1BR4B

Smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
148
Chain Sequence
FSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEQLVAGHEDSNGCINYEELVRMVLSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN
publication title Crystal structure of a vertebrate smooth muscle myosin motor domain and its complex with the essential light chain: visualization of the pre-power stroke state.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Muscle protein
total genus 29
structure length 148
sequence length 148
chains with identical sequence D, F, H
ec nomenclature ec 3.6.1.32: Transferred entry: 5.6.1.8.
pdb deposition date 1998-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br4B02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1br4B01
2KI4C 2CBLA 4TNCA 1YUSA 1B1GA 4P2YB 5BPJA 1SRAA 2BE4A 2KI6C 2M97A 2MHHA 2OS8B 2QACA 4MVFA 3AKAA 4ZCUA 2B1UA 2LLSA 4MBEA 1V1GA 1YX7A 1G33A 1NSHA 2LM5A 2NLNA 1MXLC 2FOTA 2KQYA 4HREE 1ALWA 1CFPA 1WLZA 1F8HA 2A4JA 1JSAA 1YUUA 1L2OC 2KOTA 1S26D 1B9AA 1S6IA 3TS5C 3O78A 1DTLA 4FTGA 2Q4UA 2MLFC 2BCAA 4CIDA 5DKQA 1WRKA 4OR9B 1RWYA 4DCKA 2LANA 5ER4X 2K7BA 4YGAA 3BUOB 1SR6C 1DVIA 2AMIA 3CZTX 2JT3A 1B8RA 1XK4C 4YGEB 1OE9B 4GBAA 2GGMA 2LCPA 2K2AA 2OS8C 4P5OE 1K2HA 1Y1UA 1AUIB 1QLKA 2H2KA 2WCBA 2I94A 4PHJA 1AVSA 4DS7A 5TNCA 2JC2A 3D0YB 4WQ2A 2Y5IA 3IQQA 3VRNA 1NYAA 1YVLA 5I2QA 3PLFB 2O5GA 3DD4A 3OHMB 2M1UA 2ZNEA 1CFDA 1QXPA 5J3XA 5AANA 3EVRA 1IGVA 1YURA 4XJKB 1ZMZA 1L7ZA 1BODA 4CFRA 1CDPA 2JNFA 1QX5B 2BL0C 2F8PA 1QV1A 1KK8C 1M46A 1A75A 2I18A 2L4IA 4OKHA 5HLOA 3KHEA 5G08A 1WDCC 1YUTA 4ZCVA 3FIAA 4OV2A 2JRFA 1AK8A 1FI5A 4YI8A 1CLBA 2K7CA 2OTGC 1TTXA 5K89A 2BE6A 2G2BA 2M0RA 1H4BA 1F71A 4D1EA 4C0JA 3DVJA 1DJGA 4DUQA 1K9KA 3JTDB 3SIBA 1BR4B 1SL9A 1NUBA 3FWCA 1MF8B 1CM1A 4GAOA 4GNKB 4E68A 1IKUA 2CTNA 2BKHB 3EK7A 2KBMA 3A8RA 3GK4X 1WY9A 1EG3A 1G8IA 3D10A 3EVVA 3OX5A 4PHKA 3KO0A 2F3YA 3NSKA 4GPLB 1ODBA 2LP3A 2P6BB 1PVBA 3D0YA 3VRPA 1XO5A 3SIAA 2JT8A 1N2DA 2JZIA 2JU0A 1U5IA 1GGZA 3PSRA 1YTZC 3LK1A 1SBJA 3KEVA 2KBIA 2NCOA 4PDZA 3HCMA 4PHNA 5JOLA 3O2PA 1RK9A 1CFCA 1TCFA 2LNKA 1AP4A 1YR5A 1QJTA 1RECA 1NCXA 3BXKA 5AXIA 5FYXA 4UPGA 4YBHB 3C1VA 1F55A 1WRLA 5GQQC 1K93D 2KFFA 1IQ5A 1RROA 2HETA 2M7LA 2JNXA 1BG1A 1XFZO 1J7PA 1YVHA 4ETOA 2LUCA 4HRHA 2I7AA 1FPWA 1J1EA 1LKJA 3AAKA 2E30A 3BOWB 1CMGA 1BF5A 3I5HC 2L5XB 1K96A 1S6JA 3NSIA 1LINA 1L2OB 2KNEA 2SASA 4N1GA 4GUKA 1KWOC 2KGBC 1OSAA 3WXAA 4C0LA 1SKTA 2LVIA 1BOCA 2LLUA 1CTRA 2GV5A 1B47A 1J55A 1JBAA 1SR6B 2LUXA 2CT9A 2HQWA 2HQ8A 2JPTA 1C7VA 2ZRTA 1GJYA 3O6BA 4NDCA 1SCMB 1NCZA 1YRUB 3LLEA 2I2RE 3I5FC 2PSRA 1Y1AA 1FI6A 4WRIA 5I2OA 1CDNA 2LVKA 2G9BA 5JJGA 2AAOA 1IH0A 3GOFA 1R6PA 2L2EA 4HRGA 4QJ4B 1OOJA 2ZNDA 1XFUO 1NX2A 1Q80A 4I5JA 4JWQA 4PE7A 1CDMA 1K9UA 2RGIA 2F3ZA 2LMVA 1X02A 2JOJA 3EVUA 1S36A 2CXJA 4YI9A 1DF0B 4XYNA 2MBXA 3NXAA 1UHJA 2Q91A 5CSIA 2BL0B 2LHIA 1KK8B 3SJSA 5KU1A 1WDCB 2KAVA 1DJXA 1SCMC 2HF5A 1SMGA 3CWGA 1IJ6A 2KFGA 1SK6D 1KFUL 5CSFA 4R1EA 2JT0A 2OTGB 2R2IA 1ZACA 1C7WA 5I2LA 5HYDA 1S3PA 2D8NA 3IF7A 4YRUA 1A2XA 3CS1A 2ISDA 3SG2A 2K8MB 3SG5A 1SNLA 3CGAA 2EC6C 4HSZA 1K95A 1XA5A 2AUCA 1LA0A 1W7JB 1F4QA 4AQIA 1XK4A 4GGFC 3I5GC 2M7NA 1Y1XA 1W7IB 2H61C 2KSPA 2WORA 2Y1NA 5DKRA 2L4HA 3DF0B 5AFPA 4PHMA 1J7RA 2QPTA 5AERA 2BCBA 3PM8A 3OX6A 1UP5A 2F33A 3WNXB 4YGDB 3GK1A 1CDLA 1DJYA 4DIRA 1DJHA 1OZSA 2EGDA 3DVKA 3EKJA 3BYAA 3KPXA 5DKNA 3FWBA 3BQ3A 3EKHA 5HKZA 3VRRA 1MHOA 2PASA 4NDBA 1SPYA 1CKKA 4I5LB 1KFXS 4C0KA 4MSPA 1RTP1 2FJUB 1BU3A 2KYFA 3DVEA 1Y6WA 2F2OA 1QX7A 3BUNB 1D1OA 3FS7A 2LP2A 5IBWA 4YGBB 3TDUA 1NPQA 4MLWA 1AHRA 2FCEA 2JTZA 2PALA 4QJ5B 1NX1A 3I5IC 3ZWHA 1MQ1A 3NSOA 3CR4X 3HX4A 3I5HB 3OP0A 4ORAB 1QIVA 2ZRSA 4M2PA 1K8UA 2KQ6A 3QRXA 4QJ3B 3AKBA 4NQGA 1KQVA 1OMVA 4CPVA 1TNPA 1FBVA 1KWOB 2CCMA 4GGNA 2JTTA 2MA2A 2KFHA 1TIZA 1B8LA 2ZKMX 1NIWA 4PE4A 4YGCB 4PCWA 1UURA 1CLLA 1Y0VH 2LLTA 4XJKA 3E3RA 2L98A 1EXRA 3DF0A 1TOPA 2L50A 1OZOA 2M3WA 3TUYC 1SL8A 2KAXA 2NZ0A 4OCIA 1S6CA 3I5FB 4Q04A 1TNWA 4MZLA 3VROA 3CR5X 3CLNA 1B8CA 4U8DA 1TN4A 2JXLA 2K0JA 1KFXL 2K7DA 3SG6A 1BJFA 1JWDA 2M49B 1F70A 4A4BA 2CNPA 2JXCA 3PN7B 1UUSA 4M2OA 1K94A 4PE1A 1FW4A 1KFUS 1K90D 2PVBA 2LAPA 2K61A 1GQMA 1XFXO 2L0PA 5KTYA 3EK4A 1KSMA 1SYMA 1ZFSA 1ZOTB 2DOQA 2PRUA 1XYDA 2VRGA 1UHIA 2M29A 4MZKA 2GGZA 2IS9A 1HQVA 5D69A 1BR1B 3IQOA 1RFJA 3BUMB 1A03A 2NXQA 2BECA 1G4YR 1ALVA 3ZNIA 2BBMA 3PN7C 1UHHA 3RLZA 1AJ4A 1QS7A 1A29A 4ORCB 2K7OA 5PALA 2KI6D 3WHUB 1JFJA 4MZJA 1CMFA 1KQMC 2EC6B 4FQOA 2MAZA 3TDZA 4AOMA 1A75B 2LMUA 2ZN8A 1F4OA 5HKWA 1LXFC 2BCXA 3I5GB 1H8BA 2M8UA 1CLMA 1DJWA 2SCPA 2Y4QA 3EK8A 1XFWO 1DMOA 2F2PA 1PSBA 1IQ3A 2NCPA 1M45A 2M9GA 4JPZB 3TZ1A 1CB1A 1OMDA 1DGVA 1TCOB 1B4CA 3BOWA 1DJIA 1E8AA 2KDHA 1QASA 4ORBB 5CPVA 1SW8A 1YX8A 2MLEC 5F6TA 2LC5A 1BLQA 1QTXA 1GGWA 1IRJA 1OMRA 5KSZA 3JVTB 1DGUA 4USLA 1JF0A 3WHTB 5D7FA 2WCEA 4WQ3A 2MJWB 1NX3A 1IJ5A 2K2FA 3K21A 4F0ZB 1PALA 3VRQA 3ICBA 1A4PA 1PULA 1DT7B 3BUWB 4I5NB 2WC8A 3RM1A 2WNDA 5HLVA 3CR2A 2E6WA 1TNXA 4L9MA 1U5IB 4MEWA 5AEQA 1YRTB 1TRFA 1F54A 1SL7A 1BMOA 2LHLA 3I5IB 3F45A 3LK0A 5I8NA 1M39A 4ICBA 1QLSA 1MUXA 2O60A 2EHBA 2TN4A 4DRWA 3A4UB 3VGOA 2WOSA 1LA3A 3JVTC 1JFKA 4PALA 1BT6A 1PK0D 2KYCA 2WCFA 3M0WA 2PMYA 3DVMA 1NCYA 3OB1B 3AAJA 1QVIY 2LVJA 4MRXA 4CLNA 1N65A 1V1FA 1DF0A 4GGFA 1NP8A 1UWOA 1KCYA 2H61A 3BUXB 4MRYA 1PVAA 1XVJA 1B7TY 1JUOA 3TUYB 3LCPC 2LMTA 1CM4A 1SCVA 4NDDA 1PSRA 1J7QA 2L51A 1J7OA 1IWQA 1WRZA 2ZFDA 1XFYO 3GK2A 1QVIZ 4IL1A 2LV7A 2Y1MA 1MR8A 1CFFA 1S5GY 1VRKA 3PATA 4BY5A 1QX2A 1EL4A 1EJ3A 3SG4A 1M31A 1M63B 4M2QA 1NWDA 3TDIA 4PE0A 2LE9B 1C07A 2ZN9A 1B7TZ 1NX0A 1PRWA 3O4YA 5CSNA 1K9PA 1LVCD 1AJ5A 3LL8B 1EG4A 1N0YA 1IG5A 2JWWA 1DJZA 1KSOA 1RJVA 4A4CA 2HPSA 1FF1A 1MWNA 5CSJA 3NSLA 4I5KA 3MSEB 2MRDA 1ZUZA 1KK7Y 3JTDC 1S5GZ 3OB2B 1HT9A 2BKIB 1EH2A 2M1KB 1XFVO 3SG3A 2V53A 1QATA 4N1FA 2KI4B 1R2UA 1JF2A 2BBNA 3H4SE 1KQMB 2KHNA 2FCDA 1J1DA 1TNQA 4CFQA 4N5XA 5B8IB 4BY4A 3PALA 3CTNA 4OVNF 2COLB 1UHNA 3SG7A 4JQ0D 2KGRA 4MN0A 1QIWA 1OQPA 1KK7Z 2LVVA 1JC2A 5HKYA 1CNPA 1MXEA 1SY9A 4AQJA 2JQ6A 2OPOA 1WLMA 3TS5B 4GFTA 1QV0A 2KAYA 3PFVA 1S1EA 2JULA 3KF9A 1UHKA 5ER5A
chains in the Genus database with same CATH superfamily
3PM2A 2KI4C 2CBLA 4TNCA 1YUSA 1B1GA 3D77A 4P2YB 5BPJA 1SRAA 2BE4A 2KI6C 2M97A 2MHHA 2OS8B 2QACA 4MVFA 3AKAA 4ZCUA 2B1UA 2LLSA 4MBEA 1V1GA 1YX7A 1G33A 1NSHA 2LM5A 2NLNA 1MXLC 2FOTA 2KQYA 2YGUA 4HREE 1ALWA 1CFPA 1WLZA 1F8HA 2A4JA 3B88A 2BAPA 1JSAA 1YUUA 1L2OC 2KOTA 1S26D 1B9AA 1S6IA 3TS5C 3O78A 1DTLA 4FTGA 2Q4UA 2MLFC 2BCAA 4CIDA 5DKQA 1WRKA 5I94A 1TUJA 1RWYA 4OR9B 4DCKA 2LANA 5ER4X 2K7BA 4YGAA 3BUOB 1SR6C 1DVIA 2AMIA 3CZTX 2JT3A 1B8RA 1XK4C 4YGEB 1OE9B 4GBAA 2GGMA 2LCPA 2K2AA 2OS8C 4P5OE 1K2HA 1Y1UA 1AUIB 2QEHA 1QLKA 2H2KA 2WCBA 2I94A 4PHJA 1AVSA 4DS7A 5TNCA 2JC2A 3D0YB 4JD9A 4WQ2A 2Y5IA 3IQQA 3VRNA 1NYAA 1YVLA 5FI6A 5I2QA 3PLFB 2O5GA 3DD4A 3OHMB 2M1UA 2QDIA 2ZNEA 1CFDA 3R1OA 1QXPA 5J3XA 5AANA 3EVRA 1IGVA 1YURA 4XJKB 3S0EA 1ZMZA 1L7ZA 1BODA 4CFRA 3K1EA 3NHIA 1CDPA 2JNFA 1QX5B 2BL0C 2F8PA 1QV1A 1KK8C 1M46A 1A75A 2I18A 2L4IA 4OKHA 5HLOA 3KHEA 5G08A 1WDCC 1YUTA 4ZCVA 3FIAA 4OV2A 2JRFA 1AK8A 1FI5A 4YI8A 1CLBA 2K7CA 2OTGC 1TTXA 5K89A 2BE6A 3R1PA 2G2BA 2M0RA 1H4BA 1XFRA 4D1EA 1F71A 2WC6A 3FE6A 4C0JA 3DVJA 1DJGA 4DUQA 1OOFA 1K9KA 3JTDB 2P71A 1BR4B 3SIBA 1OOHA 1SL9A 1NUBA 3FWCA 1MF8B 1CM1A 4GAOA 4GNKB 4E68A 1IKUA 2CTNA 2BKHB 3EK7A 2KBMA 3A8RA 1OOIX 3GK4X 1WY9A 1EG3A 3D76A 1G8IA 3D10A 3EVVA 3OX5A 4PHKA 3KO0A 2F3YA 3NSKA 3QMEA 4GPLB 1ODBA 2LP3A 2P6BB 1PVBA 3D0YA 3VRPA 1XO5A 3SIAA 2JT8A 1N2DA 2JZIA 2JU0A 1U5IA 1GGZA 3PSRA 1YTZC 3D73A 3LK1A 1SBJA 3KEVA 2KBIA 2NCOA 4PDZA 2ERBA 2JPOA 3HCMA 4PHNA 5JOLA 2H8VA 3O2PA 1RK9A 1CFCA 1TCFA 2LNKA 1AP4A 1YR5A 1QJTA 1RECA 1NCXA 3BXKA 5AXIA 5FYXA 4UPGA 4YBHB 3C1VA 1F55A 1WRLA 5GQQC 1K93D 2KFFA 1IQ5A 1RROA 2HETA 2WCLA 2JNXA 2M7LA 1XFZO 1BG1A 1YVHA 4ETOA 1J7PA 1P28A 2LUCA 4HRHA 2I7AA 1FPWA 1J1EA 3Q8IA 1LKJA 3AAKA 2E30A 3BOWB 1CMGA 1BF5A 3I5HC 2L5XB 1K96A 1S6JA 3NSIA 3R72A 1LINA 1L2OB 2KNEA 3FE8A 2SASA 1OW4A 4N1GA 4GUKA 1KWOC 2KGBC 1OSAA 3WXAA 4C0LA 3CZ2A 1TWOA 1SKTA 2LVIA 1BOCA 2LLUA 1CTRA 2GV5A 1B47A 1J55A 1JBAA 3B6XA 1SR6B 2LUXA 2CT9A 2HQWA 2HQ8A 2JPTA 1C7VA 2ZRTA 1GJYA 2PQLA 3O6BA 4NDCA 1SCMB 1NCZA 1YRUB 3LLEA 2I2RE 3V2LA 3I5FC 2PSRA 1Y1AA 1FI6A 4WRIA 5I2OA 1CDNA 2LVKA 2G9BA 5JJGA 2AAOA 1IH0A 3GOFA 1R6PA 2L2EA 4HRGA 4INWA 2FJYA 4JKTA 3SS5A 4QJ4B 1OOJA 2ZNDA 1XFUO 1NX2A 1Q80A 3OBVA 4I5JA 4JWQA 4PE7A 1CDMA 1K9UA 2RGIA 2F3ZA 2LMVA 2WCMA 1X02A 2JOJA 3EVUA 1S36A 3DYEA 2CXJA 4YI9A 1DF0B 4XYNA 2MBXA 3UNWA 3NXAA 1UHJA 2Q91A 5CSIA 2BL0B 2LHIA 1KK8B 3SJSA 5KU1A 1WDCB 2KAVA 1DJXA 1SCMC 2HF5A 1SMGA 3CWGA 1IJ6A 2KFGA 1SK6D 1KFUL 1ORGA 5CSFA 4R1EA 2GTEA 2JT0A 2OTGB 2R2IA 1W9ZA 4KYNA 1ZACA 1C7WA 5I2LA 5HYDA 1S3PA 2D8NA 3IF7A 4YRUA 1A2XA 3CS1A 2ISDA 3SG2A 2K8MB 3L4LA 3SG5A 1SNLA 3CGAA 2EC6C 4HSZA 1K95A 1XA5A 2AUCA 1LA0A 1W7JB 1F4QA 4OZDA 4AQIA 1XK4A 1TUZA 3FE9A 4GGFC 3I5GC 2M7NA 3B7AA 1Y1XA 1W7IB 2H61C 2KSPA 2WORA 2Y1NA 5DKRA 3S0GA 2L4HA 3DF0B 5AFPA 4PHMA 1J7RA 2QPTA 2K60A 5AERA 2BCBA 3PM8A 3OX6A 1UP5A 2F33A 3WNXB 4YGDB 3GK1A 1CDLA 1DJYA 4DIRA 1DJHA 1OZSA 2EGDA 3DVKA 3EKJA 3BYAA 3KPXA 5DKNA 3S0AA 3FWBA 3BQ3A 3EKHA 5HKZA 3VRRA 1MHOA 2PASA 4NDBA 1SPYA 1CKKA 4I5LB 1KFXS 4C0KA 4MSPA 1RTP1 1Z4HA 2FJUB 1BU3A 2KYFA 3DVEA 3DXLA 1Y6WA 2F2OA 1QX7A 3BUNB 1D1OA 3FS7A 2LP2A 5IBWA 4YGBB 3TDUA 1NPQA 4MLWA 1AHRA 2FCEA 2JTZA 2PALA 4QJ5B 1NX1A 3I5IC 3ZWHA 3BFBA 1MQ1A 3NSOA 3CR4X 3HX4A 3I5HB 3OP0A 4ORAB 1QIVA 2ZRSA 4M2PA 1K8UA 2KQ6A 1QWVA 5HL1A 3BFHA 3QRXA 4QJ3B 3AKBA 3SS4A 4NQGA 3SS3A 1KQVA 1OMVA 4CPVA 1LS8A 1TNPA 1FBVA 1KWOB 2CCMA 4GGNA 2JTTA 2MA2A 1DQEA 2KFHA 1TIZA 1B8LA 3VB1A 2ZKMX 1NIWA 4PE4A 4YGCB 4INXA 4PCWA 2KPHA 1UURA 3S0DA 1CLLA 3NHTA 1Y0VH 2LLTA 4XJKA 3E3RA 2L98A 1EXRA 3RZSA 3DF0A 1TOPA 2L50A 1OZOA 2M3WA 3TUYC 1SL8A 2KAXA 2NZ0A 4OCIA 1S6CA 3I5FB 4Q04A 1TNWA 4MZLA 3VROA 3CR5X 3CLNA 1B8CA 4U8DA 1TN4A 2JXLA 2K0JA 1KFXL 2K7DA 2WCHA 3SG6A 1BJFA 1JWDA 2M49B 1F70A 4A4BA 2CNPA 2JXCA 2KLEA 3PN7B 1UUSA 4M2OA 1K94A 4PE1A 1FW4A 1KFUS 1K90D 2WC5A 2PVBA 2LAPA 3S0FA 2K61A 1GQMA 1XFXO 2L0PA 3DY9A 5KTYA 3EK4A 1KSMA 1SYMA 1ZFSA 1ZOTB 2DOQA 2PRUA 1XYDA 2QEVA 1UHIA 2QEBA 2M29A 2VRGA 3UO9A 4MZKA 5EL2A 2GGZA 1C3YA 2IS9A 1HQVA 5D69A 1BR1B 3IQOA 1DEKA 3O4XA 1RFJA 3BUMB 1A03A 2NXQA 2BECA 1G4YR 1ALVA 3ZNIA 2BBMA 3PN7C 1UHHA 3RLZA 2P70A 2L5YA 1AJ4A 4PT1A 1QS7A 1A29A 4ORCB 2K7OA 5PALA 2KI6D 3WHUB 1JFJA 4MZJA 1CMFA 1KQMC 2EC6B 4FQOA 2MAZA 3TDZA 4AOMA 1A75B 2BNXA 2LMUA 2ZN8A 1F4OA 5HKWA 1LXFC 2BCXA 3I5GB 3IVTA 1DC1A 2M8UA 1CLMA 1DJWA 2SCPA 2Y4QA 3EK8A 5D3OA 1H8BA 1XFWO 1DMOA 2F2PA 1PSBA 1IQ3A 2NCPA 1M45A 2M9GA 4JPZB 3TZ1A 1CB1A 1OMDA 3BJHA 1DGVA 1TCOB 1B4CA 3BOWA 1DJIA 1E8AA 2KDHA 5FI7A 1QASA 4ORBB 5CPVA 1SW8A 3L4AA 1YX8A 2MLEC 5F6TA 2LC5A 1BLQA 1QTXA 1GGWA 1IRJA 1OMRA 5KSZA 3JVTB 1DGUA 4USLA 1JF0A 3WHTB 4FQTA 5D7FA 1OOGA 2WCEA 4WQ3A 2MJWB 1NX3A 1IJ5A 2K2FA 3K21A 4F0ZB 1PALA 3VRQA 3ICBA 1A4PA 1PULA 1DT7B 3DZTA 3BUWB 4I5NB 5DICA 2WC8A 3RM1A 3R1VA 2WNDA 5HLVA 3CR2A 1T14A 2E6WA 1TNXA 3CDNA 3CZ0A 4L9MA 1U5IB 1IIOA 4MEWA 5AEQA 1YRTB 1TRFA 3D78A 1F54A 1SL7A 1BMOA 3CZ1A 2LHLA 3I5IB 3F45A 3LK0A 5I8NA 1M39A 4ICBA 1QLSA 1MUXA 2O60A 2EHBA 2TN4A 4DRWA 3A4UB 3VGOA 2WOSA 3EG5B 1LA3A 3JVTC 1JFKA 4PALA 1BT6A 1PK0D 2KYCA 2WCFA 3M0WA 2PMYA 3DVMA 1NCYA 3OB1B 3AAJA 2PYQA 3CABA 2KLDA 1QVIY 2LVJA 4MRXA 4CLNA 2L2CA 1N65A 1V1FA 1DF0A 4GGFA 1NP8A 1UWOA 1Z2CB 1KCYA 2H61A 3BUXB 4MRYA 1PVAA 1XVJA 1B7TY 1JUOA 3TUYB 3LCPC 2LMTA 1CM4A 1SCVA 4NDDA 1PSRA 3BFAA 1J7QA 2L51A 1J7OA 1IWQA 1WRZA 2ZFDA 3L47A 1XFYO 3GK2A 1QVIZ 4IL1A 2LV7A 2Y1MA 1MR8A 1CFFA 1S5GY 1VRKA 3PATA 2WCJA 3OGNA 1QX2A 4BY5A 1EL4A 1EJ3A 3SG4A 1M31A 1M63B 4M2QA 1NWDA 3TDIA 4PE0A 2LE9B 1C07A 2ZN9A 1B7TZ 3S0BA 1NX0A 1PRWA 3O4YA 4IJ7A 1K9PA 1LVCD 5CSNA 1AJ5A 3LL8B 1EG4A 1N0YA 1GM0A 1IG5A 2JWWA 1DJZA 1KSOA 3CYZA 3NGVA 1RJVA 2QEOA 4A4CA 2HPSA 1FF1A 1MWNA 1SSEB 5CSJA 3NSLA 4I5KA 3MSEB 2MRDA 3D74A 1ZUZA 1KK7Y 3JTDC 1S5GZ 3OB2B 1HT9A 2BKIB 1EH2A 2M1KB 1XFVO 3SG3A 2V53A 1QATA 4N1FA 2KI4B 1R2UA 1C3ZA 1JF2A 2BBNA 3H4SE 1KQMB 2KHNA 2FCDA 1J1DA 1TNQA 4CFQA 4N5XA 5B8IB 4BY4A 3N7HA 3PALA 3CTNA 4OVNF 2COLB 1UHNA 3SG7A 4JQ0D 2KGRA 5FI2A 4MN0A 1QIWA 4F7FA 1OQPA 1DELA 1KK7Z 2LVVA 1JC2A 5HKYA 1CNPA 1MXEA 1SY9A 4AQJA 2JQ6A 3B86A 3PJIA 3D75A 2OPOA 1WLMA 3TS5B 2WCKA 4GFTA 1QV0A 2KAYA 3PFVA 1S1EA 2JULA 3KF9A 1UHKA 5ER5A 3B87A
chains in the Genus database with same CATH topology
2KI4C 2CBLA 4TNCA 1YUSA 1B1GA 4P2YB 5BPJA 1SRAA 2BE4A 2KI6C 2M97A 2MHHA 2OS8B 2QACA 4MVFA 3AKAA 4ZCUA 2B1UA 2LLSA 4MBEA 1V1GA 1YX7A 1G33A 1NSHA 2LM5A 2NLNA 1MXLC 2FOTA 2KQYA 4HREE 1ALWA 1CFPA 1WLZA 1F8HA 2A4JA 1JSAA 1YUUA 1L2OC 2KOTA 1S26D 1B9AA 1S6IA 3TS5C 3O78A 1DTLA 4FTGA 2Q4UA 2MLFC 2BCAA 4CIDA 5DKQA 1WRKA 4OR9B 1RWYA 4DCKA 2LANA 5ER4X 2K7BA 4YGAA 3BUOB 1SR6C 1DVIA 2AMIA 3CZTX 2JT3A 1B8RA 1XK4C 4YGEB 1OE9B 4GBAA 2GGMA 2LCPA 2K2AA 2OS8C 4P5OE 1K2HA 1Y1UA 1AUIB 1QLKA 2H2KA 2WCBA 2I94A 4PHJA 1AVSA 4DS7A 5TNCA 2JC2A 3D0YB 4WQ2A 2Y5IA 3IQQA 3VRNA 1NYAA 1YVLA 5I2QA 3PLFB 2O5GA 3DD4A 3OHMB 2M1UA 2ZNEA 1CFDA 1QXPA 5J3XA 5AANA 3EVRA 1IGVA 1YURA 4XJKB 1ZMZA 1L7ZA 1BODA 4CFRA 1CDPA 2JNFA 1QX5B 2BL0C 2F8PA 1QV1A 1KK8C 1M46A 1A75A 2I18A 2L4IA 4OKHA 5HLOA 3KHEA 5G08A 1WDCC 1YUTA 4ZCVA 3FIAA 4OV2A 2JRFA 1AK8A 1FI5A 4YI8A 1CLBA 2K7CA 2OTGC 1TTXA 5K89A 2BE6A 2G2BA 2M0RA 1H4BA 1F71A 4D1EA 4C0JA 3DVJA 1DJGA 4DUQA 1K9KA 3JTDB 3SIBA 1BR4B 1SL9A 1NUBA 3FWCA 1MF8B 1CM1A 4GAOA 4GNKB 4E68A 1IKUA 2CTNA 2BKHB 3EK7A 2KBMA 3A8RA 3GK4X 1WY9A 1EG3A 1G8IA 3D10A 3EVVA 3OX5A 4PHKA 3KO0A 2F3YA 3NSKA 4GPLB 1ODBA 2LP3A 2P6BB 1PVBA 3D0YA 3VRPA 1XO5A 3SIAA 2JT8A 1N2DA 2JZIA 2JU0A 1U5IA 1GGZA 3PSRA 1YTZC 3LK1A 1SBJA 3KEVA 2KBIA 2NCOA 4PDZA 3HCMA 4PHNA 5JOLA 3O2PA 1RK9A 1CFCA 1TCFA 2LNKA 1AP4A 1YR5A 1QJTA 1RECA 1NCXA 3BXKA 5AXIA 5FYXA 4UPGA 4YBHB 3C1VA 1F55A 1WRLA 5GQQC 1K93D 2KFFA 1IQ5A 1RROA 2HETA 2M7LA 2JNXA 1BG1A 1XFZO 1J7PA 1YVHA 4ETOA 2LUCA 4HRHA 2I7AA 1FPWA 1J1EA 1LKJA 3AAKA 2E30A 3BOWB 1CMGA 1BF5A 3I5HC 2L5XB 1K96A 1S6JA 3NSIA 1LINA 1L2OB 2KNEA 2SASA 4N1GA 4GUKA 1KWOC 2KGBC 1OSAA 3WXAA 4C0LA 1SKTA 2LVIA 1BOCA 2LLUA 1CTRA 2GV5A 1B47A 1J55A 1JBAA 1SR6B 2LUXA 2CT9A 2HQWA 2HQ8A 2JPTA 1C7VA 2ZRTA 1GJYA 3O6BA 4NDCA 1SCMB 1NCZA 1YRUB 3LLEA 2I2RE 3I5FC 2PSRA 1Y1AA 1FI6A 4WRIA 5I2OA 1CDNA 2LVKA 2G9BA 5JJGA 2AAOA 1IH0A 3GOFA 1R6PA 2L2EA 4HRGA 4QJ4B 1OOJA 2ZNDA 1XFUO 1NX2A 1Q80A 4I5JA 4JWQA 4PE7A 1CDMA 1K9UA 2RGIA 2F3ZA 2LMVA 1X02A 2JOJA 3EVUA 1S36A 2CXJA 4YI9A 1DF0B 4XYNA 2MBXA 3NXAA 1UHJA 2Q91A 5CSIA 2BL0B 2LHIA 1KK8B 3SJSA 5KU1A 1WDCB 2KAVA 1DJXA 1SCMC 2HF5A 1SMGA 3CWGA 1IJ6A 2KFGA 1SK6D 1KFUL 5CSFA 4R1EA 2JT0A 2OTGB 2R2IA 1ZACA 1C7WA 5I2LA 5HYDA 1S3PA 2D8NA 3IF7A 4YRUA 1A2XA 3CS1A 2ISDA 3SG2A 2K8MB 3SG5A 1SNLA 3CGAA 2EC6C 4HSZA 1K95A 1XA5A 2AUCA 1LA0A 1W7JB 1F4QA 4AQIA 1XK4A 4GGFC 3I5GC 2M7NA 1Y1XA 1W7IB 2H61C 2KSPA 2WORA 2Y1NA 5DKRA 2L4HA 3DF0B 5AFPA 4PHMA 1J7RA 2QPTA 5AERA 2BCBA 3PM8A 3OX6A 1UP5A 2F33A 3WNXB 4YGDB 3GK1A 1CDLA 1DJYA 4DIRA 1DJHA 1OZSA 2EGDA 3DVKA 3EKJA 3BYAA 3KPXA 5DKNA 3FWBA 3BQ3A 3EKHA 5HKZA 3VRRA 1MHOA 2PASA 4NDBA 1SPYA 1CKKA 4I5LB 1KFXS 4C0KA 4MSPA 1RTP1 2FJUB 1BU3A 2KYFA 3DVEA 1Y6WA 2F2OA 1QX7A 3BUNB 1D1OA 3FS7A 2LP2A 5IBWA 4YGBB 3TDUA 1NPQA 4MLWA 1AHRA 2FCEA 2JTZA 2PALA 4QJ5B 1NX1A 3I5IC 3ZWHA 1MQ1A 3NSOA 3CR4X 3HX4A 3I5HB 3OP0A 4ORAB 1QIVA 2ZRSA 4M2PA 1K8UA 2KQ6A 3QRXA 4QJ3B 3AKBA 4NQGA 1KQVA 1OMVA 4CPVA 1TNPA 1FBVA 1KWOB 2CCMA 4GGNA 2JTTA 2MA2A 2KFHA 1TIZA 1B8LA 2ZKMX 1NIWA 4PE4A 4YGCB 4PCWA 1UURA 1CLLA 1Y0VH 2LLTA 4XJKA 3E3RA 2L98A 1EXRA 3DF0A 1TOPA 2L50A 1OZOA 2M3WA 3TUYC 1SL8A 2KAXA 2NZ0A 4OCIA 1S6CA 3I5FB 4Q04A 1TNWA 4MZLA 3VROA 3CR5X 3CLNA 1B8CA 4U8DA 1TN4A 2JXLA 2K0JA 1KFXL 2K7DA 3SG6A 1BJFA 1JWDA 2M49B 1F70A 4A4BA 2CNPA 2JXCA 3PN7B 1UUSA 4M2OA 1K94A 4PE1A 1FW4A 1KFUS 1K90D 2PVBA 2LAPA 2K61A 1GQMA 1XFXO 2L0PA 5KTYA 3EK4A 1KSMA 1SYMA 1ZFSA 1ZOTB 2DOQA 2PRUA 1XYDA 2VRGA 1UHIA 2M29A 4MZKA 2GGZA 2IS9A 1HQVA 5D69A 1BR1B 3IQOA 1RFJA 3BUMB 1A03A 2NXQA 2BECA 1G4YR 1ALVA 3ZNIA 2BBMA 3PN7C 1UHHA 3RLZA 1AJ4A 1QS7A 1A29A 4ORCB 2K7OA 5PALA 2KI6D 3WHUB 1JFJA 4MZJA 1CMFA 1KQMC 2EC6B 4FQOA 2MAZA 3TDZA 4AOMA 1A75B 2LMUA 2ZN8A 1F4OA 5HKWA 1LXFC 2BCXA 3I5GB 1H8BA 2M8UA 1CLMA 1DJWA 2SCPA 2Y4QA 3EK8A 1XFWO 1DMOA 2F2PA 1PSBA 1IQ3A 2NCPA 1M45A 2M9GA 4JPZB 3TZ1A 1CB1A 1OMDA 1DGVA 1TCOB 1B4CA 3BOWA 1DJIA 1E8AA 2KDHA 1QASA 4ORBB 5CPVA 1SW8A 1YX8A 2MLEC 5F6TA 2LC5A 1BLQA 1QTXA 1GGWA 1IRJA 1OMRA 5KSZA 3JVTB 1DGUA 4USLA 1JF0A 3WHTB 5D7FA 2WCEA 4WQ3A 2MJWB 1NX3A 1IJ5A 2K2FA 3K21A 4F0ZB 1PALA 3VRQA 3ICBA 1A4PA 1PULA 1DT7B 3BUWB 4I5NB 2WC8A 3RM1A 2WNDA 5HLVA 3CR2A 2E6WA 1TNXA 4L9MA 1U5IB 4MEWA 5AEQA 1YRTB 1TRFA 1F54A 1SL7A 1BMOA 2LHLA 3I5IB 3F45A 3LK0A 5I8NA 1M39A 4ICBA 1QLSA 1MUXA 2O60A 2EHBA 2TN4A 4DRWA 3A4UB 3VGOA 2WOSA 1LA3A 3JVTC 1JFKA 4PALA 1BT6A 1PK0D 2KYCA 2WCFA 3M0WA 2PMYA 3DVMA 1NCYA 3OB1B 3AAJA 1QVIY 2LVJA 4MRXA 4CLNA 1N65A 1V1FA 1DF0A 4GGFA 1NP8A 1UWOA 1KCYA 2H61A 3BUXB 4MRYA 1PVAA 1XVJA 1B7TY 1JUOA 3TUYB 3LCPC 2LMTA 1CM4A 1SCVA 4NDDA 1PSRA 1J7QA 2L51A 1J7OA 1IWQA 1WRZA 2ZFDA 1XFYO 3GK2A 1QVIZ 4IL1A 2LV7A 2Y1MA 1MR8A 1CFFA 1S5GY 1VRKA 3PATA 4BY5A 1QX2A 1EL4A 1EJ3A 3SG4A 1M31A 1M63B 4M2QA 1NWDA 3TDIA 4PE0A 2LE9B 1C07A 2ZN9A 1B7TZ 1NX0A 1PRWA 3O4YA 5CSNA 1K9PA 1LVCD 1AJ5A 3LL8B 1EG4A 1N0YA 1IG5A 2JWWA 1DJZA 1KSOA 1RJVA 4A4CA 2HPSA 1FF1A 1MWNA 5CSJA 3NSLA 4I5KA 3MSEB 2MRDA 1ZUZA 1KK7Y 3JTDC 1S5GZ 3OB2B 1HT9A 2BKIB 1EH2A 2M1KB 1XFVO 3SG3A 2V53A 1QATA 4N1FA 2KI4B 1R2UA 1JF2A 2BBNA 3H4SE 1KQMB 2KHNA 2FCDA 1J1DA 1TNQA 4CFQA 4N5XA 5B8IB 4BY4A 3PALA 3CTNA 4OVNF 2COLB 1UHNA 3SG7A 4JQ0D 2KGRA 4MN0A 1QIWA 1OQPA 1KK7Z 2LVVA 1JC2A 5HKYA 1CNPA 1MXEA 1SY9A 4AQJA 2JQ6A 2OPOA 1WLMA 3TS5B 4GFTA 1QV0A 2KAYA 3PFVA 1S1EA 2JULA 3KF9A 1UHKA 5ER5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI4 C;  2CBL A;  4TNC A;  1YUS A;  1B1G A;  4P2Y B;  5BPJ A;  1SRA A;  2BE4 A;  2KI6 C;  2M97 A;  2MHH A;  2OS8 B;  2QAC A;  4MVF A;  3AKA A;  4ZCU A;  2B1U A;  2LLS A;  4MBE A;  1V1G A;  1YX7 A;  1G33 A;  1NSH A;  2LM5 A;  2NLN A;  1MXL C;  2FOT A;  2KQY A;  4HRE E;  1ALW A;  1CFP A;  1WLZ A;  1F8H A;  2A4J A;  1JSA A;  1YUU A;  1L2O C;  2KOT A;  1S26 D;  1B9A A;  1S6I A;  3TS5 C;  3O78 A;  1DTL A;  4FTG A;  2Q4U A;  2MLF C;  2BCA A;  4CID A;  5DKQ A;  1WRK A;  4OR9 B;  1RWY A;  4DCK A;  2LAN A;  5ER4 X;  2K7B A;  4YGA A;  3BUO B;  1SR6 C;  1DVI A;  2AMI A;  3CZT X;  2JT3 A;  1B8R A;  1XK4 C;  4YGE B;  1OE9 B;  4GBA A;  2GGM A;  2LCP A;  2K2A A;  2OS8 C;  4P5O E;  1K2H A;  1Y1U A;  1AUI B;  1QLK A;  2H2K A;  2WCB A;  2I94 A;  4PHJ A;  1AVS A;  4DS7 A;  5TNC A;  2JC2 A;  3D0Y B;  4WQ2 A;  2Y5I A;  3IQQ A;  3VRN A;  1NYA A;  1YVL A;  5I2Q A;  3PLF B;  2O5G A;  3DD4 A;  3OHM B;  2M1U A;  2ZNE A;  1CFD A;  1QXP A;  5J3X A;  5AAN A;  3EVR A;  1IGV A;  1YUR A;  4XJK B;  1ZMZ A;  1L7Z A;  1BOD A;  4CFR A;  1CDP A;  2JNF A;  1QX5 B;  2BL0 C;  2F8P A;  1QV1 A;  1KK8 C;  1M46 A;  1A75 A;  2I18 A;  2L4I A;  4OKH A;  5HLO A;  3KHE A;  5G08 A;  1WDC C;  1YUT A;  4ZCV A;  3FIA A;  4OV2 A;  2JRF A;  1AK8 A;  1FI5 A;  4YI8 A;  1CLB A;  2K7C A;  2OTG C;  1TTX A;  5K89 A;  2BE6 A;  2G2B A;  2M0R A;  1H4B A;  1F71 A;  4D1E A;  4C0J A;  3DVJ A;  1DJG A;  4DUQ A;  1K9K A;  3JTD B;  3SIB A;  1BR4 B;  1SL9 A;  1NUB A;  3FWC A;  1MF8 B;  1CM1 A;  4GAO A;  4GNK B;  4E68 A;  1IKU A;  2CTN A;  2BKH B;  3EK7 A;  2KBM A;  3A8R A;  3GK4 X;  1WY9 A;  1EG3 A;  1G8I A;  3D10 A;  3EVV A;  3OX5 A;  4PHK A;  3KO0 A;  2F3Y A;  3NSK A;  4GPL B;  1ODB A;  2LP3 A;  2P6B B;  1PVB A;  3D0Y A;  3VRP A;  1XO5 A;  3SIA A;  2JT8 A;  1N2D A;  2JZI A;  2JU0 A;  1U5I A;  1GGZ A;  3PSR A;  1YTZ C;  3LK1 A;  1SBJ A;  3KEV A;  2KBI A;  2NCO A;  4PDZ A;  3HCM A;  4PHN A;  5JOL A;  3O2P A;  1RK9 A;  1CFC A;  1TCF A;  2LNK A;  1AP4 A;  1YR5 A;  1QJT A;  1REC A;  1NCX A;  3BXK A;  5AXI A;  5FYX A;  4UPG A;  4YBH B;  3C1V A;  1F55 A;  1WRL A;  5GQQ C;  1K93 D;  2KFF A;  1IQ5 A;  1RRO A;  2HET A;  2M7L A;  2JNX A;  1BG1 A;  1XFZ O;  1J7P A;  1YVH A;  4ETO A;  2LUC A;  4HRH A;  2I7A A;  1FPW A;  1J1E A;  1LKJ A;  3AAK A;  2E30 A;  3BOW B;  1CMG A;  1BF5 A;  3I5H C;  2L5X B;  1K96 A;  1S6J A;  3NSI A;  1LIN A;  1L2O B;  2KNE A;  2SAS A;  4N1G A;  4GUK A;  1KWO C;  2KGB C;  1OSA A;  3WXA A;  4C0L A;  1SKT A;  2LVI A;  1BOC A;  2LLU A;  1CTR A;  2GV5 A;  1B47 A;  1J55 A;  1JBA A;  1SR6 B;  2LUX A;  2CT9 A;  2HQW A;  2HQ8 A;  2JPT A;  1C7V A;  2ZRT A;  1GJY A;  3O6B A;  4NDC A;  1SCM B;  1NCZ A;  1YRU B;  3LLE A;  2I2R E;  3I5F C;  2PSR A;  1Y1A A;  1FI6 A;  4WRI A;  5I2O A;  1CDN A;  2LVK A;  2G9B A;  5JJG A;  2AAO A;  1IH0 A;  3GOF A;  1R6P A;  2L2E A;  4HRG A;  4QJ4 B;  1OOJ A;  2ZND A;  1XFU O;  1NX2 A;  1Q80 A;  4I5J A;  4JWQ A;  4PE7 A;  1CDM A;  1K9U A;  2RGI A;  2F3Z A;  2LMV A;  1X02 A;  2JOJ A;  3EVU A;  1S36 A;  2CXJ A;  4YI9 A;  1DF0 B;  4XYN A;  2MBX A;  3NXA A;  1UHJ A;  2Q91 A;  5CSI A;  2BL0 B;  2LHI A;  1KK8 B;  3SJS A;  5KU1 A;  1WDC B;  2KAV A;  1DJX A;  1SCM C;  2HF5 A;  1SMG A;  3CWG A;  1IJ6 A;  2KFG A;  1SK6 D;  1KFU L;  5CSF A;  4R1E A;  2JT0 A;  2OTG B;  2R2I A;  1ZAC A;  1C7W A;  5I2L A;  5HYD A;  1S3P A;  2D8N A;  3IF7 A;  4YRU A;  1A2X A;  3CS1 A;  2ISD A;  3SG2 A;  2K8M B;  3SG5 A;  1SNL A;  3CGA A;  2EC6 C;  4HSZ A;  1K95 A;  1XA5 A;  2AUC A;  1LA0 A;  1W7J B;  1F4Q A;  4AQI A;  1XK4 A;  4GGF C;  3I5G C;  2M7N A;  1Y1X A;  1W7I B;  2H61 C;  2KSP A;  2WOR A;  2Y1N A;  5DKR A;  2L4H A;  3DF0 B;  5AFP A;  4PHM A;  1J7R A;  2QPT A;  5AER A;  2BCB A;  3PM8 A;  3OX6 A;  1UP5 A;  2F33 A;  3WNX B;  4YGD B;  3GK1 A;  1CDL A;  1DJY A;  4DIR A;  1DJH A;  1OZS A;  2EGD A;  3DVK A;  3EKJ A;  3BYA A;  3KPX A;  5DKN A;  3FWB A;  3BQ3 A;  3EKH A;  5HKZ A;  3VRR A;  1MHO A;  2PAS A;  4NDB A;  1SPY A;  1CKK A;  4I5L B;  1KFX S;  4C0K A;  4MSP A;  1RTP 1;  2FJU B;  1BU3 A;  2KYF A;  3DVE A;  1Y6W A;  2F2O A;  1QX7 A;  3BUN B;  1D1O A;  3FS7 A;  2LP2 A;  5IBW A;  4YGB B;  3TDU A;  1NPQ A;  4MLW A;  1AHR A;  2FCE A;  2JTZ A;  2PAL A;  4QJ5 B;  1NX1 A;  3I5I C;  3ZWH A;  1MQ1 A;  3NSO A;  3CR4 X;  3HX4 A;  3I5H B;  3OP0 A;  4ORA B;  1QIV A;  2ZRS A;  4M2P A;  1K8U A;  2KQ6 A;  3QRX A;  4QJ3 B;  3AKB A;  4NQG A;  1KQV A;  1OMV A;  4CPV A;  1TNP A;  1FBV A;  1KWO B;  2CCM A;  4GGN A;  2JTT A;  2MA2 A;  2KFH A;  1TIZ A;  1B8L A;  2ZKM X;  1NIW A;  4PE4 A;  4YGC B;  4PCW A;  1UUR A;  1CLL A;  1Y0V H;  2LLT A;  4XJK A;  3E3R A;  2L98 A;  1EXR A;  3DF0 A;  1TOP A;  2L50 A;  1OZO A;  2M3W A;  3TUY C;  1SL8 A;  2KAX A;  2NZ0 A;  4OCI A;  1S6C A;  3I5F B;  4Q04 A;  1TNW A;  4MZL A;  3VRO A;  3CR5 X;  3CLN A;  1B8C A;  4U8D A;  1TN4 A;  2JXL A;  2K0J A;  1KFX L;  2K7D A;  3SG6 A;  1BJF A;  1JWD A;  2M49 B;  1F70 A;  4A4B A;  2CNP A;  2JXC A;  3PN7 B;  1UUS A;  4M2O A;  1K94 A;  4PE1 A;  1FW4 A;  1KFU S;  1K90 D;  2PVB A;  2LAP A;  2K61 A;  1GQM A;  1XFX O;  2L0P A;  5KTY A;  3EK4 A;  1KSM A;  1SYM A;  1ZFS A;  1ZOT B;  2DOQ A;  2PRU A;  1XYD A;  2VRG A;  1UHI A;  2M29 A;  4MZK A;  2GGZ A;  2IS9 A;  1HQV A;  5D69 A;  1BR1 B;  3IQO A;  1RFJ A;  3BUM B;  1A03 A;  2NXQ A;  2BEC A;  1G4Y R;  1ALV A;  3ZNI A;  2BBM A;  3PN7 C;  1UHH A;  3RLZ A;  1AJ4 A;  1QS7 A;  1A29 A;  4ORC B;  2K7O A;  5PAL A;  2KI6 D;  3WHU B;  1JFJ A;  4MZJ A;  1CMF A;  1KQM C;  2EC6 B;  4FQO A;  2MAZ A;  3TDZ A;  4AOM A;  1A75 B;  2LMU A;  2ZN8 A;  1F4O A;  5HKW A;  1LXF C;  2BCX A;  3I5G B;  1H8B A;  2M8U A;  1CLM A;  1DJW A;  2SCP A;  2Y4Q A;  3EK8 A;  1XFW O;  1DMO A;  2F2P A;  1PSB A;  1IQ3 A;  2NCP A;  1M45 A;  2M9G A;  4JPZ B;  3TZ1 A;  1CB1 A;  1OMD A;  1DGV A;  1TCO B;  1B4C A;  3BOW A;  1DJI A;  1E8A A;  2KDH A;  1QAS A;  4ORB B;  5CPV A;  1SW8 A;  1YX8 A;  2MLE C;  5F6T A;  2LC5 A;  1BLQ A;  1QTX A;  1GGW A;  1IRJ A;  1OMR A;  5KSZ A;  3JVT B;  1DGU A;  4USL A;  1JF0 A;  3WHT B;  5D7F A;  2WCE A;  4WQ3 A;  2MJW B;  1NX3 A;  1IJ5 A;  2K2F A;  3K21 A;  4F0Z B;  1PAL A;  3VRQ A;  3ICB A;  1A4P A;  1PUL A;  1DT7 B;  3BUW B;  4I5N B;  2WC8 A;  3RM1 A;  2WND A;  5HLV A;  3CR2 A;  2E6W A;  1TNX A;  4L9M A;  1U5I B;  4MEW A;  5AEQ A;  1YRT B;  1TRF A;  1F54 A;  1SL7 A;  1BMO A;  2LHL A;  3I5I B;  3F45 A;  3LK0 A;  5I8N A;  1M39 A;  4ICB A;  1QLS A;  1MUX A;  2O60 A;  2EHB A;  2TN4 A;  4DRW A;  3A4U B;  3VGO A;  2WOS A;  1LA3 A;  3JVT C;  1JFK A;  4PAL A;  1BT6 A;  1PK0 D;  2KYC A;  2WCF A;  3M0W A;  2PMY A;  3DVM A;  1NCY A;  3OB1 B;  3AAJ A;  1QVI Y;  2LVJ A;  4MRX A;  4CLN A;  1N65 A;  1V1F A;  1DF0 A;  4GGF A;  1NP8 A;  1UWO A;  1KCY A;  2H61 A;  3BUX B;  4MRY A;  1PVA A;  1XVJ A;  1B7T Y;  1JUO A;  3TUY B;  3LCP C;  2LMT A;  1CM4 A;  1SCV A;  4NDD A;  1PSR A;  1J7Q A;  2L51 A;  1J7O A;  1IWQ A;  1WRZ A;  2ZFD A;  1XFY O;  3GK2 A;  1QVI Z;  4IL1 A;  2LV7 A;  2Y1M A;  1MR8 A;  1CFF A;  1S5G Y;  1VRK A;  3PAT A;  4BY5 A;  1QX2 A;  1EL4 A;  1EJ3 A;  3SG4 A;  1M31 A;  1M63 B;  4M2Q A;  1NWD A;  3TDI A;  4PE0 A;  2LE9 B;  1C07 A;  2ZN9 A;  1B7T Z;  1NX0 A;  1PRW A;  3O4Y A;  5CSN A;  1K9P A;  1LVC D;  1AJ5 A;  3LL8 B;  1EG4 A;  1N0Y A;  1IG5 A;  2JWW A;  1DJZ A;  1KSO A;  1RJV A;  4A4C A;  2HPS A;  1FF1 A;  1MWN A;  5CSJ A;  3NSL A;  4I5K A;  3MSE B;  2MRD A;  1ZUZ A;  1KK7 Y;  3JTD C;  1S5G Z;  3OB2 B;  1HT9 A;  2BKI B;  1EH2 A;  2M1K B;  1XFV O;  3SG3 A;  2V53 A;  1QAT A;  4N1F A;  2KI4 B;  1R2U A;  1JF2 A;  2BBN A;  3H4S E;  1KQM B;  2KHN A;  2FCD A;  1J1D A;  1TNQ A;  4CFQ A;  4N5X A;  5B8I B;  4BY4 A;  3PAL A;  3CTN A;  4OVN F;  2COL B;  1UHN A;  3SG7 A;  4JQ0 D;  2KGR A;  4MN0 A;  1QIW A;  1OQP A;  1KK7 Z;  2LVV A;  1JC2 A;  5HKY A;  1CNP A;  1MXE A;  1SY9 A;  4AQJ A;  2JQ6 A;  2OPO A;  1WLM A;  3TS5 B;  4GFT A;  1QV0 A;  2KAY A;  3PFV A;  1S1E A;  2JUL A;  3KF9 A;  1UHK A;  5ER5 A; 
#chains in the Genus database with same CATH topology
 3PM2 A;  2KI4 C;  2CBL A;  4TNC A;  1YUS A;  1B1G A;  3D77 A;  4P2Y B;  5BPJ A;  1SRA A;  2BE4 A;  2KI6 C;  2M97 A;  2MHH A;  2OS8 B;  2QAC A;  4MVF A;  3AKA A;  4ZCU A;  2B1U A;  2LLS A;  4MBE A;  1V1G A;  1YX7 A;  1G33 A;  1NSH A;  2LM5 A;  2NLN A;  1MXL C;  2FOT A;  2KQY A;  2YGU A;  4HRE E;  1ALW A;  1CFP A;  1WLZ A;  1F8H A;  2A4J A;  3B88 A;  2BAP A;  1JSA A;  1YUU A;  1L2O C;  2KOT A;  1S26 D;  1B9A A;  1S6I A;  3TS5 C;  3O78 A;  1DTL A;  4FTG A;  2Q4U A;  2MLF C;  2BCA A;  4CID A;  5DKQ A;  1WRK A;  5I94 A;  1TUJ A;  1RWY A;  4OR9 B;  4DCK A;  2LAN A;  5ER4 X;  2K7B A;  4YGA A;  3BUO B;  1SR6 C;  1DVI A;  2AMI A;  3CZT X;  2JT3 A;  1B8R A;  1XK4 C;  4YGE B;  1OE9 B;  4GBA A;  2GGM A;  2LCP A;  2K2A A;  2OS8 C;  4P5O E;  1K2H A;  1Y1U A;  1AUI B;  2QEH A;  1QLK A;  2H2K A;  2WCB A;  2I94 A;  4PHJ A;  1AVS A;  4DS7 A;  5TNC A;  2JC2 A;  3D0Y B;  4JD9 A;  4WQ2 A;  2Y5I A;  3IQQ A;  3VRN A;  1NYA A;  1YVL A;  5FI6 A;  5I2Q A;  3PLF B;  2O5G A;  3DD4 A;  3OHM B;  2M1U A;  2QDI A;  2ZNE A;  1CFD A;  3R1O A;  1QXP A;  5J3X A;  5AAN A;  3EVR A;  1IGV A;  1YUR A;  4XJK B;  3S0E A;  1ZMZ A;  1L7Z A;  1BOD A;  4CFR A;  3K1E A;  3NHI A;  1CDP A;  2JNF A;  1QX5 B;  2BL0 C;  2F8P A;  1QV1 A;  1KK8 C;  1M46 A;  1A75 A;  2I18 A;  2L4I A;  4OKH A;  5HLO A;  3KHE A;  5G08 A;  1WDC C;  1YUT A;  4ZCV A;  3FIA A;  4OV2 A;  2JRF A;  1AK8 A;  1FI5 A;  4YI8 A;  1CLB A;  2K7C A;  2OTG C;  1TTX A;  5K89 A;  2BE6 A;  3R1P A;  2G2B A;  2M0R A;  1H4B A;  1XFR A;  4D1E A;  1F71 A;  2WC6 A;  3FE6 A;  4C0J A;  3DVJ A;  1DJG A;  4DUQ A;  1OOF A;  1K9K A;  3JTD B;  2P71 A;  1BR4 B;  3SIB A;  1OOH A;  1SL9 A;  1NUB A;  3FWC A;  1MF8 B;  1CM1 A;  4GAO A;  4GNK B;  4E68 A;  1IKU A;  2CTN A;  2BKH B;  3EK7 A;  2KBM A;  3A8R A;  1OOI X;  3GK4 X;  1WY9 A;  1EG3 A;  3D76 A;  1G8I A;  3D10 A;  3EVV A;  3OX5 A;  4PHK A;  3KO0 A;  2F3Y A;  3NSK A;  3QME A;  4GPL B;  1ODB A;  2LP3 A;  2P6B B;  1PVB A;  3D0Y A;  3VRP A;  1XO5 A;  3SIA A;  2JT8 A;  1N2D A;  2JZI A;  2JU0 A;  1U5I A;  1GGZ A;  3PSR A;  1YTZ C;  3D73 A;  3LK1 A;  1SBJ A;  3KEV A;  2KBI A;  2NCO A;  4PDZ A;  2ERB A;  2JPO A;  3HCM A;  4PHN A;  5JOL A;  2H8V A;  3O2P A;  1RK9 A;  1CFC A;  1TCF A;  2LNK A;  1AP4 A;  1YR5 A;  1QJT A;  1REC A;  1NCX A;  3BXK A;  5AXI A;  5FYX A;  4UPG A;  4YBH B;  3C1V A;  1F55 A;  1WRL A;  5GQQ C;  1K93 D;  2KFF A;  1IQ5 A;  1RRO A;  2HET A;  2WCL A;  2JNX A;  2M7L A;  1XFZ O;  1BG1 A;  1YVH A;  4ETO A;  1J7P A;  1P28 A;  2LUC A;  4HRH A;  2I7A A;  1FPW A;  1J1E A;  3Q8I A;  1LKJ A;  3AAK A;  2E30 A;  3BOW B;  1CMG A;  1BF5 A;  3I5H C;  2L5X B;  1K96 A;  1S6J A;  3NSI A;  3R72 A;  1LIN A;  1L2O B;  2KNE A;  3FE8 A;  2SAS A;  1OW4 A;  4N1G A;  4GUK A;  1KWO C;  2KGB C;  1OSA A;  3WXA A;  4C0L A;  3CZ2 A;  1TWO A;  1SKT A;  2LVI A;  1BOC A;  2LLU A;  1CTR A;  2GV5 A;  1B47 A;  1J55 A;  1JBA A;  3B6X A;  1SR6 B;  2LUX A;  2CT9 A;  2HQW A;  2HQ8 A;  2JPT A;  1C7V A;  2ZRT A;  1GJY A;  2PQL A;  3O6B A;  4NDC A;  1SCM B;  1NCZ A;  1YRU B;  3LLE A;  2I2R E;  3V2L A;  3I5F C;  2PSR A;  1Y1A A;  1FI6 A;  4WRI A;  5I2O A;  1CDN A;  2LVK A;  2G9B A;  5JJG A;  2AAO A;  1IH0 A;  3GOF A;  1R6P A;  2L2E A;  4HRG A;  4INW A;  2FJY A;  4JKT A;  3SS5 A;  4QJ4 B;  1OOJ A;  2ZND A;  1XFU O;  1NX2 A;  1Q80 A;  3OBV A;  4I5J A;  4JWQ A;  4PE7 A;  1CDM A;  1K9U A;  2RGI A;  2F3Z A;  2LMV A;  2WCM A;  1X02 A;  2JOJ A;  3EVU A;  1S36 A;  3DYE A;  2CXJ A;  4YI9 A;  1DF0 B;  4XYN A;  2MBX A;  3UNW A;  3NXA A;  1UHJ A;  2Q91 A;  5CSI A;  2BL0 B;  2LHI A;  1KK8 B;  3SJS A;  5KU1 A;  1WDC B;  2KAV A;  1DJX A;  1SCM C;  2HF5 A;  1SMG A;  3CWG A;  1IJ6 A;  2KFG A;  1SK6 D;  1KFU L;  1ORG A;  5CSF A;  4R1E A;  2GTE A;  2JT0 A;  2OTG B;  2R2I A;  1W9Z A;  4KYN A;  1ZAC A;  1C7W A;  5I2L A;  5HYD A;  1S3P A;  2D8N A;  3IF7 A;  4YRU A;  1A2X A;  3CS1 A;  2ISD A;  3SG2 A;  2K8M B;  3L4L A;  3SG5 A;  1SNL A;  3CGA A;  2EC6 C;  4HSZ A;  1K95 A;  1XA5 A;  2AUC A;  1LA0 A;  1W7J B;  1F4Q A;  4OZD A;  4AQI A;  1XK4 A;  1TUZ A;  3FE9 A;  4GGF C;  3I5G C;  2M7N A;  3B7A A;  1Y1X A;  1W7I B;  2H61 C;  2KSP A;  2WOR A;  2Y1N A;  5DKR A;  3S0G A;  2L4H A;  3DF0 B;  5AFP A;  4PHM A;  1J7R A;  2QPT A;  2K60 A;  5AER A;  2BCB A;  3PM8 A;  3OX6 A;  1UP5 A;  2F33 A;  3WNX B;  4YGD B;  3GK1 A;  1CDL A;  1DJY A;  4DIR A;  1DJH A;  1OZS A;  2EGD A;  3DVK A;  3EKJ A;  3BYA A;  3KPX A;  5DKN A;  3S0A A;  3FWB A;  3BQ3 A;  3EKH A;  5HKZ A;  3VRR A;  1MHO A;  2PAS A;  4NDB A;  1SPY A;  1CKK A;  4I5L B;  1KFX S;  4C0K A;  4MSP A;  1RTP 1;  1Z4H A;  2FJU B;  1BU3 A;  2KYF A;  3DVE A;  3DXL A;  1Y6W A;  2F2O A;  1QX7 A;  3BUN B;  1D1O A;  3FS7 A;  2LP2 A;  5IBW A;  4YGB B;  3TDU A;  1NPQ A;  4MLW A;  1AHR A;  2FCE A;  2JTZ A;  2PAL A;  4QJ5 B;  1NX1 A;  3I5I C;  3ZWH A;  3BFB A;  1MQ1 A;  3NSO A;  3CR4 X;  3HX4 A;  3I5H B;  3OP0 A;  4ORA B;  1QIV A;  2ZRS A;  4M2P A;  1K8U A;  2KQ6 A;  1QWV A;  5HL1 A;  3BFH A;  3QRX A;  4QJ3 B;  3AKB A;  3SS4 A;  4NQG A;  3SS3 A;  1KQV A;  1OMV A;  4CPV A;  1LS8 A;  1TNP A;  1FBV A;  1KWO B;  2CCM A;  4GGN A;  2JTT A;  2MA2 A;  1DQE A;  2KFH A;  1TIZ A;  1B8L A;  3VB1 A;  2ZKM X;  1NIW A;  4PE4 A;  4YGC B;  4INX A;  4PCW A;  2KPH A;  1UUR A;  3S0D A;  1CLL A;  3NHT A;  1Y0V H;  2LLT A;  4XJK A;  3E3R A;  2L98 A;  1EXR A;  3RZS A;  3DF0 A;  1TOP A;  2L50 A;  1OZO A;  2M3W A;  3TUY C;  1SL8 A;  2KAX A;  2NZ0 A;  4OCI A;  1S6C A;  3I5F B;  4Q04 A;  1TNW A;  4MZL A;  3VRO A;  3CR5 X;  3CLN A;  1B8C A;  4U8D A;  1TN4 A;  2JXL A;  2K0J A;  1KFX L;  2K7D A;  2WCH A;  3SG6 A;  1BJF A;  1JWD A;  2M49 B;  1F70 A;  4A4B A;  2CNP A;  2JXC A;  2KLE A;  3PN7 B;  1UUS A;  4M2O A;  1K94 A;  4PE1 A;  1FW4 A;  1KFU S;  1K90 D;  2WC5 A;  2PVB A;  2LAP A;  3S0F A;  2K61 A;  1GQM A;  1XFX O;  2L0P A;  3DY9 A;  5KTY A;  3EK4 A;  1KSM A;  1SYM A;  1ZFS A;  1ZOT B;  2DOQ A;  2PRU A;  1XYD A;  2QEV A;  1UHI A;  2QEB A;  2M29 A;  2VRG A;  3UO9 A;  4MZK A;  5EL2 A;  2GGZ A;  1C3Y A;  2IS9 A;  1HQV A;  5D69 A;  1BR1 B;  3IQO A;  1DEK A;  3O4X A;  1RFJ A;  3BUM B;  1A03 A;  2NXQ A;  2BEC A;  1G4Y R;  1ALV A;  3ZNI A;  2BBM A;  3PN7 C;  1UHH A;  3RLZ A;  2P70 A;  2L5Y A;  1AJ4 A;  4PT1 A;  1QS7 A;  1A29 A;  4ORC B;  2K7O A;  5PAL A;  2KI6 D;  3WHU B;  1JFJ A;  4MZJ A;  1CMF A;  1KQM C;  2EC6 B;  4FQO A;  2MAZ A;  3TDZ A;  4AOM A;  1A75 B;  2BNX A;  2LMU A;  2ZN8 A;  1F4O A;  5HKW A;  1LXF C;  2BCX A;  3I5G B;  3IVT A;  1DC1 A;  2M8U A;  1CLM A;  1DJW A;  2SCP A;  2Y4Q A;  3EK8 A;  5D3O A;  1H8B A;  1XFW O;  1DMO A;  2F2P A;  1PSB A;  1IQ3 A;  2NCP A;  1M45 A;  2M9G A;  4JPZ B;  3TZ1 A;  1CB1 A;  1OMD A;  3BJH A;  1DGV A;  1TCO B;  1B4C A;  3BOW A;  1DJI A;  1E8A A;  2KDH A;  5FI7 A;  1QAS A;  4ORB B;  5CPV A;  1SW8 A;  3L4A A;  1YX8 A;  2MLE C;  5F6T A;  2LC5 A;  1BLQ A;  1QTX A;  1GGW A;  1IRJ A;  1OMR A;  5KSZ A;  3JVT B;  1DGU A;  4USL A;  1JF0 A;  3WHT B;  4FQT A;  5D7F A;  1OOG A;  2WCE A;  4WQ3 A;  2MJW B;  1NX3 A;  1IJ5 A;  2K2F A;  3K21 A;  4F0Z B;  1PAL A;  3VRQ A;  3ICB A;  1A4P A;  1PUL A;  1DT7 B;  3DZT A;  3BUW B;  4I5N B;  5DIC A;  2WC8 A;  3RM1 A;  3R1V A;  2WND A;  5HLV A;  3CR2 A;  1T14 A;  2E6W A;  1TNX A;  3CDN A;  3CZ0 A;  4L9M A;  1U5I B;  1IIO A;  4MEW A;  5AEQ A;  1YRT B;  1TRF A;  3D78 A;  1F54 A;  1SL7 A;  1BMO A;  3CZ1 A;  2LHL A;  3I5I B;  3F45 A;  3LK0 A;  5I8N A;  1M39 A;  4ICB A;  1QLS A;  1MUX A;  2O60 A;  2EHB A;  2TN4 A;  4DRW A;  3A4U B;  3VGO A;  2WOS A;  3EG5 B;  1LA3 A;  3JVT C;  1JFK A;  4PAL A;  1BT6 A;  1PK0 D;  2KYC A;  2WCF A;  3M0W A;  2PMY A;  3DVM A;  1NCY A;  3OB1 B;  3AAJ A;  2PYQ A;  3CAB A;  2KLD A;  1QVI Y;  2LVJ A;  4MRX A;  4CLN A;  2L2C A;  1N65 A;  1V1F A;  1DF0 A;  4GGF A;  1NP8 A;  1UWO A;  1Z2C B;  1KCY A;  2H61 A;  3BUX B;  4MRY A;  1PVA A;  1XVJ A;  1B7T Y;  1JUO A;  3TUY B;  3LCP C;  2LMT A;  1CM4 A;  1SCV A;  4NDD A;  1PSR A;  3BFA A;  1J7Q A;  2L51 A;  1J7O A;  1IWQ A;  1WRZ A;  2ZFD A;  3L47 A;  1XFY O;  3GK2 A;  1QVI Z;  4IL1 A;  2LV7 A;  2Y1M A;  1MR8 A;  1CFF A;  1S5G Y;  1VRK A;  3PAT A;  2WCJ A;  3OGN A;  1QX2 A;  4BY5 A;  1EL4 A;  1EJ3 A;  3SG4 A;  1M31 A;  1M63 B;  4M2Q A;  1NWD A;  3TDI A;  4PE0 A;  2LE9 B;  1C07 A;  2ZN9 A;  1B7T Z;  3S0B A;  1NX0 A;  1PRW A;  3O4Y A;  4IJ7 A;  1K9P A;  1LVC D;  5CSN A;  1AJ5 A;  3LL8 B;  1EG4 A;  1N0Y A;  1GM0 A;  1IG5 A;  2JWW A;  1DJZ A;  1KSO A;  3CYZ A;  3NGV A;  1RJV A;  2QEO A;  4A4C A;  2HPS A;  1FF1 A;  1MWN A;  1SSE B;  5CSJ A;  3NSL A;  4I5K A;  3MSE B;  2MRD A;  3D74 A;  1ZUZ A;  1KK7 Y;  3JTD C;  1S5G Z;  3OB2 B;  1HT9 A;  2BKI B;  1EH2 A;  2M1K B;  1XFV O;  3SG3 A;  2V53 A;  1QAT A;  4N1F A;  2KI4 B;  1R2U A;  1C3Z A;  1JF2 A;  2BBN A;  3H4S E;  1KQM B;  2KHN A;  2FCD A;  1J1D A;  1TNQ A;  4CFQ A;  4N5X A;  5B8I B;  4BY4 A;  3N7H A;  3PAL A;  3CTN A;  4OVN F;  2COL B;  1UHN A;  3SG7 A;  4JQ0 D;  2KGR A;  5FI2 A;  4MN0 A;  1QIW A;  4F7F A;  1OQP A;  1DEL A;  1KK7 Z;  2LVV A;  1JC2 A;  5HKY A;  1CNP A;  1MXE A;  1SY9 A;  4AQJ A;  2JQ6 A;  3B86 A;  3PJI A;  3D75 A;  2OPO A;  1WLM A;  3TS5 B;  2WCK A;  4GFT A;  1QV0 A;  2KAY A;  3PFV A;  1S1E A;  2JUL A;  3KF9 A;  1UHK A;  5ER5 A;  3B87 A; 
#chains in the Genus database with same CATH homology
 2KI4 C;  2CBL A;  4TNC A;  1YUS A;  1B1G A;  4P2Y B;  5BPJ A;  1SRA A;  2BE4 A;  2KI6 C;  2M97 A;  2MHH A;  2OS8 B;  2QAC A;  4MVF A;  3AKA A;  4ZCU A;  2B1U A;  2LLS A;  4MBE A;  1V1G A;  1YX7 A;  1G33 A;  1NSH A;  2LM5 A;  2NLN A;  1MXL C;  2FOT A;  2KQY A;  4HRE E;  1ALW A;  1CFP A;  1WLZ A;  1F8H A;  2A4J A;  1JSA A;  1YUU A;  1L2O C;  2KOT A;  1S26 D;  1B9A A;  1S6I A;  3TS5 C;  3O78 A;  1DTL A;  4FTG A;  2Q4U A;  2MLF C;  2BCA A;  4CID A;  5DKQ A;  1WRK A;  4OR9 B;  1RWY A;  4DCK A;  2LAN A;  5ER4 X;  2K7B A;  4YGA A;  3BUO B;  1SR6 C;  1DVI A;  2AMI A;  3CZT X;  2JT3 A;  1B8R A;  1XK4 C;  4YGE B;  1OE9 B;  4GBA A;  2GGM A;  2LCP A;  2K2A A;  2OS8 C;  4P5O E;  1K2H A;  1Y1U A;  1AUI B;  1QLK A;  2H2K A;  2WCB A;  2I94 A;  4PHJ A;  1AVS A;  4DS7 A;  5TNC A;  2JC2 A;  3D0Y B;  4WQ2 A;  2Y5I A;  3IQQ A;  3VRN A;  1NYA A;  1YVL A;  5I2Q A;  3PLF B;  2O5G A;  3DD4 A;  3OHM B;  2M1U A;  2ZNE A;  1CFD A;  1QXP A;  5J3X A;  5AAN A;  3EVR A;  1IGV A;  1YUR A;  4XJK B;  1ZMZ A;  1L7Z A;  1BOD A;  4CFR A;  1CDP A;  2JNF A;  1QX5 B;  2BL0 C;  2F8P A;  1QV1 A;  1KK8 C;  1M46 A;  1A75 A;  2I18 A;  2L4I A;  4OKH A;  5HLO A;  3KHE A;  5G08 A;  1WDC C;  1YUT A;  4ZCV A;  3FIA A;  4OV2 A;  2JRF A;  1AK8 A;  1FI5 A;  4YI8 A;  1CLB A;  2K7C A;  2OTG C;  1TTX A;  5K89 A;  2BE6 A;  2G2B A;  2M0R A;  1H4B A;  1F71 A;  4D1E A;  4C0J A;  3DVJ A;  1DJG A;  4DUQ A;  1K9K A;  3JTD B;  3SIB A;  1BR4 B;  1SL9 A;  1NUB A;  3FWC A;  1MF8 B;  1CM1 A;  4GAO A;  4GNK B;  4E68 A;  1IKU A;  2CTN A;  2BKH B;  3EK7 A;  2KBM A;  3A8R A;  3GK4 X;  1WY9 A;  1EG3 A;  1G8I A;  3D10 A;  3EVV A;  3OX5 A;  4PHK A;  3KO0 A;  2F3Y A;  3NSK A;  4GPL B;  1ODB A;  2LP3 A;  2P6B B;  1PVB A;  3D0Y A;  3VRP A;  1XO5 A;  3SIA A;  2JT8 A;  1N2D A;  2JZI A;  2JU0 A;  1U5I A;  1GGZ A;  3PSR A;  1YTZ C;  3LK1 A;  1SBJ A;  3KEV A;  2KBI A;  2NCO A;  4PDZ A;  3HCM A;  4PHN A;  5JOL A;  3O2P A;  1RK9 A;  1CFC A;  1TCF A;  2LNK A;  1AP4 A;  1YR5 A;  1QJT A;  1REC A;  1NCX A;  3BXK A;  5AXI A;  5FYX A;  4UPG A;  4YBH B;  3C1V A;  1F55 A;  1WRL A;  5GQQ C;  1K93 D;  2KFF A;  1IQ5 A;  1RRO A;  2HET A;  2M7L A;  2JNX A;  1BG1 A;  1XFZ O;  1J7P A;  1YVH A;  4ETO A;  2LUC A;  4HRH A;  2I7A A;  1FPW A;  1J1E A;  1LKJ A;  3AAK A;  2E30 A;  3BOW B;  1CMG A;  1BF5 A;  3I5H C;  2L5X B;  1K96 A;  1S6J A;  3NSI A;  1LIN A;  1L2O B;  2KNE A;  2SAS A;  4N1G A;  4GUK A;  1KWO C;  2KGB C;  1OSA A;  3WXA A;  4C0L A;  1SKT A;  2LVI A;  1BOC A;  2LLU A;  1CTR A;  2GV5 A;  1B47 A;  1J55 A;  1JBA A;  1SR6 B;  2LUX A;  2CT9 A;  2HQW A;  2HQ8 A;  2JPT A;  1C7V A;  2ZRT A;  1GJY A;  3O6B A;  4NDC A;  1SCM B;  1NCZ A;  1YRU B;  3LLE A;  2I2R E;  3I5F C;  2PSR A;  1Y1A A;  1FI6 A;  4WRI A;  5I2O A;  1CDN A;  2LVK A;  2G9B A;  5JJG A;  2AAO A;  1IH0 A;  3GOF A;  1R6P A;  2L2E A;  4HRG A;  4QJ4 B;  1OOJ A;  2ZND A;  1XFU O;  1NX2 A;  1Q80 A;  4I5J A;  4JWQ A;  4PE7 A;  1CDM A;  1K9U A;  2RGI A;  2F3Z A;  2LMV A;  1X02 A;  2JOJ A;  3EVU A;  1S36 A;  2CXJ A;  4YI9 A;  1DF0 B;  4XYN A;  2MBX A;  3NXA A;  1UHJ A;  2Q91 A;  5CSI A;  2BL0 B;  2LHI A;  1KK8 B;  3SJS A;  5KU1 A;  1WDC B;  2KAV A;  1DJX A;  1SCM C;  2HF5 A;  1SMG A;  3CWG A;  1IJ6 A;  2KFG A;  1SK6 D;  1KFU L;  5CSF A;  4R1E A;  2JT0 A;  2OTG B;  2R2I A;  1ZAC A;  1C7W A;  5I2L A;  5HYD A;  1S3P A;  2D8N A;  3IF7 A;  4YRU A;  1A2X A;  3CS1 A;  2ISD A;  3SG2 A;  2K8M B;  3SG5 A;  1SNL A;  3CGA A;  2EC6 C;  4HSZ A;  1K95 A;  1XA5 A;  2AUC A;  1LA0 A;  1W7J B;  1F4Q A;  4AQI A;  1XK4 A;  4GGF C;  3I5G C;  2M7N A;  1Y1X A;  1W7I B;  2H61 C;  2KSP A;  2WOR A;  2Y1N A;  5DKR A;  2L4H A;  3DF0 B;  5AFP A;  4PHM A;  1J7R A;  2QPT A;  5AER A;  2BCB A;  3PM8 A;  3OX6 A;  1UP5 A;  2F33 A;  3WNX B;  4YGD B;  3GK1 A;  1CDL A;  1DJY A;  4DIR A;  1DJH A;  1OZS A;  2EGD A;  3DVK A;  3EKJ A;  3BYA A;  3KPX A;  5DKN A;  3FWB A;  3BQ3 A;  3EKH A;  5HKZ A;  3VRR A;  1MHO A;  2PAS A;  4NDB A;  1SPY A;  1CKK A;  4I5L B;  1KFX S;  4C0K A;  4MSP A;  1RTP 1;  2FJU B;  1BU3 A;  2KYF A;  3DVE A;  1Y6W A;  2F2O A;  1QX7 A;  3BUN B;  1D1O A;  3FS7 A;  2LP2 A;  5IBW A;  4YGB B;  3TDU A;  1NPQ A;  4MLW A;  1AHR A;  2FCE A;  2JTZ A;  2PAL A;  4QJ5 B;  1NX1 A;  3I5I C;  3ZWH A;  1MQ1 A;  3NSO A;  3CR4 X;  3HX4 A;  3I5H B;  3OP0 A;  4ORA B;  1QIV A;  2ZRS A;  4M2P A;  1K8U A;  2KQ6 A;  3QRX A;  4QJ3 B;  3AKB A;  4NQG A;  1KQV A;  1OMV A;  4CPV A;  1TNP A;  1FBV A;  1KWO B;  2CCM A;  4GGN A;  2JTT A;  2MA2 A;  2KFH A;  1TIZ A;  1B8L A;  2ZKM X;  1NIW A;  4PE4 A;  4YGC B;  4PCW A;  1UUR A;  1CLL A;  1Y0V H;  2LLT A;  4XJK A;  3E3R A;  2L98 A;  1EXR A;  3DF0 A;  1TOP A;  2L50 A;  1OZO A;  2M3W A;  3TUY C;  1SL8 A;  2KAX A;  2NZ0 A;  4OCI A;  1S6C A;  3I5F B;  4Q04 A;  1TNW A;  4MZL A;  3VRO A;  3CR5 X;  3CLN A;  1B8C A;  4U8D A;  1TN4 A;  2JXL A;  2K0J A;  1KFX L;  2K7D A;  3SG6 A;  1BJF A;  1JWD A;  2M49 B;  1F70 A;  4A4B A;  2CNP A;  2JXC A;  3PN7 B;  1UUS A;  4M2O A;  1K94 A;  4PE1 A;  1FW4 A;  1KFU S;  1K90 D;  2PVB A;  2LAP A;  2K61 A;  1GQM A;  1XFX O;  2L0P A;  5KTY A;  3EK4 A;  1KSM A;  1SYM A;  1ZFS A;  1ZOT B;  2DOQ A;  2PRU A;  1XYD A;  2VRG A;  1UHI A;  2M29 A;  4MZK A;  2GGZ A;  2IS9 A;  1HQV A;  5D69 A;  1BR1 B;  3IQO A;  1RFJ A;  3BUM B;  1A03 A;  2NXQ A;  2BEC A;  1G4Y R;  1ALV A;  3ZNI A;  2BBM A;  3PN7 C;  1UHH A;  3RLZ A;  1AJ4 A;  1QS7 A;  1A29 A;  4ORC B;  2K7O A;  5PAL A;  2KI6 D;  3WHU B;  1JFJ A;  4MZJ A;  1CMF A;  1KQM C;  2EC6 B;  4FQO A;  2MAZ A;  3TDZ A;  4AOM A;  1A75 B;  2LMU A;  2ZN8 A;  1F4O A;  5HKW A;  1LXF C;  2BCX A;  3I5G B;  1H8B A;  2M8U A;  1CLM A;  1DJW A;  2SCP A;  2Y4Q A;  3EK8 A;  1XFW O;  1DMO A;  2F2P A;  1PSB A;  1IQ3 A;  2NCP A;  1M45 A;  2M9G A;  4JPZ B;  3TZ1 A;  1CB1 A;  1OMD A;  1DGV A;  1TCO B;  1B4C A;  3BOW A;  1DJI A;  1E8A A;  2KDH A;  1QAS A;  4ORB B;  5CPV A;  1SW8 A;  1YX8 A;  2MLE C;  5F6T A;  2LC5 A;  1BLQ A;  1QTX A;  1GGW A;  1IRJ A;  1OMR A;  5KSZ A;  3JVT B;  1DGU A;  4USL A;  1JF0 A;  3WHT B;  5D7F A;  2WCE A;  4WQ3 A;  2MJW B;  1NX3 A;  1IJ5 A;  2K2F A;  3K21 A;  4F0Z B;  1PAL A;  3VRQ A;  3ICB A;  1A4P A;  1PUL A;  1DT7 B;  3BUW B;  4I5N B;  2WC8 A;  3RM1 A;  2WND A;  5HLV A;  3CR2 A;  2E6W A;  1TNX A;  4L9M A;  1U5I B;  4MEW A;  5AEQ A;  1YRT B;  1TRF A;  1F54 A;  1SL7 A;  1BMO A;  2LHL A;  3I5I B;  3F45 A;  3LK0 A;  5I8N A;  1M39 A;  4ICB A;  1QLS A;  1MUX A;  2O60 A;  2EHB A;  2TN4 A;  4DRW A;  3A4U B;  3VGO A;  2WOS A;  1LA3 A;  3JVT C;  1JFK A;  4PAL A;  1BT6 A;  1PK0 D;  2KYC A;  2WCF A;  3M0W A;  2PMY A;  3DVM A;  1NCY A;  3OB1 B;  3AAJ A;  1QVI Y;  2LVJ A;  4MRX A;  4CLN A;  1N65 A;  1V1F A;  1DF0 A;  4GGF A;  1NP8 A;  1UWO A;  1KCY A;  2H61 A;  3BUX B;  4MRY A;  1PVA A;  1XVJ A;  1B7T Y;  1JUO A;  3TUY B;  3LCP C;  2LMT A;  1CM4 A;  1SCV A;  4NDD A;  1PSR A;  1J7Q A;  2L51 A;  1J7O A;  1IWQ A;  1WRZ A;  2ZFD A;  1XFY O;  3GK2 A;  1QVI Z;  4IL1 A;  2LV7 A;  2Y1M A;  1MR8 A;  1CFF A;  1S5G Y;  1VRK A;  3PAT A;  4BY5 A;  1QX2 A;  1EL4 A;  1EJ3 A;  3SG4 A;  1M31 A;  1M63 B;  4M2Q A;  1NWD A;  3TDI A;  4PE0 A;  2LE9 B;  1C07 A;  2ZN9 A;  1B7T Z;  1NX0 A;  1PRW A;  3O4Y A;  5CSN A;  1K9P A;  1LVC D;  1AJ5 A;  3LL8 B;  1EG4 A;  1N0Y A;  1IG5 A;  2JWW A;  1DJZ A;  1KSO A;  1RJV A;  4A4C A;  2HPS A;  1FF1 A;  1MWN A;  5CSJ A;  3NSL A;  4I5K A;  3MSE B;  2MRD A;  1ZUZ A;  1KK7 Y;  3JTD C;  1S5G Z;  3OB2 B;  1HT9 A;  2BKI B;  1EH2 A;  2M1K B;  1XFV O;  3SG3 A;  2V53 A;  1QAT A;  4N1F A;  2KI4 B;  1R2U A;  1JF2 A;  2BBN A;  3H4S E;  1KQM B;  2KHN A;  2FCD A;  1J1D A;  1TNQ A;  4CFQ A;  4N5X A;  5B8I B;  4BY4 A;  3PAL A;  3CTN A;  4OVN F;  2COL B;  1UHN A;  3SG7 A;  4JQ0 D;  2KGR A;  4MN0 A;  1QIW A;  1OQP A;  1KK7 Z;  2LVV A;  1JC2 A;  5HKY A;  1CNP A;  1MXE A;  1SY9 A;  4AQJ A;  2JQ6 A;  2OPO A;  1WLM A;  3TS5 B;  4GFT A;  1QV0 A;  2KAY A;  3PFV A;  1S1E A;  2JUL A;  3KF9 A;  1UHK A;  5ER5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...