1RECA

Three-dimensional structure of recoverin, a calcium sensor in vision
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
185
Chain Sequence
LSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOVERIN
publication title Three-Dimensional Structure of Recoverin, a Calcium Sensor in Vision
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 74
structure length 185
sequence length 190
ec nomenclature
pdb deposition date 1993-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1recA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1recA01
2VRGA 2OTGC 4MBEA 3TZ1A 4GGNA 1NUBA 3EVUA 5HKWA 1S5GY 4ICBA 4Q04A 1BOCA 1B7TZ 3EK8A 1UWOA 1RK9A 2M1UA 2LMTA 4ZCVA 1MXEA 1NYAA 1IGVA 2NXQA 3SG6A 4YRUA 1MHOA 2LVKA 1XFYO 2LHLA 1NX2A 2JQ6A 2LMVA 5AANA 4PE4A 2KAVA 1FPWA 1SCMC 4C0LA 1S36A 1JC2A 5F6TA 1C07A 1KFXS 5ER5A 1SR6C 1YURA 1TNWA 3PN7C 4IL1A 4CFRA 1M31A 2WNDA 2IS9A 1DJWA 3GK2A 1CLLA 2KI4B 2GGZA 5I2QA 2LVVA 4P5OE 1UUSA 3I5GB 1YVHA 4DS7A 2CTNA 3GK4X 4XJKB 2CXJA 1GGZA 4MEWA 3SG4A 1J7RA 2KOTA 5DKNA 5B8IB 1QX5B 4DIRA 1YTZC 1YRTB 1XFWO 2JU0A 3BUWB 1F71A 1UHNA 2QACA 2KGRA 1WLZA 2BE4A 4M2QA 1KK7Z 1QV1A 1M39A 2ZRSA 3E3RA 4OVNF 3A4UB 1ALVA 1UHKA 3OHMB 2JZIA 1CTRA 5JJGA 1U5IA 1FBVA 2JULA 2OS8C 3GK1A 3WHUB 1BG1A 4U8DA 4A4CA 5I2OA 5J3XA 3WNXB 3SG5A 1JF0A 1BR1B 3SG3A 4DUQA 1WRLA 1CDPA 2JXLA 1K93D 1CLBA 2F3YA 1K90D 4MZKA 2WCBA 4ZCUA 3AAJA 2JTZA 3LCPC 3PALA 1GJYA 3SG2A 2KI4C 3EVRA 3TUYC 4PE1A 1XVJA 3I5FC 2NLNA 1LXFC 1FF1A 2JPTA 3I5GC 2K8MB 4F0ZB 2R2IA 5D7FA 5I2LA 2K7OA 5AEQA 2BCBA 1IWQA 3EKHA 1U5IB 1EJ3A 1N0YA 1S3PA 1CNPA 1JFJA 2K7CA 3BUOB 2NCPA 3CR5X 1DF0A 2DOQA 2HF5A 2KHNA 1AJ5A 1CMFA 3I5IC 1E8AA 3ICBA 5I8NA 1DJZA 1X02A 5AERA 2KDHA 2JRFA 1OQPA 1XA5A 3DD4A 4C0JA 2L4IA 4YGBB 1F8HA 1DJIA 2M29A 2M9GA 3WXAA 1Y0VH 1KSMA 1SPYA 2KAYA 3PSRA 4PE0A 3PATA 1ODBA 2MHHA 1KWOB 1DGVA 4JPZB 1DF0B 2LLSA 3VRRA 4AQJA 2JXCA 1B8RA 4TNCA 2I2RE 3DVMA 2ZRTA 3KO0A 2F33A 1VRKA 2OTGB 3MSEB 1C7VA 1KQMC 1K2HA 1YUTA 4YBHB 1BR4B 1M46A 2CBLA 3PM8A 3ZWHA 5GQQC 2KGBC 1CDNA 1YX7A 1SW8A 4PCWA 1ZOTB 2QPTA 2Y1NA 2L2EA 3OB2B 2ZN9A 5G08A 1A75A 1JUOA 1TTXA 1SCMB 3D0YA 3KHEA 3OX5A 5DKRA 3D10A 2L98A 4CPVA 1SR6B 1YUUA 4PHNA 2I18A 3NXAA 3VROA 4AQIA 1QXPA 4JWQA 1W7IB 2FCEA 3BUNB 5CSIA 3FS7A 3HCMA 1AVSA 4MVFA 3IF7A 1IH0A 3KEVA 3DVJA 2LUCA 2BECA 1A75B 2BKHB 4E68A 1S6CA 1PVAA 3I5HC 1PSRA 1RFJA 3BYAA 3D0YB 3NSOA 4C0KA 2M7LA 1SL7A 4I5LB 5AFPA 2M49B 2LANA 2LNKA 1KK7Y 2K2FA 1TNPA 1IJ6A 1L7ZA 1HT9A 1V1GA 1EXRA 1N65A 1CFDA 2OS8B 2AAOA 3CS1A 4XJKA 1Y6WA 1NCZA 2EHBA 1GQMA 1ZMZA 1SL9A 4GFTA 1RWYA 4ORCB 3JTDC 3SIBA 1TCFA 1UHHA 1XYDA 5FYXA 3O2PA 3TUYB 2COLB 2WC8A 3I5FB 3LK0A 4JQ0D 3KPXA 3TDUA 3GOFA 1SYMA 1BU3A 4MRYA 2RGIA 4CLNA 1KFUL 2LC5A 2Y4QA 4M2PA 3SJSA 1SY9A 1NP8A 4USLA 1FW4A 4MN0A 4PE7A 4YGDB 3DVKA 3AAKA 1IRJA 3BOWA 3I5IB 1YR5A 4WQ3A 2G9BA 2L50A 4PHMA 2JT8A 2NCOA 3RM1A 1DT7B 1F55A 3IQQA 1BMOA 1LINA 2KQYA 1PVBA 2O60A 1ZACA 1CM4A 2JT3A 4N5XA 5JOLA 1IQ3A 1NX1A 4OV2A 1QV0A 1OSAA 1AUIB 2ZNDA 1BT6A 3JVTC 2MAZA 2CT9A 1WDCB 1PALA 3LL8B 1S5GZ 3BOWB 3O78A 1DMOA 4OCIA 1L2OC 2I7AA 1NCXA 2JOJA 1S6JA 2FOTA 1KQMB 1W7JB 1XFVO 2L5XB 3TS5B 3VGOA 3EK4A 4A4BA 2M3WA 3O4YA 1K94A 1RECA 4DRWA 1J1DA 1NWDA 2LM5A 1H4BA 5HLOA 3SIAA 4QJ5B 1OZOA 2BCAA 3CR4X 1UHJA 1IG5A 3C1VA 3CWGA 2PALA 5BPJA 1AJ4A 3ZNIA 1WRZA 1V1FA 1J7QA 1OZSA 1QVIZ 4QJ4B 1SKTA 4OR9B 2EGDA 2MRDA 2Y5IA 4NDBA 2O5GA 2V53A 2WCFA 3AKBA 4YI9A 2K61A 2ZFDA 2LP3A 4XYNA 3CGAA 3O6BA 5K89A 3OX6A 1B8CA 1SBJA 2ZNEA 1ZUZA 1NSHA 1F4OA 5HKYA 1SNLA 1LA3A 1TNXA 2PVBA 1WDCC 1SK6D 1PK0D 1GGWA 5HYDA 1OMRA 1BLQA 1JBAA 2WCEA 3OB1B 2FJUB 3TS5C 2ISDA 3I5HB 2KFFA 3QRXA 1B7TY 1DJGA 4MRXA 1DGUA 1HQVA 2KBMA 4YGEB 4D1EA 1AK8A 1KK8C 4FTGA 1H8BA 1KFUS 1AHRA 2LCPA 4AOMA 1S26D 1IQ5A 4GAOA 2L51A 4I5NB 3FWCA 2K7DA 3WHTB 1NX0A 2EC6B 5KTYA 1QS7A 2Q4UA 2M8UA 2KAXA 3DF0A 5HLVA 3M0WA 5KSZA 3JTDB 2F2PA 2KI6C 3NSKA 2D8NA 1MF8B 4YGAA 1K9KA 1SRAA 2JT0A 1K8UA 2BBMA 4GBAA 1PRWA 4CIDA 1CKKA 1CFFA 1DVIA 1EG3A 1J55A 3DVEA 2M97A 1LKJA 1J7OA 1YX8A 1CMGA 2MA2A 2B1UA 1B47A 4ORAB 2WOSA 2A4JA 1IKUA 3AKAA 1MXLC 2JC2A 1QASA 1XFXO 2MLEC 2SCPA 3DF0B 1C7WA 1J1EA 1QIVA 1NX3A 1IJ5A 3BXKA 3H4SE 5CSNA 1G33A 1YUSA 2EC6C 4I5JA 1QIWA 1G8IA 2BKIB 1Y1XA 1CB1A 1B4CA 2Y1MA 2H2KA 1FI6A 1OE9B 5TNCA 1KSOA 4GGFA 2HPSA 1KCYA 2AUCA 1XK4C 1K9PA 5CPVA 1EL4A 1LA0A 3JVTB 2I94A 4YI8A 2PRUA 2F8PA 3IQOA 1L2OB 3FIAA 3NSLA 4NDCA 1CFPA 4FQOA 2F3ZA 1JSAA 1NIWA 1A4PA 2BL0B 2KFHA 1F54A 2H61C 2FCDA 3LK1A 1WRKA 1QX7A 5KU1A 2BE6A 1ZFSA 2K0JA 1QVIY 1MWNA 4MZJA 1K9UA 3BQ3A 4PHJA 2MLFC 1M63B 1UURA 2CNPA 3EKJA 1OMVA 1TNQA 3CLNA 4P2YB 2P6BB 1BF5A 2MJWB 1A03A 4WQ2A 1TCOB 3OP0A 1A29A 4GNKB 2M7NA 4WRIA 5AXIA 1QLSA 2K2AA 3EK7A 1BODA 1MQ1A 2L4HA 5ER4X 2SASA 3CTNA 2ZN8A 5CSFA 4L9MA 1MUXA 3TDZA 1XO5A 2OPOA 2KBIA 1G4YR 1DJYA 1NCYA 3A8RA 2BL0C 1TN4A 4MSPA 1QATA 1DJXA 1RJVA 2E30A 3EVVA 3K21A 4QJ3B 2JNFA 4MLWA 1XFUO 1R2UA 2LVIA 3VRPA 1Y1UA 4GGFC 1KK8B 4NDDA 2MBXA 3VRQA 1UP5A 3CR2A 2LP2A 1SCVA 3KF9A 2Q91A 1LVCD 1YRUB 2K7BA 2LMUA 2L0PA 1BJFA 3VRNA 1RROA 5IBWA 2PSRA 4PALA 1K96A 3NSIA 1ALWA 3SG7A 4CFQA 1YVLA 2BBNA 1OMDA 2AMIA 2LE9B 2HETA 4HRHA 4HRGA 1B1GA 4YGCB 2KI6D 1SMGA 3RLZA 4BY5A 1F4QA 2TN4A 1N2DA 2F2OA 1K95A 4ORBB 2CCMA 4HREE 1AP4A 1CLMA 3PFVA 1CDMA 1KFXL 1XK4A 4UPGA 1QJTA 4GPLB 2M0RA 2E6WA 1OOJA 1CM1A 1Y1AA 1S6IA 5DKQA 1B9AA 1PSBA 2HQWA 1WLMA 3TDIA 1Q80A 3F45A 2JTTA 2KSPA 3LLEA 5CSJA 1EH2A 2H61A 1F70A 2HQ8A 2KQ6A 2LUXA 4I5KA 2M1KB 1MR8A 5PALA 1CDLA 2GV5A 1EG4A 2KFGA 1M45A 4PHKA 2JWWA 2LLUA 1QX2A 2LAPA 2PMYA 2GGMA 2KNEA 1JF2A 1QLKA 3HX4A 2ZKMX 4N1GA 4NQGA 1TOPA 1DTLA 1R6PA 1J7PA 2G2BA 4OKHA 4ETOA 1NPQA 1PULA 2NZ0A 5HKZA 4PDZA 4BY4A 4DCKA 1A2XA 2KYCA 2KYFA 4HSZA 1RTP1 1CFCA 2LLTA 4R1EA 1XFZO 2LV7A 4N1FA 1UHIA 1KQVA 2WORA 3PN7B 4GUKA 1JWDA 2JNXA 1JFKA 2LHIA 1B8LA 2PASA 1D1OA 1QTXA 1FI5A 1SL8A 1TIZA 1KWOC 2LVJA 3BUXB 3PLFB 3CZTX 4M2OA 4MZLA 1WY9A 1TRFA 3BUMB 3FWBA 5D69A 1DJHA 2BCXA 1S1EA
chains in the Genus database with same CATH superfamily
2VRGA 2OTGC 4MBEA 3TZ1A 4GGNA 1NUBA 3EVUA 3FE8A 5I94A 5HKWA 1S5GY 4ICBA 4Q04A 1BOCA 1B7TZ 2KPHA 3EK8A 1UWOA 1RK9A 2M1UA 2LMTA 4ZCVA 1MXEA 1NYAA 1IGVA 1OOIX 3D73A 2NXQA 3SG6A 4YRUA 1OW4A 1MHOA 2LVKA 1XFYO 2LHLA 1NX2A 2JQ6A 2LMVA 5AANA 4PE4A 2KAVA 1FPWA 4IJ7A 1SCMC 3R72A 4C0LA 1S36A 3D74A 1JC2A 5F6TA 1C07A 4F7FA 1KFXS 5ER5A 1SR6C 1YURA 1TNWA 3PN7C 4IL1A 3CZ2A 4CFRA 1M31A 1DELA 2WNDA 2IS9A 1DJWA 3GK2A 1CLLA 2KI4B 2GGZA 5I2QA 2LVVA 4P5OE 2QEBA 1UUSA 3I5GB 1YVHA 4DS7A 2CTNA 3GK4X 4XJKB 1QWVA 2CXJA 1GGZA 1OOFA 4MEWA 3SG4A 2QEHA 1J7RA 2KOTA 5DKNA 5B8IB 1QX5B 4DIRA 1YTZC 1YRTB 1XFWO 2JU0A 3BUWB 1F71A 1UHNA 2QACA 2KGRA 1WLZA 3UNWA 2BE4A 4M2QA 1KK7Z 1QV1A 1M39A 2H8VA 2ZRSA 3E3RA 4OVNF 3A4UB 1ALVA 1UHKA 3OHMB 2JZIA 1CTRA 5JJGA 1U5IA 1FBVA 2JULA 2OS8C 3GK1A 3WHUB 1BG1A 4U8DA 4A4CA 5I2OA 5J3XA 3WNXB 4JKTA 3SG5A 1JF0A 1BR1B 3SG3A 4DUQA 1WRLA 1CDPA 2JXLA 1K93D 1CLBA 2F3YA 1K90D 4MZKA 2WCBA 4ZCUA 3AAJA 2JTZA 3LCPC 3PALA 1GJYA 3SG2A 2KI4C 1ORGA 3EVRA 4PE1A 1XVJA 3I5FC 2NLNA 1LXFC 4JD9A 3TUYC 1FF1A 2JPTA 3I5GC 2K8MB 4F0ZB 2R2IA 5D7FA 1P28A 3D77A 5I2LA 2K7OA 5AEQA 1IWQA 2BCBA 3EKHA 1U5IB 1EJ3A 1N0YA 1S3PA 1CNPA 1JFJA 2K7CA 3IVTA 3BUOB 2NCPA 3CR5X 1DF0A 2DOQA 2HF5A 2KHNA 1OOHA 1AJ5A 2WCKA 1CMFA 3I5IC 1E8AA 3ICBA 5I8NA 1DJZA 1X02A 5AERA 2KDHA 2JRFA 1OQPA 1XA5A 3DD4A 4C0JA 2L4IA 4YGBB 2PQLA 3L47A 1F8HA 1DJIA 2M29A 2M9GA 3WXAA 2QEVA 1Y0VH 1KSMA 1SPYA 2KAYA 3PSRA 4PE0A 3PATA 1ODBA 2MHHA 1KWOB 1DGVA 2K60A 1DF0B 2LLSA 3NHTA 4JPZB 3S0EA 3VRRA 4AQJA 2JXCA 1B8RA 4TNCA 2I2RE 3DVMA 2ZRTA 2GTEA 3KO0A 2F33A 1VRKA 2OTGB 3MSEB 1C7VA 1KQMC 1K2HA 1YUTA 4YBHB 1BR4B 1M46A 2CBLA 3PM8A 3ZWHA 2QDIA 2KGBC 5GQQC 1CDNA 1YX7A 1SW8A 4PCWA 1ZOTB 2WCLA 4INXA 2QPTA 2Y1NA 2L2EA 3OB2B 1OOGA 2ZN9A 5G08A 1A75A 1JUOA 2P71A 1TTXA 1SCMB 3D0YA 3KHEA 3OX5A 4OZDA 5DKRA 3D10A 2L98A 4CPVA 1SR6B 1YUUA 4PHNA 2I18A 3NXAA 3VROA 4AQIA 3S0AA 4FQTA 1QXPA 4JWQA 1W7IB 2FCEA 3BUNB 3R1PA 5CSIA 3FS7A 3HCMA 1AVSA 4MVFA 3V2LA 1T14A 3IF7A 1IH0A 3KEVA 3DVJA 2LUCA 2BECA 1A75B 2BKHB 4E68A 1Z4HA 1S6CA 1PVAA 3I5HC 1PSRA 1RFJA 3BYAA 3D0YB 3NSOA 4C0KA 2M7LA 1SL7A 4I5LB 5AFPA 2M49B 2LANA 2LNKA 2L2CA 2QEOA 1KK7Y 2K2FA 1TNPA 1IJ6A 1L7ZA 3L4LA 1HT9A 1V1GA 1EXRA 1N65A 1CFDA 2OS8B 2AAOA 3CS1A 4XJKA 1Y6WA 2PYQA 3BFHA 1NCZA 2EHBA 1GQMA 1ZMZA 1SL9A 4GFTA 1RWYA 4ORCB 3JTDC 3SIBA 3VB1A 1TCFA 1UHHA 5FI7A 1XYDA 5FYXA 3O2PA 3TUYB 2COLB 2WC8A 3I5FB 3LK0A 5D3OA 4JQ0D 3KPXA 3TDUA 3CABA 3GOFA 1SYMA 1BU3A 4MRYA 2RGIA 4CLNA 1KFUL 2LC5A 2Y4QA 4M2PA 3SJSA 1SY9A 4KYNA 1NP8A 3R1VA 4USLA 3SS5A 1FW4A 4MN0A 4PE7A 4YGDB 3DVKA 3AAKA 1IRJA 3BOWA 3I5IB 1YR5A 4WQ3A 2G9BA 2L50A 4PHMA 2JT8A 5EL2A 2NCOA 3RM1A 1DT7B 1F55A 3IQQA 1BMOA 1LINA 2KQYA 1PVBA 3DZTA 2O60A 1ZACA 1CM4A 2JT3A 4N5XA 4PT1A 5JOLA 1NX1A 1IQ3A 3B86A 4OV2A 1QV0A 1C3ZA 1AUIB 1OSAA 2ZNDA 1BT6A 3JVTC 2MAZA 2CT9A 3QMEA 3CDNA 1WDCB 1PALA 3LL8B 1S5GZ 3BOWB 3O78A 1DMOA 1IIOA 4OCIA 1L2OC 2I7AA 1NCXA 2JOJA 1S6JA 2FOTA 1KQMB 1W7JB 1XFVO 2L5XB 5DICA 3TS5B 3EK4A 3VGOA 2M3WA 4A4BA 3O4YA 1K94A 1RECA 4DRWA 1J1DA 1NWDA 2LM5A 1H4BA 1SSEB 5HLOA 3SIAA 4QJ5B 1OZOA 1W9ZA 2BCAA 3CR4X 1UHJA 1IG5A 3C1VA 3CWGA 2PALA 5HL1A 5BPJA 3CYZA 1AJ4A 2WCJA 1TWOA 3ZNIA 1WRZA 1V1FA 1J7QA 1OZSA 1QVIZ 4QJ4B 1SKTA 4OR9B 3NHIA 2EGDA 2MRDA 2Y5IA 4NDBA 2O5GA 2V53A 2WCFA 3AKBA 4YI9A 2K61A 2ZFDA 2LP3A 4XYNA 3CGAA 3O6BA 5K89A 3OX6A 1B8CA 1SBJA 2ZNEA 1ZUZA 1NSHA 1F4OA 5HKYA 1SNLA 1LA3A 1TNXA 2PVBA 1WDCC 1SK6D 1PK0D 1GGWA 5HYDA 1OMRA 1BLQA 3OBVA 1JBAA 2WCEA 3OB1B 2FJUB 3TS5C 3FE9A 2ISDA 3I5HB 2KFFA 3RZSA 3QRXA 3BFBA 1B7TY 1DJGA 4MRXA 2ERBA 1DGUA 1HQVA 2KBMA 2KLEA 4YGEB 4D1EA 1AK8A 3CZ0A 1KK8C 4FTGA 1H8BA 1KFUS 1AHRA 2LCPA 2YGUA 1S26D 1IQ5A 4AOMA 4GAOA 2L51A 4I5NB 3FWCA 2K7DA 3WHTB 1NX0A 2EC6B 5KTYA 1GM0A 1QS7A 2Q4UA 2JPOA 2M8UA 3SS4A 2KAXA 3DF0A 5HLVA 5FI2A 3M0WA 5KSZA 3JTDB 2F2PA 2BNXA 2KI6C 3NGVA 3NSKA 2D8NA 1MF8B 4YGAA 1K9KA 1SRAA 2JT0A 3B88A 1K8UA 2BBMA 4GBAA 1PRWA 4CIDA 1CKKA 1CFFA 1DVIA 1EG3A 1J55A 3DVEA 2M97A 1LKJA 1J7OA 1YX8A 1CMGA 2MA2A 2B1UA 3DXLA 1B47A 4ORAB 2WOSA 2A4JA 1IKUA 3AKAA 1MXLC 2JC2A 1QASA 1XFXO 2MLEC 2SCPA 3DF0B 3EG5B 3L4AA 3B6XA 1C7WA 3DYEA 1J1EA 1QIVA 3S0FA 1NX3A 1IJ5A 3BXKA 3H4SE 5CSNA 1G33A 1YUSA 2EC6C 4I5JA 1QIWA 1G8IA 2BKIB 1Y1XA 1CB1A 1B4CA 2Y1MA 2H2KA 1FI6A 1OE9B 5TNCA 1KSOA 4GGFA 2HPSA 1KCYA 2AUCA 1XK4C 3DY9A 1K9PA 3B87A 5CPVA 1EL4A 2P70A 1LA0A 3JVTB 2I94A 4YI8A 3O4XA 2PRUA 1LS8A 2F8PA 3IQOA 1L2OB 3FIAA 3NSLA 4NDCA 1CFPA 4FQOA 2F3ZA 1JSAA 1NIWA 1A4PA 2BL0B 2KFHA 3OGNA 1F54A 2H61C 2FCDA 3LK1A 1WRKA 1QX7A 5KU1A 1Z2CB 2BE6A 1ZFSA 3Q8IA 2K0JA 1QVIY 1MWNA 4MZJA 1K9UA 3BQ3A 4PHJA 2MLFC 1M63B 1UURA 2CNPA 3EKJA 1OMVA 1TNQA 3CLNA 4P2YB 2P6BB 3BJHA 1BF5A 2MJWB 3D76A 1A03A 3UO9A 4WQ2A 1TCOB 3OP0A 1A29A 2BAPA 4GNKB 2M7NA 4WRIA 3K1EA 1QLSA 2K2AA 3EK7A 5AXIA 1BODA 1MQ1A 2L4HA 5ER4X 3N7HA 2SASA 1DC1A 3CTNA 2ZN8A 2WCMA 3D75A 3B7AA 5CSFA 4L9MA 1MUXA 3TDZA 1XO5A 2OPOA 2KBIA 3CZ1A 1G4YR 1DJYA 1NCYA 3A8RA 2BL0C 1TN4A 4MSPA 1QATA 1DJXA 1RJVA 2E30A 3EVVA 3K21A 4QJ3B 2JNFA 4MLWA 1XFUO 1R2UA 2LVIA 3VRPA 1XFRA 1Y1UA 1KK8B 4GGFC 4NDDA 2FJYA 2MBXA 3VRQA 1UP5A 3CR2A 2LP2A 1SCVA 3KF9A 2Q91A 1LVCD 1DEKA 1TUZA 1YRUB 2K7BA 2LMUA 2L0PA 1BJFA 3VRNA 1RROA 5IBWA 1C3YA 2PSRA 4PALA 1K96A 3NSIA 1ALWA 3SG7A 4CFQA 1YVLA 2BBNA 3PJIA 1OMDA 2AMIA 2LE9B 2HETA 4HRHA 4HRGA 1B1GA 4YGCB 2KI6D 1SMGA 3RLZA 4BY5A 1F4QA 2TN4A 1N2DA 2F2OA 1K95A 4ORBB 2CCMA 4HREE 1AP4A 1CLMA 3FE6A 3PFVA 1CDMA 1KFXL 3BFAA 3PM2A 1XK4A 4UPGA 1QJTA 4GPLB 2M0RA 2E6WA 1TUJA 1OOJA 1CM1A 2WC6A 1Y1AA 3S0BA 1S6IA 5DKQA 1B9AA 1PSBA 2WCHA 2HQWA 1WLMA 3TDIA 1Q80A 3F45A 2JTTA 2KSPA 3LLEA 5CSJA 1EH2A 2H61A 1F70A 2HQ8A 2KQ6A 2LUXA 4I5KA 2M1KB 1MR8A 5PALA 1CDLA 2GV5A 1EG4A 2KFGA 1M45A 4PHKA 2JWWA 2LLUA 1QX2A 2LAPA 3SS3A 2PMYA 2GGMA 2KNEA 4INWA 1JF2A 1QLKA 3D78A 3HX4A 2KLDA 2ZKMX 4N1GA 4NQGA 1TOPA 1DTLA 1R6PA 1J7PA 2G2BA 4OKHA 4ETOA 1NPQA 1PULA 2NZ0A 5HKZA 2L5YA 4PDZA 3R1OA 4BY4A 4DCKA 1A2XA 2KYCA 2KYFA 4HSZA 1RTP1 1CFCA 2LLTA 4R1EA 1XFZO 2WC5A 5FI6A 2LV7A 4N1FA 1UHIA 1KQVA 2WORA 3PN7B 4GUKA 1JWDA 2JNXA 1JFKA 2LHIA 1B8LA 2PASA 1D1OA 1QTXA 1FI5A 1SL8A 1TIZA 1KWOC 2LVJA 1DQEA 3BUXB 3CZTX 3PLFB 4M2OA 1WY9A 4MZLA 3S0GA 1TRFA 3BUMB 3FWBA 5D69A 1DJHA 2BCXA 1S1EA 3S0DA
chains in the Genus database with same CATH topology
2VRGA 2OTGC 4MBEA 3TZ1A 4GGNA 1NUBA 3EVUA 5HKWA 1S5GY 4ICBA 4Q04A 1BOCA 1B7TZ 3EK8A 1UWOA 1RK9A 2M1UA 2LMTA 4ZCVA 1MXEA 1NYAA 1IGVA 2NXQA 3SG6A 4YRUA 1MHOA 2LVKA 1XFYO 2LHLA 1NX2A 2JQ6A 2LMVA 5AANA 4PE4A 2KAVA 1FPWA 1SCMC 4C0LA 1S36A 1JC2A 5F6TA 1C07A 1KFXS 5ER5A 1SR6C 1YURA 1TNWA 3PN7C 4IL1A 4CFRA 1M31A 2WNDA 2IS9A 1DJWA 3GK2A 1CLLA 2KI4B 2GGZA 5I2QA 2LVVA 4P5OE 1UUSA 3I5GB 1YVHA 4DS7A 2CTNA 3GK4X 4XJKB 2CXJA 1GGZA 4MEWA 3SG4A 1J7RA 2KOTA 5DKNA 5B8IB 1QX5B 4DIRA 1YTZC 1YRTB 1XFWO 2JU0A 3BUWB 1F71A 1UHNA 2QACA 2KGRA 1WLZA 2BE4A 4M2QA 1KK7Z 1QV1A 1M39A 2ZRSA 3E3RA 4OVNF 3A4UB 1ALVA 1UHKA 3OHMB 2JZIA 1CTRA 5JJGA 1U5IA 1FBVA 2JULA 2OS8C 3GK1A 3WHUB 1BG1A 4U8DA 4A4CA 5I2OA 5J3XA 3WNXB 3SG5A 1JF0A 1BR1B 3SG3A 4DUQA 1WRLA 1CDPA 2JXLA 1K93D 1CLBA 2F3YA 1K90D 4MZKA 2WCBA 4ZCUA 3AAJA 2JTZA 3LCPC 3PALA 1GJYA 3SG2A 2KI4C 3EVRA 3TUYC 4PE1A 1XVJA 3I5FC 2NLNA 1LXFC 1FF1A 2JPTA 3I5GC 2K8MB 4F0ZB 2R2IA 5D7FA 5I2LA 2K7OA 5AEQA 2BCBA 1IWQA 3EKHA 1U5IB 1EJ3A 1N0YA 1S3PA 1CNPA 1JFJA 2K7CA 3BUOB 2NCPA 3CR5X 1DF0A 2DOQA 2HF5A 2KHNA 1AJ5A 1CMFA 3I5IC 1E8AA 3ICBA 5I8NA 1DJZA 1X02A 5AERA 2KDHA 2JRFA 1OQPA 1XA5A 3DD4A 4C0JA 2L4IA 4YGBB 1F8HA 1DJIA 2M29A 2M9GA 3WXAA 1Y0VH 1KSMA 1SPYA 2KAYA 3PSRA 4PE0A 3PATA 1ODBA 2MHHA 1KWOB 1DGVA 4JPZB 1DF0B 2LLSA 3VRRA 4AQJA 2JXCA 1B8RA 4TNCA 2I2RE 3DVMA 2ZRTA 3KO0A 2F33A 1VRKA 2OTGB 3MSEB 1C7VA 1KQMC 1K2HA 1YUTA 4YBHB 1BR4B 1M46A 2CBLA 3PM8A 3ZWHA 5GQQC 2KGBC 1CDNA 1YX7A 1SW8A 4PCWA 1ZOTB 2QPTA 2Y1NA 2L2EA 3OB2B 2ZN9A 5G08A 1A75A 1JUOA 1TTXA 1SCMB 3D0YA 3KHEA 3OX5A 5DKRA 3D10A 2L98A 4CPVA 1SR6B 1YUUA 4PHNA 2I18A 3NXAA 3VROA 4AQIA 1QXPA 4JWQA 1W7IB 2FCEA 3BUNB 5CSIA 3FS7A 3HCMA 1AVSA 4MVFA 3IF7A 1IH0A 3KEVA 3DVJA 2LUCA 2BECA 1A75B 2BKHB 4E68A 1S6CA 1PVAA 3I5HC 1PSRA 1RFJA 3BYAA 3D0YB 3NSOA 4C0KA 2M7LA 1SL7A 4I5LB 5AFPA 2M49B 2LANA 2LNKA 1KK7Y 2K2FA 1TNPA 1IJ6A 1L7ZA 1HT9A 1V1GA 1EXRA 1N65A 1CFDA 2OS8B 2AAOA 3CS1A 4XJKA 1Y6WA 1NCZA 2EHBA 1GQMA 1ZMZA 1SL9A 4GFTA 1RWYA 4ORCB 3JTDC 3SIBA 1TCFA 1UHHA 1XYDA 5FYXA 3O2PA 3TUYB 2COLB 2WC8A 3I5FB 3LK0A 4JQ0D 3KPXA 3TDUA 3GOFA 1SYMA 1BU3A 4MRYA 2RGIA 4CLNA 1KFUL 2LC5A 2Y4QA 4M2PA 3SJSA 1SY9A 1NP8A 4USLA 1FW4A 4MN0A 4PE7A 4YGDB 3DVKA 3AAKA 1IRJA 3BOWA 3I5IB 1YR5A 4WQ3A 2G9BA 2L50A 4PHMA 2JT8A 2NCOA 3RM1A 1DT7B 1F55A 3IQQA 1BMOA 1LINA 2KQYA 1PVBA 2O60A 1ZACA 1CM4A 2JT3A 4N5XA 5JOLA 1IQ3A 1NX1A 4OV2A 1QV0A 1OSAA 1AUIB 2ZNDA 1BT6A 3JVTC 2MAZA 2CT9A 1WDCB 1PALA 3LL8B 1S5GZ 3BOWB 3O78A 1DMOA 4OCIA 1L2OC 2I7AA 1NCXA 2JOJA 1S6JA 2FOTA 1KQMB 1W7JB 1XFVO 2L5XB 3TS5B 3VGOA 3EK4A 4A4BA 2M3WA 3O4YA 1K94A 1RECA 4DRWA 1J1DA 1NWDA 2LM5A 1H4BA 5HLOA 3SIAA 4QJ5B 1OZOA 2BCAA 3CR4X 1UHJA 1IG5A 3C1VA 3CWGA 2PALA 5BPJA 1AJ4A 3ZNIA 1WRZA 1V1FA 1J7QA 1OZSA 1QVIZ 4QJ4B 1SKTA 4OR9B 2EGDA 2MRDA 2Y5IA 4NDBA 2O5GA 2V53A 2WCFA 3AKBA 4YI9A 2K61A 2ZFDA 2LP3A 4XYNA 3CGAA 3O6BA 5K89A 3OX6A 1B8CA 1SBJA 2ZNEA 1ZUZA 1NSHA 1F4OA 5HKYA 1SNLA 1LA3A 1TNXA 2PVBA 1WDCC 1SK6D 1PK0D 1GGWA 5HYDA 1OMRA 1BLQA 1JBAA 2WCEA 3OB1B 2FJUB 3TS5C 2ISDA 3I5HB 2KFFA 3QRXA 1B7TY 1DJGA 4MRXA 1DGUA 1HQVA 2KBMA 4YGEB 4D1EA 1AK8A 1KK8C 4FTGA 1H8BA 1KFUS 1AHRA 2LCPA 4AOMA 1S26D 1IQ5A 4GAOA 2L51A 4I5NB 3FWCA 2K7DA 3WHTB 1NX0A 2EC6B 5KTYA 1QS7A 2Q4UA 2M8UA 2KAXA 3DF0A 5HLVA 3M0WA 5KSZA 3JTDB 2F2PA 2KI6C 3NSKA 2D8NA 1MF8B 4YGAA 1K9KA 1SRAA 2JT0A 1K8UA 2BBMA 4GBAA 1PRWA 4CIDA 1CKKA 1CFFA 1DVIA 1EG3A 1J55A 3DVEA 2M97A 1LKJA 1J7OA 1YX8A 1CMGA 2MA2A 2B1UA 1B47A 4ORAB 2WOSA 2A4JA 1IKUA 3AKAA 1MXLC 2JC2A 1QASA 1XFXO 2MLEC 2SCPA 3DF0B 1C7WA 1J1EA 1QIVA 1NX3A 1IJ5A 3BXKA 3H4SE 5CSNA 1G33A 1YUSA 2EC6C 4I5JA 1QIWA 1G8IA 2BKIB 1Y1XA 1CB1A 1B4CA 2Y1MA 2H2KA 1FI6A 1OE9B 5TNCA 1KSOA 4GGFA 2HPSA 1KCYA 2AUCA 1XK4C 1K9PA 5CPVA 1EL4A 1LA0A 3JVTB 2I94A 4YI8A 2PRUA 2F8PA 3IQOA 1L2OB 3FIAA 3NSLA 4NDCA 1CFPA 4FQOA 2F3ZA 1JSAA 1NIWA 1A4PA 2BL0B 2KFHA 1F54A 2H61C 2FCDA 3LK1A 1WRKA 1QX7A 5KU1A 2BE6A 1ZFSA 2K0JA 1QVIY 1MWNA 4MZJA 1K9UA 3BQ3A 4PHJA 2MLFC 1M63B 1UURA 2CNPA 3EKJA 1OMVA 1TNQA 3CLNA 4P2YB 2P6BB 1BF5A 2MJWB 1A03A 4WQ2A 1TCOB 3OP0A 1A29A 4GNKB 2M7NA 4WRIA 5AXIA 1QLSA 2K2AA 3EK7A 1BODA 1MQ1A 2L4HA 5ER4X 2SASA 3CTNA 2ZN8A 5CSFA 4L9MA 1MUXA 3TDZA 1XO5A 2OPOA 2KBIA 1G4YR 1DJYA 1NCYA 3A8RA 2BL0C 1TN4A 4MSPA 1QATA 1DJXA 1RJVA 2E30A 3EVVA 3K21A 4QJ3B 2JNFA 4MLWA 1XFUO 1R2UA 2LVIA 3VRPA 1Y1UA 4GGFC 1KK8B 4NDDA 2MBXA 3VRQA 1UP5A 3CR2A 2LP2A 1SCVA 3KF9A 2Q91A 1LVCD 1YRUB 2K7BA 2LMUA 2L0PA 1BJFA 3VRNA 1RROA 5IBWA 2PSRA 4PALA 1K96A 3NSIA 1ALWA 3SG7A 4CFQA 1YVLA 2BBNA 1OMDA 2AMIA 2LE9B 2HETA 4HRHA 4HRGA 1B1GA 4YGCB 2KI6D 1SMGA 3RLZA 4BY5A 1F4QA 2TN4A 1N2DA 2F2OA 1K95A 4ORBB 2CCMA 4HREE 1AP4A 1CLMA 3PFVA 1CDMA 1KFXL 1XK4A 4UPGA 1QJTA 4GPLB 2M0RA 2E6WA 1OOJA 1CM1A 1Y1AA 1S6IA 5DKQA 1B9AA 1PSBA 2HQWA 1WLMA 3TDIA 1Q80A 3F45A 2JTTA 2KSPA 3LLEA 5CSJA 1EH2A 2H61A 1F70A 2HQ8A 2KQ6A 2LUXA 4I5KA 2M1KB 1MR8A 5PALA 1CDLA 2GV5A 1EG4A 2KFGA 1M45A 4PHKA 2JWWA 2LLUA 1QX2A 2LAPA 2PMYA 2GGMA 2KNEA 1JF2A 1QLKA 3HX4A 2ZKMX 4N1GA 4NQGA 1TOPA 1DTLA 1R6PA 1J7PA 2G2BA 4OKHA 4ETOA 1NPQA 1PULA 2NZ0A 5HKZA 4PDZA 4BY4A 4DCKA 1A2XA 2KYCA 2KYFA 4HSZA 1RTP1 1CFCA 2LLTA 4R1EA 1XFZO 2LV7A 4N1FA 1UHIA 1KQVA 2WORA 3PN7B 4GUKA 1JWDA 2JNXA 1JFKA 2LHIA 1B8LA 2PASA 1D1OA 1QTXA 1FI5A 1SL8A 1TIZA 1KWOC 2LVJA 3BUXB 3PLFB 3CZTX 4M2OA 4MZLA 1WY9A 1TRFA 3BUMB 3FWBA 5D69A 1DJHA 2BCXA 1S1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRG A;  2OTG C;  4MBE A;  3TZ1 A;  4GGN A;  1NUB A;  3EVU A;  5HKW A;  1S5G Y;  4ICB A;  4Q04 A;  1BOC A;  1B7T Z;  3EK8 A;  1UWO A;  1RK9 A;  2M1U A;  2LMT A;  4ZCV A;  1MXE A;  1NYA A;  1IGV A;  2NXQ A;  3SG6 A;  4YRU A;  1MHO A;  2LVK A;  1XFY O;  2LHL A;  1NX2 A;  2JQ6 A;  2LMV A;  5AAN A;  4PE4 A;  2KAV A;  1FPW A;  1SCM C;  4C0L A;  1S36 A;  1JC2 A;  5F6T A;  1C07 A;  1KFX S;  5ER5 A;  1SR6 C;  1YUR A;  1TNW A;  3PN7 C;  4IL1 A;  4CFR A;  1M31 A;  2WND A;  2IS9 A;  1DJW A;  3GK2 A;  1CLL A;  2KI4 B;  2GGZ A;  5I2Q A;  2LVV A;  4P5O E;  1UUS A;  3I5G B;  1YVH A;  4DS7 A;  2CTN A;  3GK4 X;  4XJK B;  2CXJ A;  1GGZ A;  4MEW A;  3SG4 A;  1J7R A;  2KOT A;  5DKN A;  5B8I B;  1QX5 B;  4DIR A;  1YTZ C;  1YRT B;  1XFW O;  2JU0 A;  3BUW B;  1F71 A;  1UHN A;  2QAC A;  2KGR A;  1WLZ A;  2BE4 A;  4M2Q A;  1KK7 Z;  1QV1 A;  1M39 A;  2ZRS A;  3E3R A;  4OVN F;  3A4U B;  1ALV A;  1UHK A;  3OHM B;  2JZI A;  1CTR A;  5JJG A;  1U5I A;  1FBV A;  2JUL A;  2OS8 C;  3GK1 A;  3WHU B;  1BG1 A;  4U8D A;  4A4C A;  5I2O A;  5J3X A;  3WNX B;  3SG5 A;  1JF0 A;  1BR1 B;  3SG3 A;  4DUQ A;  1WRL A;  1CDP A;  2JXL A;  1K93 D;  1CLB A;  2F3Y A;  1K90 D;  4MZK A;  2WCB A;  4ZCU A;  3AAJ A;  2JTZ A;  3LCP C;  3PAL A;  1GJY A;  3SG2 A;  2KI4 C;  3EVR A;  3TUY C;  4PE1 A;  1XVJ A;  3I5F C;  2NLN A;  1LXF C;  1FF1 A;  2JPT A;  3I5G C;  2K8M B;  4F0Z B;  2R2I A;  5D7F A;  5I2L A;  2K7O A;  5AEQ A;  2BCB A;  1IWQ A;  3EKH A;  1U5I B;  1EJ3 A;  1N0Y A;  1S3P A;  1CNP A;  1JFJ A;  2K7C A;  3BUO B;  2NCP A;  3CR5 X;  1DF0 A;  2DOQ A;  2HF5 A;  2KHN A;  1AJ5 A;  1CMF A;  3I5I C;  1E8A A;  3ICB A;  5I8N A;  1DJZ A;  1X02 A;  5AER A;  2KDH A;  2JRF A;  1OQP A;  1XA5 A;  3DD4 A;  4C0J A;  2L4I A;  4YGB B;  1F8H A;  1DJI A;  2M29 A;  2M9G A;  3WXA A;  1Y0V H;  1KSM A;  1SPY A;  2KAY A;  3PSR A;  4PE0 A;  3PAT A;  1ODB A;  2MHH A;  1KWO B;  1DGV A;  4JPZ B;  1DF0 B;  2LLS A;  3VRR A;  4AQJ A;  2JXC A;  1B8R A;  4TNC A;  2I2R E;  3DVM A;  2ZRT A;  3KO0 A;  2F33 A;  1VRK A;  2OTG B;  3MSE B;  1C7V A;  1KQM C;  1K2H A;  1YUT A;  4YBH B;  1BR4 B;  1M46 A;  2CBL A;  3PM8 A;  3ZWH A;  5GQQ C;  2KGB C;  1CDN A;  1YX7 A;  1SW8 A;  4PCW A;  1ZOT B;  2QPT A;  2Y1N A;  2L2E A;  3OB2 B;  2ZN9 A;  5G08 A;  1A75 A;  1JUO A;  1TTX A;  1SCM B;  3D0Y A;  3KHE A;  3OX5 A;  5DKR A;  3D10 A;  2L98 A;  4CPV A;  1SR6 B;  1YUU A;  4PHN A;  2I18 A;  3NXA A;  3VRO A;  4AQI A;  1QXP A;  4JWQ A;  1W7I B;  2FCE A;  3BUN B;  5CSI A;  3FS7 A;  3HCM A;  1AVS A;  4MVF A;  3IF7 A;  1IH0 A;  3KEV A;  3DVJ A;  2LUC A;  2BEC A;  1A75 B;  2BKH B;  4E68 A;  1S6C A;  1PVA A;  3I5H C;  1PSR A;  1RFJ A;  3BYA A;  3D0Y B;  3NSO A;  4C0K A;  2M7L A;  1SL7 A;  4I5L B;  5AFP A;  2M49 B;  2LAN A;  2LNK A;  1KK7 Y;  2K2F A;  1TNP A;  1IJ6 A;  1L7Z A;  1HT9 A;  1V1G A;  1EXR A;  1N65 A;  1CFD A;  2OS8 B;  2AAO A;  3CS1 A;  4XJK A;  1Y6W A;  1NCZ A;  2EHB A;  1GQM A;  1ZMZ A;  1SL9 A;  4GFT A;  1RWY A;  4ORC B;  3JTD C;  3SIB A;  1TCF A;  1UHH A;  1XYD A;  5FYX A;  3O2P A;  3TUY B;  2COL B;  2WC8 A;  3I5F B;  3LK0 A;  4JQ0 D;  3KPX A;  3TDU A;  3GOF A;  1SYM A;  1BU3 A;  4MRY A;  2RGI A;  4CLN A;  1KFU L;  2LC5 A;  2Y4Q A;  4M2P A;  3SJS A;  1SY9 A;  1NP8 A;  4USL A;  1FW4 A;  4MN0 A;  4PE7 A;  4YGD B;  3DVK A;  3AAK A;  1IRJ A;  3BOW A;  3I5I B;  1YR5 A;  4WQ3 A;  2G9B A;  2L50 A;  4PHM A;  2JT8 A;  2NCO A;  3RM1 A;  1DT7 B;  1F55 A;  3IQQ A;  1BMO A;  1LIN A;  2KQY A;  1PVB A;  2O60 A;  1ZAC A;  1CM4 A;  2JT3 A;  4N5X A;  5JOL A;  1IQ3 A;  1NX1 A;  4OV2 A;  1QV0 A;  1OSA A;  1AUI B;  2ZND A;  1BT6 A;  3JVT C;  2MAZ A;  2CT9 A;  1WDC B;  1PAL A;  3LL8 B;  1S5G Z;  3BOW B;  3O78 A;  1DMO A;  4OCI A;  1L2O C;  2I7A A;  1NCX A;  2JOJ A;  1S6J A;  2FOT A;  1KQM B;  1W7J B;  1XFV O;  2L5X B;  3TS5 B;  3VGO A;  3EK4 A;  4A4B A;  2M3W A;  3O4Y A;  1K94 A;  1REC A;  4DRW A;  1J1D A;  1NWD A;  2LM5 A;  1H4B A;  5HLO A;  3SIA A;  4QJ5 B;  1OZO A;  2BCA A;  3CR4 X;  1UHJ A;  1IG5 A;  3C1V A;  3CWG A;  2PAL A;  5BPJ A;  1AJ4 A;  3ZNI A;  1WRZ A;  1V1F A;  1J7Q A;  1OZS A;  1QVI Z;  4QJ4 B;  1SKT A;  4OR9 B;  2EGD A;  2MRD A;  2Y5I A;  4NDB A;  2O5G A;  2V53 A;  2WCF A;  3AKB A;  4YI9 A;  2K61 A;  2ZFD A;  2LP3 A;  4XYN A;  3CGA A;  3O6B A;  5K89 A;  3OX6 A;  1B8C A;  1SBJ A;  2ZNE A;  1ZUZ A;  1NSH A;  1F4O A;  5HKY A;  1SNL A;  1LA3 A;  1TNX A;  2PVB A;  1WDC C;  1SK6 D;  1PK0 D;  1GGW A;  5HYD A;  1OMR A;  1BLQ A;  1JBA A;  2WCE A;  3OB1 B;  2FJU B;  3TS5 C;  2ISD A;  3I5H B;  2KFF A;  3QRX A;  1B7T Y;  1DJG A;  4MRX A;  1DGU A;  1HQV A;  2KBM A;  4YGE B;  4D1E A;  1AK8 A;  1KK8 C;  4FTG A;  1H8B A;  1KFU S;  1AHR A;  2LCP A;  4AOM A;  1S26 D;  1IQ5 A;  4GAO A;  2L51 A;  4I5N B;  3FWC A;  2K7D A;  3WHT B;  1NX0 A;  2EC6 B;  5KTY A;  1QS7 A;  2Q4U A;  2M8U A;  2KAX A;  3DF0 A;  5HLV A;  3M0W A;  5KSZ A;  3JTD B;  2F2P A;  2KI6 C;  3NSK A;  2D8N A;  1MF8 B;  4YGA A;  1K9K A;  1SRA A;  2JT0 A;  1K8U A;  2BBM A;  4GBA A;  1PRW A;  4CID A;  1CKK A;  1CFF A;  1DVI A;  1EG3 A;  1J55 A;  3DVE A;  2M97 A;  1LKJ A;  1J7O A;  1YX8 A;  1CMG A;  2MA2 A;  2B1U A;  1B47 A;  4ORA B;  2WOS A;  2A4J A;  1IKU A;  3AKA A;  1MXL C;  2JC2 A;  1QAS A;  1XFX O;  2MLE C;  2SCP A;  3DF0 B;  1C7W A;  1J1E A;  1QIV A;  1NX3 A;  1IJ5 A;  3BXK A;  3H4S E;  5CSN A;  1G33 A;  1YUS A;  2EC6 C;  4I5J A;  1QIW A;  1G8I A;  2BKI B;  1Y1X A;  1CB1 A;  1B4C A;  2Y1M A;  2H2K A;  1FI6 A;  1OE9 B;  5TNC A;  1KSO A;  4GGF A;  2HPS A;  1KCY A;  2AUC A;  1XK4 C;  1K9P A;  5CPV A;  1EL4 A;  1LA0 A;  3JVT B;  2I94 A;  4YI8 A;  2PRU A;  2F8P A;  3IQO A;  1L2O B;  3FIA A;  3NSL A;  4NDC A;  1CFP A;  4FQO A;  2F3Z A;  1JSA A;  1NIW A;  1A4P A;  2BL0 B;  2KFH A;  1F54 A;  2H61 C;  2FCD A;  3LK1 A;  1WRK A;  1QX7 A;  5KU1 A;  2BE6 A;  1ZFS A;  2K0J A;  1QVI Y;  1MWN A;  4MZJ A;  1K9U A;  3BQ3 A;  4PHJ A;  2MLF C;  1M63 B;  1UUR A;  2CNP A;  3EKJ A;  1OMV A;  1TNQ A;  3CLN A;  4P2Y B;  2P6B B;  1BF5 A;  2MJW B;  1A03 A;  4WQ2 A;  1TCO B;  3OP0 A;  1A29 A;  4GNK B;  2M7N A;  4WRI A;  5AXI A;  1QLS A;  2K2A A;  3EK7 A;  1BOD A;  1MQ1 A;  2L4H A;  5ER4 X;  2SAS A;  3CTN A;  2ZN8 A;  5CSF A;  4L9M A;  1MUX A;  3TDZ A;  1XO5 A;  2OPO A;  2KBI A;  1G4Y R;  1DJY A;  1NCY A;  3A8R A;  2BL0 C;  1TN4 A;  4MSP A;  1QAT A;  1DJX A;  1RJV A;  2E30 A;  3EVV A;  3K21 A;  4QJ3 B;  2JNF A;  4MLW A;  1XFU O;  1R2U A;  2LVI A;  3VRP A;  1Y1U A;  4GGF C;  1KK8 B;  4NDD A;  2MBX A;  3VRQ A;  1UP5 A;  3CR2 A;  2LP2 A;  1SCV A;  3KF9 A;  2Q91 A;  1LVC D;  1YRU B;  2K7B A;  2LMU A;  2L0P A;  1BJF A;  3VRN A;  1RRO A;  5IBW A;  2PSR A;  4PAL A;  1K96 A;  3NSI A;  1ALW A;  3SG7 A;  4CFQ A;  1YVL A;  2BBN A;  1OMD A;  2AMI A;  2LE9 B;  2HET A;  4HRH A;  4HRG A;  1B1G A;  4YGC B;  2KI6 D;  1SMG A;  3RLZ A;  4BY5 A;  1F4Q A;  2TN4 A;  1N2D A;  2F2O A;  1K95 A;  4ORB B;  2CCM A;  4HRE E;  1AP4 A;  1CLM A;  3PFV A;  1CDM A;  1KFX L;  1XK4 A;  4UPG A;  1QJT A;  4GPL B;  2M0R A;  2E6W A;  1OOJ A;  1CM1 A;  1Y1A A;  1S6I A;  5DKQ A;  1B9A A;  1PSB A;  2HQW A;  1WLM A;  3TDI A;  1Q80 A;  3F45 A;  2JTT A;  2KSP A;  3LLE A;  5CSJ A;  1EH2 A;  2H61 A;  1F70 A;  2HQ8 A;  2KQ6 A;  2LUX A;  4I5K A;  2M1K B;  1MR8 A;  5PAL A;  1CDL A;  2GV5 A;  1EG4 A;  2KFG A;  1M45 A;  4PHK A;  2JWW A;  2LLU A;  1QX2 A;  2LAP A;  2PMY A;  2GGM A;  2KNE A;  1JF2 A;  1QLK A;  3HX4 A;  2ZKM X;  4N1G A;  4NQG A;  1TOP A;  1DTL A;  1R6P A;  1J7P A;  2G2B A;  4OKH A;  4ETO A;  1NPQ A;  1PUL A;  2NZ0 A;  5HKZ A;  4PDZ A;  4BY4 A;  4DCK A;  1A2X A;  2KYC A;  2KYF A;  4HSZ A;  1RTP 1;  1CFC A;  2LLT A;  4R1E A;  1XFZ O;  2LV7 A;  4N1F A;  1UHI A;  1KQV A;  2WOR A;  3PN7 B;  4GUK A;  1JWD A;  2JNX A;  1JFK A;  2LHI A;  1B8L A;  2PAS A;  1D1O A;  1QTX A;  1FI5 A;  1SL8 A;  1TIZ A;  1KWO C;  2LVJ A;  3BUX B;  3PLF B;  3CZT X;  4M2O A;  4MZL A;  1WY9 A;  1TRF A;  3BUM B;  3FWB A;  5D69 A;  1DJH A;  2BCX A;  1S1E A; 
#chains in the Genus database with same CATH topology
 2VRG A;  2OTG C;  4MBE A;  3TZ1 A;  4GGN A;  1NUB A;  3EVU A;  3FE8 A;  5I94 A;  5HKW A;  1S5G Y;  4ICB A;  4Q04 A;  1BOC A;  1B7T Z;  2KPH A;  3EK8 A;  1UWO A;  1RK9 A;  2M1U A;  2LMT A;  4ZCV A;  1MXE A;  1NYA A;  1IGV A;  1OOI X;  3D73 A;  2NXQ A;  3SG6 A;  4YRU A;  1OW4 A;  1MHO A;  2LVK A;  1XFY O;  2LHL A;  1NX2 A;  2JQ6 A;  2LMV A;  5AAN A;  4PE4 A;  2KAV A;  1FPW A;  4IJ7 A;  1SCM C;  3R72 A;  4C0L A;  1S36 A;  3D74 A;  1JC2 A;  5F6T A;  1C07 A;  4F7F A;  1KFX S;  5ER5 A;  1SR6 C;  1YUR A;  1TNW A;  3PN7 C;  4IL1 A;  3CZ2 A;  4CFR A;  1M31 A;  1DEL A;  2WND A;  2IS9 A;  1DJW A;  3GK2 A;  1CLL A;  2KI4 B;  2GGZ A;  5I2Q A;  2LVV A;  4P5O E;  2QEB A;  1UUS A;  3I5G B;  1YVH A;  4DS7 A;  2CTN A;  3GK4 X;  4XJK B;  1QWV A;  2CXJ A;  1GGZ A;  1OOF A;  4MEW A;  3SG4 A;  2QEH A;  1J7R A;  2KOT A;  5DKN A;  5B8I B;  1QX5 B;  4DIR A;  1YTZ C;  1YRT B;  1XFW O;  2JU0 A;  3BUW B;  1F71 A;  1UHN A;  2QAC A;  2KGR A;  1WLZ A;  3UNW A;  2BE4 A;  4M2Q A;  1KK7 Z;  1QV1 A;  1M39 A;  2H8V A;  2ZRS A;  3E3R A;  4OVN F;  3A4U B;  1ALV A;  1UHK A;  3OHM B;  2JZI A;  1CTR A;  5JJG A;  1U5I A;  1FBV A;  2JUL A;  2OS8 C;  3GK1 A;  3WHU B;  1BG1 A;  4U8D A;  4A4C A;  5I2O A;  5J3X A;  3WNX B;  4JKT A;  3SG5 A;  1JF0 A;  1BR1 B;  3SG3 A;  4DUQ A;  1WRL A;  1CDP A;  2JXL A;  1K93 D;  1CLB A;  2F3Y A;  1K90 D;  4MZK A;  2WCB A;  4ZCU A;  3AAJ A;  2JTZ A;  3LCP C;  3PAL A;  1GJY A;  3SG2 A;  2KI4 C;  1ORG A;  3EVR A;  4PE1 A;  1XVJ A;  3I5F C;  2NLN A;  1LXF C;  4JD9 A;  3TUY C;  1FF1 A;  2JPT A;  3I5G C;  2K8M B;  4F0Z B;  2R2I A;  5D7F A;  1P28 A;  3D77 A;  5I2L A;  2K7O A;  5AEQ A;  1IWQ A;  2BCB A;  3EKH A;  1U5I B;  1EJ3 A;  1N0Y A;  1S3P A;  1CNP A;  1JFJ A;  2K7C A;  3IVT A;  3BUO B;  2NCP A;  3CR5 X;  1DF0 A;  2DOQ A;  2HF5 A;  2KHN A;  1OOH A;  1AJ5 A;  2WCK A;  1CMF A;  3I5I C;  1E8A A;  3ICB A;  5I8N A;  1DJZ A;  1X02 A;  5AER A;  2KDH A;  2JRF A;  1OQP A;  1XA5 A;  3DD4 A;  4C0J A;  2L4I A;  4YGB B;  2PQL A;  3L47 A;  1F8H A;  1DJI A;  2M29 A;  2M9G A;  3WXA A;  2QEV A;  1Y0V H;  1KSM A;  1SPY A;  2KAY A;  3PSR A;  4PE0 A;  3PAT A;  1ODB A;  2MHH A;  1KWO B;  1DGV A;  2K60 A;  1DF0 B;  2LLS A;  3NHT A;  4JPZ B;  3S0E A;  3VRR A;  4AQJ A;  2JXC A;  1B8R A;  4TNC A;  2I2R E;  3DVM A;  2ZRT A;  2GTE A;  3KO0 A;  2F33 A;  1VRK A;  2OTG B;  3MSE B;  1C7V A;  1KQM C;  1K2H A;  1YUT A;  4YBH B;  1BR4 B;  1M46 A;  2CBL A;  3PM8 A;  3ZWH A;  2QDI A;  2KGB C;  5GQQ C;  1CDN A;  1YX7 A;  1SW8 A;  4PCW A;  1ZOT B;  2WCL A;  4INX A;  2QPT A;  2Y1N A;  2L2E A;  3OB2 B;  1OOG A;  2ZN9 A;  5G08 A;  1A75 A;  1JUO A;  2P71 A;  1TTX A;  1SCM B;  3D0Y A;  3KHE A;  3OX5 A;  4OZD A;  5DKR A;  3D10 A;  2L98 A;  4CPV A;  1SR6 B;  1YUU A;  4PHN A;  2I18 A;  3NXA A;  3VRO A;  4AQI A;  3S0A A;  4FQT A;  1QXP A;  4JWQ A;  1W7I B;  2FCE A;  3BUN B;  3R1P A;  5CSI A;  3FS7 A;  3HCM A;  1AVS A;  4MVF A;  3V2L A;  1T14 A;  3IF7 A;  1IH0 A;  3KEV A;  3DVJ A;  2LUC A;  2BEC A;  1A75 B;  2BKH B;  4E68 A;  1Z4H A;  1S6C A;  1PVA A;  3I5H C;  1PSR A;  1RFJ A;  3BYA A;  3D0Y B;  3NSO A;  4C0K A;  2M7L A;  1SL7 A;  4I5L B;  5AFP A;  2M49 B;  2LAN A;  2LNK A;  2L2C A;  2QEO A;  1KK7 Y;  2K2F A;  1TNP A;  1IJ6 A;  1L7Z A;  3L4L A;  1HT9 A;  1V1G A;  1EXR A;  1N65 A;  1CFD A;  2OS8 B;  2AAO A;  3CS1 A;  4XJK A;  1Y6W A;  2PYQ A;  3BFH A;  1NCZ A;  2EHB A;  1GQM A;  1ZMZ A;  1SL9 A;  4GFT A;  1RWY A;  4ORC B;  3JTD C;  3SIB A;  3VB1 A;  1TCF A;  1UHH A;  5FI7 A;  1XYD A;  5FYX A;  3O2P A;  3TUY B;  2COL B;  2WC8 A;  3I5F B;  3LK0 A;  5D3O A;  4JQ0 D;  3KPX A;  3TDU A;  3CAB A;  3GOF A;  1SYM A;  1BU3 A;  4MRY A;  2RGI A;  4CLN A;  1KFU L;  2LC5 A;  2Y4Q A;  4M2P A;  3SJS A;  1SY9 A;  4KYN A;  1NP8 A;  3R1V A;  4USL A;  3SS5 A;  1FW4 A;  4MN0 A;  4PE7 A;  4YGD B;  3DVK A;  3AAK A;  1IRJ A;  3BOW A;  3I5I B;  1YR5 A;  4WQ3 A;  2G9B A;  2L50 A;  4PHM A;  2JT8 A;  5EL2 A;  2NCO A;  3RM1 A;  1DT7 B;  1F55 A;  3IQQ A;  1BMO A;  1LIN A;  2KQY A;  1PVB A;  3DZT A;  2O60 A;  1ZAC A;  1CM4 A;  2JT3 A;  4N5X A;  4PT1 A;  5JOL A;  1NX1 A;  1IQ3 A;  3B86 A;  4OV2 A;  1QV0 A;  1C3Z A;  1AUI B;  1OSA A;  2ZND A;  1BT6 A;  3JVT C;  2MAZ A;  2CT9 A;  3QME A;  3CDN A;  1WDC B;  1PAL A;  3LL8 B;  1S5G Z;  3BOW B;  3O78 A;  1DMO A;  1IIO A;  4OCI A;  1L2O C;  2I7A A;  1NCX A;  2JOJ A;  1S6J A;  2FOT A;  1KQM B;  1W7J B;  1XFV O;  2L5X B;  5DIC A;  3TS5 B;  3EK4 A;  3VGO A;  2M3W A;  4A4B A;  3O4Y A;  1K94 A;  1REC A;  4DRW A;  1J1D A;  1NWD A;  2LM5 A;  1H4B A;  1SSE B;  5HLO A;  3SIA A;  4QJ5 B;  1OZO A;  1W9Z A;  2BCA A;  3CR4 X;  1UHJ A;  1IG5 A;  3C1V A;  3CWG A;  2PAL A;  5HL1 A;  5BPJ A;  3CYZ A;  1AJ4 A;  2WCJ A;  1TWO A;  3ZNI A;  1WRZ A;  1V1F A;  1J7Q A;  1OZS A;  1QVI Z;  4QJ4 B;  1SKT A;  4OR9 B;  3NHI A;  2EGD A;  2MRD A;  2Y5I A;  4NDB A;  2O5G A;  2V53 A;  2WCF A;  3AKB A;  4YI9 A;  2K61 A;  2ZFD A;  2LP3 A;  4XYN A;  3CGA A;  3O6B A;  5K89 A;  3OX6 A;  1B8C A;  1SBJ A;  2ZNE A;  1ZUZ A;  1NSH A;  1F4O A;  5HKY A;  1SNL A;  1LA3 A;  1TNX A;  2PVB A;  1WDC C;  1SK6 D;  1PK0 D;  1GGW A;  5HYD A;  1OMR A;  1BLQ A;  3OBV A;  1JBA A;  2WCE A;  3OB1 B;  2FJU B;  3TS5 C;  3FE9 A;  2ISD A;  3I5H B;  2KFF A;  3RZS A;  3QRX A;  3BFB A;  1B7T Y;  1DJG A;  4MRX A;  2ERB A;  1DGU A;  1HQV A;  2KBM A;  2KLE A;  4YGE B;  4D1E A;  1AK8 A;  3CZ0 A;  1KK8 C;  4FTG A;  1H8B A;  1KFU S;  1AHR A;  2LCP A;  2YGU A;  1S26 D;  1IQ5 A;  4AOM A;  4GAO A;  2L51 A;  4I5N B;  3FWC A;  2K7D A;  3WHT B;  1NX0 A;  2EC6 B;  5KTY A;  1GM0 A;  1QS7 A;  2Q4U A;  2JPO A;  2M8U A;  3SS4 A;  2KAX A;  3DF0 A;  5HLV A;  5FI2 A;  3M0W A;  5KSZ A;  3JTD B;  2F2P A;  2BNX A;  2KI6 C;  3NGV A;  3NSK A;  2D8N A;  1MF8 B;  4YGA A;  1K9K A;  1SRA A;  2JT0 A;  3B88 A;  1K8U A;  2BBM A;  4GBA A;  1PRW A;  4CID A;  1CKK A;  1CFF A;  1DVI A;  1EG3 A;  1J55 A;  3DVE A;  2M97 A;  1LKJ A;  1J7O A;  1YX8 A;  1CMG A;  2MA2 A;  2B1U A;  3DXL A;  1B47 A;  4ORA B;  2WOS A;  2A4J A;  1IKU A;  3AKA A;  1MXL C;  2JC2 A;  1QAS A;  1XFX O;  2MLE C;  2SCP A;  3DF0 B;  3EG5 B;  3L4A A;  3B6X A;  1C7W A;  3DYE A;  1J1E A;  1QIV A;  3S0F A;  1NX3 A;  1IJ5 A;  3BXK A;  3H4S E;  5CSN A;  1G33 A;  1YUS A;  2EC6 C;  4I5J A;  1QIW A;  1G8I A;  2BKI B;  1Y1X A;  1CB1 A;  1B4C A;  2Y1M A;  2H2K A;  1FI6 A;  1OE9 B;  5TNC A;  1KSO A;  4GGF A;  2HPS A;  1KCY A;  2AUC A;  1XK4 C;  3DY9 A;  1K9P A;  3B87 A;  5CPV A;  1EL4 A;  2P70 A;  1LA0 A;  3JVT B;  2I94 A;  4YI8 A;  3O4X A;  2PRU A;  1LS8 A;  2F8P A;  3IQO A;  1L2O B;  3FIA A;  3NSL A;  4NDC A;  1CFP A;  4FQO A;  2F3Z A;  1JSA A;  1NIW A;  1A4P A;  2BL0 B;  2KFH A;  3OGN A;  1F54 A;  2H61 C;  2FCD A;  3LK1 A;  1WRK A;  1QX7 A;  5KU1 A;  1Z2C B;  2BE6 A;  1ZFS A;  3Q8I A;  2K0J A;  1QVI Y;  1MWN A;  4MZJ A;  1K9U A;  3BQ3 A;  4PHJ A;  2MLF C;  1M63 B;  1UUR A;  2CNP A;  3EKJ A;  1OMV A;  1TNQ A;  3CLN A;  4P2Y B;  2P6B B;  3BJH A;  1BF5 A;  2MJW B;  3D76 A;  1A03 A;  3UO9 A;  4WQ2 A;  1TCO B;  3OP0 A;  1A29 A;  2BAP A;  4GNK B;  2M7N A;  4WRI A;  3K1E A;  1QLS A;  2K2A A;  3EK7 A;  5AXI A;  1BOD A;  1MQ1 A;  2L4H A;  5ER4 X;  3N7H A;  2SAS A;  1DC1 A;  3CTN A;  2ZN8 A;  2WCM A;  3D75 A;  3B7A A;  5CSF A;  4L9M A;  1MUX A;  3TDZ A;  1XO5 A;  2OPO A;  2KBI A;  3CZ1 A;  1G4Y R;  1DJY A;  1NCY A;  3A8R A;  2BL0 C;  1TN4 A;  4MSP A;  1QAT A;  1DJX A;  1RJV A;  2E30 A;  3EVV A;  3K21 A;  4QJ3 B;  2JNF A;  4MLW A;  1XFU O;  1R2U A;  2LVI A;  3VRP A;  1XFR A;  1Y1U A;  1KK8 B;  4GGF C;  4NDD A;  2FJY A;  2MBX A;  3VRQ A;  1UP5 A;  3CR2 A;  2LP2 A;  1SCV A;  3KF9 A;  2Q91 A;  1LVC D;  1DEK A;  1TUZ A;  1YRU B;  2K7B A;  2LMU A;  2L0P A;  1BJF A;  3VRN A;  1RRO A;  5IBW A;  1C3Y A;  2PSR A;  4PAL A;  1K96 A;  3NSI A;  1ALW A;  3SG7 A;  4CFQ A;  1YVL A;  2BBN A;  3PJI A;  1OMD A;  2AMI A;  2LE9 B;  2HET A;  4HRH A;  4HRG A;  1B1G A;  4YGC B;  2KI6 D;  1SMG A;  3RLZ A;  4BY5 A;  1F4Q A;  2TN4 A;  1N2D A;  2F2O A;  1K95 A;  4ORB B;  2CCM A;  4HRE E;  1AP4 A;  1CLM A;  3FE6 A;  3PFV A;  1CDM A;  1KFX L;  3BFA A;  3PM2 A;  1XK4 A;  4UPG A;  1QJT A;  4GPL B;  2M0R A;  2E6W A;  1TUJ A;  1OOJ A;  1CM1 A;  2WC6 A;  1Y1A A;  3S0B A;  1S6I A;  5DKQ A;  1B9A A;  1PSB A;  2WCH A;  2HQW A;  1WLM A;  3TDI A;  1Q80 A;  3F45 A;  2JTT A;  2KSP A;  3LLE A;  5CSJ A;  1EH2 A;  2H61 A;  1F70 A;  2HQ8 A;  2KQ6 A;  2LUX A;  4I5K A;  2M1K B;  1MR8 A;  5PAL A;  1CDL A;  2GV5 A;  1EG4 A;  2KFG A;  1M45 A;  4PHK A;  2JWW A;  2LLU A;  1QX2 A;  2LAP A;  3SS3 A;  2PMY A;  2GGM A;  2KNE A;  4INW A;  1JF2 A;  1QLK A;  3D78 A;  3HX4 A;  2KLD A;  2ZKM X;  4N1G A;  4NQG A;  1TOP A;  1DTL A;  1R6P A;  1J7P A;  2G2B A;  4OKH A;  4ETO A;  1NPQ A;  1PUL A;  2NZ0 A;  5HKZ A;  2L5Y A;  4PDZ A;  3R1O A;  4BY4 A;  4DCK A;  1A2X A;  2KYC A;  2KYF A;  4HSZ A;  1RTP 1;  1CFC A;  2LLT A;  4R1E A;  1XFZ O;  2WC5 A;  5FI6 A;  2LV7 A;  4N1F A;  1UHI A;  1KQV A;  2WOR A;  3PN7 B;  4GUK A;  1JWD A;  2JNX A;  1JFK A;  2LHI A;  1B8L A;  2PAS A;  1D1O A;  1QTX A;  1FI5 A;  1SL8 A;  1TIZ A;  1KWO C;  2LVJ A;  1DQE A;  3BUX B;  3CZT X;  3PLF B;  4M2O A;  1WY9 A;  4MZL A;  3S0G A;  1TRF A;  3BUM B;  3FWB A;  5D69 A;  1DJH A;  2BCX A;  1S1E A;  3S0D A; 
#chains in the Genus database with same CATH homology
 2VRG A;  2OTG C;  4MBE A;  3TZ1 A;  4GGN A;  1NUB A;  3EVU A;  5HKW A;  1S5G Y;  4ICB A;  4Q04 A;  1BOC A;  1B7T Z;  3EK8 A;  1UWO A;  1RK9 A;  2M1U A;  2LMT A;  4ZCV A;  1MXE A;  1NYA A;  1IGV A;  2NXQ A;  3SG6 A;  4YRU A;  1MHO A;  2LVK A;  1XFY O;  2LHL A;  1NX2 A;  2JQ6 A;  2LMV A;  5AAN A;  4PE4 A;  2KAV A;  1FPW A;  1SCM C;  4C0L A;  1S36 A;  1JC2 A;  5F6T A;  1C07 A;  1KFX S;  5ER5 A;  1SR6 C;  1YUR A;  1TNW A;  3PN7 C;  4IL1 A;  4CFR A;  1M31 A;  2WND A;  2IS9 A;  1DJW A;  3GK2 A;  1CLL A;  2KI4 B;  2GGZ A;  5I2Q A;  2LVV A;  4P5O E;  1UUS A;  3I5G B;  1YVH A;  4DS7 A;  2CTN A;  3GK4 X;  4XJK B;  2CXJ A;  1GGZ A;  4MEW A;  3SG4 A;  1J7R A;  2KOT A;  5DKN A;  5B8I B;  1QX5 B;  4DIR A;  1YTZ C;  1YRT B;  1XFW O;  2JU0 A;  3BUW B;  1F71 A;  1UHN A;  2QAC A;  2KGR A;  1WLZ A;  2BE4 A;  4M2Q A;  1KK7 Z;  1QV1 A;  1M39 A;  2ZRS A;  3E3R A;  4OVN F;  3A4U B;  1ALV A;  1UHK A;  3OHM B;  2JZI A;  1CTR A;  5JJG A;  1U5I A;  1FBV A;  2JUL A;  2OS8 C;  3GK1 A;  3WHU B;  1BG1 A;  4U8D A;  4A4C A;  5I2O A;  5J3X A;  3WNX B;  3SG5 A;  1JF0 A;  1BR1 B;  3SG3 A;  4DUQ A;  1WRL A;  1CDP A;  2JXL A;  1K93 D;  1CLB A;  2F3Y A;  1K90 D;  4MZK A;  2WCB A;  4ZCU A;  3AAJ A;  2JTZ A;  3LCP C;  3PAL A;  1GJY A;  3SG2 A;  2KI4 C;  3EVR A;  3TUY C;  4PE1 A;  1XVJ A;  3I5F C;  2NLN A;  1LXF C;  1FF1 A;  2JPT A;  3I5G C;  2K8M B;  4F0Z B;  2R2I A;  5D7F A;  5I2L A;  2K7O A;  5AEQ A;  2BCB A;  1IWQ A;  3EKH A;  1U5I B;  1EJ3 A;  1N0Y A;  1S3P A;  1CNP A;  1JFJ A;  2K7C A;  3BUO B;  2NCP A;  3CR5 X;  1DF0 A;  2DOQ A;  2HF5 A;  2KHN A;  1AJ5 A;  1CMF A;  3I5I C;  1E8A A;  3ICB A;  5I8N A;  1DJZ A;  1X02 A;  5AER A;  2KDH A;  2JRF A;  1OQP A;  1XA5 A;  3DD4 A;  4C0J A;  2L4I A;  4YGB B;  1F8H A;  1DJI A;  2M29 A;  2M9G A;  3WXA A;  1Y0V H;  1KSM A;  1SPY A;  2KAY A;  3PSR A;  4PE0 A;  3PAT A;  1ODB A;  2MHH A;  1KWO B;  1DGV A;  4JPZ B;  1DF0 B;  2LLS A;  3VRR A;  4AQJ A;  2JXC A;  1B8R A;  4TNC A;  2I2R E;  3DVM A;  2ZRT A;  3KO0 A;  2F33 A;  1VRK A;  2OTG B;  3MSE B;  1C7V A;  1KQM C;  1K2H A;  1YUT A;  4YBH B;  1BR4 B;  1M46 A;  2CBL A;  3PM8 A;  3ZWH A;  5GQQ C;  2KGB C;  1CDN A;  1YX7 A;  1SW8 A;  4PCW A;  1ZOT B;  2QPT A;  2Y1N A;  2L2E A;  3OB2 B;  2ZN9 A;  5G08 A;  1A75 A;  1JUO A;  1TTX A;  1SCM B;  3D0Y A;  3KHE A;  3OX5 A;  5DKR A;  3D10 A;  2L98 A;  4CPV A;  1SR6 B;  1YUU A;  4PHN A;  2I18 A;  3NXA A;  3VRO A;  4AQI A;  1QXP A;  4JWQ A;  1W7I B;  2FCE A;  3BUN B;  5CSI A;  3FS7 A;  3HCM A;  1AVS A;  4MVF A;  3IF7 A;  1IH0 A;  3KEV A;  3DVJ A;  2LUC A;  2BEC A;  1A75 B;  2BKH B;  4E68 A;  1S6C A;  1PVA A;  3I5H C;  1PSR A;  1RFJ A;  3BYA A;  3D0Y B;  3NSO A;  4C0K A;  2M7L A;  1SL7 A;  4I5L B;  5AFP A;  2M49 B;  2LAN A;  2LNK A;  1KK7 Y;  2K2F A;  1TNP A;  1IJ6 A;  1L7Z A;  1HT9 A;  1V1G A;  1EXR A;  1N65 A;  1CFD A;  2OS8 B;  2AAO A;  3CS1 A;  4XJK A;  1Y6W A;  1NCZ A;  2EHB A;  1GQM A;  1ZMZ A;  1SL9 A;  4GFT A;  1RWY A;  4ORC B;  3JTD C;  3SIB A;  1TCF A;  1UHH A;  1XYD A;  5FYX A;  3O2P A;  3TUY B;  2COL B;  2WC8 A;  3I5F B;  3LK0 A;  4JQ0 D;  3KPX A;  3TDU A;  3GOF A;  1SYM A;  1BU3 A;  4MRY A;  2RGI A;  4CLN A;  1KFU L;  2LC5 A;  2Y4Q A;  4M2P A;  3SJS A;  1SY9 A;  1NP8 A;  4USL A;  1FW4 A;  4MN0 A;  4PE7 A;  4YGD B;  3DVK A;  3AAK A;  1IRJ A;  3BOW A;  3I5I B;  1YR5 A;  4WQ3 A;  2G9B A;  2L50 A;  4PHM A;  2JT8 A;  2NCO A;  3RM1 A;  1DT7 B;  1F55 A;  3IQQ A;  1BMO A;  1LIN A;  2KQY A;  1PVB A;  2O60 A;  1ZAC A;  1CM4 A;  2JT3 A;  4N5X A;  5JOL A;  1IQ3 A;  1NX1 A;  4OV2 A;  1QV0 A;  1OSA A;  1AUI B;  2ZND A;  1BT6 A;  3JVT C;  2MAZ A;  2CT9 A;  1WDC B;  1PAL A;  3LL8 B;  1S5G Z;  3BOW B;  3O78 A;  1DMO A;  4OCI A;  1L2O C;  2I7A A;  1NCX A;  2JOJ A;  1S6J A;  2FOT A;  1KQM B;  1W7J B;  1XFV O;  2L5X B;  3TS5 B;  3VGO A;  3EK4 A;  4A4B A;  2M3W A;  3O4Y A;  1K94 A;  1REC A;  4DRW A;  1J1D A;  1NWD A;  2LM5 A;  1H4B A;  5HLO A;  3SIA A;  4QJ5 B;  1OZO A;  2BCA A;  3CR4 X;  1UHJ A;  1IG5 A;  3C1V A;  3CWG A;  2PAL A;  5BPJ A;  1AJ4 A;  3ZNI A;  1WRZ A;  1V1F A;  1J7Q A;  1OZS A;  1QVI Z;  4QJ4 B;  1SKT A;  4OR9 B;  2EGD A;  2MRD A;  2Y5I A;  4NDB A;  2O5G A;  2V53 A;  2WCF A;  3AKB A;  4YI9 A;  2K61 A;  2ZFD A;  2LP3 A;  4XYN A;  3CGA A;  3O6B A;  5K89 A;  3OX6 A;  1B8C A;  1SBJ A;  2ZNE A;  1ZUZ A;  1NSH A;  1F4O A;  5HKY A;  1SNL A;  1LA3 A;  1TNX A;  2PVB A;  1WDC C;  1SK6 D;  1PK0 D;  1GGW A;  5HYD A;  1OMR A;  1BLQ A;  1JBA A;  2WCE A;  3OB1 B;  2FJU B;  3TS5 C;  2ISD A;  3I5H B;  2KFF A;  3QRX A;  1B7T Y;  1DJG A;  4MRX A;  1DGU A;  1HQV A;  2KBM A;  4YGE B;  4D1E A;  1AK8 A;  1KK8 C;  4FTG A;  1H8B A;  1KFU S;  1AHR A;  2LCP A;  4AOM A;  1S26 D;  1IQ5 A;  4GAO A;  2L51 A;  4I5N B;  3FWC A;  2K7D A;  3WHT B;  1NX0 A;  2EC6 B;  5KTY A;  1QS7 A;  2Q4U A;  2M8U A;  2KAX A;  3DF0 A;  5HLV A;  3M0W A;  5KSZ A;  3JTD B;  2F2P A;  2KI6 C;  3NSK A;  2D8N A;  1MF8 B;  4YGA A;  1K9K A;  1SRA A;  2JT0 A;  1K8U A;  2BBM A;  4GBA A;  1PRW A;  4CID A;  1CKK A;  1CFF A;  1DVI A;  1EG3 A;  1J55 A;  3DVE A;  2M97 A;  1LKJ A;  1J7O A;  1YX8 A;  1CMG A;  2MA2 A;  2B1U A;  1B47 A;  4ORA B;  2WOS A;  2A4J A;  1IKU A;  3AKA A;  1MXL C;  2JC2 A;  1QAS A;  1XFX O;  2MLE C;  2SCP A;  3DF0 B;  1C7W A;  1J1E A;  1QIV A;  1NX3 A;  1IJ5 A;  3BXK A;  3H4S E;  5CSN A;  1G33 A;  1YUS A;  2EC6 C;  4I5J A;  1QIW A;  1G8I A;  2BKI B;  1Y1X A;  1CB1 A;  1B4C A;  2Y1M A;  2H2K A;  1FI6 A;  1OE9 B;  5TNC A;  1KSO A;  4GGF A;  2HPS A;  1KCY A;  2AUC A;  1XK4 C;  1K9P A;  5CPV A;  1EL4 A;  1LA0 A;  3JVT B;  2I94 A;  4YI8 A;  2PRU A;  2F8P A;  3IQO A;  1L2O B;  3FIA A;  3NSL A;  4NDC A;  1CFP A;  4FQO A;  2F3Z A;  1JSA A;  1NIW A;  1A4P A;  2BL0 B;  2KFH A;  1F54 A;  2H61 C;  2FCD A;  3LK1 A;  1WRK A;  1QX7 A;  5KU1 A;  2BE6 A;  1ZFS A;  2K0J A;  1QVI Y;  1MWN A;  4MZJ A;  1K9U A;  3BQ3 A;  4PHJ A;  2MLF C;  1M63 B;  1UUR A;  2CNP A;  3EKJ A;  1OMV A;  1TNQ A;  3CLN A;  4P2Y B;  2P6B B;  1BF5 A;  2MJW B;  1A03 A;  4WQ2 A;  1TCO B;  3OP0 A;  1A29 A;  4GNK B;  2M7N A;  4WRI A;  5AXI A;  1QLS A;  2K2A A;  3EK7 A;  1BOD A;  1MQ1 A;  2L4H A;  5ER4 X;  2SAS A;  3CTN A;  2ZN8 A;  5CSF A;  4L9M A;  1MUX A;  3TDZ A;  1XO5 A;  2OPO A;  2KBI A;  1G4Y R;  1DJY A;  1NCY A;  3A8R A;  2BL0 C;  1TN4 A;  4MSP A;  1QAT A;  1DJX A;  1RJV A;  2E30 A;  3EVV A;  3K21 A;  4QJ3 B;  2JNF A;  4MLW A;  1XFU O;  1R2U A;  2LVI A;  3VRP A;  1Y1U A;  4GGF C;  1KK8 B;  4NDD A;  2MBX A;  3VRQ A;  1UP5 A;  3CR2 A;  2LP2 A;  1SCV A;  3KF9 A;  2Q91 A;  1LVC D;  1YRU B;  2K7B A;  2LMU A;  2L0P A;  1BJF A;  3VRN A;  1RRO A;  5IBW A;  2PSR A;  4PAL A;  1K96 A;  3NSI A;  1ALW A;  3SG7 A;  4CFQ A;  1YVL A;  2BBN A;  1OMD A;  2AMI A;  2LE9 B;  2HET A;  4HRH A;  4HRG A;  1B1G A;  4YGC B;  2KI6 D;  1SMG A;  3RLZ A;  4BY5 A;  1F4Q A;  2TN4 A;  1N2D A;  2F2O A;  1K95 A;  4ORB B;  2CCM A;  4HRE E;  1AP4 A;  1CLM A;  3PFV A;  1CDM A;  1KFX L;  1XK4 A;  4UPG A;  1QJT A;  4GPL B;  2M0R A;  2E6W A;  1OOJ A;  1CM1 A;  1Y1A A;  1S6I A;  5DKQ A;  1B9A A;  1PSB A;  2HQW A;  1WLM A;  3TDI A;  1Q80 A;  3F45 A;  2JTT A;  2KSP A;  3LLE A;  5CSJ A;  1EH2 A;  2H61 A;  1F70 A;  2HQ8 A;  2KQ6 A;  2LUX A;  4I5K A;  2M1K B;  1MR8 A;  5PAL A;  1CDL A;  2GV5 A;  1EG4 A;  2KFG A;  1M45 A;  4PHK A;  2JWW A;  2LLU A;  1QX2 A;  2LAP A;  2PMY A;  2GGM A;  2KNE A;  1JF2 A;  1QLK A;  3HX4 A;  2ZKM X;  4N1G A;  4NQG A;  1TOP A;  1DTL A;  1R6P A;  1J7P A;  2G2B A;  4OKH A;  4ETO A;  1NPQ A;  1PUL A;  2NZ0 A;  5HKZ A;  4PDZ A;  4BY4 A;  4DCK A;  1A2X A;  2KYC A;  2KYF A;  4HSZ A;  1RTP 1;  1CFC A;  2LLT A;  4R1E A;  1XFZ O;  2LV7 A;  4N1F A;  1UHI A;  1KQV A;  2WOR A;  3PN7 B;  4GUK A;  1JWD A;  2JNX A;  1JFK A;  2LHI A;  1B8L A;  2PAS A;  1D1O A;  1QTX A;  1FI5 A;  1SL8 A;  1TIZ A;  1KWO C;  2LVJ A;  3BUX B;  3PLF B;  3CZT X;  4M2O A;  4MZL A;  1WY9 A;  1TRF A;  3BUM B;  3FWB A;  5D69 A;  1DJH A;  2BCX A;  1S1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...