1BR4B

Smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
148
Chain Sequence
FSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEQLVAGHEDSNGCINYEELVRMVLSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN
publication title Crystal structure of a vertebrate smooth muscle myosin motor domain and its complex with the essential light chain: visualization of the pre-power stroke state.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle protein
total genus 29
structure length 148
sequence length 148
chains with identical sequence D, F, H
ec nomenclature ec 3.6.1.32: Transferred entry: 5.6.1.8.
pdb deposition date 1998-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br4B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br4B01
1SL8A 1YRUB 3I5IC 1B7TY 5I2QA 3TDUA 2AAOA 1K9PA 3PATA 4PE7A 4MRYA 1S3PA 2JPTA 3KPXA 2MA2A 3I5HB 2LANA 1F70A 1TOPA 3M0WA 1A4PA 4QJ3B 3I5GC 3PN7C 1KWOB 2BCAA 2I18A 4FQOA 1N2DA 4YGEB 5BPJA 1CTRA 3BUMB 5KTYA 3F45A 1QLKA 4NDDA 2JZIA 5K89A 3NSLA 1SW8A 1QIVA 1AJ5A 3NXAA 2JRFA 5PALA 2ISDA 4ETOA 1K90D 2PASA 3EKHA 3IF7A 1KFXS 2ZKMX 3BUWB 3SG6A 4MN0A 2KSPA 1PVAA 1UHNA 2WCFA 3GK4X 1UHIA 2F2PA 1ZMZA 2E30A 3DD4A 1AVSA 2MJWB 1DTLA 4GFTA 2K7DA 3CR2A 1XYDA 1K96A 1QLSA 3ZNIA 1MUXA 1XVJA 1XK4C 2GGMA 3AKBA 3EVVA 3KHEA 1Y1UA 1MXEA 2L98A 1V1FA 4MSPA 1PSRA 3FWBA 3EK8A 2ZNEA 3TDZA 3CS1A 1GQMA 4I5JA 3DVJA 2H61C 2JULA 2CXJA 3TS5B 1S1EA 1HT9A 2JT8A 1JF0A 1TTXA 4AQJA 2KQ6A 1PK0D 2KI4C 2FOTA 1FI6A 4ICBA 4GPLB 2KFFA 2F33A 3I5FC 4DUQA 1QTXA 1ALVA 4BY4A 3SG7A 1Y6WA 1IJ6A 1ZACA 2LMTA 1X02A 1B47A 1FBVA 1XFVO 2BL0B 1A75B 5J3XA 2KAYA 1B9AA 1TCOB 1YURA 5DKRA 1XFYO 3EK7A 2PALA 2HETA 1WRKA 5KU1A 4ORCB 1Y0VH 1YUSA 4I5KA 2NXQA 1SL9A 2LC5A 1U5IA 2K7OA 1OMRA 2KOTA 1KK7Z 1DGUA 3DVMA 4YGDB 1PALA 1M45A 2LHIA 1S26D 4N1FA 4XJKA 4MZJA 4ORAB 1DJGA 1IG5A 1UP5A 3GK1A 4AOMA 1SR6B 1F4OA 1GJYA 4MLWA 4DRWA 1FI5A 1XO5A 2L4IA 1AJ4A 2KQYA 1J55A 2O60A 1WDCC 2G9BA 2LV7A 2WOSA 3EVRA 4TNCA 4JPZB 3SG3A 2Y5IA 2LNKA 3PALA 1L2OC 1CKKA 3A8RA 4OV2A 2V53A 2KFHA 2LUXA 2WCBA 2M97A 2MAZA 2L4HA 3D0YA 1G33A 1RFJA 4MVFA 1SNLA 5AERA 5IBWA 1IJ5A 3VROA 3LL8B 5CSJA 1KK8C 2E6WA 4YGCB 5ER4X 2LVVA 3K21A 1K9KA 4GAOA 1PVBA 2LM5A 3VRPA 3D0YB 2SCPA 2LCPA 4HSZA 5D7FA 3SIBA 5FYXA 1CMGA 1NUBA 1SK6D 1H4BA 2NCPA 2EC6B 1KQMC 1CLLA 1NX2A 2KYFA 1NX0A 2BECA 3KO0A 4PHMA 1JSAA 1BLQA 3O4YA 4P5OE 3BOWB 3SJSA 4CFQA 1UWOA 1EL4A 1QV1A 3OX5A 5HYDA 1EG3A 2D8NA 4R1EA 5HKZA 5HLVA 1LA0A 3OX6A 1XA5A 1K8UA 1CDLA 1ZUZA 2OS8B 1OZSA 2ZNDA 4A4BA 4PE4A 2K0JA 1QVIY 1OQPA 1R6PA 1IQ3A 2VRGA 3DF0A 1JF2A 2BKHB 1SL7A 1LVCD 5G08A 1LINA 3A4UB 2WORA 3I5HC 2BBMA 4GGFC 4OCIA 1CMFA 1F55A 1AUIB 1B8CA 1RTP1 2KGRA 1S36A 2KI6D 2MRDA 4YRUA 1JBAA 1KWOC 1DF0A 3DVKA 3VRRA 3JVTB 3O2PA 1B7TZ 5ER5A 1DJXA 1XFXO 1DJYA 1IH0A 3LK0A 1F71A 1RK9A 1WLZA 2JQ6A 2KFGA 1Y1XA 2Y1MA 2BCBA 1DF0B 1TCFA 5I2OA 1NP8A 1KCYA 3FIAA 1MWNA 2G2BA 1WRZA 4WQ2A 2A4JA 2Q4UA 1EG4A 5CPVA 1C7WA 3RM1A 4I5NB 1J7QA 5DKQA 2H2KA 4ZCUA 1F54A 5HKWA 1FW4A 3QRXA 1DJZA 3BUXB 1UHJA 1A29A 1QJTA 4D1EA 1M63B 1OMDA 3LK1A 3ICBA 4M2QA 2FJUB 4PE0A 2FCEA 3PLFB 1YTZC 1JFJA 1SYMA 2CNPA 4JQ0D 1QASA 1BOCA 3TS5C 2ZRTA 4WRIA 4N5XA 1DJWA 2LVIA 1XK4A 1NSHA 2F3ZA 2LMVA 1S5GY 3D10A 3O6BA 4A4CA 1D1OA 1TNWA 1SBJA 2I7AA 1J1EA 1W7IB 2H61A 4IL1A 2KBIA 5JJGA 1CB1A 3OB1B 1NIWA 1NCYA 3HCMA 1J7PA 2JTZA 1NX3A 2DOQA 1LA3A 4P2YB 1CM1A 2BL0C 2M9GA 1MQ1A 1PULA 2JC2A 1SRAA 2JOJA 1NPQA 1PSBA 2HQ8A 1S6CA 1SPYA 1GGZA 1C07A 3CGAA 4MRXA 1YX8A 2L50A 4DS7A 2QACA 1TNPA 2BKIB 3OB2B 4L9MA 3PM8A 1KK7Y 1LXFC 1NYAA 1ZOTB 1DT7B 1QXPA 3JTDB 2ZN9A 1M46A 3TUYB 2MLFC 1U5IB 2F8PA 2M1KB 2KDHA 2LAPA 3GOFA 1SR6C 4M2OA 4NDBA 2M7LA 5D69A 3SG5A 1S6JA 1CLMA 2OTGB 1YUUA 5CSNA 5AFPA 4XJKB 1QATA 2BBNA 3LCPC 5AEQA 4PALA 1VRKA 1IWQA 5B8IB 2M29A 3AAJA 4Q04A 1JUOA 4ZCVA 2PMYA 1LKJA 1NCXA 1B1GA 2JT3A 4GUKA 1J7OA 1BR4B 1SY9A 4FTGA 1K94A 2WNDA 1TN4A 2Q91A 2JXLA 1RJVA 1YVHA 4USLA 5HKYA 3CZTX 2PVBA 1G8IA 2KHNA 2L51A 1B4CA 2K7CA 1JFKA 2LP2A 1UHKA 1TNQA 2EC6C 1CDMA 2B1UA 1RWYA 4QJ5B 3OHMB 2O5GA 2LP3A 1BU3A 5I2LA 5F6TA 2L5XB 2P6BB 4F0ZB 1N0YA 1UURA 1DMOA 1CM4A 4YI9A 1IKUA 1A2XA 1CNPA 2MLEC 3EVUA 2EGDA 1YRTB 2OS8C 2MHHA 5DKNA 2LUCA 4YGBB 1QX5B 2K2FA 3PSRA 1A03A 1OSAA 4OR9B 1WRLA 1FF1A 1ODBA 3SIAA 4XYNA 1JC2A 1DJHA 1SCMB 2M0RA 3FS7A 1QV0A 4ORBB 3DF0B 3JVTC 1AP4A 3CTNA 2PRUA 1H8BA 1CLBA 4MZKA 1M39A 4DIRA 2K2AA 1NX1A 4GGFA 2SASA 1B8LA 3I5IB 1SMGA 4GNKB 2JT0A 3ZWHA 1BODA 1YX7A 2Y1NA 4NDCA 1CDPA 1AHRA 1NWDA 4MBEA 1YUTA 1OOJA 3KEVA 3PFVA 2JWWA 1BJFA 1MF8B 1KFUS 2RGIA 3BYAA 1IRJA 1QS7A 2HQWA 4YBHB 3I5GB 3IQOA 3PN7B 2LVJA 2GV5A 3E3RA 1CFDA 1MHOA 2OPOA 1CFFA 1RECA 2M1UA 4AQIA 1YVLA 1M31A 3NSKA 1KSOA 4OVNF 1TIZA 2R2IA 1ALWA 2EHBA 2ZN8A 4DCKA 4M2PA 3BUOB 2M7NA 1DGVA 1DJIA 2JXCA 3NSIA 5KSZA 4PDZA 2F3YA 1CDNA 3WXAA 3VRNA 1BMOA 5I8NA 2PSRA 5JOLA 3O78A 3C1VA 4C0JA 2KI6C 1K95A 4WQ3A 1V1GA 1ZFSA 2JNFA 2KAVA 3WNXB 2K7BA 1K9UA 1WLMA 3VGOA 2BE6A 1J7RA 1FPWA 3GK2A 2F2OA 2M49B 1TRFA 2ZRSA 2BCXA 2CCMA 2LLSA 2NLNA 3AAKA 1KQVA 2NCOA 3OP0A 2KNEA 1C7VA 3WHUB 3CLNA 2LLTA 4E68A 1IQ5A 2L2EA 1S5GZ 1K2HA 2I2RE 3BQ3A 2WC8A 1R2UA 2GGZA 1N65A 1NCZA 2KI4B 2LHLA 1A75A 1XFWO 2WCEA 3WHTB 5GQQC 2KAXA 3I5FB 2CBLA 2NZ0A 4CIDA 4HREE 3TDIA 1CFPA 3JTDC 1J1DA 1QIWA 3IQQA 4UPGA 3TUYC 1B8RA 4YGAA 1RROA 3KF9A 4GGNA 4C0LA 4U8DA 2KGBC 1UUSA 2OTGC 4CPVA 4PE1A 1L7ZA 1F4QA 2JTTA 5HLOA 4OKHA 1W7JB 1YR5A 2L0PA 2CTNA 3MSEB 1OMVA 4JWQA 1EJ3A 2TN4A 1BR1B 1WY9A 2QPTA 2LVKA 4CFRA 3BUNB 1KFUL 5TNCA 2KBMA 1UHHA 3NSOA 1G4YR 2LLUA 3CWGA 4HRGA 1HQVA 2HF5A 2JU0A 4YI8A 5AANA 2IS9A 1BT6A 1Q80A 1BG1A 2Y4QA 3BXKA 3EKJA 1WDCB 4NQGA 1EH2A 1S6IA 1KSMA 4N1GA 1K93D 3H4SE 4PHJA 1L2OB 3SG4A 1CFCA 1EXRA 1JWDA 1PRWA 1DVIA 1KFXL 1SKTA 3CR4X 3TZ1A 2MBXA 1AK8A 1GGWA 2FCDA 1SCVA 2I94A 1XFUO 4I5LB 1KK8B 4HRHA 2BE4A 3RLZA 2AUCA 1E8AA 4GBAA 2M8UA 1QX2A 4PHKA 3BOWA 2AMIA 4MZLA 2LMUA 1MXLC 1XFZO 3SG2A 4BY5A 2COLB 3HX4A 5CSIA 1OZOA 4PCWA 4QJ4B 1IGVA 1KQMB 1TNXA 1MR8A 4MEWA 1QX7A 3DVEA 2LE9B 3FWCA 3AKAA 1BF5A 1F8HA 2M3WA 1SCMC 2K8MB 2ZFDA 3LLEA 4C0KA 3CR5X 3EK4A 2K61A 2HPSA 5AXIA 5CSFA 4CLNA 4PHNA 3VRQA 2CT9A 2JNXA 1QVIZ 2KYCA 1Y1AA 1OE9B
chains in the Genus database with same CATH superfamily
1SL8A 1YRUB 3I5IC 1B7TY 5I2QA 3TDUA 2AAOA 1K9PA 3PATA 4PE7A 4MRYA 1S3PA 2KLDA 2JPTA 4FQTA 1P28A 3KPXA 2MA2A 2WCMA 3SS4A 3I5HB 2LANA 1F70A 1TOPA 3M0WA 1A4PA 3FE8A 4QJ3B 2L2CA 3I5GC 3PN7C 1KWOB 2BCAA 2I18A 4FQOA 1N2DA 4YGEB 5BPJA 1CTRA 3BUMB 5KTYA 3F45A 3B87A 1QLKA 4NDDA 5FI6A 2JZIA 5K89A 3NSLA 1SW8A 1QIVA 1AJ5A 3NXAA 3UO9A 2JRFA 5PALA 2ISDA 4ETOA 1K90D 2PASA 3EKHA 3IF7A 1KFXS 2ZKMX 3BUWB 3S0EA 3SG6A 4MN0A 2KSPA 1PVAA 1UHNA 2WCFA 3GK4X 1UHIA 2F2PA 1ZMZA 2E30A 3DD4A 1AVSA 2MJWB 1DTLA 2P70A 4GFTA 5EL2A 2K7DA 3CR2A 1XYDA 1K96A 1QLSA 3ZNIA 1MUXA 1XVJA 1XK4C 2GGMA 3AKBA 3EVVA 3BFHA 1Y1UA 3KHEA 1MXEA 2L98A 1V1FA 4MSPA 1PSRA 3FWBA 3EK8A 2ZNEA 3TDZA 3CS1A 1GQMA 4I5JA 3DVJA 2H61C 2JULA 2CXJA 3TS5B 3VB1A 3B86A 1S1EA 3L4LA 1HT9A 2JT8A 1JF0A 1TTXA 4AQJA 2KQ6A 1DELA 4OZDA 1PK0D 2KI4C 2FOTA 1FI6A 4ICBA 2QEBA 4GPLB 2KFFA 2F33A 3I5FC 4DUQA 1QTXA 1ALVA 4BY4A 3SG7A 1Y6WA 1Z4HA 1IJ6A 1ZACA 2LMTA 4KYNA 1X02A 1B47A 1FBVA 1XFVO 1A75B 2BL0B 5J3XA 2KAYA 1B9AA 2BNXA 1TCOB 1YURA 5DKRA 1XFYO 3EK7A 2PALA 2HETA 1WRKA 3D78A 3BFBA 5KU1A 4ORCB 1Y0VH 1YUSA 4I5KA 2NXQA 1SL9A 2LC5A 1U5IA 2K7OA 1OMRA 2KOTA 1KK7Z 1DGUA 3DVMA 4YGDB 1PALA 1M45A 3R1OA 2LHIA 1S26D 4N1FA 4XJKA 4MZJA 4ORAB 1DJGA 1IG5A 1UP5A 3GK1A 4AOMA 1SR6B 1F4OA 1GJYA 4MLWA 4DRWA 1FI5A 1XO5A 2L4IA 1AJ4A 1T14A 2WC6A 2KQYA 1J55A 2O60A 1WDCC 2G9BA 2LV7A 2WOSA 3BJHA 3EVRA 4TNCA 4JPZB 3SG3A 2Y5IA 2LNKA 3PALA 1L2OC 1CKKA 3A8RA 4OV2A 2V53A 2KFHA 2LUXA 2WCBA 3O4XA 2M97A 2MAZA 2L4HA 3D0YA 1G33A 1RFJA 4MVFA 1SNLA 5AERA 5IBWA 1IJ5A 3VROA 3LL8B 5CSJA 1KK8C 2E6WA 4YGCB 5ER4X 2LVVA 3K21A 1K9KA 4GAOA 1PVBA 1C3ZA 2LM5A 3VRPA 3D0YB 2SCPA 2LCPA 4HSZA 5D7FA 3SIBA 5FYXA 1CMGA 1NUBA 1SK6D 1H4BA 2ERBA 2NCPA 3DXLA 2EC6B 1KQMC 1CLLA 2KPHA 1NX2A 2KYFA 4IJ7A 1NX0A 2BECA 3KO0A 4PHMA 1JSAA 1BLQA 3O4YA 4P5OE 1XFRA 3BOWB 3SJSA 4CFQA 1UWOA 1EL4A 1QV1A 3OX5A 5HYDA 1EG3A 2D8NA 4R1EA 5HKZA 5HLVA 1LA0A 3OX6A 1XA5A 1K8UA 1CDLA 1ZUZA 5FI7A 2OS8B 1OZSA 2ZNDA 4A4BA 4PE4A 2K0JA 2QEVA 1QVIY 1OQPA 1R6PA 1DC1A 2VRGA 3DF0A 1IQ3A 1JF2A 2BKHB 1SL7A 3FE9A 1LVCD 5G08A 1LINA 3A4UB 2WORA 3I5HC 2BBMA 4GGFC 4OCIA 4PT1A 1CMFA 1AUIB 1F55A 1B8CA 1RTP1 2KGRA 1S36A 2KI6D 1DEKA 2MRDA 4YRUA 1JBAA 1KWOC 3S0GA 1DF0A 3DVKA 3VRRA 3JVTB 3O2PA 1SSEB 1B7TZ 5ER5A 1DJXA 1XFXO 1DJYA 1IH0A 3LK0A 3L47A 1F71A 1RK9A 1WLZA 2JQ6A 2KFGA 1Y1XA 2Y1MA 1TUJA 1DF0B 1TCFA 2BCBA 2WCHA 5I2OA 1NP8A 1KCYA 3FIAA 1MWNA 2G2BA 1WRZA 4WQ2A 2A4JA 2Q4UA 1EG4A 5CPVA 1C7WA 3RM1A 2JPOA 4I5NB 1J7QA 5DKQA 2H2KA 4ZCUA 1F54A 5HKWA 1FW4A 2P71A 3QRXA 1DJZA 3BUXB 1UHJA 1A29A 1QJTA 3NHTA 4D1EA 1M63B 1OMDA 3LK1A 3ICBA 4M2QA 2FJUB 4PE0A 2FCEA 3PLFB 1YTZC 1JFJA 1SYMA 2CNPA 4JQ0D 1QASA 1BOCA 3TS5C 2BAPA 2ZRTA 4N5XA 4WRIA 1DJWA 2LVIA 3OBVA 1XK4A 1NSHA 2F3ZA 2LMVA 1S5GY 3D10A 3O6BA 4A4CA 4INXA 1TNWA 1D1OA 1SBJA 2I7AA 1J1EA 1W7IB 2H61A 2K60A 4IL1A 2KBIA 5JJGA 1CB1A 3OB1B 1NIWA 1NCYA 3HCMA 4F7FA 1J7PA 2JTZA 1NX3A 3CABA 2DOQA 1LA3A 4P2YB 1CM1A 2BL0C 2M9GA 3D75A 3D77A 1MQ1A 3CYZA 1PULA 2JC2A 3EG5B 1SRAA 2JOJA 1NPQA 1PSBA 2HQ8A 1S6CA 1SPYA 1GGZA 1C07A 3CGAA 4MRXA 1W9ZA 1YX8A 2L50A 3NGVA 4DS7A 2QACA 1TNPA 2BKIB 2QEHA 3OB2B 4L9MA 5HL1A 1ORGA 3PM8A 1KK7Y 1LXFC 1NYAA 1ZOTB 1DT7B 1QXPA 3JTDB 2ZN9A 1M46A 3SS3A 2MLFC 3TUYB 1U5IB 2F8PA 2M1KB 2KDHA 2LAPA 3GOFA 1SR6C 4M2OA 4NDBA 2M7LA 5D69A 3SG5A 1S6JA 1CLMA 2OTGB 1YUUA 3R1VA 5CSNA 3S0BA 2H8VA 4XJKB 1QATA 2BBNA 3N7HA 3LCPC 5AFPA 5AEQA 3S0FA 3S0DA 4PALA 1VRKA 1IWQA 5B8IB 2M29A 3AAJA 4Q04A 1JUOA 4ZCVA 2PMYA 1LKJA 1NCXA 1B1GA 2JT3A 3R72A 4GUKA 1J7OA 1BR4B 1SY9A 4FTGA 1K94A 2WNDA 1TN4A 2Q91A 2JXLA 3S0AA 1RJVA 3CDNA 5FI2A 1YVHA 4USLA 3D74A 5HKYA 3CZTX 2PVBA 1G8IA 2KHNA 3K1EA 1DQEA 2L51A 1B4CA 1OOIX 1JFKA 2K7CA 2LP2A 1UHKA 1TNQA 2EC6C 1CDMA 2B1UA 3DZTA 1RWYA 4QJ5B 3OHMB 2O5GA 2LP3A 1BU3A 5I2LA 5F6TA 2L5XB 2P6BB 4F0ZB 1N0YA 1UURA 2WCKA 1CM4A 4YI9A 1IKUA 1A2XA 1CNPA 1DMOA 2MLEC 3EVUA 2EGDA 1YRTB 2OS8C 2MHHA 5DKNA 2LUCA 3D73A 3R1PA 1LS8A 4YGBB 1QX5B 2K2FA 3PSRA 1A03A 1OSAA 4OR9B 1WRLA 5D3OA 1FF1A 1ODBA 3SIAA 4XYNA 1JC2A 1DJHA 2QEOA 1SCMB 2M0RA 4JD9A 3FS7A 1QV0A 4ORBB 3DF0B 3JVTC 1AP4A 3CTNA 2PRUA 1H8BA 1CLBA 4MZKA 1M39A 4DIRA 2K2AA 1NX1A 4GGFA 2SASA 1B8LA 3I5IB 1SMGA 4GNKB 2JT0A 3ZWHA 1BODA 1YX7A 2Y1NA 4NDCA 3RZSA 1CDPA 1AHRA 1NWDA 2PQLA 4MBEA 1YUTA 1OOJA 3KEVA 3PFVA 2JWWA 1BJFA 1MF8B 1KFUS 2RGIA 3BYAA 1IRJA 1QS7A 2HQWA 3D76A 4YBHB 3NHIA 1OOFA 3I5GB 2WC5A 3IQOA 2LVJA 2GV5A 3E3RA 3PN7B 1CFDA 1MHOA 2OPOA 1CFFA 1RECA 2M1UA 4AQIA 1YVLA 1M31A 3NSKA 1KSOA 4OVNF 1TIZA 2R2IA 1ALWA 2EHBA 2ZN8A 2GTEA 3CZ0A 3QMEA 4DCKA 4M2PA 3BUOB 2M7NA 2FJYA 1DGVA 1DJIA 2JXCA 3NSIA 5KSZA 4PDZA 2F3YA 2QDIA 4JKTA 1CDNA 3CZ2A 3IVTA 3VRNA 3WXAA 1BMOA 5I8NA 2PSRA 5JOLA 3O78A 3C1VA 4C0JA 2KI6C 2YGUA 1K95A 3Q8IA 4WQ3A 1V1GA 1ZFSA 2JNFA 2KAVA 3CZ1A 3WNXB 2K7BA 1K9UA 1WLMA 3VGOA 2BE6A 1J7RA 1FPWA 3GK2A 3L4AA 2F2OA 2M49B 1TRFA 3B88A 2ZRSA 2BCXA 2CCMA 2LLSA 2NLNA 2PYQA 3AAKA 1KQVA 2NCOA 3OP0A 2KNEA 1C7VA 3WHUB 2WCJA 3CLNA 2LLTA 5DICA 4E68A 1IQ5A 2L2EA 1S5GZ 1K2HA 2I2RE 3BQ3A 2WC8A 1R2UA 2GGZA 1N65A 1NCZA 1OOGA 2KI4B 2LHLA 3FE6A 1A75A 1XFWO 2WCEA 3WHTB 5GQQC 2KAXA 3I5FB 1C3YA 2CBLA 3B6XA 2NZ0A 5I94A 4CIDA 4HREE 3TDIA 1CFPA 3JTDC 1J1DA 1QIWA 3PM2A 3IQQA 4UPGA 3B7AA 3DYEA 3TUYC 1B8RA 4YGAA 1RROA 3KF9A 4GGNA 4C0LA 4U8DA 2KGBC 1UUSA 2OTGC 4CPVA 4PE1A 1L7ZA 1F4QA 1TWOA 2JTTA 5HLOA 4OKHA 1W7JB 1YR5A 2L0PA 2CTNA 3MSEB 1OOHA 1OMVA 1GM0A 4JWQA 1EJ3A 2TN4A 1BR1B 1WY9A 2QPTA 2LVKA 4CFRA 3BUNB 1KFUL 5TNCA 2KBMA 1UHHA 3NSOA 1Z2CB 1G4YR 2LLUA 1IIOA 3CWGA 4HRGA 1HQVA 2HF5A 2JU0A 3PJIA 4YI8A 5AANA 2IS9A 1BT6A 1Q80A 1BG1A 2Y4QA 3BXKA 3EKJA 1WDCB 4NQGA 1EH2A 1S6IA 1KSMA 4N1GA 1K93D 3H4SE 1QWVA 4PHJA 1L2OB 3SG4A 1CFCA 1EXRA 1JWDA 1PRWA 1DVIA 1KFXL 1SKTA 3BFAA 3CR4X 3TZ1A 1TUZA 2MBXA 1AK8A 1GGWA 2FCDA 1SCVA 2I94A 1XFUO 2L5YA 4I5LB 1KK8B 3UNWA 4HRHA 2BE4A 3RLZA 2AUCA 1E8AA 4GBAA 2M8UA 1QX2A 4PHKA 3OGNA 3BOWA 2AMIA 4MZLA 2LMUA 1MXLC 1XFZO 3SG2A 3SS5A 4BY5A 1OW4A 2COLB 3HX4A 5CSIA 1OZOA 4PCWA 4QJ4B 1IGVA 1KQMB 1TNXA 1MR8A 4MEWA 1QX7A 3DVEA 2LE9B 3FWCA 3AKAA 1BF5A 1F8HA 2M3WA 1SCMC 2K8MB 2ZFDA 3LLEA 4C0KA 3CR5X 3EK4A 2K61A 2HPSA 3DY9A 5AXIA 5CSFA 4CLNA 4INWA 4PHNA 3VRQA 2KLEA 2WCLA 3V2LA 2CT9A 2JNXA 1QVIZ 2KYCA 1Y1AA 1OE9B
chains in the Genus database with same CATH topology
1SL8A 1YRUB 3I5IC 1B7TY 5I2QA 3TDUA 2AAOA 1K9PA 3PATA 4PE7A 4MRYA 1S3PA 2JPTA 3KPXA 2MA2A 3I5HB 2LANA 1F70A 1TOPA 3M0WA 1A4PA 4QJ3B 3I5GC 3PN7C 1KWOB 2BCAA 2I18A 4FQOA 1N2DA 4YGEB 5BPJA 1CTRA 3BUMB 5KTYA 3F45A 1QLKA 4NDDA 2JZIA 5K89A 3NSLA 1SW8A 1QIVA 1AJ5A 3NXAA 2JRFA 5PALA 2ISDA 4ETOA 1K90D 2PASA 3EKHA 3IF7A 1KFXS 2ZKMX 3BUWB 3SG6A 4MN0A 2KSPA 1PVAA 1UHNA 2WCFA 3GK4X 1UHIA 2F2PA 1ZMZA 2E30A 3DD4A 1AVSA 2MJWB 1DTLA 4GFTA 2K7DA 3CR2A 1XYDA 1K96A 1QLSA 3ZNIA 1MUXA 1XVJA 1XK4C 2GGMA 3AKBA 3EVVA 3KHEA 1Y1UA 1MXEA 2L98A 1V1FA 4MSPA 1PSRA 3FWBA 3EK8A 2ZNEA 3TDZA 3CS1A 1GQMA 4I5JA 3DVJA 2H61C 2JULA 2CXJA 3TS5B 1S1EA 1HT9A 2JT8A 1JF0A 1TTXA 4AQJA 2KQ6A 1PK0D 2KI4C 2FOTA 1FI6A 4ICBA 4GPLB 2KFFA 2F33A 3I5FC 4DUQA 1QTXA 1ALVA 4BY4A 3SG7A 1Y6WA 1IJ6A 1ZACA 2LMTA 1X02A 1B47A 1FBVA 1XFVO 2BL0B 1A75B 5J3XA 2KAYA 1B9AA 1TCOB 1YURA 5DKRA 1XFYO 3EK7A 2PALA 2HETA 1WRKA 5KU1A 4ORCB 1Y0VH 1YUSA 4I5KA 2NXQA 1SL9A 2LC5A 1U5IA 2K7OA 1OMRA 2KOTA 1KK7Z 1DGUA 3DVMA 4YGDB 1PALA 1M45A 2LHIA 1S26D 4N1FA 4XJKA 4MZJA 4ORAB 1DJGA 1IG5A 1UP5A 3GK1A 4AOMA 1SR6B 1F4OA 1GJYA 4MLWA 4DRWA 1FI5A 1XO5A 2L4IA 1AJ4A 2KQYA 1J55A 2O60A 1WDCC 2G9BA 2LV7A 2WOSA 3EVRA 4TNCA 4JPZB 3SG3A 2Y5IA 2LNKA 3PALA 1L2OC 1CKKA 3A8RA 4OV2A 2V53A 2KFHA 2LUXA 2WCBA 2M97A 2MAZA 2L4HA 3D0YA 1G33A 1RFJA 4MVFA 1SNLA 5AERA 5IBWA 1IJ5A 3VROA 3LL8B 5CSJA 1KK8C 2E6WA 4YGCB 5ER4X 2LVVA 3K21A 1K9KA 4GAOA 1PVBA 2LM5A 3VRPA 3D0YB 2SCPA 2LCPA 4HSZA 5D7FA 3SIBA 5FYXA 1CMGA 1NUBA 1SK6D 1H4BA 2NCPA 2EC6B 1KQMC 1CLLA 1NX2A 2KYFA 1NX0A 2BECA 3KO0A 4PHMA 1JSAA 1BLQA 3O4YA 4P5OE 3BOWB 3SJSA 4CFQA 1UWOA 1EL4A 1QV1A 3OX5A 5HYDA 1EG3A 2D8NA 4R1EA 5HKZA 5HLVA 1LA0A 3OX6A 1XA5A 1K8UA 1CDLA 1ZUZA 2OS8B 1OZSA 2ZNDA 4A4BA 4PE4A 2K0JA 1QVIY 1OQPA 1R6PA 1IQ3A 2VRGA 3DF0A 1JF2A 2BKHB 1SL7A 1LVCD 5G08A 1LINA 3A4UB 2WORA 3I5HC 2BBMA 4GGFC 4OCIA 1CMFA 1F55A 1AUIB 1B8CA 1RTP1 2KGRA 1S36A 2KI6D 2MRDA 4YRUA 1JBAA 1KWOC 1DF0A 3DVKA 3VRRA 3JVTB 3O2PA 1B7TZ 5ER5A 1DJXA 1XFXO 1DJYA 1IH0A 3LK0A 1F71A 1RK9A 1WLZA 2JQ6A 2KFGA 1Y1XA 2Y1MA 2BCBA 1DF0B 1TCFA 5I2OA 1NP8A 1KCYA 3FIAA 1MWNA 2G2BA 1WRZA 4WQ2A 2A4JA 2Q4UA 1EG4A 5CPVA 1C7WA 3RM1A 4I5NB 1J7QA 5DKQA 2H2KA 4ZCUA 1F54A 5HKWA 1FW4A 3QRXA 1DJZA 3BUXB 1UHJA 1A29A 1QJTA 4D1EA 1M63B 1OMDA 3LK1A 3ICBA 4M2QA 2FJUB 4PE0A 2FCEA 3PLFB 1YTZC 1JFJA 1SYMA 2CNPA 4JQ0D 1QASA 1BOCA 3TS5C 2ZRTA 4WRIA 4N5XA 1DJWA 2LVIA 1XK4A 1NSHA 2F3ZA 2LMVA 1S5GY 3D10A 3O6BA 4A4CA 1D1OA 1TNWA 1SBJA 2I7AA 1J1EA 1W7IB 2H61A 4IL1A 2KBIA 5JJGA 1CB1A 3OB1B 1NIWA 1NCYA 3HCMA 1J7PA 2JTZA 1NX3A 2DOQA 1LA3A 4P2YB 1CM1A 2BL0C 2M9GA 1MQ1A 1PULA 2JC2A 1SRAA 2JOJA 1NPQA 1PSBA 2HQ8A 1S6CA 1SPYA 1GGZA 1C07A 3CGAA 4MRXA 1YX8A 2L50A 4DS7A 2QACA 1TNPA 2BKIB 3OB2B 4L9MA 3PM8A 1KK7Y 1LXFC 1NYAA 1ZOTB 1DT7B 1QXPA 3JTDB 2ZN9A 1M46A 3TUYB 2MLFC 1U5IB 2F8PA 2M1KB 2KDHA 2LAPA 3GOFA 1SR6C 4M2OA 4NDBA 2M7LA 5D69A 3SG5A 1S6JA 1CLMA 2OTGB 1YUUA 5CSNA 5AFPA 4XJKB 1QATA 2BBNA 3LCPC 5AEQA 4PALA 1VRKA 1IWQA 5B8IB 2M29A 3AAJA 4Q04A 1JUOA 4ZCVA 2PMYA 1LKJA 1NCXA 1B1GA 2JT3A 4GUKA 1J7OA 1BR4B 1SY9A 4FTGA 1K94A 2WNDA 1TN4A 2Q91A 2JXLA 1RJVA 1YVHA 4USLA 5HKYA 3CZTX 2PVBA 1G8IA 2KHNA 2L51A 1B4CA 2K7CA 1JFKA 2LP2A 1UHKA 1TNQA 2EC6C 1CDMA 2B1UA 1RWYA 4QJ5B 3OHMB 2O5GA 2LP3A 1BU3A 5I2LA 5F6TA 2L5XB 2P6BB 4F0ZB 1N0YA 1UURA 1DMOA 1CM4A 4YI9A 1IKUA 1A2XA 1CNPA 2MLEC 3EVUA 2EGDA 1YRTB 2OS8C 2MHHA 5DKNA 2LUCA 4YGBB 1QX5B 2K2FA 3PSRA 1A03A 1OSAA 4OR9B 1WRLA 1FF1A 1ODBA 3SIAA 4XYNA 1JC2A 1DJHA 1SCMB 2M0RA 3FS7A 1QV0A 4ORBB 3DF0B 3JVTC 1AP4A 3CTNA 2PRUA 1H8BA 1CLBA 4MZKA 1M39A 4DIRA 2K2AA 1NX1A 4GGFA 2SASA 1B8LA 3I5IB 1SMGA 4GNKB 2JT0A 3ZWHA 1BODA 1YX7A 2Y1NA 4NDCA 1CDPA 1AHRA 1NWDA 4MBEA 1YUTA 1OOJA 3KEVA 3PFVA 2JWWA 1BJFA 1MF8B 1KFUS 2RGIA 3BYAA 1IRJA 1QS7A 2HQWA 4YBHB 3I5GB 3IQOA 3PN7B 2LVJA 2GV5A 3E3RA 1CFDA 1MHOA 2OPOA 1CFFA 1RECA 2M1UA 4AQIA 1YVLA 1M31A 3NSKA 1KSOA 4OVNF 1TIZA 2R2IA 1ALWA 2EHBA 2ZN8A 4DCKA 4M2PA 3BUOB 2M7NA 1DGVA 1DJIA 2JXCA 3NSIA 5KSZA 4PDZA 2F3YA 1CDNA 3WXAA 3VRNA 1BMOA 5I8NA 2PSRA 5JOLA 3O78A 3C1VA 4C0JA 2KI6C 1K95A 4WQ3A 1V1GA 1ZFSA 2JNFA 2KAVA 3WNXB 2K7BA 1K9UA 1WLMA 3VGOA 2BE6A 1J7RA 1FPWA 3GK2A 2F2OA 2M49B 1TRFA 2ZRSA 2BCXA 2CCMA 2LLSA 2NLNA 3AAKA 1KQVA 2NCOA 3OP0A 2KNEA 1C7VA 3WHUB 3CLNA 2LLTA 4E68A 1IQ5A 2L2EA 1S5GZ 1K2HA 2I2RE 3BQ3A 2WC8A 1R2UA 2GGZA 1N65A 1NCZA 2KI4B 2LHLA 1A75A 1XFWO 2WCEA 3WHTB 5GQQC 2KAXA 3I5FB 2CBLA 2NZ0A 4CIDA 4HREE 3TDIA 1CFPA 3JTDC 1J1DA 1QIWA 3IQQA 4UPGA 3TUYC 1B8RA 4YGAA 1RROA 3KF9A 4GGNA 4C0LA 4U8DA 2KGBC 1UUSA 2OTGC 4CPVA 4PE1A 1L7ZA 1F4QA 2JTTA 5HLOA 4OKHA 1W7JB 1YR5A 2L0PA 2CTNA 3MSEB 1OMVA 4JWQA 1EJ3A 2TN4A 1BR1B 1WY9A 2QPTA 2LVKA 4CFRA 3BUNB 1KFUL 5TNCA 2KBMA 1UHHA 3NSOA 1G4YR 2LLUA 3CWGA 4HRGA 1HQVA 2HF5A 2JU0A 4YI8A 5AANA 2IS9A 1BT6A 1Q80A 1BG1A 2Y4QA 3BXKA 3EKJA 1WDCB 4NQGA 1EH2A 1S6IA 1KSMA 4N1GA 1K93D 3H4SE 4PHJA 1L2OB 3SG4A 1CFCA 1EXRA 1JWDA 1PRWA 1DVIA 1KFXL 1SKTA 3CR4X 3TZ1A 2MBXA 1AK8A 1GGWA 2FCDA 1SCVA 2I94A 1XFUO 4I5LB 1KK8B 4HRHA 2BE4A 3RLZA 2AUCA 1E8AA 4GBAA 2M8UA 1QX2A 4PHKA 3BOWA 2AMIA 4MZLA 2LMUA 1MXLC 1XFZO 3SG2A 4BY5A 2COLB 3HX4A 5CSIA 1OZOA 4PCWA 4QJ4B 1IGVA 1KQMB 1TNXA 1MR8A 4MEWA 1QX7A 3DVEA 2LE9B 3FWCA 3AKAA 1BF5A 1F8HA 2M3WA 1SCMC 2K8MB 2ZFDA 3LLEA 4C0KA 3CR5X 3EK4A 2K61A 2HPSA 5AXIA 5CSFA 4CLNA 4PHNA 3VRQA 2CT9A 2JNXA 1QVIZ 2KYCA 1Y1AA 1OE9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL8 A;  1YRU B;  3I5I C;  1B7T Y;  5I2Q A;  3TDU A;  2AAO A;  1K9P A;  3PAT A;  4PE7 A;  4MRY A;  1S3P A;  2JPT A;  3KPX A;  2MA2 A;  3I5H B;  2LAN A;  1F70 A;  1TOP A;  3M0W A;  1A4P A;  4QJ3 B;  3I5G C;  3PN7 C;  1KWO B;  2BCA A;  2I18 A;  4FQO A;  1N2D A;  4YGE B;  5BPJ A;  1CTR A;  3BUM B;  5KTY A;  3F45 A;  1QLK A;  4NDD A;  2JZI A;  5K89 A;  3NSL A;  1SW8 A;  1QIV A;  1AJ5 A;  3NXA A;  2JRF A;  5PAL A;  2ISD A;  4ETO A;  1K90 D;  2PAS A;  3EKH A;  3IF7 A;  1KFX S;  2ZKM X;  3BUW B;  3SG6 A;  4MN0 A;  2KSP A;  1PVA A;  1UHN A;  2WCF A;  3GK4 X;  1UHI A;  2F2P A;  1ZMZ A;  2E30 A;  3DD4 A;  1AVS A;  2MJW B;  1DTL A;  4GFT A;  2K7D A;  3CR2 A;  1XYD A;  1K96 A;  1QLS A;  3ZNI A;  1MUX A;  1XVJ A;  1XK4 C;  2GGM A;  3AKB A;  3EVV A;  3KHE A;  1Y1U A;  1MXE A;  2L98 A;  1V1F A;  4MSP A;  1PSR A;  3FWB A;  3EK8 A;  2ZNE A;  3TDZ A;  3CS1 A;  1GQM A;  4I5J A;  3DVJ A;  2H61 C;  2JUL A;  2CXJ A;  3TS5 B;  1S1E A;  1HT9 A;  2JT8 A;  1JF0 A;  1TTX A;  4AQJ A;  2KQ6 A;  1PK0 D;  2KI4 C;  2FOT A;  1FI6 A;  4ICB A;  4GPL B;  2KFF A;  2F33 A;  3I5F C;  4DUQ A;  1QTX A;  1ALV A;  4BY4 A;  3SG7 A;  1Y6W A;  1IJ6 A;  1ZAC A;  2LMT A;  1X02 A;  1B47 A;  1FBV A;  1XFV O;  2BL0 B;  1A75 B;  5J3X A;  2KAY A;  1B9A A;  1TCO B;  1YUR A;  5DKR A;  1XFY O;  3EK7 A;  2PAL A;  2HET A;  1WRK A;  5KU1 A;  4ORC B;  1Y0V H;  1YUS A;  4I5K A;  2NXQ A;  1SL9 A;  2LC5 A;  1U5I A;  2K7O A;  1OMR A;  2KOT A;  1KK7 Z;  1DGU A;  3DVM A;  4YGD B;  1PAL A;  1M45 A;  2LHI A;  1S26 D;  4N1F A;  4XJK A;  4MZJ A;  4ORA B;  1DJG A;  1IG5 A;  1UP5 A;  3GK1 A;  4AOM A;  1SR6 B;  1F4O A;  1GJY A;  4MLW A;  4DRW A;  1FI5 A;  1XO5 A;  2L4I A;  1AJ4 A;  2KQY A;  1J55 A;  2O60 A;  1WDC C;  2G9B A;  2LV7 A;  2WOS A;  3EVR A;  4TNC A;  4JPZ B;  3SG3 A;  2Y5I A;  2LNK A;  3PAL A;  1L2O C;  1CKK A;  3A8R A;  4OV2 A;  2V53 A;  2KFH A;  2LUX A;  2WCB A;  2M97 A;  2MAZ A;  2L4H A;  3D0Y A;  1G33 A;  1RFJ A;  4MVF A;  1SNL A;  5AER A;  5IBW A;  1IJ5 A;  3VRO A;  3LL8 B;  5CSJ A;  1KK8 C;  2E6W A;  4YGC B;  5ER4 X;  2LVV A;  3K21 A;  1K9K A;  4GAO A;  1PVB A;  2LM5 A;  3VRP A;  3D0Y B;  2SCP A;  2LCP A;  4HSZ A;  5D7F A;  3SIB A;  5FYX A;  1CMG A;  1NUB A;  1SK6 D;  1H4B A;  2NCP A;  2EC6 B;  1KQM C;  1CLL A;  1NX2 A;  2KYF A;  1NX0 A;  2BEC A;  3KO0 A;  4PHM A;  1JSA A;  1BLQ A;  3O4Y A;  4P5O E;  3BOW B;  3SJS A;  4CFQ A;  1UWO A;  1EL4 A;  1QV1 A;  3OX5 A;  5HYD A;  1EG3 A;  2D8N A;  4R1E A;  5HKZ A;  5HLV A;  1LA0 A;  3OX6 A;  1XA5 A;  1K8U A;  1CDL A;  1ZUZ A;  2OS8 B;  1OZS A;  2ZND A;  4A4B A;  4PE4 A;  2K0J A;  1QVI Y;  1OQP A;  1R6P A;  1IQ3 A;  2VRG A;  3DF0 A;  1JF2 A;  2BKH B;  1SL7 A;  1LVC D;  5G08 A;  1LIN A;  3A4U B;  2WOR A;  3I5H C;  2BBM A;  4GGF C;  4OCI A;  1CMF A;  1F55 A;  1AUI B;  1B8C A;  1RTP 1;  2KGR A;  1S36 A;  2KI6 D;  2MRD A;  4YRU A;  1JBA A;  1KWO C;  1DF0 A;  3DVK A;  3VRR A;  3JVT B;  3O2P A;  1B7T Z;  5ER5 A;  1DJX A;  1XFX O;  1DJY A;  1IH0 A;  3LK0 A;  1F71 A;  1RK9 A;  1WLZ A;  2JQ6 A;  2KFG A;  1Y1X A;  2Y1M A;  2BCB A;  1DF0 B;  1TCF A;  5I2O A;  1NP8 A;  1KCY A;  3FIA A;  1MWN A;  2G2B A;  1WRZ A;  4WQ2 A;  2A4J A;  2Q4U A;  1EG4 A;  5CPV A;  1C7W A;  3RM1 A;  4I5N B;  1J7Q A;  5DKQ A;  2H2K A;  4ZCU A;  1F54 A;  5HKW A;  1FW4 A;  3QRX A;  1DJZ A;  3BUX B;  1UHJ A;  1A29 A;  1QJT A;  4D1E A;  1M63 B;  1OMD A;  3LK1 A;  3ICB A;  4M2Q A;  2FJU B;  4PE0 A;  2FCE A;  3PLF B;  1YTZ C;  1JFJ A;  1SYM A;  2CNP A;  4JQ0 D;  1QAS A;  1BOC A;  3TS5 C;  2ZRT A;  4WRI A;  4N5X A;  1DJW A;  2LVI A;  1XK4 A;  1NSH A;  2F3Z A;  2LMV A;  1S5G Y;  3D10 A;  3O6B A;  4A4C A;  1D1O A;  1TNW A;  1SBJ A;  2I7A A;  1J1E A;  1W7I B;  2H61 A;  4IL1 A;  2KBI A;  5JJG A;  1CB1 A;  3OB1 B;  1NIW A;  1NCY A;  3HCM A;  1J7P A;  2JTZ A;  1NX3 A;  2DOQ A;  1LA3 A;  4P2Y B;  1CM1 A;  2BL0 C;  2M9G A;  1MQ1 A;  1PUL A;  2JC2 A;  1SRA A;  2JOJ A;  1NPQ A;  1PSB A;  2HQ8 A;  1S6C A;  1SPY A;  1GGZ A;  1C07 A;  3CGA A;  4MRX A;  1YX8 A;  2L50 A;  4DS7 A;  2QAC A;  1TNP A;  2BKI B;  3OB2 B;  4L9M A;  3PM8 A;  1KK7 Y;  1LXF C;  1NYA A;  1ZOT B;  1DT7 B;  1QXP A;  3JTD B;  2ZN9 A;  1M46 A;  3TUY B;  2MLF C;  1U5I B;  2F8P A;  2M1K B;  2KDH A;  2LAP A;  3GOF A;  1SR6 C;  4M2O A;  4NDB A;  2M7L A;  5D69 A;  3SG5 A;  1S6J A;  1CLM A;  2OTG B;  1YUU A;  5CSN A;  5AFP A;  4XJK B;  1QAT A;  2BBN A;  3LCP C;  5AEQ A;  4PAL A;  1VRK A;  1IWQ A;  5B8I B;  2M29 A;  3AAJ A;  4Q04 A;  1JUO A;  4ZCV A;  2PMY A;  1LKJ A;  1NCX A;  1B1G A;  2JT3 A;  4GUK A;  1J7O A;  1BR4 B;  1SY9 A;  4FTG A;  1K94 A;  2WND A;  1TN4 A;  2Q91 A;  2JXL A;  1RJV A;  1YVH A;  4USL A;  5HKY A;  3CZT X;  2PVB A;  1G8I A;  2KHN A;  2L51 A;  1B4C A;  2K7C A;  1JFK A;  2LP2 A;  1UHK A;  1TNQ A;  2EC6 C;  1CDM A;  2B1U A;  1RWY A;  4QJ5 B;  3OHM B;  2O5G A;  2LP3 A;  1BU3 A;  5I2L A;  5F6T A;  2L5X B;  2P6B B;  4F0Z B;  1N0Y A;  1UUR A;  1DMO A;  1CM4 A;  4YI9 A;  1IKU A;  1A2X A;  1CNP A;  2MLE C;  3EVU A;  2EGD A;  1YRT B;  2OS8 C;  2MHH A;  5DKN A;  2LUC A;  4YGB B;  1QX5 B;  2K2F A;  3PSR A;  1A03 A;  1OSA A;  4OR9 B;  1WRL A;  1FF1 A;  1ODB A;  3SIA A;  4XYN A;  1JC2 A;  1DJH A;  1SCM B;  2M0R A;  3FS7 A;  1QV0 A;  4ORB B;  3DF0 B;  3JVT C;  1AP4 A;  3CTN A;  2PRU A;  1H8B A;  1CLB A;  4MZK A;  1M39 A;  4DIR A;  2K2A A;  1NX1 A;  4GGF A;  2SAS A;  1B8L A;  3I5I B;  1SMG A;  4GNK B;  2JT0 A;  3ZWH A;  1BOD A;  1YX7 A;  2Y1N A;  4NDC A;  1CDP A;  1AHR A;  1NWD A;  4MBE A;  1YUT A;  1OOJ A;  3KEV A;  3PFV A;  2JWW A;  1BJF A;  1MF8 B;  1KFU S;  2RGI A;  3BYA A;  1IRJ A;  1QS7 A;  2HQW A;  4YBH B;  3I5G B;  3IQO A;  3PN7 B;  2LVJ A;  2GV5 A;  3E3R A;  1CFD A;  1MHO A;  2OPO A;  1CFF A;  1REC A;  2M1U A;  4AQI A;  1YVL A;  1M31 A;  3NSK A;  1KSO A;  4OVN F;  1TIZ A;  2R2I A;  1ALW A;  2EHB A;  2ZN8 A;  4DCK A;  4M2P A;  3BUO B;  2M7N A;  1DGV A;  1DJI A;  2JXC A;  3NSI A;  5KSZ A;  4PDZ A;  2F3Y A;  1CDN A;  3WXA A;  3VRN A;  1BMO A;  5I8N A;  2PSR A;  5JOL A;  3O78 A;  3C1V A;  4C0J A;  2KI6 C;  1K95 A;  4WQ3 A;  1V1G A;  1ZFS A;  2JNF A;  2KAV A;  3WNX B;  2K7B A;  1K9U A;  1WLM A;  3VGO A;  2BE6 A;  1J7R A;  1FPW A;  3GK2 A;  2F2O A;  2M49 B;  1TRF A;  2ZRS A;  2BCX A;  2CCM A;  2LLS A;  2NLN A;  3AAK A;  1KQV A;  2NCO A;  3OP0 A;  2KNE A;  1C7V A;  3WHU B;  3CLN A;  2LLT A;  4E68 A;  1IQ5 A;  2L2E A;  1S5G Z;  1K2H A;  2I2R E;  3BQ3 A;  2WC8 A;  1R2U A;  2GGZ A;  1N65 A;  1NCZ A;  2KI4 B;  2LHL A;  1A75 A;  1XFW O;  2WCE A;  3WHT B;  5GQQ C;  2KAX A;  3I5F B;  2CBL A;  2NZ0 A;  4CID A;  4HRE E;  3TDI A;  1CFP A;  3JTD C;  1J1D A;  1QIW A;  3IQQ A;  4UPG A;  3TUY C;  1B8R A;  4YGA A;  1RRO A;  3KF9 A;  4GGN A;  4C0L A;  4U8D A;  2KGB C;  1UUS A;  2OTG C;  4CPV A;  4PE1 A;  1L7Z A;  1F4Q A;  2JTT A;  5HLO A;  4OKH A;  1W7J B;  1YR5 A;  2L0P A;  2CTN A;  3MSE B;  1OMV A;  4JWQ A;  1EJ3 A;  2TN4 A;  1BR1 B;  1WY9 A;  2QPT A;  2LVK A;  4CFR A;  3BUN B;  1KFU L;  5TNC A;  2KBM A;  1UHH A;  3NSO A;  1G4Y R;  2LLU A;  3CWG A;  4HRG A;  1HQV A;  2HF5 A;  2JU0 A;  4YI8 A;  5AAN A;  2IS9 A;  1BT6 A;  1Q80 A;  1BG1 A;  2Y4Q A;  3BXK A;  3EKJ A;  1WDC B;  4NQG A;  1EH2 A;  1S6I A;  1KSM A;  4N1G A;  1K93 D;  3H4S E;  4PHJ A;  1L2O B;  3SG4 A;  1CFC A;  1EXR A;  1JWD A;  1PRW A;  1DVI A;  1KFX L;  1SKT A;  3CR4 X;  3TZ1 A;  2MBX A;  1AK8 A;  1GGW A;  2FCD A;  1SCV A;  2I94 A;  1XFU O;  4I5L B;  1KK8 B;  4HRH A;  2BE4 A;  3RLZ A;  2AUC A;  1E8A A;  4GBA A;  2M8U A;  1QX2 A;  4PHK A;  3BOW A;  2AMI A;  4MZL A;  2LMU A;  1MXL C;  1XFZ O;  3SG2 A;  4BY5 A;  2COL B;  3HX4 A;  5CSI A;  1OZO A;  4PCW A;  4QJ4 B;  1IGV A;  1KQM B;  1TNX A;  1MR8 A;  4MEW A;  1QX7 A;  3DVE A;  2LE9 B;  3FWC A;  3AKA A;  1BF5 A;  1F8H A;  2M3W A;  1SCM C;  2K8M B;  2ZFD A;  3LLE A;  4C0K A;  3CR5 X;  3EK4 A;  2K61 A;  2HPS A;  5AXI A;  5CSF A;  4CLN A;  4PHN A;  3VRQ A;  2CT9 A;  2JNX A;  1QVI Z;  2KYC A;  1Y1A A;  1OE9 B; 
#chains in the Genus database with same CATH topology
 1SL8 A;  1YRU B;  3I5I C;  1B7T Y;  5I2Q A;  3TDU A;  2AAO A;  1K9P A;  3PAT A;  4PE7 A;  4MRY A;  1S3P A;  2KLD A;  2JPT A;  4FQT A;  1P28 A;  3KPX A;  2MA2 A;  2WCM A;  3SS4 A;  3I5H B;  2LAN A;  1F70 A;  1TOP A;  3M0W A;  1A4P A;  3FE8 A;  4QJ3 B;  2L2C A;  3I5G C;  3PN7 C;  1KWO B;  2BCA A;  2I18 A;  4FQO A;  1N2D A;  4YGE B;  5BPJ A;  1CTR A;  3BUM B;  5KTY A;  3F45 A;  3B87 A;  1QLK A;  4NDD A;  5FI6 A;  2JZI A;  5K89 A;  3NSL A;  1SW8 A;  1QIV A;  1AJ5 A;  3NXA A;  3UO9 A;  2JRF A;  5PAL A;  2ISD A;  4ETO A;  1K90 D;  2PAS A;  3EKH A;  3IF7 A;  1KFX S;  2ZKM X;  3BUW B;  3S0E A;  3SG6 A;  4MN0 A;  2KSP A;  1PVA A;  1UHN A;  2WCF A;  3GK4 X;  1UHI A;  2F2P A;  1ZMZ A;  2E30 A;  3DD4 A;  1AVS A;  2MJW B;  1DTL A;  2P70 A;  4GFT A;  5EL2 A;  2K7D A;  3CR2 A;  1XYD A;  1K96 A;  1QLS A;  3ZNI A;  1MUX A;  1XVJ A;  1XK4 C;  2GGM A;  3AKB A;  3EVV A;  3BFH A;  1Y1U A;  3KHE A;  1MXE A;  2L98 A;  1V1F A;  4MSP A;  1PSR A;  3FWB A;  3EK8 A;  2ZNE A;  3TDZ A;  3CS1 A;  1GQM A;  4I5J A;  3DVJ A;  2H61 C;  2JUL A;  2CXJ A;  3TS5 B;  3VB1 A;  3B86 A;  1S1E A;  3L4L A;  1HT9 A;  2JT8 A;  1JF0 A;  1TTX A;  4AQJ A;  2KQ6 A;  1DEL A;  4OZD A;  1PK0 D;  2KI4 C;  2FOT A;  1FI6 A;  4ICB A;  2QEB A;  4GPL B;  2KFF A;  2F33 A;  3I5F C;  4DUQ A;  1QTX A;  1ALV A;  4BY4 A;  3SG7 A;  1Y6W A;  1Z4H A;  1IJ6 A;  1ZAC A;  2LMT A;  4KYN A;  1X02 A;  1B47 A;  1FBV A;  1XFV O;  1A75 B;  2BL0 B;  5J3X A;  2KAY A;  1B9A A;  2BNX A;  1TCO B;  1YUR A;  5DKR A;  1XFY O;  3EK7 A;  2PAL A;  2HET A;  1WRK A;  3D78 A;  3BFB A;  5KU1 A;  4ORC B;  1Y0V H;  1YUS A;  4I5K A;  2NXQ A;  1SL9 A;  2LC5 A;  1U5I A;  2K7O A;  1OMR A;  2KOT A;  1KK7 Z;  1DGU A;  3DVM A;  4YGD B;  1PAL A;  1M45 A;  3R1O A;  2LHI A;  1S26 D;  4N1F A;  4XJK A;  4MZJ A;  4ORA B;  1DJG A;  1IG5 A;  1UP5 A;  3GK1 A;  4AOM A;  1SR6 B;  1F4O A;  1GJY A;  4MLW A;  4DRW A;  1FI5 A;  1XO5 A;  2L4I A;  1AJ4 A;  1T14 A;  2WC6 A;  2KQY A;  1J55 A;  2O60 A;  1WDC C;  2G9B A;  2LV7 A;  2WOS A;  3BJH A;  3EVR A;  4TNC A;  4JPZ B;  3SG3 A;  2Y5I A;  2LNK A;  3PAL A;  1L2O C;  1CKK A;  3A8R A;  4OV2 A;  2V53 A;  2KFH A;  2LUX A;  2WCB A;  3O4X A;  2M97 A;  2MAZ A;  2L4H A;  3D0Y A;  1G33 A;  1RFJ A;  4MVF A;  1SNL A;  5AER A;  5IBW A;  1IJ5 A;  3VRO A;  3LL8 B;  5CSJ A;  1KK8 C;  2E6W A;  4YGC B;  5ER4 X;  2LVV A;  3K21 A;  1K9K A;  4GAO A;  1PVB A;  1C3Z A;  2LM5 A;  3VRP A;  3D0Y B;  2SCP A;  2LCP A;  4HSZ A;  5D7F A;  3SIB A;  5FYX A;  1CMG A;  1NUB A;  1SK6 D;  1H4B A;  2ERB A;  2NCP A;  3DXL A;  2EC6 B;  1KQM C;  1CLL A;  2KPH A;  1NX2 A;  2KYF A;  4IJ7 A;  1NX0 A;  2BEC A;  3KO0 A;  4PHM A;  1JSA A;  1BLQ A;  3O4Y A;  4P5O E;  1XFR A;  3BOW B;  3SJS A;  4CFQ A;  1UWO A;  1EL4 A;  1QV1 A;  3OX5 A;  5HYD A;  1EG3 A;  2D8N A;  4R1E A;  5HKZ A;  5HLV A;  1LA0 A;  3OX6 A;  1XA5 A;  1K8U A;  1CDL A;  1ZUZ A;  5FI7 A;  2OS8 B;  1OZS A;  2ZND A;  4A4B A;  4PE4 A;  2K0J A;  2QEV A;  1QVI Y;  1OQP A;  1R6P A;  1DC1 A;  2VRG A;  3DF0 A;  1IQ3 A;  1JF2 A;  2BKH B;  1SL7 A;  3FE9 A;  1LVC D;  5G08 A;  1LIN A;  3A4U B;  2WOR A;  3I5H C;  2BBM A;  4GGF C;  4OCI A;  4PT1 A;  1CMF A;  1AUI B;  1F55 A;  1B8C A;  1RTP 1;  2KGR A;  1S36 A;  2KI6 D;  1DEK A;  2MRD A;  4YRU A;  1JBA A;  1KWO C;  3S0G A;  1DF0 A;  3DVK A;  3VRR A;  3JVT B;  3O2P A;  1SSE B;  1B7T Z;  5ER5 A;  1DJX A;  1XFX O;  1DJY A;  1IH0 A;  3LK0 A;  3L47 A;  1F71 A;  1RK9 A;  1WLZ A;  2JQ6 A;  2KFG A;  1Y1X A;  2Y1M A;  1TUJ A;  1DF0 B;  1TCF A;  2BCB A;  2WCH A;  5I2O A;  1NP8 A;  1KCY A;  3FIA A;  1MWN A;  2G2B A;  1WRZ A;  4WQ2 A;  2A4J A;  2Q4U A;  1EG4 A;  5CPV A;  1C7W A;  3RM1 A;  2JPO A;  4I5N B;  1J7Q A;  5DKQ A;  2H2K A;  4ZCU A;  1F54 A;  5HKW A;  1FW4 A;  2P71 A;  3QRX A;  1DJZ A;  3BUX B;  1UHJ A;  1A29 A;  1QJT A;  3NHT A;  4D1E A;  1M63 B;  1OMD A;  3LK1 A;  3ICB A;  4M2Q A;  2FJU B;  4PE0 A;  2FCE A;  3PLF B;  1YTZ C;  1JFJ A;  1SYM A;  2CNP A;  4JQ0 D;  1QAS A;  1BOC A;  3TS5 C;  2BAP A;  2ZRT A;  4N5X A;  4WRI A;  1DJW A;  2LVI A;  3OBV A;  1XK4 A;  1NSH A;  2F3Z A;  2LMV A;  1S5G Y;  3D10 A;  3O6B A;  4A4C A;  4INX A;  1TNW A;  1D1O A;  1SBJ A;  2I7A A;  1J1E A;  1W7I B;  2H61 A;  2K60 A;  4IL1 A;  2KBI A;  5JJG A;  1CB1 A;  3OB1 B;  1NIW A;  1NCY A;  3HCM A;  4F7F A;  1J7P A;  2JTZ A;  1NX3 A;  3CAB A;  2DOQ A;  1LA3 A;  4P2Y B;  1CM1 A;  2BL0 C;  2M9G A;  3D75 A;  3D77 A;  1MQ1 A;  3CYZ A;  1PUL A;  2JC2 A;  3EG5 B;  1SRA A;  2JOJ A;  1NPQ A;  1PSB A;  2HQ8 A;  1S6C A;  1SPY A;  1GGZ A;  1C07 A;  3CGA A;  4MRX A;  1W9Z A;  1YX8 A;  2L50 A;  3NGV A;  4DS7 A;  2QAC A;  1TNP A;  2BKI B;  2QEH A;  3OB2 B;  4L9M A;  5HL1 A;  1ORG A;  3PM8 A;  1KK7 Y;  1LXF C;  1NYA A;  1ZOT B;  1DT7 B;  1QXP A;  3JTD B;  2ZN9 A;  1M46 A;  3SS3 A;  2MLF C;  3TUY B;  1U5I B;  2F8P A;  2M1K B;  2KDH A;  2LAP A;  3GOF A;  1SR6 C;  4M2O A;  4NDB A;  2M7L A;  5D69 A;  3SG5 A;  1S6J A;  1CLM A;  2OTG B;  1YUU A;  3R1V A;  5CSN A;  3S0B A;  2H8V A;  4XJK B;  1QAT A;  2BBN A;  3N7H A;  3LCP C;  5AFP A;  5AEQ A;  3S0F A;  3S0D A;  4PAL A;  1VRK A;  1IWQ A;  5B8I B;  2M29 A;  3AAJ A;  4Q04 A;  1JUO A;  4ZCV A;  2PMY A;  1LKJ A;  1NCX A;  1B1G A;  2JT3 A;  3R72 A;  4GUK A;  1J7O A;  1BR4 B;  1SY9 A;  4FTG A;  1K94 A;  2WND A;  1TN4 A;  2Q91 A;  2JXL A;  3S0A A;  1RJV A;  3CDN A;  5FI2 A;  1YVH A;  4USL A;  3D74 A;  5HKY A;  3CZT X;  2PVB A;  1G8I A;  2KHN A;  3K1E A;  1DQE A;  2L51 A;  1B4C A;  1OOI X;  1JFK A;  2K7C A;  2LP2 A;  1UHK A;  1TNQ A;  2EC6 C;  1CDM A;  2B1U A;  3DZT A;  1RWY A;  4QJ5 B;  3OHM B;  2O5G A;  2LP3 A;  1BU3 A;  5I2L A;  5F6T A;  2L5X B;  2P6B B;  4F0Z B;  1N0Y A;  1UUR A;  2WCK A;  1CM4 A;  4YI9 A;  1IKU A;  1A2X A;  1CNP A;  1DMO A;  2MLE C;  3EVU A;  2EGD A;  1YRT B;  2OS8 C;  2MHH A;  5DKN A;  2LUC A;  3D73 A;  3R1P A;  1LS8 A;  4YGB B;  1QX5 B;  2K2F A;  3PSR A;  1A03 A;  1OSA A;  4OR9 B;  1WRL A;  5D3O A;  1FF1 A;  1ODB A;  3SIA A;  4XYN A;  1JC2 A;  1DJH A;  2QEO A;  1SCM B;  2M0R A;  4JD9 A;  3FS7 A;  1QV0 A;  4ORB B;  3DF0 B;  3JVT C;  1AP4 A;  3CTN A;  2PRU A;  1H8B A;  1CLB A;  4MZK A;  1M39 A;  4DIR A;  2K2A A;  1NX1 A;  4GGF A;  2SAS A;  1B8L A;  3I5I B;  1SMG A;  4GNK B;  2JT0 A;  3ZWH A;  1BOD A;  1YX7 A;  2Y1N A;  4NDC A;  3RZS A;  1CDP A;  1AHR A;  1NWD A;  2PQL A;  4MBE A;  1YUT A;  1OOJ A;  3KEV A;  3PFV A;  2JWW A;  1BJF A;  1MF8 B;  1KFU S;  2RGI A;  3BYA A;  1IRJ A;  1QS7 A;  2HQW A;  3D76 A;  4YBH B;  3NHI A;  1OOF A;  3I5G B;  2WC5 A;  3IQO A;  2LVJ A;  2GV5 A;  3E3R A;  3PN7 B;  1CFD A;  1MHO A;  2OPO A;  1CFF A;  1REC A;  2M1U A;  4AQI A;  1YVL A;  1M31 A;  3NSK A;  1KSO A;  4OVN F;  1TIZ A;  2R2I A;  1ALW A;  2EHB A;  2ZN8 A;  2GTE A;  3CZ0 A;  3QME A;  4DCK A;  4M2P A;  3BUO B;  2M7N A;  2FJY A;  1DGV A;  1DJI A;  2JXC A;  3NSI A;  5KSZ A;  4PDZ A;  2F3Y A;  2QDI A;  4JKT A;  1CDN A;  3CZ2 A;  3IVT A;  3VRN A;  3WXA A;  1BMO A;  5I8N A;  2PSR A;  5JOL A;  3O78 A;  3C1V A;  4C0J A;  2KI6 C;  2YGU A;  1K95 A;  3Q8I A;  4WQ3 A;  1V1G A;  1ZFS A;  2JNF A;  2KAV A;  3CZ1 A;  3WNX B;  2K7B A;  1K9U A;  1WLM A;  3VGO A;  2BE6 A;  1J7R A;  1FPW A;  3GK2 A;  3L4A A;  2F2O A;  2M49 B;  1TRF A;  3B88 A;  2ZRS A;  2BCX A;  2CCM A;  2LLS A;  2NLN A;  2PYQ A;  3AAK A;  1KQV A;  2NCO A;  3OP0 A;  2KNE A;  1C7V A;  3WHU B;  2WCJ A;  3CLN A;  2LLT A;  5DIC A;  4E68 A;  1IQ5 A;  2L2E A;  1S5G Z;  1K2H A;  2I2R E;  3BQ3 A;  2WC8 A;  1R2U A;  2GGZ A;  1N65 A;  1NCZ A;  1OOG A;  2KI4 B;  2LHL A;  3FE6 A;  1A75 A;  1XFW O;  2WCE A;  3WHT B;  5GQQ C;  2KAX A;  3I5F B;  1C3Y A;  2CBL A;  3B6X A;  2NZ0 A;  5I94 A;  4CID A;  4HRE E;  3TDI A;  1CFP A;  3JTD C;  1J1D A;  1QIW A;  3PM2 A;  3IQQ A;  4UPG A;  3B7A A;  3DYE A;  3TUY C;  1B8R A;  4YGA A;  1RRO A;  3KF9 A;  4GGN A;  4C0L A;  4U8D A;  2KGB C;  1UUS A;  2OTG C;  4CPV A;  4PE1 A;  1L7Z A;  1F4Q A;  1TWO A;  2JTT A;  5HLO A;  4OKH A;  1W7J B;  1YR5 A;  2L0P A;  2CTN A;  3MSE B;  1OOH A;  1OMV A;  1GM0 A;  4JWQ A;  1EJ3 A;  2TN4 A;  1BR1 B;  1WY9 A;  2QPT A;  2LVK A;  4CFR A;  3BUN B;  1KFU L;  5TNC A;  2KBM A;  1UHH A;  3NSO A;  1Z2C B;  1G4Y R;  2LLU A;  1IIO A;  3CWG A;  4HRG A;  1HQV A;  2HF5 A;  2JU0 A;  3PJI A;  4YI8 A;  5AAN A;  2IS9 A;  1BT6 A;  1Q80 A;  1BG1 A;  2Y4Q A;  3BXK A;  3EKJ A;  1WDC B;  4NQG A;  1EH2 A;  1S6I A;  1KSM A;  4N1G A;  1K93 D;  3H4S E;  1QWV A;  4PHJ A;  1L2O B;  3SG4 A;  1CFC A;  1EXR A;  1JWD A;  1PRW A;  1DVI A;  1KFX L;  1SKT A;  3BFA A;  3CR4 X;  3TZ1 A;  1TUZ A;  2MBX A;  1AK8 A;  1GGW A;  2FCD A;  1SCV A;  2I94 A;  1XFU O;  2L5Y A;  4I5L B;  1KK8 B;  3UNW A;  4HRH A;  2BE4 A;  3RLZ A;  2AUC A;  1E8A A;  4GBA A;  2M8U A;  1QX2 A;  4PHK A;  3OGN A;  3BOW A;  2AMI A;  4MZL A;  2LMU A;  1MXL C;  1XFZ O;  3SG2 A;  3SS5 A;  4BY5 A;  1OW4 A;  2COL B;  3HX4 A;  5CSI A;  1OZO A;  4PCW A;  4QJ4 B;  1IGV A;  1KQM B;  1TNX A;  1MR8 A;  4MEW A;  1QX7 A;  3DVE A;  2LE9 B;  3FWC A;  3AKA A;  1BF5 A;  1F8H A;  2M3W A;  1SCM C;  2K8M B;  2ZFD A;  3LLE A;  4C0K A;  3CR5 X;  3EK4 A;  2K61 A;  2HPS A;  3DY9 A;  5AXI A;  5CSF A;  4CLN A;  4INW A;  4PHN A;  3VRQ A;  2KLE A;  2WCL A;  3V2L A;  2CT9 A;  2JNX A;  1QVI Z;  2KYC A;  1Y1A A;  1OE9 B; 
#chains in the Genus database with same CATH homology
 1SL8 A;  1YRU B;  3I5I C;  1B7T Y;  5I2Q A;  3TDU A;  2AAO A;  1K9P A;  3PAT A;  4PE7 A;  4MRY A;  1S3P A;  2JPT A;  3KPX A;  2MA2 A;  3I5H B;  2LAN A;  1F70 A;  1TOP A;  3M0W A;  1A4P A;  4QJ3 B;  3I5G C;  3PN7 C;  1KWO B;  2BCA A;  2I18 A;  4FQO A;  1N2D A;  4YGE B;  5BPJ A;  1CTR A;  3BUM B;  5KTY A;  3F45 A;  1QLK A;  4NDD A;  2JZI A;  5K89 A;  3NSL A;  1SW8 A;  1QIV A;  1AJ5 A;  3NXA A;  2JRF A;  5PAL A;  2ISD A;  4ETO A;  1K90 D;  2PAS A;  3EKH A;  3IF7 A;  1KFX S;  2ZKM X;  3BUW B;  3SG6 A;  4MN0 A;  2KSP A;  1PVA A;  1UHN A;  2WCF A;  3GK4 X;  1UHI A;  2F2P A;  1ZMZ A;  2E30 A;  3DD4 A;  1AVS A;  2MJW B;  1DTL A;  4GFT A;  2K7D A;  3CR2 A;  1XYD A;  1K96 A;  1QLS A;  3ZNI A;  1MUX A;  1XVJ A;  1XK4 C;  2GGM A;  3AKB A;  3EVV A;  3KHE A;  1Y1U A;  1MXE A;  2L98 A;  1V1F A;  4MSP A;  1PSR A;  3FWB A;  3EK8 A;  2ZNE A;  3TDZ A;  3CS1 A;  1GQM A;  4I5J A;  3DVJ A;  2H61 C;  2JUL A;  2CXJ A;  3TS5 B;  1S1E A;  1HT9 A;  2JT8 A;  1JF0 A;  1TTX A;  4AQJ A;  2KQ6 A;  1PK0 D;  2KI4 C;  2FOT A;  1FI6 A;  4ICB A;  4GPL B;  2KFF A;  2F33 A;  3I5F C;  4DUQ A;  1QTX A;  1ALV A;  4BY4 A;  3SG7 A;  1Y6W A;  1IJ6 A;  1ZAC A;  2LMT A;  1X02 A;  1B47 A;  1FBV A;  1XFV O;  2BL0 B;  1A75 B;  5J3X A;  2KAY A;  1B9A A;  1TCO B;  1YUR A;  5DKR A;  1XFY O;  3EK7 A;  2PAL A;  2HET A;  1WRK A;  5KU1 A;  4ORC B;  1Y0V H;  1YUS A;  4I5K A;  2NXQ A;  1SL9 A;  2LC5 A;  1U5I A;  2K7O A;  1OMR A;  2KOT A;  1KK7 Z;  1DGU A;  3DVM A;  4YGD B;  1PAL A;  1M45 A;  2LHI A;  1S26 D;  4N1F A;  4XJK A;  4MZJ A;  4ORA B;  1DJG A;  1IG5 A;  1UP5 A;  3GK1 A;  4AOM A;  1SR6 B;  1F4O A;  1GJY A;  4MLW A;  4DRW A;  1FI5 A;  1XO5 A;  2L4I A;  1AJ4 A;  2KQY A;  1J55 A;  2O60 A;  1WDC C;  2G9B A;  2LV7 A;  2WOS A;  3EVR A;  4TNC A;  4JPZ B;  3SG3 A;  2Y5I A;  2LNK A;  3PAL A;  1L2O C;  1CKK A;  3A8R A;  4OV2 A;  2V53 A;  2KFH A;  2LUX A;  2WCB A;  2M97 A;  2MAZ A;  2L4H A;  3D0Y A;  1G33 A;  1RFJ A;  4MVF A;  1SNL A;  5AER A;  5IBW A;  1IJ5 A;  3VRO A;  3LL8 B;  5CSJ A;  1KK8 C;  2E6W A;  4YGC B;  5ER4 X;  2LVV A;  3K21 A;  1K9K A;  4GAO A;  1PVB A;  2LM5 A;  3VRP A;  3D0Y B;  2SCP A;  2LCP A;  4HSZ A;  5D7F A;  3SIB A;  5FYX A;  1CMG A;  1NUB A;  1SK6 D;  1H4B A;  2NCP A;  2EC6 B;  1KQM C;  1CLL A;  1NX2 A;  2KYF A;  1NX0 A;  2BEC A;  3KO0 A;  4PHM A;  1JSA A;  1BLQ A;  3O4Y A;  4P5O E;  3BOW B;  3SJS A;  4CFQ A;  1UWO A;  1EL4 A;  1QV1 A;  3OX5 A;  5HYD A;  1EG3 A;  2D8N A;  4R1E A;  5HKZ A;  5HLV A;  1LA0 A;  3OX6 A;  1XA5 A;  1K8U A;  1CDL A;  1ZUZ A;  2OS8 B;  1OZS A;  2ZND A;  4A4B A;  4PE4 A;  2K0J A;  1QVI Y;  1OQP A;  1R6P A;  1IQ3 A;  2VRG A;  3DF0 A;  1JF2 A;  2BKH B;  1SL7 A;  1LVC D;  5G08 A;  1LIN A;  3A4U B;  2WOR A;  3I5H C;  2BBM A;  4GGF C;  4OCI A;  1CMF A;  1F55 A;  1AUI B;  1B8C A;  1RTP 1;  2KGR A;  1S36 A;  2KI6 D;  2MRD A;  4YRU A;  1JBA A;  1KWO C;  1DF0 A;  3DVK A;  3VRR A;  3JVT B;  3O2P A;  1B7T Z;  5ER5 A;  1DJX A;  1XFX O;  1DJY A;  1IH0 A;  3LK0 A;  1F71 A;  1RK9 A;  1WLZ A;  2JQ6 A;  2KFG A;  1Y1X A;  2Y1M A;  2BCB A;  1DF0 B;  1TCF A;  5I2O A;  1NP8 A;  1KCY A;  3FIA A;  1MWN A;  2G2B A;  1WRZ A;  4WQ2 A;  2A4J A;  2Q4U A;  1EG4 A;  5CPV A;  1C7W A;  3RM1 A;  4I5N B;  1J7Q A;  5DKQ A;  2H2K A;  4ZCU A;  1F54 A;  5HKW A;  1FW4 A;  3QRX A;  1DJZ A;  3BUX B;  1UHJ A;  1A29 A;  1QJT A;  4D1E A;  1M63 B;  1OMD A;  3LK1 A;  3ICB A;  4M2Q A;  2FJU B;  4PE0 A;  2FCE A;  3PLF B;  1YTZ C;  1JFJ A;  1SYM A;  2CNP A;  4JQ0 D;  1QAS A;  1BOC A;  3TS5 C;  2ZRT A;  4WRI A;  4N5X A;  1DJW A;  2LVI A;  1XK4 A;  1NSH A;  2F3Z A;  2LMV A;  1S5G Y;  3D10 A;  3O6B A;  4A4C A;  1D1O A;  1TNW A;  1SBJ A;  2I7A A;  1J1E A;  1W7I B;  2H61 A;  4IL1 A;  2KBI A;  5JJG A;  1CB1 A;  3OB1 B;  1NIW A;  1NCY A;  3HCM A;  1J7P A;  2JTZ A;  1NX3 A;  2DOQ A;  1LA3 A;  4P2Y B;  1CM1 A;  2BL0 C;  2M9G A;  1MQ1 A;  1PUL A;  2JC2 A;  1SRA A;  2JOJ A;  1NPQ A;  1PSB A;  2HQ8 A;  1S6C A;  1SPY A;  1GGZ A;  1C07 A;  3CGA A;  4MRX A;  1YX8 A;  2L50 A;  4DS7 A;  2QAC A;  1TNP A;  2BKI B;  3OB2 B;  4L9M A;  3PM8 A;  1KK7 Y;  1LXF C;  1NYA A;  1ZOT B;  1DT7 B;  1QXP A;  3JTD B;  2ZN9 A;  1M46 A;  3TUY B;  2MLF C;  1U5I B;  2F8P A;  2M1K B;  2KDH A;  2LAP A;  3GOF A;  1SR6 C;  4M2O A;  4NDB A;  2M7L A;  5D69 A;  3SG5 A;  1S6J A;  1CLM A;  2OTG B;  1YUU A;  5CSN A;  5AFP A;  4XJK B;  1QAT A;  2BBN A;  3LCP C;  5AEQ A;  4PAL A;  1VRK A;  1IWQ A;  5B8I B;  2M29 A;  3AAJ A;  4Q04 A;  1JUO A;  4ZCV A;  2PMY A;  1LKJ A;  1NCX A;  1B1G A;  2JT3 A;  4GUK A;  1J7O A;  1BR4 B;  1SY9 A;  4FTG A;  1K94 A;  2WND A;  1TN4 A;  2Q91 A;  2JXL A;  1RJV A;  1YVH A;  4USL A;  5HKY A;  3CZT X;  2PVB A;  1G8I A;  2KHN A;  2L51 A;  1B4C A;  2K7C A;  1JFK A;  2LP2 A;  1UHK A;  1TNQ A;  2EC6 C;  1CDM A;  2B1U A;  1RWY A;  4QJ5 B;  3OHM B;  2O5G A;  2LP3 A;  1BU3 A;  5I2L A;  5F6T A;  2L5X B;  2P6B B;  4F0Z B;  1N0Y A;  1UUR A;  1DMO A;  1CM4 A;  4YI9 A;  1IKU A;  1A2X A;  1CNP A;  2MLE C;  3EVU A;  2EGD A;  1YRT B;  2OS8 C;  2MHH A;  5DKN A;  2LUC A;  4YGB B;  1QX5 B;  2K2F A;  3PSR A;  1A03 A;  1OSA A;  4OR9 B;  1WRL A;  1FF1 A;  1ODB A;  3SIA A;  4XYN A;  1JC2 A;  1DJH A;  1SCM B;  2M0R A;  3FS7 A;  1QV0 A;  4ORB B;  3DF0 B;  3JVT C;  1AP4 A;  3CTN A;  2PRU A;  1H8B A;  1CLB A;  4MZK A;  1M39 A;  4DIR A;  2K2A A;  1NX1 A;  4GGF A;  2SAS A;  1B8L A;  3I5I B;  1SMG A;  4GNK B;  2JT0 A;  3ZWH A;  1BOD A;  1YX7 A;  2Y1N A;  4NDC A;  1CDP A;  1AHR A;  1NWD A;  4MBE A;  1YUT A;  1OOJ A;  3KEV A;  3PFV A;  2JWW A;  1BJF A;  1MF8 B;  1KFU S;  2RGI A;  3BYA A;  1IRJ A;  1QS7 A;  2HQW A;  4YBH B;  3I5G B;  3IQO A;  3PN7 B;  2LVJ A;  2GV5 A;  3E3R A;  1CFD A;  1MHO A;  2OPO A;  1CFF A;  1REC A;  2M1U A;  4AQI A;  1YVL A;  1M31 A;  3NSK A;  1KSO A;  4OVN F;  1TIZ A;  2R2I A;  1ALW A;  2EHB A;  2ZN8 A;  4DCK A;  4M2P A;  3BUO B;  2M7N A;  1DGV A;  1DJI A;  2JXC A;  3NSI A;  5KSZ A;  4PDZ A;  2F3Y A;  1CDN A;  3WXA A;  3VRN A;  1BMO A;  5I8N A;  2PSR A;  5JOL A;  3O78 A;  3C1V A;  4C0J A;  2KI6 C;  1K95 A;  4WQ3 A;  1V1G A;  1ZFS A;  2JNF A;  2KAV A;  3WNX B;  2K7B A;  1K9U A;  1WLM A;  3VGO A;  2BE6 A;  1J7R A;  1FPW A;  3GK2 A;  2F2O A;  2M49 B;  1TRF A;  2ZRS A;  2BCX A;  2CCM A;  2LLS A;  2NLN A;  3AAK A;  1KQV A;  2NCO A;  3OP0 A;  2KNE A;  1C7V A;  3WHU B;  3CLN A;  2LLT A;  4E68 A;  1IQ5 A;  2L2E A;  1S5G Z;  1K2H A;  2I2R E;  3BQ3 A;  2WC8 A;  1R2U A;  2GGZ A;  1N65 A;  1NCZ A;  2KI4 B;  2LHL A;  1A75 A;  1XFW O;  2WCE A;  3WHT B;  5GQQ C;  2KAX A;  3I5F B;  2CBL A;  2NZ0 A;  4CID A;  4HRE E;  3TDI A;  1CFP A;  3JTD C;  1J1D A;  1QIW A;  3IQQ A;  4UPG A;  3TUY C;  1B8R A;  4YGA A;  1RRO A;  3KF9 A;  4GGN A;  4C0L A;  4U8D A;  2KGB C;  1UUS A;  2OTG C;  4CPV A;  4PE1 A;  1L7Z A;  1F4Q A;  2JTT A;  5HLO A;  4OKH A;  1W7J B;  1YR5 A;  2L0P A;  2CTN A;  3MSE B;  1OMV A;  4JWQ A;  1EJ3 A;  2TN4 A;  1BR1 B;  1WY9 A;  2QPT A;  2LVK A;  4CFR A;  3BUN B;  1KFU L;  5TNC A;  2KBM A;  1UHH A;  3NSO A;  1G4Y R;  2LLU A;  3CWG A;  4HRG A;  1HQV A;  2HF5 A;  2JU0 A;  4YI8 A;  5AAN A;  2IS9 A;  1BT6 A;  1Q80 A;  1BG1 A;  2Y4Q A;  3BXK A;  3EKJ A;  1WDC B;  4NQG A;  1EH2 A;  1S6I A;  1KSM A;  4N1G A;  1K93 D;  3H4S E;  4PHJ A;  1L2O B;  3SG4 A;  1CFC A;  1EXR A;  1JWD A;  1PRW A;  1DVI A;  1KFX L;  1SKT A;  3CR4 X;  3TZ1 A;  2MBX A;  1AK8 A;  1GGW A;  2FCD A;  1SCV A;  2I94 A;  1XFU O;  4I5L B;  1KK8 B;  4HRH A;  2BE4 A;  3RLZ A;  2AUC A;  1E8A A;  4GBA A;  2M8U A;  1QX2 A;  4PHK A;  3BOW A;  2AMI A;  4MZL A;  2LMU A;  1MXL C;  1XFZ O;  3SG2 A;  4BY5 A;  2COL B;  3HX4 A;  5CSI A;  1OZO A;  4PCW A;  4QJ4 B;  1IGV A;  1KQM B;  1TNX A;  1MR8 A;  4MEW A;  1QX7 A;  3DVE A;  2LE9 B;  3FWC A;  3AKA A;  1BF5 A;  1F8H A;  2M3W A;  1SCM C;  2K8M B;  2ZFD A;  3LLE A;  4C0K A;  3CR5 X;  3EK4 A;  2K61 A;  2HPS A;  5AXI A;  5CSF A;  4CLN A;  4PHN A;  3VRQ A;  2CT9 A;  2JNX A;  1QVI Z;  2KYC A;  1Y1A A;  1OE9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...