2Y1MA 1NYAA 4AQJA 2PVBA 3OB2B 1AJ4A 3JVTB 3L47A 4XJKA 1M63B 1J55A 1JF0A 5D7FA 1DQEA 2LANA 1Y6WA 2BKIB 2ISDA 1CFPA 3DZTA 1ALWA 2NCOA 2LV7A 1IRJA 1NX0A 1TWOA 5ER4X 3TS5B 1ZACA 3EK4A 3F45A 2BCXA 1DJHA 1SCVA 3I5HC 3ZNIA 1RECA 1XFUO 1CLMA 3CZ0A 2BBMA 1CNPA 1S5GY 1SR6C 2BE4A 2FOTA 3BUNB 1QWVA 3EK8A 3L4AA 1ALVA 3WNXB 3PN7C 2AUCA 1YVLA 3AKAA 1TOPA 4JD9A 4PHNA 1B7TY 1QVIZ 4PCWA 1B9AA 5JOLA 5G08A 3EKJA 4MRYA 2K7CA 1F4OA 2M97A 4YGDB 4QJ4B 2F2OA 2LP2A 4DCKA 2L2EA 2WORA 2HQ8A 1TUZA 2O5GA 1YUSA 4MBEA 1JSAA 1CDPA 2MJWB 3LCPC 3TUYC 1MF8B 1XO5A 4MZKA 1F8HA 1KSOA 4YGBB 5AFPA 1K94A 1GGZA 1ORGA 3HCMA 2BBNA 5F6TA 1LA3A 1JUOA 1CDMA 1L7ZA 2L5YA 4OR9B 4TNCA 3VRNA 2TN4A 2WC5A 2B1UA 1WRKA 2K0JA 1V1FA 2P6BB 2KAVA 1GJYA 3IQQA 1YTZC 3BFHA 2FJUB 3C1VA 1EG4A 3B86A 4CFQA 1NWDA 5ER5A 2MAZA 1OOIX 1WDCC 1WLZA 3AKBA 2ZNEA 1JWDA 1J1DA 1NPQA 1ZMZA 2H61A 2KBMA 2F8PA 1J7PA 3KEVA 4GBAA 3GK4X 1FI5A 1G4YR 2KYCA 2OTGB 5AXIA 2YGUA 2PASA 1KWOC 2KGRA 4ZCVA 1A2XA 1NP8A 1OMVA 1JFJA 1JBAA 1KK8B 1K93D 4INXA 1S36A 2MHHA 4C0KA 5KTYA 1KQVA 1WY9A 2EC6C 2NZ0A 1SL9A 2EC6B 4MZJA 3SG3A 3GK1A 3S0EA 1OOFA 1BR4B 3IQOA 1B8CA 2H61C 3SJSA 1AP4A 2EGDA 3BUXB 3D76A 1JFKA 1KWOB 3CDNA 2P71A 1BU3A 2LNKA 1GGWA 1U5IB 2K7DA 4JWQA 1F54A 3VROA 2ERBA 2LHLA 1U5IA 1YR5A 4USLA 1QS7A 2Q91A 3S0AA 1WRZA 2SCPA 4PALA 3S0DA 2ZFDA 2JRFA 1IG5A 1M45A 1ODBA 2JTTA 2K60A 3NHIA 1PVAA 3CZ2A 5KU1A 1KFUS 1AHRA 1JF2A 2WCBA 4ICBA 2QACA 5D3OA 2MRDA 3O6BA 2G2BA 5I2QA 4U8DA 2FCDA 3V2LA 1Q80A 5PALA 1V1GA 1Y1AA 1SL7A 1R2UA 2I2RE 1F4QA 3NXAA 4FQTA 2Y5IA 1C7WA 4WQ2A 1SK6D 3SIBA 2M8UA 1EJ3A 2LMVA 3CLNA 1K2HA 4IJ7A 4OZDA 2L4IA 1TNXA 1NCZA 1BF5A 1CLBA 1SMGA 1QIVA 1DTLA 3DVMA 1XFWO 2Q4UA 3BUOB 3VRPA 3R1OA 3CR5X 2BCAA 1N2DA 1DJZA 1AUIB 1YUTA 1W9ZA 2PYQA 2OPOA 3OX6A 4PHMA 5I94A 1OOHA 2ZNDA 3B7AA 2NCPA 5B8IB 3M0WA 2LP3A 1RWYA 1BR1B 1UWOA 1DGUA 4DS7A 2WCLA 1YX8A 2WCEA 5HKYA 2KPHA 4GAOA 2KNEA 2NLNA 2ZN8A 3CS1A 1TIZA 1ZOTB 4YGCB 2BNXA 2KAXA 4BY4A 1WLMA 3JTDB 3RZSA 3SG4A 2WCFA 3NSKA 1QLKA 3DF0B 1B8LA 5BPJA 1J7RA 1N0YA 2KLDA 2O60A 2KHNA 1XK4A 4N1GA 1HQVA 3B88A 2LM5A 2P70A 3I5IB 1YUUA 3BXKA 3BFAA 1J7OA 2LLUA 4GFTA 3BOWA 1Y1UA 3CZ1A 3EVUA 2DOQA 2I94A 2ZKMX 1OSAA 4MSPA 4BY5A 1W7IB 1QV1A 2FJYA 2PMYA 4QJ3B 1D1OA 3EVRA 1NCXA 5GQQC 4I5LB 2WCKA 1SYMA 4MEWA 3RM1A 1CM4A 1Y1XA 3DXLA 4PHKA 5DICA 1RROA 4YGAA 2M49B 2H2KA 3GK2A 3BFBA 4IL1A 2JNXA 3I5GB 1SSEB 2WC6A 2JULA 1SCMB 2LCPA 3TUYB 3QMEA 4YI8A 4DIRA 1FW4A 3AAJA 3D77A 1XFVO 4M2QA 4GGFA 1YRUB 3GOFA 3TDIA 2QEOA 3D73A 4HREE 1MR8A 1BT6A 3OP0A 3PM8A 1DF0B 1A75B 5FI6A 4WRIA 5IBWA 3PATA 2LC5A 2LMTA 1PULA 1TN4A 3NSLA 3EVVA 1QX5B 1AK8A 1RTP1 1LS8A 3PN7B 3S0BA 1Z4HA 5HLOA 3JVTC 4PDZA 4GUKA 2M3WA 3DD4A 2QEBA 2LVKA 3CABA 1MQ1A 2OS8C 2MBXA 1B1GA 3UNWA 4MRXA 3EG5B 1PK0D 4WQ3A 1PSBA 3LK1A 4R1EA 1DVIA 1IJ6A 2JC2A 1EXRA 1UHIA 1AJ5A 4JKTA 1EG3A 1M46A 4YGEB 3S0GA 1XFXO 1RK9A 2HPSA 2Y1NA 1DJGA 3SG7A 1OZOA 1S26D 1IWQA 5D69A 2LLTA 3DVJA 1B7TZ 2AAOA 2M0RA 3I5GC 4I5NB 2KQYA 4FQOA 1OW4A 1TNPA 4AQIA 2LVJA 3ICBA 2JWWA 3TDUA 4L9MA 4INWA 5FI7A 1YURA 2JZIA 3CYZA 2MA2A 2CBLA 1J1EA 1TUJA 1CMFA 4A4CA 1CM1A 2RGIA 4HRHA 3EKHA 2GV5A 3SG2A 1OQPA 3R1VA 3BUWB 4ZCUA 1BMOA 2KSPA 4GGNA 5DKQA 1L2OB 2JNFA 2KOTA 3FWBA 2ZRSA 1K9KA 3SS4A 2L51A 2F3YA 1GM0A 1SL8A 1R6PA 1BODA 1KQMB 1OOJA 3CWGA 2OTGC 4ETOA 2KFFA 1CFDA 1H4BA 2CTNA 1SCMC 1AVSA 3A4UB 3EK7A 3SIAA 1SW8A 2HF5A 2BAPA 1IJ5A 2M7LA 3UO9A 4QJ5B 3AAKA 1QX2A 5J3XA 2M29A 1UUSA 1GQMA 1K9UA 2L2CA 3OGNA 1JC2A 3LK0A 1CDNA 3BOWB 3I5FC 4HSZA 1CFCA 1CTRA 2WNDA 4XYNA 1YVHA 1B47A 4ORBB 1TCFA 1S6IA 2JXLA 3KHEA 2BECA 5HLVA 1A75A 1NCYA 2E6WA 2H8VA 2M7NA 1DF0A 1T14A 1NX3A 2M1KB 2K7BA 3FWCA 3KF9A 4MN0A 1XYDA 1UHJA 2L50A 4OCIA 1DJWA 4CLNA 1UHKA 1OE9B 1LXFC 3MSEB 5CPVA 1KSMA 1C3YA 5EL2A 3VB1A 1QXPA 1IH0A 2LVVA 1KFXS 4M2OA 2JU0A 1BG1A 3I5IC 2KI6C
chains in the Genus database with same CATH topology
2K8MB 2KI6D 3DVEA 3PFVA 1MXLC 3WHUB 1A29A 2CNPA 4PE1A 1MXEA 3OB1B 1IQ5A 3JTDC 3TDZA 1BLQA 1CDLA 4GPLB 1CMGA 2LAPA 2FCEA 1QJTA 1UURA 2A4JA 2K2AA 5K89A 1XFYO 4P2YB 2MLEC 2OS8B 2WOSA 1QX7A 2KAYA 4F0ZB 3KO0A 2LMUA 1PALA 3TS5C 3NSOA 2CT9A 1DMOA 1J7QA 5HKWA 1K9PA 1CLLA 2KDHA 3BUMB 1KFXL 2KI4C 4HRGA 2F2PA 1DJYA 1MHOA 5HYDA 1KFUL 1N65A 2GGZA 3CZTX 4AOMA 1NX2A 3DF0A 1FBVA 1F70A 1PSRA 2I7AA 2ZN9A 3D0YA 1LVCD 1VRKA 5CSFA 1NIWA 4N1FA 3VGOA 4CFRA 5FYXA 1TNQA 3K21A 5AANA 4YI9A 2BKHB 2EHBA 1OMDA 4M2PA 1G8IA 1HT9A 1M31A 2D8NA 5AEQA 1C7VA 4ORCB 5I2LA 4OV2A 1CFFA 2KYFA 2JTZA 1QTXA 2K61A 1WDCB 3I5HB 5DKNA 1YRTB 4OKHA 1QASA 1IQ3A 2KFHA 1UP5A 1SY9A 2PSRA 2V53A 3I5FB 1CB1A 1BJFA 1QVIY 3E3RA 1SBJA 1Y0VH 2BE6A 1LKJA 3BQ3A 2HQWA 1B4CA 1WRLA 5AERA 1S5GZ 3PALA 2LHIA 2M9GA 3LLEA 3O2PA 3RLZA 2ZRTA 1M39A 2JT0A 1DT7B 1S6CA 5KSZA 5CSIA 2AMIA 4N5XA 4NDCA 1KK7Z 1L2OC 1FF1A 1S6JA 2L98A 1KK8C 3HX4A 2KQ6A 4DRWA 1BOCA 1SR6B 1DJIA 2KBIA 2KFGA 4MZLA 1X02A 4D1EA 2COLB 4NDDA 4PHJA 2JPTA 1SPYA 3H4SE 2LLSA 4GNKB 1OMRA 3D0YB 1QIWA 2LUXA 1KK7Y 4I5JA 3DVKA 1SRAA 4FTGA 2M1UA 1LA0A 1CKKA 2SASA 2JXCA 3WXAA 1A4PA 1PVBA 1EL4A 3IF7A 2HETA 5TNCA 4NDBA 2L4HA 1IGVA 3FS7A 1TNWA 2R2IA 1G33A 4MLWA 4C0JA 1S1EA 4PE4A 3CR2A 1TCOB 3VRQA 2GGMA 1ZUZA 1UHNA 3LL8B 1NX1A 3D10A 1RFJA 4A4BA 2L5XB 2F3ZA 3WHTB 4UPGA 1E8AA 1IKUA 4P5OE 2QPTA 1FI6A 1MWNA 1XA5A 1XVJA 4MVFA 4C0LA 1SKTA 1YX7A 2JT3A 5HKZA 1ZFSA 3O4YA 1NSHA 2MLFC 2WC8A 1PRWA 1UHHA 1W7JB 1EH2A 1LINA 3TZ1A 1DGVA 1K95A 1MUXA 1TRFA 2BCBA 2LE9B 2VRGA 3CR4X 4GGFC 1F71A 4JPZB 1H8BA 1KCYA 2CXJA 2NXQA 3OX5A 2Y4QA 1A03A 1XFZO 2BL0C 1XK4C 2K7OA 2L0PA 3PLFB 1DJXA 2PALA 4CIDA 4CPVA 3ZWHA 2LVIA 1TTXA 5I2OA 4JQ0D 1F55A 3KPXA 1KQMC 2F33A 3OHMB 1QLSA 5DKRA 1SNLA 4E68A 3VRRA 1C07A 3FIAA 2KGBC 3CGAA 1K96A 5I8NA 2BL0B 4Q04A 5CSNA 3SG6A 1NUBA 1OZSA 3BYAA 2PRUA 1QV0A 2I18A 2LUCA 4ORAB 4PE7A 4YBHB 2IS9A 2E30A 1S3PA 2KI4B 2K2FA 4I5KA 1QATA 3SG5A 1B8RA 2CCMA 1K90D 1RJVA 2JQ6A 3O78A 4PE0A 4OVNF 1K8UA 3PSRA 4NQGA 4XJKB 2G9BA 3CTNA 3NSIA 4DUQA 2JT8A 5CSJA 3A8RA 4YRUA 2JOJA 3QRXA 5JJGA 1FPWA 2Y1MA 1NYAA 4AQJA 2PVBA 3OB2B 1AJ4A 3JVTB 4XJKA 1M63B 1J55A 1JF0A 5D7FA 2LANA 1Y6WA 2BKIB 2ISDA 1CFPA 1ALWA 2NCOA 2LV7A 1IRJA 1NX0A 5ER4X 3TS5B 1ZACA 3EK4A 3F45A 2BCXA 1DJHA 1SCVA 3I5HC 3ZNIA 1RECA 1XFUO 1CLMA 2BBMA 1CNPA 1S5GY 1SR6C 2BE4A 2FOTA 3BUNB 3EK8A 1ALVA 3WNXB 3PN7C 2AUCA 1YVLA 3AKAA 1TOPA 4PHNA 1B7TY 1QVIZ 4PCWA 1B9AA 5JOLA 5G08A 3EKJA 4MRYA 2K7CA 1F4OA 2M97A 4YGDB 4QJ4B 2F2OA 2LP2A 4DCKA 2L2EA 2WORA 2HQ8A 2O5GA 1YUSA 4MBEA 1JSAA 1CDPA 2MJWB 3LCPC 3TUYC 1MF8B 1XO5A 4MZKA 1F8HA 1KSOA 4YGBB 5AFPA 1K94A 1GGZA 3HCMA 2BBNA 5F6TA 1LA3A 1JUOA 1CDMA 1L7ZA 4OR9B 4TNCA 3VRNA 2TN4A 2B1UA 1WRKA 2K0JA 1V1FA 2P6BB 2KAVA 1GJYA 3IQQA 1YTZC 2FJUB 3C1VA 1EG4A 4CFQA 1NWDA 5ER5A 2MAZA 1WDCC 1WLZA 3AKBA 2ZNEA 1JWDA 1J1DA 1NPQA 1ZMZA 2H61A 2KBMA 2F8PA 1J7PA 3KEVA 4GBAA 3GK4X 1FI5A 1G4YR 2KYCA 2OTGB 5AXIA 2PASA 1KWOC 2KGRA 4ZCVA 1A2XA 1NP8A 1OMVA 1JFJA 1JBAA 1KK8B 1K93D 1KQVA 1S36A 2MHHA 4C0KA 5KTYA 1WY9A 2EC6C 2NZ0A 1SL9A 2EC6B 4MZJA 3SG3A 3GK1A 1BR4B 3IQOA 1B8CA 2H61C 3SJSA 1AP4A 2EGDA 3BUXB 1JFKA 1KWOB 1BU3A 2LNKA 1GGWA 1U5IB 2K7DA 4JWQA 1F54A 3VROA 2LHLA 1U5IA 1YR5A 4USLA 1QS7A 2Q91A 1WRZA 2SCPA 4PALA 2ZFDA 2JRFA 1IG5A 1M45A 1ODBA 2JTTA 1PVAA 5KU1A 1KFUS 1AHRA 1JF2A 2WCBA 4ICBA 2QACA 2MRDA 3O6BA 2G2BA 5I2QA 4U8DA 2FCDA 1Q80A 5PALA 1V1GA 1Y1AA 1SL7A 1R2UA 2I2RE 1F4QA 3NXAA 4WQ2A 2Y5IA 1C7WA 1SK6D 3SIBA 2M8UA 1EJ3A 2LMVA 3CLNA 1K2HA 2L4IA 1TNXA 1NCZA 1BF5A 1CLBA 1SMGA 1QIVA 1DTLA 3DVMA 1XFWO 2Q4UA 3BUOB 3VRPA 3CR5X 1N2DA 1DJZA 2BCAA 1AUIB 1YUTA 3OX6A 2OPOA 4PHMA 2ZNDA 2NCPA 5B8IB 3M0WA 2LP3A 1RWYA 1BR1B 1UWOA 1DGUA 4DS7A 1YX8A 2WCEA 5HKYA 4GAOA 2KNEA 2NLNA 2ZN8A 3CS1A 1TIZA 1ZOTB 4YGCB 4BY4A 2KAXA 1WLMA 3JTDB 3SG4A 2WCFA 3NSKA 1QLKA 3DF0B 1B8LA 5BPJA 1J7RA 1N0YA 2O60A 2KHNA 1XK4A 4N1GA 1HQVA 2LM5A 3I5IB 1YUUA 3BXKA 1J7OA 2LLUA 4GFTA 3BOWA 1Y1UA 3EVUA 2DOQA 2I94A 2ZKMX 1OSAA 4MSPA 4BY5A 1W7IB 1QV1A 2PMYA 4QJ3B 1D1OA 3EVRA 1NCXA 5GQQC 4I5LB 1SYMA 4MEWA 3RM1A 1CM4A 1Y1XA 4PHKA 1RROA 4YGAA 2M49B 2H2KA 3GK2A 4IL1A 2JNXA 3I5GB 2JULA 1SCMB 2LCPA 3TUYB 4YI8A 4DIRA 1FW4A 3AAJA 1XFVO 4M2QA 4GGFA 1YRUB 3GOFA 3TDIA 4HREE 1MR8A 1BT6A 3OP0A 3PM8A 1DF0B 1A75B 4WRIA 5IBWA 3PATA 2LC5A 2LMTA 1PULA 1TN4A 3NSLA 3EVVA 1QX5B 1AK8A 1RTP1 3PN7B 5HLOA 3JVTC 4PDZA 4GUKA 2M3WA 3DD4A 2LVKA 1MQ1A 2OS8C 2MBXA 1B1GA 4MRXA 1PK0D 4WQ3A 1PSBA 3LK1A 4R1EA 1DVIA 1IJ6A 2JC2A 1EXRA 1UHIA 1AJ5A 1EG3A 1M46A 4YGEB 1XFXO 1RK9A 2HPSA 2Y1NA 1DJGA 3SG7A 1OZOA 1S26D 1IWQA 5D69A 2LLTA 3DVJA 1B7TZ 2AAOA 2M0RA 3I5GC 4I5NB 2KQYA 4FQOA 4AQIA 1TNPA 2LVJA 3ICBA 2JWWA 3TDUA 4L9MA 1YURA 2JZIA 2MA2A 2CBLA 1J1EA 1CMFA 4A4CA 1CM1A 2RGIA 4HRHA 3EKHA 2GV5A 3SG2A 1OQPA 3BUWB 4ZCUA 1BMOA 2KSPA 4GGNA 5DKQA 1L2OB 2JNFA 2KOTA 3FWBA 2ZRSA 1K9KA 2L51A 2F3YA 1SL8A 1R6PA 1BODA 1KQMB 1OOJA 3CWGA 2OTGC 4ETOA 2KFFA 1CFDA 1H4BA 2CTNA 1SCMC 1AVSA 3A4UB 3EK7A 3SIAA 1SW8A 2HF5A 4QJ5B 1IJ5A 2M7LA 3AAKA 1QX2A 5J3XA 2M29A 1UUSA 1GQMA 1K9UA 1JC2A 3LK0A 1CDNA 3BOWB 3I5FC 4HSZA 1CFCA 1CTRA 2WNDA 4XYNA 1YVHA 1B47A 4ORBB 1TCFA 1S6IA 2JXLA 3KHEA 2BECA 5HLVA 1A75A 1NCYA 2E6WA 2M7NA 1DF0A 2M1KB 1NX3A 3FWCA 2K7BA 3KF9A 4MN0A 4OCIA 1XYDA 1UHJA 2L50A 1DJWA 4CLNA 1UHKA 1OE9B 1LXFC 3MSEB 5CPVA 1KSMA 1IH0A 1QXPA 2LVVA 1KFXS 4M2OA 2JU0A 1BG1A 3I5IC 2KI6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8M B;  2KI6 D;  3DVE A;  3PFV A;  1MXL C;  3WHU B;  1A29 A;  2CNP A;  4PE1 A;  1MXE A;  3OB1 B;  1IQ5 A;  3JTD C;  3TDZ A;  1BLQ A;  1CDL A;  4GPL B;  1CMG A;  2LAP A;  2FCE A;  1QJT A;  1UUR A;  2A4J A;  2K2A A;  5K89 A;  1XFY O;  4P2Y B;  2MLE C;  2OS8 B;  2WOS A;  1QX7 A;  2KAY A;  4F0Z B;  3KO0 A;  2LMU A;  1PAL A;  3TS5 C;  3NSO A;  2CT9 A;  1DMO A;  1J7Q A;  5HKW A;  1K9P A;  1CLL A;  2KDH A;  3BUM B;  1KFX L;  2KI4 C;  4HRG A;  2F2P A;  1DJY A;  1MHO A;  5HYD A;  1KFU L;  1N65 A;  2GGZ A;  3CZT X;  4AOM A;  1NX2 A;  3DF0 A;  1FBV A;  1F70 A;  1PSR A;  2I7A A;  2ZN9 A;  3D0Y A;  1LVC D;  1VRK A;  5CSF A;  1NIW A;  4N1F A;  3VGO A;  4CFR A;  5FYX A;  1TNQ A;  3K21 A;  5AAN A;  4YI9 A;  2BKH B;  2EHB A;  1OMD A;  4M2P A;  1G8I A;  1HT9 A;  1M31 A;  2D8N A;  5AEQ A;  1C7V A;  4ORC B;  5I2L A;  4OV2 A;  1CFF A;  2KYF A;  2JTZ A;  1QTX A;  2K61 A;  1WDC B;  3I5H B;  5DKN A;  1YRT B;  4OKH A;  1QAS A;  1IQ3 A;  2KFH A;  1UP5 A;  1SY9 A;  2PSR A;  2V53 A;  3I5F B;  1CB1 A;  1BJF A;  1QVI Y;  3E3R A;  1SBJ A;  1Y0V H;  2BE6 A;  1LKJ A;  3BQ3 A;  2HQW A;  1B4C A;  1WRL A;  5AER A;  1S5G Z;  3PAL A;  2LHI A;  2M9G A;  3LLE A;  3O2P A;  3RLZ A;  2ZRT A;  1M39 A;  2JT0 A;  1DT7 B;  1S6C A;  5KSZ A;  5CSI A;  2AMI A;  4N5X A;  4NDC A;  1KK7 Z;  1L2O C;  1FF1 A;  1S6J A;  2L98 A;  1KK8 C;  3HX4 A;  2KQ6 A;  4DRW A;  1BOC A;  1SR6 B;  1DJI A;  2KBI A;  2KFG A;  4MZL A;  1X02 A;  4D1E A;  2COL B;  4NDD A;  4PHJ A;  2JPT A;  1SPY A;  3H4S E;  2LLS A;  4GNK B;  1OMR A;  3D0Y B;  1QIW A;  2LUX A;  1KK7 Y;  4I5J A;  3DVK A;  1SRA A;  4FTG A;  2M1U A;  1LA0 A;  1CKK A;  2SAS A;  2JXC A;  3WXA A;  1A4P A;  1PVB A;  1EL4 A;  3IF7 A;  2HET A;  5TNC A;  4NDB A;  2L4H A;  1IGV A;  3FS7 A;  1TNW A;  2R2I A;  1G33 A;  4MLW A;  4C0J A;  1S1E A;  4PE4 A;  3CR2 A;  1TCO B;  3VRQ A;  2GGM A;  1ZUZ A;  1UHN A;  3LL8 B;  1NX1 A;  3D10 A;  1RFJ A;  4A4B A;  2L5X B;  2F3Z A;  3WHT B;  4UPG A;  1E8A A;  1IKU A;  4P5O E;  2QPT A;  1FI6 A;  1MWN A;  1XA5 A;  1XVJ A;  4MVF A;  4C0L A;  1SKT A;  1YX7 A;  2JT3 A;  5HKZ A;  1ZFS A;  3O4Y A;  1NSH A;  2MLF C;  2WC8 A;  1PRW A;  1UHH A;  1W7J B;  1EH2 A;  1LIN A;  3TZ1 A;  1DGV A;  1K95 A;  1MUX A;  1TRF A;  2BCB A;  2LE9 B;  2VRG A;  3CR4 X;  4GGF C;  1F71 A;  4JPZ B;  1H8B A;  1KCY A;  2CXJ A;  2NXQ A;  3OX5 A;  2Y4Q A;  1A03 A;  1XFZ O;  2BL0 C;  1XK4 C;  2K7O A;  2L0P A;  3PLF B;  1DJX A;  2PAL A;  4CID A;  4CPV A;  3ZWH A;  2LVI A;  1TTX A;  5I2O A;  4JQ0 D;  1F55 A;  3KPX A;  1KQM C;  2F33 A;  3OHM B;  1QLS A;  5DKR A;  1SNL A;  4E68 A;  3VRR A;  1C07 A;  3FIA A;  2KGB C;  3CGA A;  1K96 A;  5I8N A;  2BL0 B;  4Q04 A;  5CSN A;  3SG6 A;  1NUB A;  1OZS A;  3BYA A;  2PRU A;  1QV0 A;  2I18 A;  2LUC A;  4ORA B;  4PE7 A;  4YBH B;  2IS9 A;  2E30 A;  1S3P A;  2KI4 B;  2K2F A;  4I5K A;  1QAT A;  3SG5 A;  1B8R A;  2CCM A;  1K90 D;  1RJV A;  2JQ6 A;  3O78 A;  4PE0 A;  4OVN F;  1K8U A;  3PSR A;  4NQG A;  4XJK B;  2G9B A;  3CTN A;  3NSI A;  4DUQ A;  2JT8 A;  5CSJ A;  3A8R A;  4YRU A;  2JOJ A;  3QRX A;  5JJG A;  1FPW A;  2Y1M A;  1NYA A;  4AQJ A;  2PVB A;  3OB2 B;  1AJ4 A;  3JVT B;  4XJK A;  1M63 B;  1J55 A;  1JF0 A;  5D7F A;  2LAN A;  1Y6W A;  2BKI B;  2ISD A;  1CFP A;  1ALW A;  2NCO A;  2LV7 A;  1IRJ A;  1NX0 A;  5ER4 X;  3TS5 B;  1ZAC A;  3EK4 A;  3F45 A;  2BCX A;  1DJH A;  1SCV A;  3I5H C;  3ZNI A;  1REC A;  1XFU O;  1CLM A;  2BBM A;  1CNP A;  1S5G Y;  1SR6 C;  2BE4 A;  2FOT A;  3BUN B;  3EK8 A;  1ALV A;  3WNX B;  3PN7 C;  2AUC A;  1YVL A;  3AKA A;  1TOP A;  4PHN A;  1B7T Y;  1QVI Z;  4PCW A;  1B9A A;  5JOL A;  5G08 A;  3EKJ A;  4MRY A;  2K7C A;  1F4O A;  2M97 A;  4YGD B;  4QJ4 B;  2F2O A;  2LP2 A;  4DCK A;  2L2E A;  2WOR A;  2HQ8 A;  2O5G A;  1YUS A;  4MBE A;  1JSA A;  1CDP A;  2MJW B;  3LCP C;  3TUY C;  1MF8 B;  1XO5 A;  4MZK A;  1F8H A;  1KSO A;  4YGB B;  5AFP A;  1K94 A;  1GGZ A;  3HCM A;  2BBN A;  5F6T A;  1LA3 A;  1JUO A;  1CDM A;  1L7Z A;  4OR9 B;  4TNC A;  3VRN A;  2TN4 A;  2B1U A;  1WRK A;  2K0J A;  1V1F A;  2P6B B;  2KAV A;  1GJY A;  3IQQ A;  1YTZ C;  2FJU B;  3C1V A;  1EG4 A;  4CFQ A;  1NWD A;  5ER5 A;  2MAZ A;  1WDC C;  1WLZ A;  3AKB A;  2ZNE A;  1JWD A;  1J1D A;  1NPQ A;  1ZMZ A;  2H61 A;  2KBM A;  2F8P A;  1J7P A;  3KEV A;  4GBA A;  3GK4 X;  1FI5 A;  1G4Y R;  2KYC A;  2OTG B;  5AXI A;  2PAS A;  1KWO C;  2KGR A;  4ZCV A;  1A2X A;  1NP8 A;  1OMV A;  1JFJ A;  1JBA A;  1KK8 B;  1K93 D;  1KQV A;  1S36 A;  2MHH A;  4C0K A;  5KTY A;  1WY9 A;  2EC6 C;  2NZ0 A;  1SL9 A;  2EC6 B;  4MZJ A;  3SG3 A;  3GK1 A;  1BR4 B;  3IQO A;  1B8C A;  2H61 C;  3SJS A;  1AP4 A;  2EGD A;  3BUX B;  1JFK A;  1KWO B;  1BU3 A;  2LNK A;  1GGW A;  1U5I B;  2K7D A;  4JWQ A;  1F54 A;  3VRO A;  2LHL A;  1U5I A;  1YR5 A;  4USL A;  1QS7 A;  2Q91 A;  1WRZ A;  2SCP A;  4PAL A;  2ZFD A;  2JRF A;  1IG5 A;  1M45 A;  1ODB A;  2JTT A;  1PVA A;  5KU1 A;  1KFU S;  1AHR A;  1JF2 A;  2WCB A;  4ICB A;  2QAC A;  2MRD A;  3O6B A;  2G2B A;  5I2Q A;  4U8D A;  2FCD A;  1Q80 A;  5PAL A;  1V1G A;  1Y1A A;  1SL7 A;  1R2U A;  2I2R E;  1F4Q A;  3NXA A;  4WQ2 A;  2Y5I A;  1C7W A;  1SK6 D;  3SIB A;  2M8U A;  1EJ3 A;  2LMV A;  3CLN A;  1K2H A;  2L4I A;  1TNX A;  1NCZ A;  1BF5 A;  1CLB A;  1SMG A;  1QIV A;  1DTL A;  3DVM A;  1XFW O;  2Q4U A;  3BUO B;  3VRP A;  3CR5 X;  1N2D A;  1DJZ A;  2BCA A;  1AUI B;  1YUT A;  3OX6 A;  2OPO A;  4PHM A;  2ZND A;  2NCP A;  5B8I B;  3M0W A;  2LP3 A;  1RWY A;  1BR1 B;  1UWO A;  1DGU A;  4DS7 A;  1YX8 A;  2WCE A;  5HKY A;  4GAO A;  2KNE A;  2NLN A;  2ZN8 A;  3CS1 A;  1TIZ A;  1ZOT B;  4YGC B;  4BY4 A;  2KAX A;  1WLM A;  3JTD B;  3SG4 A;  2WCF A;  3NSK A;  1QLK A;  3DF0 B;  1B8L A;  5BPJ A;  1J7R A;  1N0Y A;  2O60 A;  2KHN A;  1XK4 A;  4N1G A;  1HQV A;  2LM5 A;  3I5I B;  1YUU A;  3BXK A;  1J7O A;  2LLU A;  4GFT A;  3BOW A;  1Y1U A;  3EVU A;  2DOQ A;  2I94 A;  2ZKM X;  1OSA A;  4MSP A;  4BY5 A;  1W7I B;  1QV1 A;  2PMY A;  4QJ3 B;  1D1O A;  3EVR A;  1NCX A;  5GQQ C;  4I5L B;  1SYM A;  4MEW A;  3RM1 A;  1CM4 A;  1Y1X A;  4PHK A;  1RRO A;  4YGA A;  2M49 B;  2H2K A;  3GK2 A;  4IL1 A;  2JNX A;  3I5G B;  2JUL A;  1SCM B;  2LCP A;  3TUY B;  4YI8 A;  4DIR A;  1FW4 A;  3AAJ A;  1XFV O;  4M2Q A;  4GGF A;  1YRU B;  3GOF A;  3TDI A;  4HRE E;  1MR8 A;  1BT6 A;  3OP0 A;  3PM8 A;  1DF0 B;  1A75 B;  4WRI A;  5IBW A;  3PAT A;  2LC5 A;  2LMT A;  1PUL A;  1TN4 A;  3NSL A;  3EVV A;  1QX5 B;  1AK8 A;  1RTP 1;  3PN7 B;  5HLO A;  3JVT C;  4PDZ A;  4GUK A;  2M3W A;  3DD4 A;  2LVK A;  1MQ1 A;  2OS8 C;  2MBX A;  1B1G A;  4MRX A;  1PK0 D;  4WQ3 A;  1PSB A;  3LK1 A;  4R1E A;  1DVI A;  1IJ6 A;  2JC2 A;  1EXR A;  1UHI A;  1AJ5 A;  1EG3 A;  1M46 A;  4YGE B;  1XFX O;  1RK9 A;  2HPS A;  2Y1N A;  1DJG A;  3SG7 A;  1OZO A;  1S26 D;  1IWQ A;  5D69 A;  2LLT A;  3DVJ A;  1B7T Z;  2AAO A;  2M0R A;  3I5G C;  4I5N B;  2KQY A;  4FQO A;  4AQI A;  1TNP A;  2LVJ A;  3ICB A;  2JWW A;  3TDU A;  4L9M A;  1YUR A;  2JZI A;  2MA2 A;  2CBL A;  1J1E A;  1CMF A;  4A4C A;  1CM1 A;  2RGI A;  4HRH A;  3EKH A;  2GV5 A;  3SG2 A;  1OQP A;  3BUW B;  4ZCU A;  1BMO A;  2KSP A;  4GGN A;  5DKQ A;  1L2O B;  2JNF A;  2KOT A;  3FWB A;  2ZRS A;  1K9K A;  2L51 A;  2F3Y A;  1SL8 A;  1R6P A;  1BOD A;  1KQM B;  1OOJ A;  3CWG A;  2OTG C;  4ETO A;  2KFF A;  1CFD A;  1H4B A;  2CTN A;  1SCM C;  1AVS A;  3A4U B;  3EK7 A;  3SIA A;  1SW8 A;  2HF5 A;  4QJ5 B;  1IJ5 A;  2M7L A;  3AAK A;  1QX2 A;  5J3X A;  2M29 A;  1UUS A;  1GQM A;  1K9U A;  1JC2 A;  3LK0 A;  1CDN A;  3BOW B;  3I5F C;  4HSZ A;  1CFC A;  1CTR A;  2WND A;  4XYN A;  1YVH A;  1B47 A;  4ORB B;  1TCF A;  1S6I A;  2JXL A;  3KHE A;  2BEC A;  5HLV A;  1A75 A;  1NCY A;  2E6W A;  2M7N A;  1DF0 A;  2M1K B;  1NX3 A;  3FWC A;  2K7B A;  3KF9 A;  4MN0 A;  4OCI A;  1XYD A;  1UHJ A;  2L50 A;  1DJW A;  4CLN A;  1UHK A;  1OE9 B;  1LXF C;  3MSE B;  5CPV A;  1KSM A;  1IH0 A;  1QXP A;  2LVV A;  1KFX S;  4M2O A;  2JU0 A;  1BG1 A;  3I5I C;  2KI6 C; 
#chains in the Genus database with same CATH topology
 2K8M B;  2KI6 D;  3DVE A;  3PFV A;  1MXL C;  3WHU B;  1A29 A;  2CNP A;  4PE1 A;  1MXE A;  3OB1 B;  1IQ5 A;  3JTD C;  3OBV A;  3TDZ A;  1BLQ A;  1CDL A;  4GPL B;  1CMG A;  2LAP A;  2FCE A;  1QJT A;  1UUR A;  2A4J A;  2K2A A;  2WCM A;  1XFY O;  4P2Y B;  2MLE C;  2OS8 B;  3SS3 A;  2WOS A;  5K89 A;  1DC1 A;  1QX7 A;  2KAY A;  4F0Z B;  1IIO A;  3KO0 A;  2LMU A;  1PAL A;  3TS5 C;  3NSO A;  2CT9 A;  1DMO A;  1J7Q A;  5HKW A;  1K9P A;  3K1E A;  1CLL A;  2KDH A;  3BUM B;  1KFX L;  2KI4 C;  4HRG A;  2F2P A;  1DJY A;  1MHO A;  5HYD A;  1KFU L;  1N65 A;  2GGZ A;  3CZT X;  4AOM A;  1NX2 A;  3DF0 A;  4F7F A;  1FBV A;  1F70 A;  1PSR A;  2I7A A;  2ZN9 A;  3D0Y A;  1LVC D;  1VRK A;  5CSF A;  1NIW A;  4N1F A;  3VGO A;  4CFR A;  5FYX A;  1TNQ A;  1XFR A;  3K21 A;  5AAN A;  4YI9 A;  1OOG A;  2BKH B;  2EHB A;  1OMD A;  4M2P A;  1G8I A;  1HT9 A;  1M31 A;  2D8N A;  5AEQ A;  1C7V A;  4ORC B;  5FI2 A;  3D78 A;  5I2L A;  4OV2 A;  1CFF A;  2KYF A;  2JTZ A;  1QTX A;  2K61 A;  1WDC B;  3FE8 A;  3I5H B;  5DKN A;  1YRT B;  4OKH A;  1QAS A;  1IQ3 A;  2KFH A;  1UP5 A;  1SY9 A;  2PSR A;  2V53 A;  3I5F B;  1CB1 A;  1BJF A;  3IVT A;  1QVI Y;  3E3R A;  2QDI A;  3D74 A;  1SBJ A;  1Y0V H;  2BE6 A;  1LKJ A;  3BQ3 A;  2HQW A;  2JPO A;  1B4C A;  1WRL A;  5AER A;  1S5G Z;  3PAL A;  2LHI A;  2M9G A;  3LLE A;  3O2P A;  3RLZ A;  1Z2C B;  2ZRT A;  1M39 A;  3FE6 A;  2JT0 A;  1DT7 B;  3PJI A;  1S6C A;  3PM2 A;  5CSI A;  1DEK A;  2AMI A;  5KSZ A;  4N5X A;  4NDC A;  1KK7 Z;  1L2O C;  1FF1 A;  1S6J A;  2L98 A;  1KK8 C;  3DYE A;  3HX4 A;  2KQ6 A;  4DRW A;  1BOC A;  1SR6 B;  1DJI A;  2KBI A;  2KFG A;  4MZL A;  3B6X A;  1X02 A;  4D1E A;  2KLE A;  2COL B;  4NDD A;  4PHJ A;  2JPT A;  1SPY A;  3NGV A;  3H4S E;  2LLS A;  4GNK B;  1OMR A;  3D0Y B;  1QIW A;  2LUX A;  1P28 A;  1KK7 Y;  4I5J A;  3DVK A;  3S0F A;  1SRA A;  4FTG A;  2M1U A;  1LA0 A;  1CKK A;  2SAS A;  2JXC A;  3WXA A;  1A4P A;  1PVB A;  1EL4 A;  2QEV A;  3D75 A;  3FE9 A;  3IF7 A;  2HET A;  5TNC A;  2PQL A;  4NDB A;  2L4H A;  1IGV A;  3FS7 A;  1TNW A;  2R2I A;  1G33 A;  4MLW A;  3BJH A;  4C0J A;  1S1E A;  4PE4 A;  3CR2 A;  1TCO B;  3VRQ A;  1ZUZ A;  2GGM A;  1UHN A;  3LL8 B;  1NX1 A;  3D10 A;  3DY9 A;  1RFJ A;  4A4B A;  2L5X B;  2F3Z A;  4PT1 A;  3WHT B;  4UPG A;  1DEL A;  1E8A A;  1IKU A;  4P5O E;  2QPT A;  3R72 A;  1FI6 A;  1MWN A;  1XA5 A;  1XVJ A;  4MVF A;  4C0L A;  1SKT A;  1YX7 A;  2JT3 A;  5HKZ A;  1ZFS A;  3NHT A;  3O4Y A;  4KYN A;  1NSH A;  2MLF C;  2WC8 A;  1PRW A;  1UHH A;  1W7J B;  1EH2 A;  1LIN A;  3Q8I A;  3TZ1 A;  2GTE A;  1DGV A;  1K95 A;  1MUX A;  1TRF A;  2BCB A;  2LE9 B;  2VRG A;  3B87 A;  3CR4 X;  4GGF C;  4JPZ B;  1F71 A;  1H8B A;  1KCY A;  2CXJ A;  2NXQ A;  3OX5 A;  2Y4Q A;  1A03 A;  3SS5 A;  1XFZ O;  2BL0 C;  1XK4 C;  2K7O A;  2L0P A;  3PLF B;  1DJX A;  2PAL A;  3R1P A;  4CID A;  4CPV A;  3ZWH A;  5HL1 A;  2LVI A;  1TTX A;  2WCH A;  5I2O A;  4JQ0 D;  1F55 A;  3KPX A;  1KQM C;  2F33 A;  3OHM B;  1QLS A;  5DKR A;  1SNL A;  4E68 A;  3VRR A;  1C07 A;  3FIA A;  2KGB C;  3CGA A;  1K96 A;  5I8N A;  2BL0 B;  2WCJ A;  4Q04 A;  5CSN A;  3SG6 A;  1NUB A;  1OZS A;  3BYA A;  2PRU A;  1QV0 A;  3N7H A;  2I18 A;  2LUC A;  4ORA B;  4PE7 A;  4YBH B;  2IS9 A;  2E30 A;  1S3P A;  2KI4 B;  2K2F A;  2QEH A;  1QAT A;  3L4L A;  1B8R A;  4I5K A;  3SG5 A;  2CCM A;  1C3Z A;  3O4X A;  1K90 D;  1RJV A;  2JQ6 A;  3O78 A;  4PE0 A;  4OVN F;  1K8U A;  3PSR A;  4NQG A;  4XJK B;  2G9B A;  3CTN A;  3NSI A;  4DUQ A;  2JT8 A;  5CSJ A;  3A8R A;  4YRU A;  2JOJ A;  3QRX A;  5JJG A;  1FPW A;  2Y1M A;  1NYA A;  4AQJ A;  2PVB A;  3OB2 B;  1AJ4 A;  3JVT B;  3L47 A;  4XJK A;  1M63 B;  1J55 A;  1JF0 A;  5D7F A;  1DQE A;  2LAN A;  1Y6W A;  2BKI B;  2ISD A;  1CFP A;  3DZT A;  1ALW A;  2NCO A;  2LV7 A;  1IRJ A;  1NX0 A;  1TWO A;  5ER4 X;  3TS5 B;  1ZAC A;  3EK4 A;  3F45 A;  2BCX A;  1DJH A;  1SCV A;  3I5H C;  3ZNI A;  1REC A;  1XFU O;  1CLM A;  3CZ0 A;  2BBM A;  1CNP A;  1S5G Y;  1SR6 C;  2BE4 A;  2FOT A;  3BUN B;  1QWV A;  3EK8 A;  3L4A A;  1ALV A;  3WNX B;  3PN7 C;  2AUC A;  1YVL A;  3AKA A;  1TOP A;  4JD9 A;  4PHN A;  1B7T Y;  1QVI Z;  4PCW A;  1B9A A;  5JOL A;  5G08 A;  3EKJ A;  4MRY A;  2K7C A;  1F4O A;  2M97 A;  4YGD B;  4QJ4 B;  2F2O A;  2LP2 A;  4DCK A;  2L2E A;  2WOR A;  2HQ8 A;  1TUZ A;  2O5G A;  1YUS A;  4MBE A;  1JSA A;  1CDP A;  2MJW B;  3LCP C;  3TUY C;  1MF8 B;  1XO5 A;  4MZK A;  1F8H A;  1KSO A;  4YGB B;  5AFP A;  1K94 A;  1GGZ A;  1ORG A;  3HCM A;  2BBN A;  5F6T A;  1LA3 A;  1JUO A;  1CDM A;  1L7Z A;  2L5Y A;  4OR9 B;  4TNC A;  3VRN A;  2TN4 A;  2WC5 A;  2B1U A;  1WRK A;  2K0J A;  1V1F A;  2P6B B;  2KAV A;  1GJY A;  3IQQ A;  1YTZ C;  3BFH A;  2FJU B;  3C1V A;  1EG4 A;  3B86 A;  4CFQ A;  1NWD A;  5ER5 A;  2MAZ A;  1OOI X;  1WDC C;  1WLZ A;  3AKB A;  2ZNE A;  1JWD A;  1J1D A;  1NPQ A;  1ZMZ A;  2H61 A;  2KBM A;  2F8P A;  1J7P A;  3KEV A;  4GBA A;  3GK4 X;  1FI5 A;  1G4Y R;  2KYC A;  2OTG B;  5AXI A;  2YGU A;  2PAS A;  1KWO C;  2KGR A;  4ZCV A;  1A2X A;  1NP8 A;  1OMV A;  1JFJ A;  1JBA A;  1KK8 B;  1K93 D;  4INX A;  1S36 A;  2MHH A;  4C0K A;  5KTY A;  1KQV A;  1WY9 A;  2EC6 C;  2NZ0 A;  1SL9 A;  2EC6 B;  4MZJ A;  3SG3 A;  3GK1 A;  3S0E A;  1OOF A;  1BR4 B;  3IQO A;  1B8C A;  2H61 C;  3SJS A;  1AP4 A;  2EGD A;  3BUX B;  3D76 A;  1JFK A;  1KWO B;  3CDN A;  2P71 A;  1BU3 A;  2LNK A;  1GGW A;  1U5I B;  2K7D A;  4JWQ A;  1F54 A;  3VRO A;  2ERB A;  2LHL A;  1U5I A;  1YR5 A;  4USL A;  1QS7 A;  2Q91 A;  3S0A A;  1WRZ A;  2SCP A;  4PAL A;  3S0D A;  2ZFD A;  2JRF A;  1IG5 A;  1M45 A;  1ODB A;  2JTT A;  2K60 A;  3NHI A;  1PVA A;  3CZ2 A;  5KU1 A;  1KFU S;  1AHR A;  1JF2 A;  2WCB A;  4ICB A;  2QAC A;  5D3O A;  2MRD A;  3O6B A;  2G2B A;  5I2Q A;  4U8D A;  2FCD A;  3V2L A;  1Q80 A;  5PAL A;  1V1G A;  1Y1A A;  1SL7 A;  1R2U A;  2I2R E;  1F4Q A;  3NXA A;  4FQT A;  2Y5I A;  1C7W A;  4WQ2 A;  1SK6 D;  3SIB A;  2M8U A;  1EJ3 A;  2LMV A;  3CLN A;  1K2H A;  4IJ7 A;  4OZD A;  2L4I A;  1TNX A;  1NCZ A;  1BF5 A;  1CLB A;  1SMG A;  1QIV A;  1DTL A;  3DVM A;  1XFW O;  2Q4U A;  3BUO B;  3VRP A;  3R1O A;  3CR5 X;  2BCA A;  1N2D A;  1DJZ A;  1AUI B;  1YUT A;  1W9Z A;  2PYQ A;  2OPO A;  3OX6 A;  4PHM A;  5I94 A;  1OOH A;  2ZND A;  3B7A A;  2NCP A;  5B8I B;  3M0W A;  2LP3 A;  1RWY A;  1BR1 B;  1UWO A;  1DGU A;  4DS7 A;  2WCL A;  1YX8 A;  2WCE A;  5HKY A;  2KPH A;  4GAO A;  2KNE A;  2NLN A;  2ZN8 A;  3CS1 A;  1TIZ A;  1ZOT B;  4YGC B;  2BNX A;  2KAX A;  4BY4 A;  1WLM A;  3JTD B;  3RZS A;  3SG4 A;  2WCF A;  3NSK A;  1QLK A;  3DF0 B;  1B8L A;  5BPJ A;  1J7R A;  1N0Y A;  2KLD A;  2O60 A;  2KHN A;  1XK4 A;  4N1G A;  1HQV A;  3B88 A;  2LM5 A;  2P70 A;  3I5I B;  1YUU A;  3BXK A;  3BFA A;  1J7O A;  2LLU A;  4GFT A;  3BOW A;  1Y1U A;  3CZ1 A;  3EVU A;  2DOQ A;  2I94 A;  2ZKM X;  1OSA A;  4MSP A;  4BY5 A;  1W7I B;  1QV1 A;  2FJY A;  2PMY A;  4QJ3 B;  1D1O A;  3EVR A;  1NCX A;  5GQQ C;  4I5L B;  2WCK A;  1SYM A;  4MEW A;  3RM1 A;  1CM4 A;  1Y1X A;  3DXL A;  4PHK A;  5DIC A;  1RRO A;  4YGA A;  2M49 B;  2H2K A;  3GK2 A;  3BFB A;  4IL1 A;  2JNX A;  3I5G B;  1SSE B;  2WC6 A;  2JUL A;  1SCM B;  2LCP A;  3TUY B;  3QME A;  4YI8 A;  4DIR A;  1FW4 A;  3AAJ A;  3D77 A;  1XFV O;  4M2Q A;  4GGF A;  1YRU B;  3GOF A;  3TDI A;  2QEO A;  3D73 A;  4HRE E;  1MR8 A;  1BT6 A;  3OP0 A;  3PM8 A;  1DF0 B;  1A75 B;  5FI6 A;  4WRI A;  5IBW A;  3PAT A;  2LC5 A;  2LMT A;  1PUL A;  1TN4 A;  3NSL A;  3EVV A;  1QX5 B;  1AK8 A;  1RTP 1;  1LS8 A;  3PN7 B;  3S0B A;  1Z4H A;  5HLO A;  3JVT C;  4PDZ A;  4GUK A;  2M3W A;  3DD4 A;  2QEB A;  2LVK A;  3CAB A;  1MQ1 A;  2OS8 C;  2MBX A;  1B1G A;  3UNW A;  4MRX A;  3EG5 B;  1PK0 D;  4WQ3 A;  1PSB A;  3LK1 A;  4R1E A;  1DVI A;  1IJ6 A;  2JC2 A;  1EXR A;  1UHI A;  1AJ5 A;  4JKT A;  1EG3 A;  1M46 A;  4YGE B;  3S0G A;  1XFX O;  1RK9 A;  2HPS A;  2Y1N A;  1DJG A;  3SG7 A;  1OZO A;  1S26 D;  1IWQ A;  5D69 A;  2LLT A;  3DVJ A;  1B7T Z;  2AAO A;  2M0R A;  3I5G C;  4I5N B;  2KQY A;  4FQO A;  1OW4 A;  1TNP A;  4AQI A;  2LVJ A;  3ICB A;  2JWW A;  3TDU A;  4L9M A;  4INW A;  5FI7 A;  1YUR A;  2JZI A;  3CYZ A;  2MA2 A;  2CBL A;  1J1E A;  1TUJ A;  1CMF A;  4A4C A;  1CM1 A;  2RGI A;  4HRH A;  3EKH A;  2GV5 A;  3SG2 A;  1OQP A;  3R1V A;  3BUW B;  4ZCU A;  1BMO A;  2KSP A;  4GGN A;  5DKQ A;  1L2O B;  2JNF A;  2KOT A;  3FWB A;  2ZRS A;  1K9K A;  3SS4 A;  2L51 A;  2F3Y A;  1GM0 A;  1SL8 A;  1R6P A;  1BOD A;  1KQM B;  1OOJ A;  3CWG A;  2OTG C;  4ETO A;  2KFF A;  1CFD A;  1H4B A;  2CTN A;  1SCM C;  1AVS A;  3A4U B;  3EK7 A;  3SIA A;  1SW8 A;  2HF5 A;  2BAP A;  1IJ5 A;  2M7L A;  3UO9 A;  4QJ5 B;  3AAK A;  1QX2 A;  5J3X A;  2M29 A;  1UUS A;  1GQM A;  1K9U A;  2L2C A;  3OGN A;  1JC2 A;  3LK0 A;  1CDN A;  3BOW B;  3I5F C;  4HSZ A;  1CFC A;  1CTR A;  2WND A;  4XYN A;  1YVH A;  1B47 A;  4ORB B;  1TCF A;  1S6I A;  2JXL A;  3KHE A;  2BEC A;  5HLV A;  1A75 A;  1NCY A;  2E6W A;  2H8V A;  2M7N A;  1DF0 A;  1T14 A;  1NX3 A;  2M1K B;  2K7B A;  3FWC A;  3KF9 A;  4MN0 A;  1XYD A;  1UHJ A;  2L50 A;  4OCI A;  1DJW A;  4CLN A;  1UHK A;  1OE9 B;  1LXF C;  3MSE B;  5CPV A;  1KSM A;  1C3Y A;  5EL2 A;  3VB1 A;  1QXP A;  1IH0 A;  2LVV A;  1KFX S;  4M2O A;  2JU0 A;  1BG1 A;  3I5I C;  2KI6 C; 
#chains in the Genus database with same CATH homology
 2K8M B;  2KI6 D;  3DVE A;  3PFV A;  1MXL C;  3WHU B;  1A29 A;  2CNP A;  4PE1 A;  1MXE A;  3OB1 B;  1IQ5 A;  3JTD C;  3TDZ A;  1BLQ A;  1CDL A;  4GPL B;  1CMG A;  2LAP A;  2FCE A;  1QJT A;  1UUR A;  2A4J A;  2K2A A;  5K89 A;  1XFY O;  4P2Y B;  2MLE C;  2OS8 B;  2WOS A;  1QX7 A;  2KAY A;  4F0Z B;  3KO0 A;  2LMU A;  1PAL A;  3TS5 C;  3NSO A;  2CT9 A;  1DMO A;  1J7Q A;  5HKW A;  1K9P A;  1CLL A;  2KDH A;  3BUM B;  1KFX L;  2KI4 C;  4HRG A;  2F2P A;  1DJY A;  1MHO A;  5HYD A;  1KFU L;  1N65 A;  2GGZ A;  3CZT X;  4AOM A;  1NX2 A;  3DF0 A;  1FBV A;  1F70 A;  1PSR A;  2I7A A;  2ZN9 A;  3D0Y A;  1LVC D;  1VRK A;  5CSF A;  1NIW A;  4N1F A;  3VGO A;  4CFR A;  5FYX A;  1TNQ A;  3K21 A;  5AAN A;  4YI9 A;  2BKH B;  2EHB A;  1OMD A;  4M2P A;  1G8I A;  1HT9 A;  1M31 A;  2D8N A;  5AEQ A;  1C7V A;  4ORC B;  5I2L A;  4OV2 A;  1CFF A;  2KYF A;  2JTZ A;  1QTX A;  2K61 A;  1WDC B;  3I5H B;  5DKN A;  1YRT B;  4OKH A;  1QAS A;  1IQ3 A;  2KFH A;  1UP5 A;  1SY9 A;  2PSR A;  2V53 A;  3I5F B;  1CB1 A;  1BJF A;  1QVI Y;  3E3R A;  1SBJ A;  1Y0V H;  2BE6 A;  1LKJ A;  3BQ3 A;  2HQW A;  1B4C A;  1WRL A;  5AER A;  1S5G Z;  3PAL A;  2LHI A;  2M9G A;  3LLE A;  3O2P A;  3RLZ A;  2ZRT A;  1M39 A;  2JT0 A;  1DT7 B;  1S6C A;  5KSZ A;  5CSI A;  2AMI A;  4N5X A;  4NDC A;  1KK7 Z;  1L2O C;  1FF1 A;  1S6J A;  2L98 A;  1KK8 C;  3HX4 A;  2KQ6 A;  4DRW A;  1BOC A;  1SR6 B;  1DJI A;  2KBI A;  2KFG A;  4MZL A;  1X02 A;  4D1E A;  2COL B;  4NDD A;  4PHJ A;  2JPT A;  1SPY A;  3H4S E;  2LLS A;  4GNK B;  1OMR A;  3D0Y B;  1QIW A;  2LUX A;  1KK7 Y;  4I5J A;  3DVK A;  1SRA A;  4FTG A;  2M1U A;  1LA0 A;  1CKK A;  2SAS A;  2JXC A;  3WXA A;  1A4P A;  1PVB A;  1EL4 A;  3IF7 A;  2HET A;  5TNC A;  4NDB A;  2L4H A;  1IGV A;  3FS7 A;  1TNW A;  2R2I A;  1G33 A;  4MLW A;  4C0J A;  1S1E A;  4PE4 A;  3CR2 A;  1TCO B;  3VRQ A;  2GGM A;  1ZUZ A;  1UHN A;  3LL8 B;  1NX1 A;  3D10 A;  1RFJ A;  4A4B A;  2L5X B;  2F3Z A;  3WHT B;  4UPG A;  1E8A A;  1IKU A;  4P5O E;  2QPT A;  1FI6 A;  1MWN A;  1XA5 A;  1XVJ A;  4MVF A;  4C0L A;  1SKT A;  1YX7 A;  2JT3 A;  5HKZ A;  1ZFS A;  3O4Y A;  1NSH A;  2MLF C;  2WC8 A;  1PRW A;  1UHH A;  1W7J B;  1EH2 A;  1LIN A;  3TZ1 A;  1DGV A;  1K95 A;  1MUX A;  1TRF A;  2BCB A;  2LE9 B;  2VRG A;  3CR4 X;  4GGF C;  1F71 A;  4JPZ B;  1H8B A;  1KCY A;  2CXJ A;  2NXQ A;  3OX5 A;  2Y4Q A;  1A03 A;  1XFZ O;  2BL0 C;  1XK4 C;  2K7O A;  2L0P A;  3PLF B;  1DJX A;  2PAL A;  4CID A;  4CPV A;  3ZWH A;  2LVI A;  1TTX A;  5I2O A;  4JQ0 D;  1F55 A;  3KPX A;  1KQM C;  2F33 A;  3OHM B;  1QLS A;  5DKR A;  1SNL A;  4E68 A;  3VRR A;  1C07 A;  3FIA A;  2KGB C;  3CGA A;  1K96 A;  5I8N A;  2BL0 B;  4Q04 A;  5CSN A;  3SG6 A;  1NUB A;  1OZS A;  3BYA A;  2PRU A;  1QV0 A;  2I18 A;  2LUC A;  4ORA B;  4PE7 A;  4YBH B;  2IS9 A;  2E30 A;  1S3P A;  2KI4 B;  2K2F A;  4I5K A;  1QAT A;  3SG5 A;  1B8R A;  2CCM A;  1K90 D;  1RJV A;  2JQ6 A;  3O78 A;  4PE0 A;  4OVN F;  1K8U A;  3PSR A;  4NQG A;  4XJK B;  2G9B A;  3CTN A;  3NSI A;  4DUQ A;  2JT8 A;  5CSJ A;  3A8R A;  4YRU A;  2JOJ A;  3QRX A;  5JJG A;  1FPW A;  2Y1M A;  1NYA A;  4AQJ A;  2PVB A;  3OB2 B;  1AJ4 A;  3JVT B;  4XJK A;  1M63 B;  1J55 A;  1JF0 A;  5D7F A;  2LAN A;  1Y6W A;  2BKI B;  2ISD A;  1CFP A;  1ALW A;  2NCO A;  2LV7 A;  1IRJ A;  1NX0 A;  5ER4 X;  3TS5 B;  1ZAC A;  3EK4 A;  3F45 A;  2BCX A;  1DJH A;  1SCV A;  3I5H C;  3ZNI A;  1REC A;  1XFU O;  1CLM A;  2BBM A;  1CNP A;  1S5G Y;  1SR6 C;  2BE4 A;  2FOT A;  3BUN B;  3EK8 A;  1ALV A;  3WNX B;  3PN7 C;  2AUC A;  1YVL A;  3AKA A;  1TOP A;  4PHN A;  1B7T Y;  1QVI Z;  4PCW A;  1B9A A;  5JOL A;  5G08 A;  3EKJ A;  4MRY A;  2K7C A;  1F4O A;  2M97 A;  4YGD B;  4QJ4 B;  2F2O A;  2LP2 A;  4DCK A;  2L2E A;  2WOR A;  2HQ8 A;  2O5G A;  1YUS A;  4MBE A;  1JSA A;  1CDP A;  2MJW B;  3LCP C;  3TUY C;  1MF8 B;  1XO5 A;  4MZK A;  1F8H A;  1KSO A;  4YGB B;  5AFP A;  1K94 A;  1GGZ A;  3HCM A;  2BBN A;  5F6T A;  1LA3 A;  1JUO A;  1CDM A;  1L7Z A;  4OR9 B;  4TNC A;  3VRN A;  2TN4 A;  2B1U A;  1WRK A;  2K0J A;  1V1F A;  2P6B B;  2KAV A;  1GJY A;  3IQQ A;  1YTZ C;  2FJU B;  3C1V A;  1EG4 A;  4CFQ A;  1NWD A;  5ER5 A;  2MAZ A;  1WDC C;  1WLZ A;  3AKB A;  2ZNE A;  1JWD A;  1J1D A;  1NPQ A;  1ZMZ A;  2H61 A;  2KBM A;  2F8P A;  1J7P A;  3KEV A;  4GBA A;  3GK4 X;  1FI5 A;  1G4Y R;  2KYC A;  2OTG B;  5AXI A;  2PAS A;  1KWO C;  2KGR A;  4ZCV A;  1A2X A;  1NP8 A;  1OMV A;  1JFJ A;  1JBA A;  1KK8 B;  1K93 D;  1KQV A;  1S36 A;  2MHH A;  4C0K A;  5KTY A;  1WY9 A;  2EC6 C;  2NZ0 A;  1SL9 A;  2EC6 B;  4MZJ A;  3SG3 A;  3GK1 A;  1BR4 B;  3IQO A;  1B8C A;  2H61 C;  3SJS A;  1AP4 A;  2EGD A;  3BUX B;  1JFK A;  1KWO B;  1BU3 A;  2LNK A;  1GGW A;  1U5I B;  2K7D A;  4JWQ A;  1F54 A;  3VRO A;  2LHL A;  1U5I A;  1YR5 A;  4USL A;  1QS7 A;  2Q91 A;  1WRZ A;  2SCP A;  4PAL A;  2ZFD A;  2JRF A;  1IG5 A;  1M45 A;  1ODB A;  2JTT A;  1PVA A;  5KU1 A;  1KFU S;  1AHR A;  1JF2 A;  2WCB A;  4ICB A;  2QAC A;  2MRD A;  3O6B A;  2G2B A;  5I2Q A;  4U8D A;  2FCD A;  1Q80 A;  5PAL A;  1V1G A;  1Y1A A;  1SL7 A;  1R2U A;  2I2R E;  1F4Q A;  3NXA A;  4WQ2 A;  2Y5I A;  1C7W A;  1SK6 D;  3SIB A;  2M8U A;  1EJ3 A;  2LMV A;  3CLN A;  1K2H A;  2L4I A;  1TNX A;  1NCZ A;  1BF5 A;  1CLB A;  1SMG A;  1QIV A;  1DTL A;  3DVM A;  1XFW O;  2Q4U A;  3BUO B;  3VRP A;  3CR5 X;  1N2D A;  1DJZ A;  2BCA A;  1AUI B;  1YUT A;  3OX6 A;  2OPO A;  4PHM A;  2ZND A;  2NCP A;  5B8I B;  3M0W A;  2LP3 A;  1RWY A;  1BR1 B;  1UWO A;  1DGU A;  4DS7 A;  1YX8 A;  2WCE A;  5HKY A;  4GAO A;  2KNE A;  2NLN A;  2ZN8 A;  3CS1 A;  1TIZ A;  1ZOT B;  4YGC B;  4BY4 A;  2KAX A;  1WLM A;  3JTD B;  3SG4 A;  2WCF A;  3NSK A;  1QLK A;  3DF0 B;  1B8L A;  5BPJ A;  1J7R A;  1N0Y A;  2O60 A;  2KHN A;  1XK4 A;  4N1G A;  1HQV A;  2LM5 A;  3I5I B;  1YUU A;  3BXK A;  1J7O A;  2LLU A;  4GFT A;  3BOW A;  1Y1U A;  3EVU A;  2DOQ A;  2I94 A;  2ZKM X;  1OSA A;  4MSP A;  4BY5 A;  1W7I B;  1QV1 A;  2PMY A;  4QJ3 B;  1D1O A;  3EVR A;  1NCX A;  5GQQ C;  4I5L B;  1SYM A;  4MEW A;  3RM1 A;  1CM4 A;  1Y1X A;  4PHK A;  1RRO A;  4YGA A;  2M49 B;  2H2K A;  3GK2 A;  4IL1 A;  2JNX A;  3I5G B;  2JUL A;  1SCM B;  2LCP A;  3TUY B;  4YI8 A;  4DIR A;  1FW4 A;  3AAJ A;  1XFV O;  4M2Q A;  4GGF A;  1YRU B;  3GOF A;  3TDI A;  4HRE E;  1MR8 A;  1BT6 A;  3OP0 A;  3PM8 A;  1DF0 B;  1A75 B;  4WRI A;  5IBW A;  3PAT A;  2LC5 A;  2LMT A;  1PUL A;  1TN4 A;  3NSL A;  3EVV A;  1QX5 B;  1AK8 A;  1RTP 1;  3PN7 B;  5HLO A;  3JVT C;  4PDZ A;  4GUK A;  2M3W A;  3DD4 A;  2LVK A;  1MQ1 A;  2OS8 C;  2MBX A;  1B1G A;  4MRX A;  1PK0 D;  4WQ3 A;  1PSB A;  3LK1 A;  4R1E A;  1DVI A;  1IJ6 A;  2JC2 A;  1EXR A;  1UHI A;  1AJ5 A;  1EG3 A;  1M46 A;  4YGE B;  1XFX O;  1RK9 A;  2HPS A;  2Y1N A;  1DJG A;  3SG7 A;  1OZO A;  1S26 D;  1IWQ A;  5D69 A;  2LLT A;  3DVJ A;  1B7T Z;  2AAO A;  2M0R A;  3I5G C;  4I5N B;  2KQY A;  4FQO A;  4AQI A;  1TNP A;  2LVJ A;  3ICB A;  2JWW A;  3TDU A;  4L9M A;  1YUR A;  2JZI A;  2MA2 A;  2CBL A;  1J1E A;  1CMF A;  4A4C A;  1CM1 A;  2RGI A;  4HRH A;  3EKH A;  2GV5 A;  3SG2 A;  1OQP A;  3BUW B;  4ZCU A;  1BMO A;  2KSP A;  4GGN A;  5DKQ A;  1L2O B;  2JNF A;  2KOT A;  3FWB A;  2ZRS A;  1K9K A;  2L51 A;  2F3Y A;  1SL8 A;  1R6P A;  1BOD A;  1KQM B;  1OOJ A;  3CWG A;  2OTG C;  4ETO A;  2KFF A;  1CFD A;  1H4B A;  2CTN A;  1SCM C;  1AVS A;  3A4U B;  3EK7 A;  3SIA A;  1SW8 A;  2HF5 A;  4QJ5 B;  1IJ5 A;  2M7L A;  3AAK A;  1QX2 A;  5J3X A;  2M29 A;  1UUS A;  1GQM A;  1K9U A;  1JC2 A;  3LK0 A;  1CDN A;  3BOW B;  3I5F C;  4HSZ A;  1CFC A;  1CTR A;  2WND A;  4XYN A;  1YVH A;  1B47 A;  4ORB B;  1TCF A;  1S6I A;  2JXL A;  3KHE A;  2BEC A;  5HLV A;  1A75 A;  1NCY A;  2E6W A;  2M7N A;  1DF0 A;  2M1K B;  1NX3 A;  3FWC A;  2K7B A;  3KF9 A;  4MN0 A;  4OCI A;  1XYD A;  1UHJ A;  2L50 A;  1DJW A;  4CLN A;  1UHK A;  1OE9 B;  1LXF C;  3MSE B;  5CPV A;  1KSM A;  1IH0 A;  1QXP A;  2LVV A;  1KFX S;  4M2O A;  2JU0 A;  1BG1 A;  3I5I C;  2KI6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...