1RECA

Three-dimensional structure of recoverin, a calcium sensor in vision
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
185
Chain Sequence
LSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords RECOVERIN
publication title Three-Dimensional Structure of Recoverin, a Calcium Sensor in Vision
pubmed doi rcsb
source organism Bos taurus
total genus 74
structure length 185
sequence length 190
ec nomenclature
pdb deposition date 1993-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1recA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1recA01
1FI6A 1TN4A 2M3WA 1SY9A 2CT9A 2LLSA 2OTGC 4PALA 2LNKA 2OTGB 2KFHA 1EH2A 1YRUB 4JQ0D 3SG3A 2M7NA 4NDCA 3LK0A 4CIDA 1UURA 2CXJA 1Y0VH 1WLMA 4GUKA 5FYXA 1Y1XA 4YGEB 1QV0A 1K9KA 4YBHB 5AANA 1BODA 1KFXL 2LMVA 2AUCA 3IQQA 4N5XA 1AUIB 1NCYA 1S36A 2KOTA 1EJ3A 3IF7A 1A29A 1MUXA 3WXAA 4PHKA 1XFVO 4U8DA 2M7LA 3EK7A 2ISDA 1WRZA 3I5IC 1XA5A 3C1VA 1W7JB 1YX8A 1QLKA 3AKAA 1UHNA 3JVTC 1F4OA 1DJZA 3JVTB 1YVLA 1KSMA 2BCXA 2K7BA 3HX4A 2F3YA 1PALA 2LLTA 2JWWA 2LE9B 2L4IA 4QJ3B 1SW8A 2V53A 4PHMA 5KTYA 1KQVA 1EG3A 1K96A 2JTTA 4MZKA 1JF2A 2M1KB 2O60A 5TNCA 5HKWA 1OMRA 1SCVA 4CPVA 3BOWB 2LVJA 1VRKA 1J1EA 1TIZA 2NCPA 3GK4X 1BMOA 4YGBB 3VRRA 1SL7A 1KQMB 4XJKB 2KI6C 2I7AA 2JOJA 3FWBA 3TZ1A 1RWYA 3DVJA 2AAOA 1IQ3A 1DJGA 1R2UA 4M2OA 4PE0A 1GGWA 1UHKA 2F8PA 1RROA 1MXLC 1QIVA 1S6IA 1SYMA 2PVBA 2LMTA 1BT6A 2F2OA 3CLNA 3D0YB 3LLEA 4YRUA 3EK4A 2BE6A 2M0RA 4I5LB 1L7ZA 1MHOA 2A4JA 3VROA 1HQVA 1CDMA 1SBJA 1IJ6A 3BQ3A 3DF0B 1EXRA 1U5IA 1SCMC 2HPSA 1CKKA 3NSOA 1J7PA 1SCMB 2MAZA 3VRQA 5CSIA 1LXFC 3NXAA 5GQQC 3O2PA 1QATA 5AFPA 2F2PA 2K2FA 3SG7A 2LM5A 1NCXA 2ZNEA 1OE9B 3EVRA 3TUYC 4QJ4B 5HKZA 1V1GA 1BOCA 1W7IB 3PLFB 3O78A 2M1UA 3TUYB 1HT9A 3BXKA 3CR5X 2BCAA 2HETA 3AAKA 1K8UA 2JRFA 1AP4A 1BR1B 4C0JA 1IG5A 1IGVA 2HF5A 2TN4A 5K89A 2WORA 2FCEA 1FBVA 1XFUO 2JXCA 2MHHA 1F54A 1UHIA 4P5OE 1QS7A 3OB1B 1YUTA 2BCBA 1QASA 1IH0A 1PVBA 1ZMZA 1BG1A 2JT3A 4GNKB 1XFZO 1A75A 1Y1AA 2G9BA 1CNPA 2JQ6A 2HQWA 2R2IA 1QX2A 4YGDB 3D10A 2LVVA 1Y6WA 2QACA 5AERA 3OP0A 4NDBA 1AHRA 1K94A 2CNPA 2NXQA 1DJXA 2WCEA 4PE1A 3M0WA 2OS8C 1M63B 4XYNA 1YVHA 3I5GC 2OS8B 1LA3A 1UP5A 1RECA 3PSRA 1JC2A 3I5GB 1CMFA 3ZWHA 1OQPA 3PFVA 1NX3A 1KFUL 5D69A 1J7QA 1BU3A 5KU1A 3DD4A 1J55A 1GQMA 2E30A 2H61C 2BKIB 3WHUB 3SG6A 1SPYA 1XFXO 1CMGA 1KFXS 1S3PA 3PN7C 4HSZA 5I8NA 2D8NA 3PN7B 4P2YB 4DRWA 3CS1A 2LVIA 1KCYA 3SG2A 1UWOA 5D7FA 1SL8A 1PSBA 1LVCD 1ODBA 1XK4C 1CFDA 4ICBA 1F70A 4GFTA 1XFWO 3H4SE 3RM1A 2BE4A 2LUCA 2KYFA 1BLQA 2Q4UA 2KI4C 5PALA 3HCMA 1NSHA 1AJ4A 4I5NB 2WNDA 4PE7A 3TS5C 1A4PA 1CM1A 1S6CA 1WDCC 3TS5B 1WDCB 1DJIA 4N1FA 4ORBB 1GJYA 5F6TA 3I5IB 2COLB 2K0JA 2KSPA 5KSZA 1QV1A 1JBAA 4F0ZB 4FQOA 1QLSA 1CLBA 3EVUA 2JZIA 2SASA 1L2OC 1S1EA 1D1OA 1FW4A 5CPVA 2K7DA 3DVMA 4HRHA 3JTDC 2O5GA 1RK9A 3JTDB 2LAPA 1QJTA 2KGRA 4A4BA 2NZ0A 1A2XA 2BKHB 1NX0A 2MBXA 1CTRA 3KF9A 3KPXA 4C0KA 2JT8A 3RLZA 2LHLA 1SKTA 1Q80A 1XYDA 1N2DA 3VRNA 1FPWA 4DIRA 2JTZA 1NX2A 5ER4X 2JNFA 1E8AA 1OMDA 5I2LA 1KK8C 2KFFA 4OCIA 2JXLA 2LUXA 1KK8B 2RGIA 2E6WA 2K8MB 2KHNA 4GAOA 1DJYA 1LINA 2VRGA 2LC5A 2BBNA 3PM8A 1DGVA 3FWCA 2EC6C 2KAYA 2PALA 5CSNA 1YRTB 3FS7A 3GK2A 1K9PA 3SIBA 2HQ8A 1OSAA 2BL0C 1N0YA 2KNEA 2Y5IA 4E68A 4ORCB 2BL0B 2IS9A 3TDIA 1SRAA 2F33A 2KI6D 5J3XA 1F55A 2EGDA 2JNXA 3EVVA 2WCBA 1FF1A 2LANA 4CFRA 1TRFA 4USLA 4PHJA 1CDNA 1DF0A 4AOMA 2AMIA 2FJUB 3F45A 1K93D 1H4BA 2FOTA 3NSIA 2NLNA 1MWNA 1OMVA 4PDZA 1TNXA 3ICBA 4YI8A 3SG5A 3KHEA 4MRXA 2WCFA 3DVEA 3OB2B 4GGFA 1M46A 1EL4A 2KGBC 3I5HC 4OR9B 3SIAA 1FI5A 2Y1NA 2K7OA 1JF0A 1OZOA 3I5HB 4WRIA 5I2QA 4HRGA 4YGAA 5HLVA 5JOLA 2L98A 1YR5A 1YX7A 4GBAA 1G4YR 5G08A 1QTXA 2WC8A 1KFUS 1TNQA 2L2EA 3OX6A 1OZSA 1WRLA 3BUXB 4I5KA 5HLOA 2JPTA 1PK0D 1ALVA 1PSRA 1S5GZ 4JWQA 2OPOA 4TNCA 3FIAA 1IQ5A 3CTNA 1CFFA 4C0LA 1YURA 3TDUA 4CLNA 3NSLA 1C7WA 2LP2A 2NCOA 1K90D 4YI9A 3ZNIA 1KWOC 1B47A 1LA0A 1B4CA 4IL1A 1KWOB 1UUSA 1DVIA 1F4QA 4BY4A 1B7TZ 2Y4QA 2KAXA 2I2RE 2ZFDA 1SNLA 1U5IB 5DKNA 1XO5A 1NIWA 3BOWA 1B9AA 5HKYA 4ORAB 1J7RA 1PRWA 5AXIA 4A4CA 3CWGA 2LV7A 2L51A 2MA2A 4Q04A 3CZTX 4QJ5B 4FTGA 1MR8A 4XJKA 2L5XB 2WOSA 4BY5A 3WHTB 1BF5A 1PULA 1S5GY 4R1EA 3KO0A 2KI4B 4MVFA 2PRUA 4MBEA 1CM4A 3E3RA 2LVKA 1AK8A 1K9UA 3O6BA 3KEVA 2LCPA 1AJ5A 3BYAA 3D0YA 1ZUZA 1IJ5A 1RJVA 3QRXA 2K61A 4OKHA 1GGZA 3PALA 3AKBA 3O4YA 5I2OA 4PE4A 4PCWA 3IQOA 1B7TY 1DJWA 1CLMA 1YUUA 4YGCB 3EK8A 1M45A 2DOQA 1AVSA 3CR4X 3DF0A 4N1GA 2KYCA 1L2OB 2JT0A 1ALWA 1A75B 4L9MA 4ZCUA 1C7VA 1ZFSA 1JSAA 1NYAA 1RFJA 1IKUA 2KBIA 2M9GA 2ZNDA 2LP3A 2CTNA 1WRKA 2MRDA 3EKHA 4GGNA 1A03A 1EG4A 2I18A 1WY9A 2MJWB 1S6JA 2Y1MA 2ZKMX 1K95A 4ZCVA 1G8IA 4MEWA 1TOPA 4DCKA 1S26D 1N65A 2GGZA 3CGAA 3VGOA 2PMYA 1NP8A 5JJGA 2KAVA 1WLZA 1CDLA 2G2BA 5AEQA 4UPGA 3DVKA 1MF8B 1SMGA 1QX5B 2M97A 1ZOTB 2PASA 1R6PA 3SG4A 2F3ZA 2H2KA 2MLFC 5HYDA 1QIWA 2EC6B 2BECA 2JC2A 3K21A 2SCPA 1KSOA 1KQMC 2KQ6A 1QXPA 2GGMA 3WNXB 1JWDA 1MXEA 2JU0A 2Q91A 1V1FA 1YUSA 5B8IB 3LK1A 4OVNF 5CSJA 5DKQA 5BPJA 1K2HA 1IRJA 4WQ3A 1ZACA 1Y1UA 1QVIZ 4MZJA 2M49B 1SR6C 4GPLB 3TDZA 1B8RA 2M29A 1SR6B 3PATA 4MLWA 1JFKA 1QX7A 2FCDA 1NWDA 4HREE 1BR4B 5DKRA 1TCFA 1BJFA 3A8RA 1OOJA 4NDDA 2H61A 3GOFA 1JFJA 3SJSA 2K7CA 1F8HA 1DTLA 1NX1A 1B1GA 2LLUA 1M31A 3AAJA 4MN0A 3BUOB 3LL8B 4WQ2A 2GV5A 3BUNB 1IWQA 1XK4A 3OX5A 5CSFA 2CBLA 1UHHA 1XFYO 2EHBA 3CR2A 4PHNA 1G33A 4D1EA 2ZRSA 2I94A 1JUOA 1SL9A 1XVJA 1KK7Z 4AQJA 3GK1A 1QVIY 4MSPA 2CCMA 1MQ1A 3I5FC 3I5FB 2QPTA 1UHJA 1TTXA 4MZLA 1YTZC 1CDPA 1B8CA 2L4HA 4NQGA 2LHIA 1CFPA 1X02A 4OV2A 1TNPA 2B1UA 1DGUA 4CFQA 1H8BA 2ZN9A 1CLLA 2KDHA 2LMUA 2K2AA 1DJHA 5ER5A 1J1DA 1TCOB 4AQIA 2L0PA 3VRPA 1CB1A 3BUWB 4DUQA 4M2PA 1B8LA 4MRYA 3NSKA 4ETOA 2BBMA 1SK6D 3A4UB 5IBWA 2M8UA 3BUMB 1NUBA 2ZN8A 2P6BB 1M39A 1NPQA 1TNWA 2KBMA 3EKJA 1DT7B 1NCZA 2L50A 3LCPC 2MLEC 1PVAA 4M2QA 1RTP1 2JULA 2PSRA 4I5JA 1DF0B 2KFGA 3MSEB 1KK7Y 2KQYA 1C07A 1CFCA 1LKJA 3OHMB 1DMOA 1F71A 4JPZB 4DS7A 1J7OA 2ZRTA 4GGFC
chains in the Genus database with same CATH superfamily
1FI6A 1TN4A 2M3WA 1SY9A 2CT9A 2LLSA 2OTGC 3CZ0A 4PALA 2LNKA 2OTGB 2KFHA 1EH2A 1YRUB 4JQ0D 3SG3A 2M7NA 4NDCA 3LK0A 4CIDA 1UURA 2CXJA 3D74A 1Y0VH 1WLMA 4GUKA 5FYXA 4F7FA 1Y1XA 4YGEB 1QV0A 1K9KA 4YBHB 5AANA 1BODA 1Z4HA 1KFXL 2LMVA 2AUCA 2QEOA 3IQQA 4N5XA 1AUIB 1NCYA 1S36A 2KOTA 1EJ3A 3IF7A 3SS3A 1A29A 1MUXA 3WXAA 4PHKA 1XFVO 2KLDA 1C3ZA 3FE6A 4U8DA 2M7LA 3EK7A 2ISDA 3CZ2A 1WRZA 3I5IC 4JD9A 1XA5A 3C1VA 1W7JB 1YX8A 1QLKA 3OGNA 3AKAA 1UHNA 3JVTC 1F4OA 1C3YA 1DJZA 3JVTB 1YVLA 1KSMA 2BCXA 2K7BA 3HX4A 2F3YA 1PALA 2LLTA 2JWWA 2LE9B 1T14A 2L4IA 4QJ3B 1SW8A 3D78A 2V53A 4PHMA 5KTYA 1KQVA 1EG3A 1K96A 2JTTA 4MZKA 1JF2A 2M1KB 2O60A 5TNCA 5HKWA 1OMRA 1SCVA 4CPVA 3BOWB 2LVJA 1VRKA 3FE9A 1J1EA 1TIZA 2NCPA 3GK4X 3V2LA 1BMOA 4YGBB 3VRRA 1SL7A 1KQMB 4XJKB 2KI6C 2I7AA 2JOJA 3FWBA 3TZ1A 1RWYA 3DVJA 3B7AA 2AAOA 5I94A 1IQ3A 1DJGA 1R2UA 4M2OA 4PE0A 1GGWA 1UHKA 2F8PA 1RROA 1MXLC 1QIVA 1S6IA 1SYMA 2PVBA 2LMTA 1BT6A 2F2OA 3CLNA 3D0YB 3LLEA 4YRUA 3EK4A 2BE6A 2M0RA 4I5LB 1L7ZA 1MHOA 2A4JA 3VROA 1HQVA 1CDMA 1SBJA 1IJ6A 3BQ3A 3DF0B 2QEVA 1EXRA 1U5IA 1SCMC 2HPSA 1CKKA 1SSEB 3NSOA 1SCMB 2MAZA 4JKTA 5CSIA 3VRQA 1J7PA 1XFRA 1LXFC 3NXAA 5GQQC 3O2PA 1QATA 5AFPA 2L5YA 2F2PA 2K2FA 3L47A 3SG7A 2LM5A 1NCXA 2ZNEA 1OE9B 3EVRA 2K60A 3TUYC 4QJ4B 5HKZA 1V1GA 1BOCA 1W7IB 3PLFB 3O78A 2M1UA 3TUYB 1HT9A 3BXKA 2L2CA 2BCAA 2HETA 3AAKA 1K8UA 2JRFA 3CR5X 1AP4A 1BR1B 4C0JA 1IG5A 1IGVA 2HF5A 2TN4A 3N7HA 2WCHA 5K89A 2WORA 2FCEA 1FBVA 1XFUO 2JXCA 2MHHA 1F54A 1UHIA 4P5OE 1QS7A 3OB1B 1YUTA 2BCBA 1QASA 3QMEA 1PVBA 1IH0A 1ZMZA 3DZTA 1BG1A 2JT3A 4GNKB 3S0EA 1XFZO 1A75A 1Y1AA 2G9BA 1CNPA 4INXA 2JQ6A 1DELA 2HQWA 2R2IA 1QX2A 4YGDB 3D10A 2LVVA 1Y6WA 2QACA 5AERA 3OP0A 4NDBA 1AHRA 1K94A 2CNPA 2NXQA 1DJXA 2WCEA 4PE1A 3M0WA 2OS8C 3OBVA 1M63B 3B87A 4XYNA 1YVHA 3I5GC 2OS8B 1LA3A 1UP5A 1RECA 3PSRA 1JC2A 3I5GB 1CMFA 3ZWHA 1OQPA 3PFVA 1NX3A 1KFUL 5D69A 1J7QA 3R1OA 1BU3A 5KU1A 3DD4A 2WC6A 1J55A 1GQMA 2E30A 2H61C 2BKIB 2WC5A 3WHUB 3SG6A 1SPYA 1XFXO 1CMGA 1KFXS 1S3PA 3PN7C 4HSZA 5I8NA 2D8NA 3PN7B 4P2YB 4DRWA 1LS8A 2LVIA 3CS1A 1KCYA 3SG2A 1UWOA 5D7FA 1SL8A 1PSBA 1LVCD 1ODBA 2PQLA 3BFHA 1DQEA 3CYZA 1XK4C 1CFDA 4ICBA 4PT1A 4GFTA 1XFWO 3H4SE 3RM1A 1F70A 2BE4A 3K1EA 1ORGA 2LUCA 2KYFA 1BLQA 2Q4UA 2KI4C 3D77A 3HCMA 5PALA 1NSHA 2ERBA 4KYNA 3D73A 1AJ4A 4I5NB 2WNDA 4PE7A 3TS5C 1A4PA 1CM1A 1S6CA 1WDCC 3TS5B 1WDCB 1DJIA 4N1FA 3BFBA 1GJYA 4ORBB 5F6TA 3I5IB 1IIOA 2COLB 2K0JA 2KSPA 5KSZA 1QV1A 1JBAA 4F0ZB 4FQOA 1QLSA 1CLBA 3EVUA 2JZIA 2SASA 1L2OC 1S1EA 1D1OA 1FW4A 5CPVA 2K7DA 3DVMA 4HRHA 3JTDC 2O5GA 1RK9A 3BJHA 3JTDB 3S0AA 2LAPA 3B86A 1QJTA 2KGRA 4A4BA 2NZ0A 1A2XA 3B6XA 2BKHB 3NGVA 1NX0A 2MBXA 1CTRA 3KF9A 3KPXA 4C0KA 2JT8A 3RLZA 2LHLA 1SKTA 1Q80A 1XYDA 1N2DA 3VRNA 1FPWA 4DIRA 2JTZA 1NX2A 1W9ZA 5ER4X 2JNFA 1E8AA 1OMDA 5I2LA 1KK8C 2KFFA 4OCIA 2JXLA 2LUXA 1KK8B 2RGIA 2E6WA 3R1VA 2K8MB 2KHNA 4GAOA 1DJYA 1LINA 2VRGA 2LC5A 2BBNA 1TWOA 3PM8A 1DGVA 3FWCA 2FJYA 3CDNA 1OW4A 2EC6C 2KAYA 2PALA 5CSNA 1YRTB 3FS7A 3SS4A 2QDIA 3GK2A 1K9PA 3SIBA 2HQ8A 1OSAA 2BL0C 1N0YA 2KNEA 2Y5IA 4E68A 4ORCB 2BL0B 2IS9A 3TDIA 1SRAA 2F33A 2KI6D 5J3XA 1F55A 2EGDA 2JNXA 3EVVA 2WCBA 1FF1A 2LANA 3DXLA 3L4LA 4CFRA 1TRFA 4USLA 4PHJA 3DYEA 3S0BA 1CDNA 2WCMA 1DF0A 4AOMA 2AMIA 2FJUB 2WCLA 1K93D 3D75A 3EG5B 2FOTA 3F45A 3NSIA 1H4BA 2NLNA 1MWNA 1OMVA 4PDZA 1TNXA 3ICBA 4YI8A 3SG5A 3DY9A 1OOFA 3KHEA 3B88A 3PM2A 4MRXA 2WCFA 3DVEA 3OB2B 4GGFA 3CZ1A 1M46A 1EL4A 2KGBC 3I5HC 4OR9B 3SIAA 1FI5A 2Y1NA 2K7OA 1JF0A 1OZOA 3I5HB 4WRIA 5I2QA 4HRGA 4INWA 4YGAA 5HLVA 5JOLA 2L98A 4OZDA 3RZSA 3Q8IA 1YR5A 1YX7A 4GBAA 1G4YR 5G08A 1QTXA 2WC8A 1KFUS 1TNQA 2L2EA 2P71A 3OX6A 5D3OA 1OZSA 1WRLA 3BUXB 4I5KA 5HLOA 2JPTA 1PK0D 1ALVA 1PSRA 1DC1A 1S5GZ 4JWQA 2OPOA 2GTEA 4TNCA 2WCJA 3FIAA 1IQ5A 3CTNA 3R1PA 1CFFA 4C0LA 1YURA 5EL2A 3TDUA 4CLNA 3NSLA 1C7WA 2LP2A 2NCOA 1K90D 4YI9A 3ZNIA 1KWOC 1B47A 1LA0A 1B4CA 4IL1A 1KWOB 1UUSA 1DVIA 1F4QA 4BY4A 1B7TZ 2Y4QA 2KAXA 2I2RE 5FI2A 2ZFDA 1SNLA 1U5IB 5DKNA 1XO5A 3UNWA 1NIWA 3BOWA 1B9AA 3R72A 3UO9A 5HKYA 4ORAB 5HL1A 1J7RA 1PRWA 5AXIA 4A4CA 3CWGA 2LV7A 2L51A 2MA2A 4Q04A 1P28A 3CZTX 4QJ5B 4FTGA 1MR8A 4XJKA 2L5XB 2WOSA 4BY5A 3WHTB 1BF5A 1PULA 1S5GY 4R1EA 3KO0A 2KI4B 4MVFA 2PRUA 4MBEA 1CM4A 3E3RA 2LVKA 1AK8A 1K9UA 3O6BA 3KEVA 2LCPA 1AJ5A 2JPOA 3BYAA 3D0YA 1ZUZA 1OOIX 1IJ5A 1RJVA 3QRXA 2K61A 4OKHA 1GGZA 3PALA 3AKBA 3O4YA 5I2OA 2QEHA 4PE4A 4PCWA 3IQOA 1B7TY 1DJWA 1CLMA 1YUUA 4YGCB 3EK8A 1M45A 2DOQA 1AVSA 3CR4X 3DF0A 4N1GA 2KYCA 1L2OB 2JT0A 1ALWA 1A75B 4L9MA 4ZCUA 1C7VA 1ZFSA 1JSAA 1NYAA 2WCKA 1RFJA 1IKUA 2KBIA 2M9GA 2QEBA 2LP3A 2CTNA 1WRKA 2MRDA 2ZNDA 3EKHA 4GGNA 1A03A 1EG4A 2I18A 1TUJA 1WY9A 2MJWB 1S6JA 2Y1MA 1Z2CB 2ZKMX 1K95A 4ZCVA 1G8IA 4MEWA 1TOPA 4DCKA 1OOGA 1S26D 1N65A 2GGZA 2KLEA 3CGAA 3VGOA 2PMYA 1NP8A 5JJGA 2KAVA 1WLZA 3VB1A 1CDLA 2G2BA 5AEQA 4UPGA 3SS5A 3D76A 3DVKA 1MF8B 1SMGA 1QX5B 2M97A 1ZOTB 2PASA 1R6PA 2YGUA 3SG4A 2F3ZA 2H2KA 2MLFC 5HYDA 1QIWA 2EC6B 2BECA 2JC2A 3K21A 2SCPA 5FI7A 1KSOA 1KQMC 2KQ6A 1QXPA 2GGMA 3WNXB 1JWDA 1MXEA 2JU0A 2Q91A 1V1FA 1YUSA 5B8IB 3LK1A 2KPHA 4FQTA 4OVNF 5CSJA 5DKQA 5BPJA 1K2HA 1IRJA 4WQ3A 1ZACA 1Y1UA 1QVIZ 4MZJA 2M49B 1SR6C 4GPLB 3TDZA 2BAPA 1B8RA 2M29A 1SR6B 3PATA 4MLWA 1JFKA 1QX7A 2FCDA 1NWDA 4HREE 1BR4B 5DKRA 1DEKA 1TCFA 1BJFA 3A8RA 1OOJA 4NDDA 2H61A 3GOFA 1JFJA 3BFAA 5DICA 3SJSA 2K7CA 1F8HA 1DTLA 3FE8A 4IJ7A 1NX1A 1B1GA 2LLUA 1M31A 3AAJA 4MN0A 3BUOB 3S0DA 3LL8B 4WQ2A 2GV5A 3BUNB 1IWQA 1XK4A 3OX5A 5CSFA 3S0GA 3O4XA 2CBLA 1UHHA 1XFYO 2EHBA 3CR2A 4PHNA 2P70A 1G33A 4D1EA 2ZRSA 2I94A 1JUOA 1SL9A 1XVJA 1KK7Z 4AQJA 1OOHA 2PYQA 3GK1A 1QVIY 4MSPA 2CCMA 1MQ1A 3I5FC 3I5FB 2QPTA 1UHJA 1TTXA 4MZLA 1YTZC 1CDPA 1B8CA 2L4HA 4NQGA 2LHIA 1CFPA 1X02A 4OV2A 1TNPA 2B1UA 1DGUA 4CFQA 1H8BA 2ZN9A 1CLLA 2KDHA 2LMUA 2K2AA 1DJHA 5ER5A 1J1DA 1TCOB 4AQIA 2L0PA 3VRPA 1CB1A 3BUWB 4DUQA 3S0FA 3L4AA 4M2PA 1B8LA 4MRYA 3NSKA 4ETOA 1GM0A 2BBMA 1SK6D 3A4UB 5IBWA 2M8UA 3BUMB 1NUBA 2ZN8A 1QWVA 1TUZA 1M39A 1NPQA 1TNWA 2KBMA 2P6BB 3EKJA 3NHTA 1DT7B 1NCZA 2L50A 3LCPC 2MLEC 1PVAA 3PJIA 4M2QA 2BNXA 1RTP1 2H8VA 2JULA 2PSRA 4I5JA 3CABA 1DF0B 2KFGA 5FI6A 3MSEB 1KK7Y 2KQYA 1C07A 1CFCA 1LKJA 3OHMB 1DMOA 1F71A 4JPZB 3IVTA 3NHIA 4DS7A 1J7OA 2ZRTA 4GGFC
chains in the Genus database with same CATH topology
1FI6A 1TN4A 2M3WA 1SY9A 2CT9A 2LLSA 2OTGC 4PALA 2LNKA 2OTGB 2KFHA 1EH2A 1YRUB 4JQ0D 3SG3A 2M7NA 4NDCA 3LK0A 4CIDA 1UURA 2CXJA 1Y0VH 1WLMA 4GUKA 5FYXA 1Y1XA 4YGEB 1QV0A 1K9KA 4YBHB 5AANA 1BODA 1KFXL 2LMVA 2AUCA 3IQQA 4N5XA 1AUIB 1NCYA 1S36A 2KOTA 1EJ3A 3IF7A 1A29A 1MUXA 3WXAA 4PHKA 1XFVO 4U8DA 2M7LA 3EK7A 2ISDA 1WRZA 3I5IC 1XA5A 3C1VA 1W7JB 1YX8A 1QLKA 3AKAA 1UHNA 3JVTC 1F4OA 1DJZA 3JVTB 1YVLA 1KSMA 2BCXA 2K7BA 3HX4A 2F3YA 1PALA 2LLTA 2JWWA 2LE9B 2L4IA 4QJ3B 1SW8A 2V53A 4PHMA 5KTYA 1KQVA 1EG3A 1K96A 2JTTA 4MZKA 1JF2A 2M1KB 2O60A 5TNCA 5HKWA 1OMRA 1SCVA 4CPVA 3BOWB 2LVJA 1VRKA 1J1EA 1TIZA 2NCPA 3GK4X 1BMOA 4YGBB 3VRRA 1SL7A 1KQMB 4XJKB 2KI6C 2I7AA 2JOJA 3FWBA 3TZ1A 1RWYA 3DVJA 2AAOA 1IQ3A 1DJGA 1R2UA 4M2OA 4PE0A 1GGWA 1UHKA 2F8PA 1RROA 1MXLC 1QIVA 1S6IA 1SYMA 2PVBA 2LMTA 1BT6A 2F2OA 3CLNA 3D0YB 3LLEA 4YRUA 3EK4A 2BE6A 2M0RA 4I5LB 1L7ZA 1MHOA 2A4JA 3VROA 1HQVA 1CDMA 1SBJA 1IJ6A 3BQ3A 3DF0B 1EXRA 1U5IA 1SCMC 2HPSA 1CKKA 3NSOA 1J7PA 1SCMB 2MAZA 3VRQA 5CSIA 1LXFC 3NXAA 5GQQC 3O2PA 1QATA 5AFPA 2F2PA 2K2FA 3SG7A 2LM5A 1NCXA 2ZNEA 1OE9B 3EVRA 3TUYC 4QJ4B 5HKZA 1V1GA 1BOCA 1W7IB 3PLFB 3O78A 2M1UA 3TUYB 1HT9A 3BXKA 3CR5X 2BCAA 2HETA 3AAKA 1K8UA 2JRFA 1AP4A 1BR1B 4C0JA 1IG5A 1IGVA 2HF5A 2TN4A 5K89A 2WORA 2FCEA 1FBVA 1XFUO 2JXCA 2MHHA 1F54A 1UHIA 4P5OE 1QS7A 3OB1B 1YUTA 2BCBA 1QASA 1IH0A 1PVBA 1ZMZA 1BG1A 2JT3A 4GNKB 1XFZO 1A75A 1Y1AA 2G9BA 1CNPA 2JQ6A 2HQWA 2R2IA 1QX2A 4YGDB 3D10A 2LVVA 1Y6WA 2QACA 5AERA 3OP0A 4NDBA 1AHRA 1K94A 2CNPA 2NXQA 1DJXA 2WCEA 4PE1A 3M0WA 2OS8C 1M63B 4XYNA 1YVHA 3I5GC 2OS8B 1LA3A 1UP5A 1RECA 3PSRA 1JC2A 3I5GB 1CMFA 3ZWHA 1OQPA 3PFVA 1NX3A 1KFUL 5D69A 1J7QA 1BU3A 5KU1A 3DD4A 1J55A 1GQMA 2E30A 2H61C 2BKIB 3WHUB 3SG6A 1SPYA 1XFXO 1CMGA 1KFXS 1S3PA 3PN7C 4HSZA 5I8NA 2D8NA 3PN7B 4P2YB 4DRWA 3CS1A 2LVIA 1KCYA 3SG2A 1UWOA 5D7FA 1SL8A 1PSBA 1LVCD 1ODBA 1XK4C 1CFDA 4ICBA 1F70A 4GFTA 1XFWO 3H4SE 3RM1A 2BE4A 2LUCA 2KYFA 1BLQA 2Q4UA 2KI4C 5PALA 3HCMA 1NSHA 1AJ4A 4I5NB 2WNDA 4PE7A 3TS5C 1A4PA 1CM1A 1S6CA 1WDCC 3TS5B 1WDCB 1DJIA 4N1FA 4ORBB 1GJYA 5F6TA 3I5IB 2COLB 2K0JA 2KSPA 5KSZA 1QV1A 1JBAA 4F0ZB 4FQOA 1QLSA 1CLBA 3EVUA 2JZIA 2SASA 1L2OC 1S1EA 1D1OA 1FW4A 5CPVA 2K7DA 3DVMA 4HRHA 3JTDC 2O5GA 1RK9A 3JTDB 2LAPA 1QJTA 2KGRA 4A4BA 2NZ0A 1A2XA 2BKHB 1NX0A 2MBXA 1CTRA 3KF9A 3KPXA 4C0KA 2JT8A 3RLZA 2LHLA 1SKTA 1Q80A 1XYDA 1N2DA 3VRNA 1FPWA 4DIRA 2JTZA 1NX2A 5ER4X 2JNFA 1E8AA 1OMDA 5I2LA 1KK8C 2KFFA 4OCIA 2JXLA 2LUXA 1KK8B 2RGIA 2E6WA 2K8MB 2KHNA 4GAOA 1DJYA 1LINA 2VRGA 2LC5A 2BBNA 3PM8A 1DGVA 3FWCA 2EC6C 2KAYA 2PALA 5CSNA 1YRTB 3FS7A 3GK2A 1K9PA 3SIBA 2HQ8A 1OSAA 2BL0C 1N0YA 2KNEA 2Y5IA 4E68A 4ORCB 2BL0B 2IS9A 3TDIA 1SRAA 2F33A 2KI6D 5J3XA 1F55A 2EGDA 2JNXA 3EVVA 2WCBA 1FF1A 2LANA 4CFRA 1TRFA 4USLA 4PHJA 1CDNA 1DF0A 4AOMA 2AMIA 2FJUB 3F45A 1K93D 1H4BA 2FOTA 3NSIA 2NLNA 1MWNA 1OMVA 4PDZA 1TNXA 3ICBA 4YI8A 3SG5A 3KHEA 4MRXA 2WCFA 3DVEA 3OB2B 4GGFA 1M46A 1EL4A 2KGBC 3I5HC 4OR9B 3SIAA 1FI5A 2Y1NA 2K7OA 1JF0A 1OZOA 3I5HB 4WRIA 5I2QA 4HRGA 4YGAA 5HLVA 5JOLA 2L98A 1YR5A 1YX7A 4GBAA 1G4YR 5G08A 1QTXA 2WC8A 1KFUS 1TNQA 2L2EA 3OX6A 1OZSA 1WRLA 3BUXB 4I5KA 5HLOA 2JPTA 1PK0D 1ALVA 1PSRA 1S5GZ 4JWQA 2OPOA 4TNCA 3FIAA 1IQ5A 3CTNA 1CFFA 4C0LA 1YURA 3TDUA 4CLNA 3NSLA 1C7WA 2LP2A 2NCOA 1K90D 4YI9A 3ZNIA 1KWOC 1B47A 1LA0A 1B4CA 4IL1A 1KWOB 1UUSA 1DVIA 1F4QA 4BY4A 1B7TZ 2Y4QA 2KAXA 2I2RE 2ZFDA 1SNLA 1U5IB 5DKNA 1XO5A 1NIWA 3BOWA 1B9AA 5HKYA 4ORAB 1J7RA 1PRWA 5AXIA 4A4CA 3CWGA 2LV7A 2L51A 2MA2A 4Q04A 3CZTX 4QJ5B 4FTGA 1MR8A 4XJKA 2L5XB 2WOSA 4BY5A 3WHTB 1BF5A 1PULA 1S5GY 4R1EA 3KO0A 2KI4B 4MVFA 2PRUA 4MBEA 1CM4A 3E3RA 2LVKA 1AK8A 1K9UA 3O6BA 3KEVA 2LCPA 1AJ5A 3BYAA 3D0YA 1ZUZA 1IJ5A 1RJVA 3QRXA 2K61A 4OKHA 1GGZA 3PALA 3AKBA 3O4YA 5I2OA 4PE4A 4PCWA 3IQOA 1B7TY 1DJWA 1CLMA 1YUUA 4YGCB 3EK8A 1M45A 2DOQA 1AVSA 3CR4X 3DF0A 4N1GA 2KYCA 1L2OB 2JT0A 1ALWA 1A75B 4L9MA 4ZCUA 1C7VA 1ZFSA 1JSAA 1NYAA 1RFJA 1IKUA 2KBIA 2M9GA 2ZNDA 2LP3A 2CTNA 1WRKA 2MRDA 3EKHA 4GGNA 1A03A 1EG4A 2I18A 1WY9A 2MJWB 1S6JA 2Y1MA 2ZKMX 1K95A 4ZCVA 1G8IA 4MEWA 1TOPA 4DCKA 1S26D 1N65A 2GGZA 3CGAA 3VGOA 2PMYA 1NP8A 5JJGA 2KAVA 1WLZA 1CDLA 2G2BA 5AEQA 4UPGA 3DVKA 1MF8B 1SMGA 1QX5B 2M97A 1ZOTB 2PASA 1R6PA 3SG4A 2F3ZA 2H2KA 2MLFC 5HYDA 1QIWA 2EC6B 2BECA 2JC2A 3K21A 2SCPA 1KSOA 1KQMC 2KQ6A 1QXPA 2GGMA 3WNXB 1JWDA 1MXEA 2JU0A 2Q91A 1V1FA 1YUSA 5B8IB 3LK1A 4OVNF 5CSJA 5DKQA 5BPJA 1K2HA 1IRJA 4WQ3A 1ZACA 1Y1UA 1QVIZ 4MZJA 2M49B 1SR6C 4GPLB 3TDZA 1B8RA 2M29A 1SR6B 3PATA 4MLWA 1JFKA 1QX7A 2FCDA 1NWDA 4HREE 1BR4B 5DKRA 1TCFA 1BJFA 3A8RA 1OOJA 4NDDA 2H61A 3GOFA 1JFJA 3SJSA 2K7CA 1F8HA 1DTLA 1NX1A 1B1GA 2LLUA 1M31A 3AAJA 4MN0A 3BUOB 3LL8B 4WQ2A 2GV5A 3BUNB 1IWQA 1XK4A 3OX5A 5CSFA 2CBLA 1UHHA 1XFYO 2EHBA 3CR2A 4PHNA 1G33A 4D1EA 2ZRSA 2I94A 1JUOA 1SL9A 1XVJA 1KK7Z 4AQJA 3GK1A 1QVIY 4MSPA 2CCMA 1MQ1A 3I5FC 3I5FB 2QPTA 1UHJA 1TTXA 4MZLA 1YTZC 1CDPA 1B8CA 2L4HA 4NQGA 2LHIA 1CFPA 1X02A 4OV2A 1TNPA 2B1UA 1DGUA 4CFQA 1H8BA 2ZN9A 1CLLA 2KDHA 2LMUA 2K2AA 1DJHA 5ER5A 1J1DA 1TCOB 4AQIA 2L0PA 3VRPA 1CB1A 3BUWB 4DUQA 4M2PA 1B8LA 4MRYA 3NSKA 4ETOA 2BBMA 1SK6D 3A4UB 5IBWA 2M8UA 3BUMB 1NUBA 2ZN8A 2P6BB 1M39A 1NPQA 1TNWA 2KBMA 3EKJA 1DT7B 1NCZA 2L50A 3LCPC 2MLEC 1PVAA 4M2QA 1RTP1 2JULA 2PSRA 4I5JA 1DF0B 2KFGA 3MSEB 1KK7Y 2KQYA 1C07A 1CFCA 1LKJA 3OHMB 1DMOA 1F71A 4JPZB 4DS7A 1J7OA 2ZRTA 4GGFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FI6 A;  1TN4 A;  2M3W A;  1SY9 A;  2CT9 A;  2LLS A;  2OTG C;  4PAL A;  2LNK A;  2OTG B;  2KFH A;  1EH2 A;  1YRU B;  4JQ0 D;  3SG3 A;  2M7N A;  4NDC A;  3LK0 A;  4CID A;  1UUR A;  2CXJ A;  1Y0V H;  1WLM A;  4GUK A;  5FYX A;  1Y1X A;  4YGE B;  1QV0 A;  1K9K A;  4YBH B;  5AAN A;  1BOD A;  1KFX L;  2LMV A;  2AUC A;  3IQQ A;  4N5X A;  1AUI B;  1NCY A;  1S36 A;  2KOT A;  1EJ3 A;  3IF7 A;  1A29 A;  1MUX A;  3WXA A;  4PHK A;  1XFV O;  4U8D A;  2M7L A;  3EK7 A;  2ISD A;  1WRZ A;  3I5I C;  1XA5 A;  3C1V A;  1W7J B;  1YX8 A;  1QLK A;  3AKA A;  1UHN A;  3JVT C;  1F4O A;  1DJZ A;  3JVT B;  1YVL A;  1KSM A;  2BCX A;  2K7B A;  3HX4 A;  2F3Y A;  1PAL A;  2LLT A;  2JWW A;  2LE9 B;  2L4I A;  4QJ3 B;  1SW8 A;  2V53 A;  4PHM A;  5KTY A;  1KQV A;  1EG3 A;  1K96 A;  2JTT A;  4MZK A;  1JF2 A;  2M1K B;  2O60 A;  5TNC A;  5HKW A;  1OMR A;  1SCV A;  4CPV A;  3BOW B;  2LVJ A;  1VRK A;  1J1E A;  1TIZ A;  2NCP A;  3GK4 X;  1BMO A;  4YGB B;  3VRR A;  1SL7 A;  1KQM B;  4XJK B;  2KI6 C;  2I7A A;  2JOJ A;  3FWB A;  3TZ1 A;  1RWY A;  3DVJ A;  2AAO A;  1IQ3 A;  1DJG A;  1R2U A;  4M2O A;  4PE0 A;  1GGW A;  1UHK A;  2F8P A;  1RRO A;  1MXL C;  1QIV A;  1S6I A;  1SYM A;  2PVB A;  2LMT A;  1BT6 A;  2F2O A;  3CLN A;  3D0Y B;  3LLE A;  4YRU A;  3EK4 A;  2BE6 A;  2M0R A;  4I5L B;  1L7Z A;  1MHO A;  2A4J A;  3VRO A;  1HQV A;  1CDM A;  1SBJ A;  1IJ6 A;  3BQ3 A;  3DF0 B;  1EXR A;  1U5I A;  1SCM C;  2HPS A;  1CKK A;  3NSO A;  1J7P A;  1SCM B;  2MAZ A;  3VRQ A;  5CSI A;  1LXF C;  3NXA A;  5GQQ C;  3O2P A;  1QAT A;  5AFP A;  2F2P A;  2K2F A;  3SG7 A;  2LM5 A;  1NCX A;  2ZNE A;  1OE9 B;  3EVR A;  3TUY C;  4QJ4 B;  5HKZ A;  1V1G A;  1BOC A;  1W7I B;  3PLF B;  3O78 A;  2M1U A;  3TUY B;  1HT9 A;  3BXK A;  3CR5 X;  2BCA A;  2HET A;  3AAK A;  1K8U A;  2JRF A;  1AP4 A;  1BR1 B;  4C0J A;  1IG5 A;  1IGV A;  2HF5 A;  2TN4 A;  5K89 A;  2WOR A;  2FCE A;  1FBV A;  1XFU O;  2JXC A;  2MHH A;  1F54 A;  1UHI A;  4P5O E;  1QS7 A;  3OB1 B;  1YUT A;  2BCB A;  1QAS A;  1IH0 A;  1PVB A;  1ZMZ A;  1BG1 A;  2JT3 A;  4GNK B;  1XFZ O;  1A75 A;  1Y1A A;  2G9B A;  1CNP A;  2JQ6 A;  2HQW A;  2R2I A;  1QX2 A;  4YGD B;  3D10 A;  2LVV A;  1Y6W A;  2QAC A;  5AER A;  3OP0 A;  4NDB A;  1AHR A;  1K94 A;  2CNP A;  2NXQ A;  1DJX A;  2WCE A;  4PE1 A;  3M0W A;  2OS8 C;  1M63 B;  4XYN A;  1YVH A;  3I5G C;  2OS8 B;  1LA3 A;  1UP5 A;  1REC A;  3PSR A;  1JC2 A;  3I5G B;  1CMF A;  3ZWH A;  1OQP A;  3PFV A;  1NX3 A;  1KFU L;  5D69 A;  1J7Q A;  1BU3 A;  5KU1 A;  3DD4 A;  1J55 A;  1GQM A;  2E30 A;  2H61 C;  2BKI B;  3WHU B;  3SG6 A;  1SPY A;  1XFX O;  1CMG A;  1KFX S;  1S3P A;  3PN7 C;  4HSZ A;  5I8N A;  2D8N A;  3PN7 B;  4P2Y B;  4DRW A;  3CS1 A;  2LVI A;  1KCY A;  3SG2 A;  1UWO A;  5D7F A;  1SL8 A;  1PSB A;  1LVC D;  1ODB A;  1XK4 C;  1CFD A;  4ICB A;  1F70 A;  4GFT A;  1XFW O;  3H4S E;  3RM1 A;  2BE4 A;  2LUC A;  2KYF A;  1BLQ A;  2Q4U A;  2KI4 C;  5PAL A;  3HCM A;  1NSH A;  1AJ4 A;  4I5N B;  2WND A;  4PE7 A;  3TS5 C;  1A4P A;  1CM1 A;  1S6C A;  1WDC C;  3TS5 B;  1WDC B;  1DJI A;  4N1F A;  4ORB B;  1GJY A;  5F6T A;  3I5I B;  2COL B;  2K0J A;  2KSP A;  5KSZ A;  1QV1 A;  1JBA A;  4F0Z B;  4FQO A;  1QLS A;  1CLB A;  3EVU A;  2JZI A;  2SAS A;  1L2O C;  1S1E A;  1D1O A;  1FW4 A;  5CPV A;  2K7D A;  3DVM A;  4HRH A;  3JTD C;  2O5G A;  1RK9 A;  3JTD B;  2LAP A;  1QJT A;  2KGR A;  4A4B A;  2NZ0 A;  1A2X A;  2BKH B;  1NX0 A;  2MBX A;  1CTR A;  3KF9 A;  3KPX A;  4C0K A;  2JT8 A;  3RLZ A;  2LHL A;  1SKT A;  1Q80 A;  1XYD A;  1N2D A;  3VRN A;  1FPW A;  4DIR A;  2JTZ A;  1NX2 A;  5ER4 X;  2JNF A;  1E8A A;  1OMD A;  5I2L A;  1KK8 C;  2KFF A;  4OCI A;  2JXL A;  2LUX A;  1KK8 B;  2RGI A;  2E6W A;  2K8M B;  2KHN A;  4GAO A;  1DJY A;  1LIN A;  2VRG A;  2LC5 A;  2BBN A;  3PM8 A;  1DGV A;  3FWC A;  2EC6 C;  2KAY A;  2PAL A;  5CSN A;  1YRT B;  3FS7 A;  3GK2 A;  1K9P A;  3SIB A;  2HQ8 A;  1OSA A;  2BL0 C;  1N0Y A;  2KNE A;  2Y5I A;  4E68 A;  4ORC B;  2BL0 B;  2IS9 A;  3TDI A;  1SRA A;  2F33 A;  2KI6 D;  5J3X A;  1F55 A;  2EGD A;  2JNX A;  3EVV A;  2WCB A;  1FF1 A;  2LAN A;  4CFR A;  1TRF A;  4USL A;  4PHJ A;  1CDN A;  1DF0 A;  4AOM A;  2AMI A;  2FJU B;  3F45 A;  1K93 D;  1H4B A;  2FOT A;  3NSI A;  2NLN A;  1MWN A;  1OMV A;  4PDZ A;  1TNX A;  3ICB A;  4YI8 A;  3SG5 A;  3KHE A;  4MRX A;  2WCF A;  3DVE A;  3OB2 B;  4GGF A;  1M46 A;  1EL4 A;  2KGB C;  3I5H C;  4OR9 B;  3SIA A;  1FI5 A;  2Y1N A;  2K7O A;  1JF0 A;  1OZO A;  3I5H B;  4WRI A;  5I2Q A;  4HRG A;  4YGA A;  5HLV A;  5JOL A;  2L98 A;  1YR5 A;  1YX7 A;  4GBA A;  1G4Y R;  5G08 A;  1QTX A;  2WC8 A;  1KFU S;  1TNQ A;  2L2E A;  3OX6 A;  1OZS A;  1WRL A;  3BUX B;  4I5K A;  5HLO A;  2JPT A;  1PK0 D;  1ALV A;  1PSR A;  1S5G Z;  4JWQ A;  2OPO A;  4TNC A;  3FIA A;  1IQ5 A;  3CTN A;  1CFF A;  4C0L A;  1YUR A;  3TDU A;  4CLN A;  3NSL A;  1C7W A;  2LP2 A;  2NCO A;  1K90 D;  4YI9 A;  3ZNI A;  1KWO C;  1B47 A;  1LA0 A;  1B4C A;  4IL1 A;  1KWO B;  1UUS A;  1DVI A;  1F4Q A;  4BY4 A;  1B7T Z;  2Y4Q A;  2KAX A;  2I2R E;  2ZFD A;  1SNL A;  1U5I B;  5DKN A;  1XO5 A;  1NIW A;  3BOW A;  1B9A A;  5HKY A;  4ORA B;  1J7R A;  1PRW A;  5AXI A;  4A4C A;  3CWG A;  2LV7 A;  2L51 A;  2MA2 A;  4Q04 A;  3CZT X;  4QJ5 B;  4FTG A;  1MR8 A;  4XJK A;  2L5X B;  2WOS A;  4BY5 A;  3WHT B;  1BF5 A;  1PUL A;  1S5G Y;  4R1E A;  3KO0 A;  2KI4 B;  4MVF A;  2PRU A;  4MBE A;  1CM4 A;  3E3R A;  2LVK A;  1AK8 A;  1K9U A;  3O6B A;  3KEV A;  2LCP A;  1AJ5 A;  3BYA A;  3D0Y A;  1ZUZ A;  1IJ5 A;  1RJV A;  3QRX A;  2K61 A;  4OKH A;  1GGZ A;  3PAL A;  3AKB A;  3O4Y A;  5I2O A;  4PE4 A;  4PCW A;  3IQO A;  1B7T Y;  1DJW A;  1CLM A;  1YUU A;  4YGC B;  3EK8 A;  1M45 A;  2DOQ A;  1AVS A;  3CR4 X;  3DF0 A;  4N1G A;  2KYC A;  1L2O B;  2JT0 A;  1ALW A;  1A75 B;  4L9M A;  4ZCU A;  1C7V A;  1ZFS A;  1JSA A;  1NYA A;  1RFJ A;  1IKU A;  2KBI A;  2M9G A;  2ZND A;  2LP3 A;  2CTN A;  1WRK A;  2MRD A;  3EKH A;  4GGN A;  1A03 A;  1EG4 A;  2I18 A;  1WY9 A;  2MJW B;  1S6J A;  2Y1M A;  2ZKM X;  1K95 A;  4ZCV A;  1G8I A;  4MEW A;  1TOP A;  4DCK A;  1S26 D;  1N65 A;  2GGZ A;  3CGA A;  3VGO A;  2PMY A;  1NP8 A;  5JJG A;  2KAV A;  1WLZ A;  1CDL A;  2G2B A;  5AEQ A;  4UPG A;  3DVK A;  1MF8 B;  1SMG A;  1QX5 B;  2M97 A;  1ZOT B;  2PAS A;  1R6P A;  3SG4 A;  2F3Z A;  2H2K A;  2MLF C;  5HYD A;  1QIW A;  2EC6 B;  2BEC A;  2JC2 A;  3K21 A;  2SCP A;  1KSO A;  1KQM C;  2KQ6 A;  1QXP A;  2GGM A;  3WNX B;  1JWD A;  1MXE A;  2JU0 A;  2Q91 A;  1V1F A;  1YUS A;  5B8I B;  3LK1 A;  4OVN F;  5CSJ A;  5DKQ A;  5BPJ A;  1K2H A;  1IRJ A;  4WQ3 A;  1ZAC A;  1Y1U A;  1QVI Z;  4MZJ A;  2M49 B;  1SR6 C;  4GPL B;  3TDZ A;  1B8R A;  2M29 A;  1SR6 B;  3PAT A;  4MLW A;  1JFK A;  1QX7 A;  2FCD A;  1NWD A;  4HRE E;  1BR4 B;  5DKR A;  1TCF A;  1BJF A;  3A8R A;  1OOJ A;  4NDD A;  2H61 A;  3GOF A;  1JFJ A;  3SJS A;  2K7C A;  1F8H A;  1DTL A;  1NX1 A;  1B1G A;  2LLU A;  1M31 A;  3AAJ A;  4MN0 A;  3BUO B;  3LL8 B;  4WQ2 A;  2GV5 A;  3BUN B;  1IWQ A;  1XK4 A;  3OX5 A;  5CSF A;  2CBL A;  1UHH A;  1XFY O;  2EHB A;  3CR2 A;  4PHN A;  1G33 A;  4D1E A;  2ZRS A;  2I94 A;  1JUO A;  1SL9 A;  1XVJ A;  1KK7 Z;  4AQJ A;  3GK1 A;  1QVI Y;  4MSP A;  2CCM A;  1MQ1 A;  3I5F C;  3I5F B;  2QPT A;  1UHJ A;  1TTX A;  4MZL A;  1YTZ C;  1CDP A;  1B8C A;  2L4H A;  4NQG A;  2LHI A;  1CFP A;  1X02 A;  4OV2 A;  1TNP A;  2B1U A;  1DGU A;  4CFQ A;  1H8B A;  2ZN9 A;  1CLL A;  2KDH A;  2LMU A;  2K2A A;  1DJH A;  5ER5 A;  1J1D A;  1TCO B;  4AQI A;  2L0P A;  3VRP A;  1CB1 A;  3BUW B;  4DUQ A;  4M2P A;  1B8L A;  4MRY A;  3NSK A;  4ETO A;  2BBM A;  1SK6 D;  3A4U B;  5IBW A;  2M8U A;  3BUM B;  1NUB A;  2ZN8 A;  2P6B B;  1M39 A;  1NPQ A;  1TNW A;  2KBM A;  3EKJ A;  1DT7 B;  1NCZ A;  2L50 A;  3LCP C;  2MLE C;  1PVA A;  4M2Q A;  1RTP 1;  2JUL A;  2PSR A;  4I5J A;  1DF0 B;  2KFG A;  3MSE B;  1KK7 Y;  2KQY A;  1C07 A;  1CFC A;  1LKJ A;  3OHM B;  1DMO A;  1F71 A;  4JPZ B;  4DS7 A;  1J7O A;  2ZRT A;  4GGF C; 
#chains in the Genus database with same CATH topology
 1FI6 A;  1TN4 A;  2M3W A;  1SY9 A;  2CT9 A;  2LLS A;  2OTG C;  3CZ0 A;  4PAL A;  2LNK A;  2OTG B;  2KFH A;  1EH2 A;  1YRU B;  4JQ0 D;  3SG3 A;  2M7N A;  4NDC A;  3LK0 A;  4CID A;  1UUR A;  2CXJ A;  3D74 A;  1Y0V H;  1WLM A;  4GUK A;  5FYX A;  4F7F A;  1Y1X A;  4YGE B;  1QV0 A;  1K9K A;  4YBH B;  5AAN A;  1BOD A;  1Z4H A;  1KFX L;  2LMV A;  2AUC A;  2QEO A;  3IQQ A;  4N5X A;  1AUI B;  1NCY A;  1S36 A;  2KOT A;  1EJ3 A;  3IF7 A;  3SS3 A;  1A29 A;  1MUX A;  3WXA A;  4PHK A;  1XFV O;  2KLD A;  1C3Z A;  3FE6 A;  4U8D A;  2M7L A;  3EK7 A;  2ISD A;  3CZ2 A;  1WRZ A;  3I5I C;  4JD9 A;  1XA5 A;  3C1V A;  1W7J B;  1YX8 A;  1QLK A;  3OGN A;  3AKA A;  1UHN A;  3JVT C;  1F4O A;  1C3Y A;  1DJZ A;  3JVT B;  1YVL A;  1KSM A;  2BCX A;  2K7B A;  3HX4 A;  2F3Y A;  1PAL A;  2LLT A;  2JWW A;  2LE9 B;  1T14 A;  2L4I A;  4QJ3 B;  1SW8 A;  3D78 A;  2V53 A;  4PHM A;  5KTY A;  1KQV A;  1EG3 A;  1K96 A;  2JTT A;  4MZK A;  1JF2 A;  2M1K B;  2O60 A;  5TNC A;  5HKW A;  1OMR A;  1SCV A;  4CPV A;  3BOW B;  2LVJ A;  1VRK A;  3FE9 A;  1J1E A;  1TIZ A;  2NCP A;  3GK4 X;  3V2L A;  1BMO A;  4YGB B;  3VRR A;  1SL7 A;  1KQM B;  4XJK B;  2KI6 C;  2I7A A;  2JOJ A;  3FWB A;  3TZ1 A;  1RWY A;  3DVJ A;  3B7A A;  2AAO A;  5I94 A;  1IQ3 A;  1DJG A;  1R2U A;  4M2O A;  4PE0 A;  1GGW A;  1UHK A;  2F8P A;  1RRO A;  1MXL C;  1QIV A;  1S6I A;  1SYM A;  2PVB A;  2LMT A;  1BT6 A;  2F2O A;  3CLN A;  3D0Y B;  3LLE A;  4YRU A;  3EK4 A;  2BE6 A;  2M0R A;  4I5L B;  1L7Z A;  1MHO A;  2A4J A;  3VRO A;  1HQV A;  1CDM A;  1SBJ A;  1IJ6 A;  3BQ3 A;  3DF0 B;  2QEV A;  1EXR A;  1U5I A;  1SCM C;  2HPS A;  1CKK A;  1SSE B;  3NSO A;  1SCM B;  2MAZ A;  4JKT A;  5CSI A;  3VRQ A;  1J7P A;  1XFR A;  1LXF C;  3NXA A;  5GQQ C;  3O2P A;  1QAT A;  5AFP A;  2L5Y A;  2F2P A;  2K2F A;  3L47 A;  3SG7 A;  2LM5 A;  1NCX A;  2ZNE A;  1OE9 B;  3EVR A;  2K60 A;  3TUY C;  4QJ4 B;  5HKZ A;  1V1G A;  1BOC A;  1W7I B;  3PLF B;  3O78 A;  2M1U A;  3TUY B;  1HT9 A;  3BXK A;  2L2C A;  2BCA A;  2HET A;  3AAK A;  1K8U A;  2JRF A;  3CR5 X;  1AP4 A;  1BR1 B;  4C0J A;  1IG5 A;  1IGV A;  2HF5 A;  2TN4 A;  3N7H A;  2WCH A;  5K89 A;  2WOR A;  2FCE A;  1FBV A;  1XFU O;  2JXC A;  2MHH A;  1F54 A;  1UHI A;  4P5O E;  1QS7 A;  3OB1 B;  1YUT A;  2BCB A;  1QAS A;  3QME A;  1PVB A;  1IH0 A;  1ZMZ A;  3DZT A;  1BG1 A;  2JT3 A;  4GNK B;  3S0E A;  1XFZ O;  1A75 A;  1Y1A A;  2G9B A;  1CNP A;  4INX A;  2JQ6 A;  1DEL A;  2HQW A;  2R2I A;  1QX2 A;  4YGD B;  3D10 A;  2LVV A;  1Y6W A;  2QAC A;  5AER A;  3OP0 A;  4NDB A;  1AHR A;  1K94 A;  2CNP A;  2NXQ A;  1DJX A;  2WCE A;  4PE1 A;  3M0W A;  2OS8 C;  3OBV A;  1M63 B;  3B87 A;  4XYN A;  1YVH A;  3I5G C;  2OS8 B;  1LA3 A;  1UP5 A;  1REC A;  3PSR A;  1JC2 A;  3I5G B;  1CMF A;  3ZWH A;  1OQP A;  3PFV A;  1NX3 A;  1KFU L;  5D69 A;  1J7Q A;  3R1O A;  1BU3 A;  5KU1 A;  3DD4 A;  2WC6 A;  1J55 A;  1GQM A;  2E30 A;  2H61 C;  2BKI B;  2WC5 A;  3WHU B;  3SG6 A;  1SPY A;  1XFX O;  1CMG A;  1KFX S;  1S3P A;  3PN7 C;  4HSZ A;  5I8N A;  2D8N A;  3PN7 B;  4P2Y B;  4DRW A;  1LS8 A;  2LVI A;  3CS1 A;  1KCY A;  3SG2 A;  1UWO A;  5D7F A;  1SL8 A;  1PSB A;  1LVC D;  1ODB A;  2PQL A;  3BFH A;  1DQE A;  3CYZ A;  1XK4 C;  1CFD A;  4ICB A;  4PT1 A;  4GFT A;  1XFW O;  3H4S E;  3RM1 A;  1F70 A;  2BE4 A;  3K1E A;  1ORG A;  2LUC A;  2KYF A;  1BLQ A;  2Q4U A;  2KI4 C;  3D77 A;  3HCM A;  5PAL A;  1NSH A;  2ERB A;  4KYN A;  3D73 A;  1AJ4 A;  4I5N B;  2WND A;  4PE7 A;  3TS5 C;  1A4P A;  1CM1 A;  1S6C A;  1WDC C;  3TS5 B;  1WDC B;  1DJI A;  4N1F A;  3BFB A;  1GJY A;  4ORB B;  5F6T A;  3I5I B;  1IIO A;  2COL B;  2K0J A;  2KSP A;  5KSZ A;  1QV1 A;  1JBA A;  4F0Z B;  4FQO A;  1QLS A;  1CLB A;  3EVU A;  2JZI A;  2SAS A;  1L2O C;  1S1E A;  1D1O A;  1FW4 A;  5CPV A;  2K7D A;  3DVM A;  4HRH A;  3JTD C;  2O5G A;  1RK9 A;  3BJH A;  3JTD B;  3S0A A;  2LAP A;  3B86 A;  1QJT A;  2KGR A;  4A4B A;  2NZ0 A;  1A2X A;  3B6X A;  2BKH B;  3NGV A;  1NX0 A;  2MBX A;  1CTR A;  3KF9 A;  3KPX A;  4C0K A;  2JT8 A;  3RLZ A;  2LHL A;  1SKT A;  1Q80 A;  1XYD A;  1N2D A;  3VRN A;  1FPW A;  4DIR A;  2JTZ A;  1NX2 A;  1W9Z A;  5ER4 X;  2JNF A;  1E8A A;  1OMD A;  5I2L A;  1KK8 C;  2KFF A;  4OCI A;  2JXL A;  2LUX A;  1KK8 B;  2RGI A;  2E6W A;  3R1V A;  2K8M B;  2KHN A;  4GAO A;  1DJY A;  1LIN A;  2VRG A;  2LC5 A;  2BBN A;  1TWO A;  3PM8 A;  1DGV A;  3FWC A;  2FJY A;  3CDN A;  1OW4 A;  2EC6 C;  2KAY A;  2PAL A;  5CSN A;  1YRT B;  3FS7 A;  3SS4 A;  2QDI A;  3GK2 A;  1K9P A;  3SIB A;  2HQ8 A;  1OSA A;  2BL0 C;  1N0Y A;  2KNE A;  2Y5I A;  4E68 A;  4ORC B;  2BL0 B;  2IS9 A;  3TDI A;  1SRA A;  2F33 A;  2KI6 D;  5J3X A;  1F55 A;  2EGD A;  2JNX A;  3EVV A;  2WCB A;  1FF1 A;  2LAN A;  3DXL A;  3L4L A;  4CFR A;  1TRF A;  4USL A;  4PHJ A;  3DYE A;  3S0B A;  1CDN A;  2WCM A;  1DF0 A;  4AOM A;  2AMI A;  2FJU B;  2WCL A;  1K93 D;  3D75 A;  3EG5 B;  2FOT A;  3F45 A;  3NSI A;  1H4B A;  2NLN A;  1MWN A;  1OMV A;  4PDZ A;  1TNX A;  3ICB A;  4YI8 A;  3SG5 A;  3DY9 A;  1OOF A;  3KHE A;  3B88 A;  3PM2 A;  4MRX A;  2WCF A;  3DVE A;  3OB2 B;  4GGF A;  3CZ1 A;  1M46 A;  1EL4 A;  2KGB C;  3I5H C;  4OR9 B;  3SIA A;  1FI5 A;  2Y1N A;  2K7O A;  1JF0 A;  1OZO A;  3I5H B;  4WRI A;  5I2Q A;  4HRG A;  4INW A;  4YGA A;  5HLV A;  5JOL A;  2L98 A;  4OZD A;  3RZS A;  3Q8I A;  1YR5 A;  1YX7 A;  4GBA A;  1G4Y R;  5G08 A;  1QTX A;  2WC8 A;  1KFU S;  1TNQ A;  2L2E A;  2P71 A;  3OX6 A;  5D3O A;  1OZS A;  1WRL A;  3BUX B;  4I5K A;  5HLO A;  2JPT A;  1PK0 D;  1ALV A;  1PSR A;  1DC1 A;  1S5G Z;  4JWQ A;  2OPO A;  2GTE A;  4TNC A;  2WCJ A;  3FIA A;  1IQ5 A;  3CTN A;  3R1P A;  1CFF A;  4C0L A;  1YUR A;  5EL2 A;  3TDU A;  4CLN A;  3NSL A;  1C7W A;  2LP2 A;  2NCO A;  1K90 D;  4YI9 A;  3ZNI A;  1KWO C;  1B47 A;  1LA0 A;  1B4C A;  4IL1 A;  1KWO B;  1UUS A;  1DVI A;  1F4Q A;  4BY4 A;  1B7T Z;  2Y4Q A;  2KAX A;  2I2R E;  5FI2 A;  2ZFD A;  1SNL A;  1U5I B;  5DKN A;  1XO5 A;  3UNW A;  1NIW A;  3BOW A;  1B9A A;  3R72 A;  3UO9 A;  5HKY A;  4ORA B;  5HL1 A;  1J7R A;  1PRW A;  5AXI A;  4A4C A;  3CWG A;  2LV7 A;  2L51 A;  2MA2 A;  4Q04 A;  1P28 A;  3CZT X;  4QJ5 B;  4FTG A;  1MR8 A;  4XJK A;  2L5X B;  2WOS A;  4BY5 A;  3WHT B;  1BF5 A;  1PUL A;  1S5G Y;  4R1E A;  3KO0 A;  2KI4 B;  4MVF A;  2PRU A;  4MBE A;  1CM4 A;  3E3R A;  2LVK A;  1AK8 A;  1K9U A;  3O6B A;  3KEV A;  2LCP A;  1AJ5 A;  2JPO A;  3BYA A;  3D0Y A;  1ZUZ A;  1OOI X;  1IJ5 A;  1RJV A;  3QRX A;  2K61 A;  4OKH A;  1GGZ A;  3PAL A;  3AKB A;  3O4Y A;  5I2O A;  2QEH A;  4PE4 A;  4PCW A;  3IQO A;  1B7T Y;  1DJW A;  1CLM A;  1YUU A;  4YGC B;  3EK8 A;  1M45 A;  2DOQ A;  1AVS A;  3CR4 X;  3DF0 A;  4N1G A;  2KYC A;  1L2O B;  2JT0 A;  1ALW A;  1A75 B;  4L9M A;  4ZCU A;  1C7V A;  1ZFS A;  1JSA A;  1NYA A;  2WCK A;  1RFJ A;  1IKU A;  2KBI A;  2M9G A;  2QEB A;  2LP3 A;  2CTN A;  1WRK A;  2MRD A;  2ZND A;  3EKH A;  4GGN A;  1A03 A;  1EG4 A;  2I18 A;  1TUJ A;  1WY9 A;  2MJW B;  1S6J A;  2Y1M A;  1Z2C B;  2ZKM X;  1K95 A;  4ZCV A;  1G8I A;  4MEW A;  1TOP A;  4DCK A;  1OOG A;  1S26 D;  1N65 A;  2GGZ A;  2KLE A;  3CGA A;  3VGO A;  2PMY A;  1NP8 A;  5JJG A;  2KAV A;  1WLZ A;  3VB1 A;  1CDL A;  2G2B A;  5AEQ A;  4UPG A;  3SS5 A;  3D76 A;  3DVK A;  1MF8 B;  1SMG A;  1QX5 B;  2M97 A;  1ZOT B;  2PAS A;  1R6P A;  2YGU A;  3SG4 A;  2F3Z A;  2H2K A;  2MLF C;  5HYD A;  1QIW A;  2EC6 B;  2BEC A;  2JC2 A;  3K21 A;  2SCP A;  5FI7 A;  1KSO A;  1KQM C;  2KQ6 A;  1QXP A;  2GGM A;  3WNX B;  1JWD A;  1MXE A;  2JU0 A;  2Q91 A;  1V1F A;  1YUS A;  5B8I B;  3LK1 A;  2KPH A;  4FQT A;  4OVN F;  5CSJ A;  5DKQ A;  5BPJ A;  1K2H A;  1IRJ A;  4WQ3 A;  1ZAC A;  1Y1U A;  1QVI Z;  4MZJ A;  2M49 B;  1SR6 C;  4GPL B;  3TDZ A;  2BAP A;  1B8R A;  2M29 A;  1SR6 B;  3PAT A;  4MLW A;  1JFK A;  1QX7 A;  2FCD A;  1NWD A;  4HRE E;  1BR4 B;  5DKR A;  1DEK A;  1TCF A;  1BJF A;  3A8R A;  1OOJ A;  4NDD A;  2H61 A;  3GOF A;  1JFJ A;  3BFA A;  5DIC A;  3SJS A;  2K7C A;  1F8H A;  1DTL A;  3FE8 A;  4IJ7 A;  1NX1 A;  1B1G A;  2LLU A;  1M31 A;  3AAJ A;  4MN0 A;  3BUO B;  3S0D A;  3LL8 B;  4WQ2 A;  2GV5 A;  3BUN B;  1IWQ A;  1XK4 A;  3OX5 A;  5CSF A;  3S0G A;  3O4X A;  2CBL A;  1UHH A;  1XFY O;  2EHB A;  3CR2 A;  4PHN A;  2P70 A;  1G33 A;  4D1E A;  2ZRS A;  2I94 A;  1JUO A;  1SL9 A;  1XVJ A;  1KK7 Z;  4AQJ A;  1OOH A;  2PYQ A;  3GK1 A;  1QVI Y;  4MSP A;  2CCM A;  1MQ1 A;  3I5F C;  3I5F B;  2QPT A;  1UHJ A;  1TTX A;  4MZL A;  1YTZ C;  1CDP A;  1B8C A;  2L4H A;  4NQG A;  2LHI A;  1CFP A;  1X02 A;  4OV2 A;  1TNP A;  2B1U A;  1DGU A;  4CFQ A;  1H8B A;  2ZN9 A;  1CLL A;  2KDH A;  2LMU A;  2K2A A;  1DJH A;  5ER5 A;  1J1D A;  1TCO B;  4AQI A;  2L0P A;  3VRP A;  1CB1 A;  3BUW B;  4DUQ A;  3S0F A;  3L4A A;  4M2P A;  1B8L A;  4MRY A;  3NSK A;  4ETO A;  1GM0 A;  2BBM A;  1SK6 D;  3A4U B;  5IBW A;  2M8U A;  3BUM B;  1NUB A;  2ZN8 A;  1QWV A;  1TUZ A;  1M39 A;  1NPQ A;  1TNW A;  2KBM A;  2P6B B;  3EKJ A;  3NHT A;  1DT7 B;  1NCZ A;  2L50 A;  3LCP C;  2MLE C;  1PVA A;  3PJI A;  4M2Q A;  2BNX A;  1RTP 1;  2H8V A;  2JUL A;  2PSR A;  4I5J A;  3CAB A;  1DF0 B;  2KFG A;  5FI6 A;  3MSE B;  1KK7 Y;  2KQY A;  1C07 A;  1CFC A;  1LKJ A;  3OHM B;  1DMO A;  1F71 A;  4JPZ B;  3IVT A;  3NHI A;  4DS7 A;  1J7O A;  2ZRT A;  4GGF C; 
#chains in the Genus database with same CATH homology
 1FI6 A;  1TN4 A;  2M3W A;  1SY9 A;  2CT9 A;  2LLS A;  2OTG C;  4PAL A;  2LNK A;  2OTG B;  2KFH A;  1EH2 A;  1YRU B;  4JQ0 D;  3SG3 A;  2M7N A;  4NDC A;  3LK0 A;  4CID A;  1UUR A;  2CXJ A;  1Y0V H;  1WLM A;  4GUK A;  5FYX A;  1Y1X A;  4YGE B;  1QV0 A;  1K9K A;  4YBH B;  5AAN A;  1BOD A;  1KFX L;  2LMV A;  2AUC A;  3IQQ A;  4N5X A;  1AUI B;  1NCY A;  1S36 A;  2KOT A;  1EJ3 A;  3IF7 A;  1A29 A;  1MUX A;  3WXA A;  4PHK A;  1XFV O;  4U8D A;  2M7L A;  3EK7 A;  2ISD A;  1WRZ A;  3I5I C;  1XA5 A;  3C1V A;  1W7J B;  1YX8 A;  1QLK A;  3AKA A;  1UHN A;  3JVT C;  1F4O A;  1DJZ A;  3JVT B;  1YVL A;  1KSM A;  2BCX A;  2K7B A;  3HX4 A;  2F3Y A;  1PAL A;  2LLT A;  2JWW A;  2LE9 B;  2L4I A;  4QJ3 B;  1SW8 A;  2V53 A;  4PHM A;  5KTY A;  1KQV A;  1EG3 A;  1K96 A;  2JTT A;  4MZK A;  1JF2 A;  2M1K B;  2O60 A;  5TNC A;  5HKW A;  1OMR A;  1SCV A;  4CPV A;  3BOW B;  2LVJ A;  1VRK A;  1J1E A;  1TIZ A;  2NCP A;  3GK4 X;  1BMO A;  4YGB B;  3VRR A;  1SL7 A;  1KQM B;  4XJK B;  2KI6 C;  2I7A A;  2JOJ A;  3FWB A;  3TZ1 A;  1RWY A;  3DVJ A;  2AAO A;  1IQ3 A;  1DJG A;  1R2U A;  4M2O A;  4PE0 A;  1GGW A;  1UHK A;  2F8P A;  1RRO A;  1MXL C;  1QIV A;  1S6I A;  1SYM A;  2PVB A;  2LMT A;  1BT6 A;  2F2O A;  3CLN A;  3D0Y B;  3LLE A;  4YRU A;  3EK4 A;  2BE6 A;  2M0R A;  4I5L B;  1L7Z A;  1MHO A;  2A4J A;  3VRO A;  1HQV A;  1CDM A;  1SBJ A;  1IJ6 A;  3BQ3 A;  3DF0 B;  1EXR A;  1U5I A;  1SCM C;  2HPS A;  1CKK A;  3NSO A;  1J7P A;  1SCM B;  2MAZ A;  3VRQ A;  5CSI A;  1LXF C;  3NXA A;  5GQQ C;  3O2P A;  1QAT A;  5AFP A;  2F2P A;  2K2F A;  3SG7 A;  2LM5 A;  1NCX A;  2ZNE A;  1OE9 B;  3EVR A;  3TUY C;  4QJ4 B;  5HKZ A;  1V1G A;  1BOC A;  1W7I B;  3PLF B;  3O78 A;  2M1U A;  3TUY B;  1HT9 A;  3BXK A;  3CR5 X;  2BCA A;  2HET A;  3AAK A;  1K8U A;  2JRF A;  1AP4 A;  1BR1 B;  4C0J A;  1IG5 A;  1IGV A;  2HF5 A;  2TN4 A;  5K89 A;  2WOR A;  2FCE A;  1FBV A;  1XFU O;  2JXC A;  2MHH A;  1F54 A;  1UHI A;  4P5O E;  1QS7 A;  3OB1 B;  1YUT A;  2BCB A;  1QAS A;  1IH0 A;  1PVB A;  1ZMZ A;  1BG1 A;  2JT3 A;  4GNK B;  1XFZ O;  1A75 A;  1Y1A A;  2G9B A;  1CNP A;  2JQ6 A;  2HQW A;  2R2I A;  1QX2 A;  4YGD B;  3D10 A;  2LVV A;  1Y6W A;  2QAC A;  5AER A;  3OP0 A;  4NDB A;  1AHR A;  1K94 A;  2CNP A;  2NXQ A;  1DJX A;  2WCE A;  4PE1 A;  3M0W A;  2OS8 C;  1M63 B;  4XYN A;  1YVH A;  3I5G C;  2OS8 B;  1LA3 A;  1UP5 A;  1REC A;  3PSR A;  1JC2 A;  3I5G B;  1CMF A;  3ZWH A;  1OQP A;  3PFV A;  1NX3 A;  1KFU L;  5D69 A;  1J7Q A;  1BU3 A;  5KU1 A;  3DD4 A;  1J55 A;  1GQM A;  2E30 A;  2H61 C;  2BKI B;  3WHU B;  3SG6 A;  1SPY A;  1XFX O;  1CMG A;  1KFX S;  1S3P A;  3PN7 C;  4HSZ A;  5I8N A;  2D8N A;  3PN7 B;  4P2Y B;  4DRW A;  3CS1 A;  2LVI A;  1KCY A;  3SG2 A;  1UWO A;  5D7F A;  1SL8 A;  1PSB A;  1LVC D;  1ODB A;  1XK4 C;  1CFD A;  4ICB A;  1F70 A;  4GFT A;  1XFW O;  3H4S E;  3RM1 A;  2BE4 A;  2LUC A;  2KYF A;  1BLQ A;  2Q4U A;  2KI4 C;  5PAL A;  3HCM A;  1NSH A;  1AJ4 A;  4I5N B;  2WND A;  4PE7 A;  3TS5 C;  1A4P A;  1CM1 A;  1S6C A;  1WDC C;  3TS5 B;  1WDC B;  1DJI A;  4N1F A;  4ORB B;  1GJY A;  5F6T A;  3I5I B;  2COL B;  2K0J A;  2KSP A;  5KSZ A;  1QV1 A;  1JBA A;  4F0Z B;  4FQO A;  1QLS A;  1CLB A;  3EVU A;  2JZI A;  2SAS A;  1L2O C;  1S1E A;  1D1O A;  1FW4 A;  5CPV A;  2K7D A;  3DVM A;  4HRH A;  3JTD C;  2O5G A;  1RK9 A;  3JTD B;  2LAP A;  1QJT A;  2KGR A;  4A4B A;  2NZ0 A;  1A2X A;  2BKH B;  1NX0 A;  2MBX A;  1CTR A;  3KF9 A;  3KPX A;  4C0K A;  2JT8 A;  3RLZ A;  2LHL A;  1SKT A;  1Q80 A;  1XYD A;  1N2D A;  3VRN A;  1FPW A;  4DIR A;  2JTZ A;  1NX2 A;  5ER4 X;  2JNF A;  1E8A A;  1OMD A;  5I2L A;  1KK8 C;  2KFF A;  4OCI A;  2JXL A;  2LUX A;  1KK8 B;  2RGI A;  2E6W A;  2K8M B;  2KHN A;  4GAO A;  1DJY A;  1LIN A;  2VRG A;  2LC5 A;  2BBN A;  3PM8 A;  1DGV A;  3FWC A;  2EC6 C;  2KAY A;  2PAL A;  5CSN A;  1YRT B;  3FS7 A;  3GK2 A;  1K9P A;  3SIB A;  2HQ8 A;  1OSA A;  2BL0 C;  1N0Y A;  2KNE A;  2Y5I A;  4E68 A;  4ORC B;  2BL0 B;  2IS9 A;  3TDI A;  1SRA A;  2F33 A;  2KI6 D;  5J3X A;  1F55 A;  2EGD A;  2JNX A;  3EVV A;  2WCB A;  1FF1 A;  2LAN A;  4CFR A;  1TRF A;  4USL A;  4PHJ A;  1CDN A;  1DF0 A;  4AOM A;  2AMI A;  2FJU B;  3F45 A;  1K93 D;  1H4B A;  2FOT A;  3NSI A;  2NLN A;  1MWN A;  1OMV A;  4PDZ A;  1TNX A;  3ICB A;  4YI8 A;  3SG5 A;  3KHE A;  4MRX A;  2WCF A;  3DVE A;  3OB2 B;  4GGF A;  1M46 A;  1EL4 A;  2KGB C;  3I5H C;  4OR9 B;  3SIA A;  1FI5 A;  2Y1N A;  2K7O A;  1JF0 A;  1OZO A;  3I5H B;  4WRI A;  5I2Q A;  4HRG A;  4YGA A;  5HLV A;  5JOL A;  2L98 A;  1YR5 A;  1YX7 A;  4GBA A;  1G4Y R;  5G08 A;  1QTX A;  2WC8 A;  1KFU S;  1TNQ A;  2L2E A;  3OX6 A;  1OZS A;  1WRL A;  3BUX B;  4I5K A;  5HLO A;  2JPT A;  1PK0 D;  1ALV A;  1PSR A;  1S5G Z;  4JWQ A;  2OPO A;  4TNC A;  3FIA A;  1IQ5 A;  3CTN A;  1CFF A;  4C0L A;  1YUR A;  3TDU A;  4CLN A;  3NSL A;  1C7W A;  2LP2 A;  2NCO A;  1K90 D;  4YI9 A;  3ZNI A;  1KWO C;  1B47 A;  1LA0 A;  1B4C A;  4IL1 A;  1KWO B;  1UUS A;  1DVI A;  1F4Q A;  4BY4 A;  1B7T Z;  2Y4Q A;  2KAX A;  2I2R E;  2ZFD A;  1SNL A;  1U5I B;  5DKN A;  1XO5 A;  1NIW A;  3BOW A;  1B9A A;  5HKY A;  4ORA B;  1J7R A;  1PRW A;  5AXI A;  4A4C A;  3CWG A;  2LV7 A;  2L51 A;  2MA2 A;  4Q04 A;  3CZT X;  4QJ5 B;  4FTG A;  1MR8 A;  4XJK A;  2L5X B;  2WOS A;  4BY5 A;  3WHT B;  1BF5 A;  1PUL A;  1S5G Y;  4R1E A;  3KO0 A;  2KI4 B;  4MVF A;  2PRU A;  4MBE A;  1CM4 A;  3E3R A;  2LVK A;  1AK8 A;  1K9U A;  3O6B A;  3KEV A;  2LCP A;  1AJ5 A;  3BYA A;  3D0Y A;  1ZUZ A;  1IJ5 A;  1RJV A;  3QRX A;  2K61 A;  4OKH A;  1GGZ A;  3PAL A;  3AKB A;  3O4Y A;  5I2O A;  4PE4 A;  4PCW A;  3IQO A;  1B7T Y;  1DJW A;  1CLM A;  1YUU A;  4YGC B;  3EK8 A;  1M45 A;  2DOQ A;  1AVS A;  3CR4 X;  3DF0 A;  4N1G A;  2KYC A;  1L2O B;  2JT0 A;  1ALW A;  1A75 B;  4L9M A;  4ZCU A;  1C7V A;  1ZFS A;  1JSA A;  1NYA A;  1RFJ A;  1IKU A;  2KBI A;  2M9G A;  2ZND A;  2LP3 A;  2CTN A;  1WRK A;  2MRD A;  3EKH A;  4GGN A;  1A03 A;  1EG4 A;  2I18 A;  1WY9 A;  2MJW B;  1S6J A;  2Y1M A;  2ZKM X;  1K95 A;  4ZCV A;  1G8I A;  4MEW A;  1TOP A;  4DCK A;  1S26 D;  1N65 A;  2GGZ A;  3CGA A;  3VGO A;  2PMY A;  1NP8 A;  5JJG A;  2KAV A;  1WLZ A;  1CDL A;  2G2B A;  5AEQ A;  4UPG A;  3DVK A;  1MF8 B;  1SMG A;  1QX5 B;  2M97 A;  1ZOT B;  2PAS A;  1R6P A;  3SG4 A;  2F3Z A;  2H2K A;  2MLF C;  5HYD A;  1QIW A;  2EC6 B;  2BEC A;  2JC2 A;  3K21 A;  2SCP A;  1KSO A;  1KQM C;  2KQ6 A;  1QXP A;  2GGM A;  3WNX B;  1JWD A;  1MXE A;  2JU0 A;  2Q91 A;  1V1F A;  1YUS A;  5B8I B;  3LK1 A;  4OVN F;  5CSJ A;  5DKQ A;  5BPJ A;  1K2H A;  1IRJ A;  4WQ3 A;  1ZAC A;  1Y1U A;  1QVI Z;  4MZJ A;  2M49 B;  1SR6 C;  4GPL B;  3TDZ A;  1B8R A;  2M29 A;  1SR6 B;  3PAT A;  4MLW A;  1JFK A;  1QX7 A;  2FCD A;  1NWD A;  4HRE E;  1BR4 B;  5DKR A;  1TCF A;  1BJF A;  3A8R A;  1OOJ A;  4NDD A;  2H61 A;  3GOF A;  1JFJ A;  3SJS A;  2K7C A;  1F8H A;  1DTL A;  1NX1 A;  1B1G A;  2LLU A;  1M31 A;  3AAJ A;  4MN0 A;  3BUO B;  3LL8 B;  4WQ2 A;  2GV5 A;  3BUN B;  1IWQ A;  1XK4 A;  3OX5 A;  5CSF A;  2CBL A;  1UHH A;  1XFY O;  2EHB A;  3CR2 A;  4PHN A;  1G33 A;  4D1E A;  2ZRS A;  2I94 A;  1JUO A;  1SL9 A;  1XVJ A;  1KK7 Z;  4AQJ A;  3GK1 A;  1QVI Y;  4MSP A;  2CCM A;  1MQ1 A;  3I5F C;  3I5F B;  2QPT A;  1UHJ A;  1TTX A;  4MZL A;  1YTZ C;  1CDP A;  1B8C A;  2L4H A;  4NQG A;  2LHI A;  1CFP A;  1X02 A;  4OV2 A;  1TNP A;  2B1U A;  1DGU A;  4CFQ A;  1H8B A;  2ZN9 A;  1CLL A;  2KDH A;  2LMU A;  2K2A A;  1DJH A;  5ER5 A;  1J1D A;  1TCO B;  4AQI A;  2L0P A;  3VRP A;  1CB1 A;  3BUW B;  4DUQ A;  4M2P A;  1B8L A;  4MRY A;  3NSK A;  4ETO A;  2BBM A;  1SK6 D;  3A4U B;  5IBW A;  2M8U A;  3BUM B;  1NUB A;  2ZN8 A;  2P6B B;  1M39 A;  1NPQ A;  1TNW A;  2KBM A;  3EKJ A;  1DT7 B;  1NCZ A;  2L50 A;  3LCP C;  2MLE C;  1PVA A;  4M2Q A;  1RTP 1;  2JUL A;  2PSR A;  4I5J A;  1DF0 B;  2KFG A;  3MSE B;  1KK7 Y;  2KQY A;  1C07 A;  1CFC A;  1LKJ A;  3OHM B;  1DMO A;  1F71 A;  4JPZ B;  4DS7 A;  1J7O A;  2ZRT A;  4GGF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...