4YRUA

Crystal structure of c-terminally truncated neuronal calcium sensor (ncs-1) from rattus norvegicus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
159
structure length
151
Chain Sequence
b'LTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTTPEKRVDRIFAMMDKNADGKLTLQEFQEGSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuronal calcium sensor 1
publication title Neuronal Calcium Sensor-1 Binds the D2 Dopamine Receptor and G-protein-coupled Receptor Kinase 1 (GRK1) Peptides Using Different Modes of Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 47
structure length 151
sequence length 159
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yruA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yruA02
1FF1A 1B4CA 1LXFC 2LVIA 4N5XA 4AOMA 4JQ0D 2L50A 1CMFA 1DF0A 2BBNA 1L7ZA 2D8NA 1FI6A 1YX7A 1AJ4A 4OCIA 2I7AA 1M63B 5DKRA 1G33A 2KAVA 1YVLA 2LMTA 4I5NB 5GQQC 5HKZA 5I2LA 3I5HC 1CDNA 3GK2A 1TNPA 1SY9A 1UHHA 2HF5A 2H61A 2LLSA 4TNCA 4MVFA 1C7VA 4MN0A 2KAYA 4PHKA 3JTDB 1EL4A 5PALA 1BMOA 5HYDA 1JC2A 1DGUA 2E30A 3CLNA 1BU3A 1SCMB 1UHNA 2KI6D 3SJSA 2V53A 1UWOA 3I5IC 2O60A 1B1GA 4N1FA 1DJWA 1EG4A 1MUXA 4WRIA 3DVEA 1DGVA 1IRJA 1NPQA 3DF0A 4DIRA 2PALA 2KYFA 2MLEC 2WCBA 3RLZA 1PK0D 2BKIB 2Y1NA 1QVIY 4HRHA 3I5HB 2MBXA 1TIZA 3HCMA 2KSPA 4CIDA 1BODA 3E3RA 2FCEA 2WCEA 3M0WA 4I5JA 1JF2A 4WQ2A 1YUUA 3KF9A 1RFJA 1BLQA 1MQ1A 1S1EA 2L0PA 2K7OA 1SMGA 1XFYO 1NCXA 1K96A 1DJZA 5HKWA 1QATA 3CR4X 1KWOC 1NUBA 3JVTC 1PSBA 3SG7A 3BOWB 3CGAA 5AFPA 1W7IB 1JWDA 1TOPA 2I18A 2JTTA 1F55A 3TS5C 4GNKB 3AAJA 5G08A 2NCOA 2BCXA 4YGCB 1SRAA 2L4HA 3LCPC 2I2RE 4QJ3B 1QIWA 1CLMA 4YRUA 1HQVA 1KSMA 2K61A 5D69A 4CLNA 5I2QA 3FWBA 1S6CA 1QX5B 2KI6C 1B7TY 1QXPA 1KK8B 2O5GA 2P6BB 1OE9B 1NX0A 1S6JA 1QS7A 3D0YA 1BR4B 1AHRA 1J1EA 5I2OA 2KNEA 3PN7C 5AANA 2OS8C 1UP5A 3CWGA 3TS5B 4QJ4B 2L2EA 2QPTA 1EG3A 1MHOA 1OZOA 3VRNA 2LANA 1CLBA 3PATA 3NSIA 1TNWA 1IGVA 3SG4A 1B7TZ 3KEVA 1XFWO 2K0JA 1OSAA 1TNQA 1BOCA 3FS7A 4XJKB 1UHJA 5D7FA 2LHLA 2F3YA 1A29A 1QX2A 1WDCC 1Y6WA 4HRGA 1IWQA 2ZN9A 1GQMA 1S5GY 1XVJA 1SYMA 3OHMB 2BECA 1DF0B 2KFHA 1DJXA 3I5FC 3KO0A 5ER5A 2G9BA 1B8LA 2R2IA 1TN4A 3PSRA 4DCKA 1YUSA 1NCYA 4I5LB 2M7LA 3GK4X 5DKQA 1H4BA 1GGZA 1YX8A 3BUNB 4YBHB 1BG1A 1CMGA 5IBWA 1GJYA 4PE7A 2I94A 3VROA 2LVJA 3I5GC 3OB1B 2OPOA 1S5GZ 2RGIA 2IS9A 1J7RA 3DVJA 1SW8A 2KHNA 4NDBA 5F6TA 3WNXB 2WORA 3ICBA 2JXLA 1K8UA 1PSRA 4ORAB 5JOLA 1M39A 3I5FB 3OP0A 2BCAA 1A75A 1QTXA 2KQ6A 2K7BA 4XJKA 1EJ3A 4OVNF 4MRXA 2ZFDA 4BY5A 2LV7A 2KBIA 2KOTA 2K8MB 4JWQA 4N1GA 1KQVA 1QIVA 4C0KA 3SG3A 3IQOA 1SL7A 2F33A 4C0JA 2GGMA 2KGRA 2MAZA 1DVIA 3I5GB 1G4YR 1QV1A 1M31A 2BE6A 2NLNA 4NDCA 2NCPA 1YURA 4GAOA 2HQWA 3KHEA 4MZJA 2LVVA 2EC6B 1DJHA 1KQMC 2KQYA 1BT6A 2H2KA 2KBMA 1XYDA 1NIWA 2JPTA 3NSOA 3CS1A 2JNFA 3PFVA 1NYAA 4USLA 2JC2A 3BXKA 1NP8A 3FIAA 4GGNA 1XK4C 2AAOA 1JBAA 1H8BA 1OOJA 1CB1A 3F45A 1TCFA 4GGFC 1L2OC 1WRZA 3BYAA 1SCVA 2GGZA 4C0LA 4F0ZB 1NSHA 2LP3A 1SPYA 1ZACA 3TUYC 1PULA 4CPVA 3EVUA 1PVBA 1K94A 2F8PA 1KQMB 1Y1UA 3D0YB 4PE0A 1CKKA 4JPZB 1TRFA 2L98A 3EKHA 4PCWA 3OX5A 1OMDA 2EGDA 3EVVA 3I5IB 4HREE 1KCYA 3EK7A 1MWNA 1AK8A 1YR5A 5CSNA 2JZIA 1MXEA 1KFXL 2WCFA 1J55A 4ORCB 3QRXA 1E8AA 1B47A 2M3WA 5AERA 4GBAA 1JUOA 1DTLA 3DVKA 2M1UA 3TUYB 1XFXO 3HX4A 1YTZC 5HLVA 2LC5A 4AQIA 1QJTA 1B9AA 3AKBA 1FW4A 3BUOB 3ZNIA 1IKUA 2Y5IA 1JFJA 3VRQA 1JF0A 2BKHB 4M2PA 3GK1A 1RTP1 3MSEB 4P5OE 1NX1A 2JU0A 1F70A 4IL1A 3BUWB 2F2OA 1S36A 3AKAA 1F4OA 1RROA 2ZNEA 3DD4A 1MR8A 1ZUZA 4PE4A 1KWOB 2ZN8A 1XFUO 3TDZA 3JVTB 4YGBB 1DJGA 2LHIA 2M8UA 1SR6C 2Y4QA 1YVHA 1CFPA 1XK4A 2L5XB 2KFFA 2E6WA 2LLUA 4GGFA 1KFXS 5I8NA 1K93D 1PALA 1QX7A 2PSRA 1UURA 2ZNDA 1CFCA 1DJIA 1A2XA 1OQPA 2M1KB 1F54A 4MRYA 2BCBA 1TTXA 1RJVA 2JXCA 1N2DA 1CM4A 1BF5A 2JNXA 1A75B 2K7CA 4A4BA 1ALVA 4XYNA 1UHIA 1C7WA 1Y1XA 3PN7B 1JSAA 1KFUL 4FTGA 2OS8B 4L9MA 3LK1A 4MLWA 1V1FA 1CM1A 1U5IB 2JOJA 1A4PA 1DMOA 1IJ6A 1CDPA 3VGOA 2GV5A 2VRGA 4MSPA 2Q4UA 1X02A 1M45A 2MJWB 1D1OA 2KYCA 1GGWA 3IQQA 3NSKA 1YRTB 2LM5A 4I5KA 1SKTA 2ZKMX 2JWWA 3A8RA 1SL8A 1HT9A 1B8RA 3IF7A 5AXIA 4BY4A 1IG5A 1C07A 1WDCB 2ZRTA 5KSZA 1LINA 2LVKA 3O78A 4GUKA 1ALWA 2ISDA 1Y0VH 2TN4A 3EKJA 1F8HA 2NZ0A 1CNPA 1NCZA 2LNKA 2CBLA 1WLMA 2CCMA 1S6IA 1FPWA 1RECA 1NX2A 2CTNA 3SIBA 2LUCA 4A4CA 4GFTA 1KFUS 3WHTB 3NXAA 1SNLA 2CNPA 1U5IA 2BE4A 2NXQA 4Q04A 2ZRSA 5ER4X 1AJ5A 1BR1B 1OMVA 2MA2A 3KPXA 5HLOA 1YUTA 2F2PA 1CDLA 1ZFSA 3OX6A 2KFGA 3JTDC 2M0RA 4PDZA 1SK6D 1JFKA 5DKNA 4PE1A 1IH0A 1BJFA 2JT3A 1SCMC 3O2PA 4AQJA 4OR9B 1MF8B 4ZCVA 2CT9A 1K9KA 2K2AA 1DJYA 3LK0A 1WRKA 1ZOTB 2BL0C 1CFDA 2M49B 2Q91A 4PALA 3VRPA 3WXAA 4YGAA 3D10A 3TDIA 1CDMA 4YGDB 5J3XA 2OTGC 1R6PA 2PRUA 2LCPA 1J7QA 3LL8B 1ODBA 3H4SE 1K9PA 4DUQA 1A03A 1W7JB 3TZ1A 1J1DA 3SG2A 2JRFA 4P2YB 2LMUA 3LLEA 2MRDA 1LVCD 4M2OA 1IJ5A 4MEWA 2QACA 2BL0B 1S3PA 2JQ6A 4CFQA 3BUXB 1L2OB 4OV2A 1MXLC 2LLTA 4U8DA 1RK9A 4R1EA 1CLLA 5CPVA 2OTGB 1KSOA 1S26D 4HSZA 4PHMA 3SG5A 2Y1MA 1LKJA 4ETOA 4OKHA 4CFRA 1RWYA 1TNXA 1TCOB 3PLFB 4YI9A 4ZCUA 1F71A 2COLB 3CR2A 1N65A 2BBMA 1FI5A 3PALA 2LAPA 1KK8C 1IQ5A 2FCDA 1WRLA 2SCPA 2M97A 3TDUA 1AUIB 1VRKA 4M2QA 1B8CA 1XA5A 1QVIZ 2HETA 3EK4A 1NX3A 4MZLA 5CSFA 3WHUB 5K89A 1YRUB 2WOSA 3NSLA 2PASA 2PMYA 1AP4A 2LUXA 5CSJA 1Y1AA 3BUMB 2WC8A 1WLZA 4MZKA 3SG6A 1UUSA 5TNCA 1K2HA 1KK7Y 5B8IB 4NDDA 2PVBA 2SASA 2A4JA 2KDHA 1OZSA 1QLKA 1R2UA 3DVMA 1PRWA 2FJUB 1K90D 2CXJA 2G2BA 3ZWHA 1XFVO 3EVRA 3VRRA 2L51A 4PHJA 1F4QA 1SR6B 2L4IA 2KAXA 1IQ3A 1J7PA 5KU1A 1XO5A 4MBEA 1QASA 1KK7Z 2F3ZA 3CZTX 2WNDA 1DT7B 1QLSA 4YGEB 5HKYA 3BOWA 2KI4C 1EH2A 2M29A 3GOFA 3A4UB 1UHKA 2H61C 5CSIA 2JT0A 4NQGA 2KGBC 3AAKA 5AEQA 3CTNA 4UPGA 3OB2B 2DOQA 4DS7A 1Q80A 2HQ8A 2K2FA 1FBVA 4E68A 3K21A 1OMRA 1AVSA 2MLFC 1WY9A 2FOTA 3RM1A 4YI8A 4GPLB 1CFFA 3SIAA 1NWDA 1V1GA 4WQ3A 5BPJA 2K7DA 3O4YA 3BQ3A 1PVAA 1M46A 2M9GA 2EHBA 4ICBA 2KI4B 1CTRA 1LA0A 1SL9A 2M7NA 1K9UA 2LP2A 2JULA 5FYXA 4PHNA 3FWCA 2JT8A 5JJGA 1K95A 5KTYA 4QJ5B 3O6BA 1N0YA 1EXRA 1QV0A 3C1VA 4D1EA 2B1UA 3PM8A 2HPSA 4FQOA 4DRWA 2AMIA 2JTZA 3EK8A 4ORBB 1SBJA 3CR5X 2EC6C 3DF0B 1G8IA 1XFZO 1ZMZA 2LE9B 2MHHA 1LA3A 2AUCA 1J7OA 2LMVA
chains in the Genus database with same CATH superfamily
1FF1A 1B4CA 1LXFC 2LVIA 4N5XA 4AOMA 4JQ0D 2L50A 1CMFA 2P71A 1DF0A 3QMEA 2BBNA 1L7ZA 2D8NA 1FI6A 1YX7A 1AJ4A 4OCIA 2I7AA 1M63B 5DKRA 1G33A 2KAVA 1YVLA 2WCMA 3S0BA 2LMTA 4I5NB 5GQQC 5HKZA 5I2LA 3I5HC 1CDNA 3GK2A 1TNPA 1SY9A 1UHHA 2HF5A 2H61A 2LLSA 4TNCA 4MVFA 1C7VA 4MN0A 2KAYA 4PHKA 3JTDB 1EL4A 5PALA 1BMOA 2WCJA 2PYQA 5HYDA 1JC2A 1DGUA 2E30A 3CLNA 1BU3A 1SCMB 1UHNA 2KI6D 3L4AA 3SJSA 2V53A 1UWOA 3I5IC 2O60A 1B1GA 4N1FA 1DJWA 1EG4A 1MUXA 4WRIA 3DVEA 1DGVA 1IRJA 1NPQA 3DF0A 4DIRA 2PALA 2KYFA 2MLEC 2WCBA 3RLZA 3S0AA 1PK0D 3K1EA 2BKIB 3S0EA 2Y1NA 1QVIY 4HRHA 3SS5A 3I5HB 2MBXA 1TIZA 3HCMA 2KSPA 3R1VA 4CIDA 1BODA 3E3RA 2FCEA 2WCEA 3M0WA 4I5JA 1JF2A 4WQ2A 3UNWA 5DICA 3OGNA 1YUUA 3KF9A 1RFJA 1BLQA 1MQ1A 1S1EA 2L0PA 2K7OA 1OW4A 1SMGA 4KYNA 1XFYO 1NCXA 1K96A 1DJZA 5HKWA 1QATA 3CR4X 3S0GA 1KWOC 1NUBA 3JVTC 1PSBA 3SG7A 3BOWB 3CGAA 5AFPA 1W7IB 1JWDA 1TOPA 2I18A 2JTTA 1F55A 3TS5C 4GNKB 3AAJA 5G08A 2NCOA 2BCXA 4FQTA 4YGCB 1SRAA 3RZSA 2L4HA 3FE6A 3LCPC 2I2RE 4QJ3B 1QIWA 1QWVA 1CLMA 3DYEA 1HQVA 1KSMA 2K61A 5D69A 4CLNA 4YRUA 3FWBA 5I2QA 2GTEA 1S6CA 1QX5B 2KI6C 1B7TY 1QXPA 1KK8B 2O5GA 2P6BB 1OE9B 1NX0A 1S6JA 1QS7A 3D0YA 1BR4B 1AHRA 1J1EA 5I2OA 2KNEA 3PN7C 5AANA 2OS8C 1UP5A 3CWGA 3TS5B 4QJ4B 2L2EA 2QPTA 1EG3A 1MHOA 1OZOA 3D75A 3VRNA 2LANA 3D77A 1CLBA 3PATA 3NSIA 1TNWA 1IGVA 3SG4A 1B7TZ 3KEVA 5D3OA 1XFWO 2K0JA 1OSAA 1TNQA 1BOCA 2KLEA 3DY9A 3FS7A 4XJKB 1UHJA 5D7FA 2LHLA 2F3YA 3L4LA 1A29A 1QX2A 1WDCC 1Y6WA 4HRGA 1IWQA 2ZN9A 1GQMA 1S5GY 1XVJA 1SYMA 3OHMB 1DF0B 2BECA 2KFHA 1DJXA 3I5FC 3KO0A 5ER5A 2G9BA 1B8LA 2R2IA 3PM2A 1TN4A 3PSRA 4DCKA 1OOGA 3B87A 1YUSA 1NCYA 4I5LB 2M7LA 3CDNA 1TWOA 3GK4X 5DKQA 1H4BA 1GGZA 1YX8A 3BUNB 4YBHB 1BG1A 1CMGA 5IBWA 1GJYA 4PE7A 2I94A 3VROA 2LVJA 3I5GC 3OB1B 2OPOA 1S5GZ 2RGIA 2IS9A 1J7RA 3DVJA 1SW8A 2KHNA 4NDBA 5F6TA 3WNXB 2WORA 3B7AA 2JXLA 3ICBA 1K8UA 1PSRA 4ORAB 5JOLA 1M39A 3I5FB 3IVTA 3OP0A 2BCAA 3R1OA 1A75A 1QTXA 2KQ6A 2K7BA 4XJKA 1EJ3A 4OVNF 4MRXA 2FJYA 2ZFDA 4BY5A 2LV7A 2KBIA 2KOTA 2K8MB 4JWQA 4N1GA 1KQVA 1QIVA 4C0KA 3SG3A 3IQOA 1SL7A 2F33A 4C0JA 2GGMA 2KGRA 2MAZA 1DVIA 3I5GB 1G4YR 1ORGA 1QV1A 1T14A 1M31A 2BE6A 2NLNA 4NDCA 2NCPA 1YURA 1DEKA 3R1PA 4GAOA 2HQWA 3KHEA 4MZJA 2LVVA 2EC6B 1DJHA 1KQMC 2KQYA 1BT6A 2H2KA 2KBMA 1XYDA 1NIWA 2JPTA 3NSOA 3CS1A 2JNFA 3PFVA 1NYAA 4USLA 1DQEA 2JC2A 3NHIA 3BXKA 1NP8A 3FIAA 4GGNA 1XK4C 2AAOA 1JBAA 1H8BA 1OOJA 1CB1A 3F45A 1TCFA 4GGFC 1L2OC 1WRZA 3BYAA 1SCVA 2GGZA 4C0LA 4F0ZB 1NSHA 2LP3A 1SPYA 1ZACA 2ERBA 3TUYC 1PULA 4CPVA 3EVUA 1PVBA 1K94A 2F8PA 1KQMB 1OOIX 1Y1UA 3D0YB 2PQLA 4PE0A 3SS4A 1CKKA 4JPZB 1TRFA 2L98A 2WC6A 3EKHA 4PCWA 3OX5A 4JKTA 1OMDA 2EGDA 3EVVA 3I5IB 4HREE 1KCYA 3EK7A 1IIOA 1MWNA 1AK8A 2QEOA 1YR5A 5CSNA 2JZIA 1MXEA 1KFXL 2WCFA 1J55A 4ORCB 3QRXA 1E8AA 1B47A 2M3WA 5AERA 4GBAA 1JUOA 1DTLA 3DVKA 2M1UA 3TUYB 1XFXO 3HX4A 1P28A 1YTZC 5HLVA 2LC5A 4AQIA 1QJTA 1B9AA 3AKBA 3B6XA 1FW4A 3D73A 3BUOB 3ZNIA 1IKUA 2Y5IA 1JFJA 3VRQA 1JF0A 2BKHB 4M2PA 3GK1A 1RTP1 3MSEB 4P5OE 2QEHA 1NX1A 2JU0A 1DC1A 1F70A 4IL1A 3BUWB 3NGVA 2F2OA 1S36A 3AKAA 1F4OA 1RROA 2ZNEA 3CYZA 3DD4A 1MR8A 3O4XA 2WCHA 2JPOA 1ZUZA 4PE4A 1KWOB 2ZN8A 1XFUO 3TDZA 1GM0A 3JVTB 4YGBB 1DJGA 2LHIA 2M8UA 3NHTA 1SR6C 2Y4QA 1YVHA 1CFPA 1XK4A 2L5XB 2KFFA 2E6WA 2LLUA 4GGFA 1KFXS 5I8NA 1K93D 1PALA 1QX7A 2PSRA 1UURA 2ZNDA 1CFCA 1DJIA 1A2XA 1OQPA 2M1KB 1F54A 4MRYA 2BCBA 1TTXA 1RJVA 2JXCA 3D76A 1N2DA 1CM4A 1BF5A 1SSEB 2JNXA 1A75B 2K7CA 4A4BA 1ALVA 4XYNA 1UHIA 3PJIA 3B86A 5EL2A 1C7WA 1Y1XA 3PN7B 1JSAA 1KFUL 4FTGA 2OS8B 4L9MA 3LK1A 4MLWA 1V1FA 1CM1A 1U5IB 2JOJA 1A4PA 1DMOA 1IJ6A 1CDPA 3VGOA 2GV5A 2VRGA 4MSPA 2Q4UA 1X02A 1M45A 2MJWB 1D1OA 2KYCA 1GGWA 3IQQA 3NSKA 1OOFA 1YRTB 2LM5A 4I5KA 1SKTA 2ZKMX 2JWWA 3A8RA 1SL8A 1HT9A 1B8RA 3IF7A 5AXIA 4BY4A 1IG5A 1C07A 1TUJA 1WDCB 2ZRTA 5KSZA 1LINA 2LVKA 3O78A 4GUKA 1ALWA 2ISDA 1Y0VH 2TN4A 3EKJA 1F8HA 2NZ0A 1CNPA 1NCZA 1LS8A 2LNKA 2CBLA 1WLMA 2CCMA 1S6IA 2K60A 1FPWA 1RECA 1NX2A 2CTNA 3SIBA 2LUCA 3S0DA 4A4CA 3DXLA 4GFTA 3S0FA 1KFUS 3CZ1A 2H8VA 3WHTB 3NXAA 1SNLA 2CNPA 1U5IA 2BE4A 2NXQA 4Q04A 2ZRSA 5ER4X 1AJ5A 1BR1B 1OMVA 2MA2A 3KPXA 5HLOA 1YUTA 2F2PA 1CDLA 1ZFSA 2KLDA 3BFHA 3OX6A 2KFGA 3CZ2A 2M0RA 3JTDC 4PDZA 4OZDA 1SK6D 1JFKA 5DKNA 4PE1A 1IH0A 1BJFA 2JT3A 1SCMC 3O2PA 4AQJA 4OR9B 1MF8B 4ZCVA 2CT9A 1K9KA 2K2AA 1DJYA 3LK0A 1WRKA 1ZOTB 2BL0C 1CFDA 2M49B 1TUZA 2Q91A 4PALA 3VRPA 3WXAA 4YGAA 1C3ZA 3D10A 3TDIA 1CDMA 4YGDB 5J3XA 2OTGC 1R6PA 2PRUA 3DZTA 4IJ7A 2LCPA 5FI2A 1J7QA 3LL8B 1ODBA 3H4SE 3BFBA 1K9PA 3R72A 4DUQA 1A03A 1W7JB 3TZ1A 1J1DA 3SG2A 2JRFA 3UO9A 2L5YA 4P2YB 2LMUA 3LLEA 2MRDA 1LVCD 4M2OA 1IJ5A 4MEWA 2QACA 3L47A 2BL0B 5HL1A 5FI7A 1S3PA 2JQ6A 4CFQA 3BUXB 1L2OB 4OV2A 1MXLC 2LLTA 3B88A 3FE8A 4F7FA 3CZ0A 4U8DA 1RK9A 4R1EA 1CLLA 5CPVA 2OTGB 3OBVA 3N7HA 1KSOA 1S26D 4HSZA 5I94A 4PHMA 3BJHA 2BNXA 3SG5A 2Y1MA 1LKJA 3SS3A 4ETOA 4OKHA 4CFRA 2QDIA 1RWYA 3CABA 1TNXA 1TCOB 3PLFB 4YI9A 4ZCUA 1F71A 2COLB 3CR2A 1N65A 2WC5A 2BBMA 1FI5A 3PALA 2LAPA 1KK8C 1IQ5A 2FCDA 1WRLA 2SCPA 2M97A 3TDUA 1AUIB 1VRKA 4M2QA 1B8CA 3FE9A 3Q8IA 1XA5A 1QVIZ 3EG5B 5FI6A 2HETA 3EK4A 1NX3A 4MZLA 5CSFA 3VB1A 3WHUB 5K89A 1YRUB 2WOSA 3NSLA 2PASA 3V2LA 2PMYA 1AP4A 2LUXA 5CSJA 1W9ZA 1Y1AA 3BUMB 2WC8A 1WLZA 4MZKA 3SG6A 1UUSA 5TNCA 1K2HA 1KK7Y 5B8IB 2QEBA 2PVBA 2SASA 4NDDA 2A4JA 2KDHA 1OZSA 1QLKA 1R2UA 3DVMA 1PRWA 2FJUB 1K90D 3D78A 2CXJA 2G2BA 2WCLA 3ZWHA 1XFVO 3EVRA 3VRRA 2L51A 4PHJA 1F4QA 1SR6B 2L4IA 2KAXA 4INWA 1IQ3A 1J7PA 5KU1A 1XFRA 1XO5A 2QEVA 4MBEA 1QASA 2BAPA 1KK7Z 2F3ZA 2YGUA 3CZTX 2WNDA 1DT7B 1QLSA 4YGEB 2WCKA 5HKYA 3BOWA 2KI4C 1EH2A 2M29A 3GOFA 3A4UB 1UHKA 2H61C 5CSIA 2JT0A 4NQGA 2KGBC 3AAKA 5AEQA 3CTNA 2L2CA 4UPGA 3OB2B 2DOQA 4DS7A 1Q80A 2HQ8A 4PT1A 2K2FA 1FBVA 4E68A 3K21A 1OMRA 1AVSA 2MLFC 1WY9A 2FOTA 3RM1A 4YI8A 4GPLB 1CFFA 3SIAA 1Z4HA 1NWDA 1V1GA 1Z2CB 4INXA 4WQ3A 5BPJA 2K7DA 3O4YA 3D74A 1C3YA 3BQ3A 1PVAA 1M46A 2M9GA 2EHBA 4ICBA 2KI4B 1CTRA 1LA0A 1SL9A 2M7NA 1K9UA 2LP2A 2JULA 5FYXA 4PHNA 3FWCA 2JT8A 5JJGA 1OOHA 2KPHA 1K95A 5KTYA 4QJ5B 3O6BA 1N0YA 1EXRA 1DELA 1QV0A 3C1VA 4D1EA 2B1UA 3PM8A 2HPSA 4FQOA 4DRWA 2P70A 2AMIA 2JTZA 3EK8A 4ORBB 1SBJA 3CR5X 2EC6C 3DF0B 1G8IA 1XFZO 1ZMZA 3BFAA 2LE9B 2MHHA 1LA3A 2AUCA 1J7OA 4JD9A 2LMVA
chains in the Genus database with same CATH topology
1FF1A 1B4CA 1LXFC 2LVIA 4N5XA 4AOMA 4JQ0D 2L50A 1CMFA 1DF0A 2BBNA 1L7ZA 2D8NA 1FI6A 1YX7A 1AJ4A 4OCIA 2I7AA 1M63B 5DKRA 1G33A 2KAVA 1YVLA 2LMTA 4I5NB 5GQQC 5HKZA 5I2LA 3I5HC 1CDNA 3GK2A 1TNPA 1SY9A 1UHHA 2HF5A 2H61A 2LLSA 4TNCA 4MVFA 1C7VA 4MN0A 2KAYA 4PHKA 3JTDB 1EL4A 5PALA 1BMOA 5HYDA 1JC2A 1DGUA 2E30A 3CLNA 1BU3A 1SCMB 1UHNA 2KI6D 3SJSA 2V53A 1UWOA 3I5IC 2O60A 1B1GA 4N1FA 1DJWA 1EG4A 1MUXA 4WRIA 3DVEA 1DGVA 1IRJA 1NPQA 3DF0A 4DIRA 2PALA 2KYFA 2MLEC 2WCBA 3RLZA 1PK0D 2BKIB 2Y1NA 1QVIY 4HRHA 3I5HB 2MBXA 1TIZA 3HCMA 2KSPA 4CIDA 1BODA 3E3RA 2FCEA 2WCEA 3M0WA 4I5JA 1JF2A 4WQ2A 1YUUA 3KF9A 1RFJA 1BLQA 1MQ1A 1S1EA 2L0PA 2K7OA 1SMGA 1XFYO 1NCXA 1K96A 1DJZA 5HKWA 1QATA 3CR4X 1KWOC 1NUBA 3JVTC 1PSBA 3SG7A 3BOWB 3CGAA 5AFPA 1W7IB 1JWDA 1TOPA 2I18A 2JTTA 1F55A 3TS5C 4GNKB 3AAJA 5G08A 2NCOA 2BCXA 4YGCB 1SRAA 2L4HA 3LCPC 2I2RE 4QJ3B 1QIWA 1CLMA 4YRUA 1HQVA 1KSMA 2K61A 5D69A 4CLNA 5I2QA 3FWBA 1S6CA 1QX5B 2KI6C 1B7TY 1QXPA 1KK8B 2O5GA 2P6BB 1OE9B 1NX0A 1S6JA 1QS7A 3D0YA 1BR4B 1AHRA 1J1EA 5I2OA 2KNEA 3PN7C 5AANA 2OS8C 1UP5A 3CWGA 3TS5B 4QJ4B 2L2EA 2QPTA 1EG3A 1MHOA 1OZOA 3VRNA 2LANA 1CLBA 3PATA 3NSIA 1TNWA 1IGVA 3SG4A 1B7TZ 3KEVA 1XFWO 2K0JA 1OSAA 1TNQA 1BOCA 3FS7A 4XJKB 1UHJA 5D7FA 2LHLA 2F3YA 1A29A 1QX2A 1WDCC 1Y6WA 4HRGA 1IWQA 2ZN9A 1GQMA 1S5GY 1XVJA 1SYMA 3OHMB 2BECA 1DF0B 2KFHA 1DJXA 3I5FC 3KO0A 5ER5A 2G9BA 1B8LA 2R2IA 1TN4A 3PSRA 4DCKA 1YUSA 1NCYA 4I5LB 2M7LA 3GK4X 5DKQA 1H4BA 1GGZA 1YX8A 3BUNB 4YBHB 1BG1A 1CMGA 5IBWA 1GJYA 4PE7A 2I94A 3VROA 2LVJA 3I5GC 3OB1B 2OPOA 1S5GZ 2RGIA 2IS9A 1J7RA 3DVJA 1SW8A 2KHNA 4NDBA 5F6TA 3WNXB 2WORA 3ICBA 2JXLA 1K8UA 1PSRA 4ORAB 5JOLA 1M39A 3I5FB 3OP0A 2BCAA 1A75A 1QTXA 2KQ6A 2K7BA 4XJKA 1EJ3A 4OVNF 4MRXA 2ZFDA 4BY5A 2LV7A 2KBIA 2KOTA 2K8MB 4JWQA 4N1GA 1KQVA 1QIVA 4C0KA 3SG3A 3IQOA 1SL7A 2F33A 4C0JA 2GGMA 2KGRA 2MAZA 1DVIA 3I5GB 1G4YR 1QV1A 1M31A 2BE6A 2NLNA 4NDCA 2NCPA 1YURA 4GAOA 2HQWA 3KHEA 4MZJA 2LVVA 2EC6B 1DJHA 1KQMC 2KQYA 1BT6A 2H2KA 2KBMA 1XYDA 1NIWA 2JPTA 3NSOA 3CS1A 2JNFA 3PFVA 1NYAA 4USLA 2JC2A 3BXKA 1NP8A 3FIAA 4GGNA 1XK4C 2AAOA 1JBAA 1H8BA 1OOJA 1CB1A 3F45A 1TCFA 4GGFC 1L2OC 1WRZA 3BYAA 1SCVA 2GGZA 4C0LA 4F0ZB 1NSHA 2LP3A 1SPYA 1ZACA 3TUYC 1PULA 4CPVA 3EVUA 1PVBA 1K94A 2F8PA 1KQMB 1Y1UA 3D0YB 4PE0A 1CKKA 4JPZB 1TRFA 2L98A 3EKHA 4PCWA 3OX5A 1OMDA 2EGDA 3EVVA 3I5IB 4HREE 1KCYA 3EK7A 1MWNA 1AK8A 1YR5A 5CSNA 2JZIA 1MXEA 1KFXL 2WCFA 1J55A 4ORCB 3QRXA 1E8AA 1B47A 2M3WA 5AERA 4GBAA 1JUOA 1DTLA 3DVKA 2M1UA 3TUYB 1XFXO 3HX4A 1YTZC 5HLVA 2LC5A 4AQIA 1QJTA 1B9AA 3AKBA 1FW4A 3BUOB 3ZNIA 1IKUA 2Y5IA 1JFJA 3VRQA 1JF0A 2BKHB 4M2PA 3GK1A 1RTP1 3MSEB 4P5OE 1NX1A 2JU0A 1F70A 4IL1A 3BUWB 2F2OA 1S36A 3AKAA 1F4OA 1RROA 2ZNEA 3DD4A 1MR8A 1ZUZA 4PE4A 1KWOB 2ZN8A 1XFUO 3TDZA 3JVTB 4YGBB 1DJGA 2LHIA 2M8UA 1SR6C 2Y4QA 1YVHA 1CFPA 1XK4A 2L5XB 2KFFA 2E6WA 2LLUA 4GGFA 1KFXS 5I8NA 1K93D 1PALA 1QX7A 2PSRA 1UURA 2ZNDA 1CFCA 1DJIA 1A2XA 1OQPA 2M1KB 1F54A 4MRYA 2BCBA 1TTXA 1RJVA 2JXCA 1N2DA 1CM4A 1BF5A 2JNXA 1A75B 2K7CA 4A4BA 1ALVA 4XYNA 1UHIA 1C7WA 1Y1XA 3PN7B 1JSAA 1KFUL 4FTGA 2OS8B 4L9MA 3LK1A 4MLWA 1V1FA 1CM1A 1U5IB 2JOJA 1A4PA 1DMOA 1IJ6A 1CDPA 3VGOA 2GV5A 2VRGA 4MSPA 2Q4UA 1X02A 1M45A 2MJWB 1D1OA 2KYCA 1GGWA 3IQQA 3NSKA 1YRTB 2LM5A 4I5KA 1SKTA 2ZKMX 2JWWA 3A8RA 1SL8A 1HT9A 1B8RA 3IF7A 5AXIA 4BY4A 1IG5A 1C07A 1WDCB 2ZRTA 5KSZA 1LINA 2LVKA 3O78A 4GUKA 1ALWA 2ISDA 1Y0VH 2TN4A 3EKJA 1F8HA 2NZ0A 1CNPA 1NCZA 2LNKA 2CBLA 1WLMA 2CCMA 1S6IA 1FPWA 1RECA 1NX2A 2CTNA 3SIBA 2LUCA 4A4CA 4GFTA 1KFUS 3WHTB 3NXAA 1SNLA 2CNPA 1U5IA 2BE4A 2NXQA 4Q04A 2ZRSA 5ER4X 1AJ5A 1BR1B 1OMVA 2MA2A 3KPXA 5HLOA 1YUTA 2F2PA 1CDLA 1ZFSA 3OX6A 2KFGA 3JTDC 2M0RA 4PDZA 1SK6D 1JFKA 5DKNA 4PE1A 1IH0A 1BJFA 2JT3A 1SCMC 3O2PA 4AQJA 4OR9B 1MF8B 4ZCVA 2CT9A 1K9KA 2K2AA 1DJYA 3LK0A 1WRKA 1ZOTB 2BL0C 1CFDA 2M49B 2Q91A 4PALA 3VRPA 3WXAA 4YGAA 3D10A 3TDIA 1CDMA 4YGDB 5J3XA 2OTGC 1R6PA 2PRUA 2LCPA 1J7QA 3LL8B 1ODBA 3H4SE 1K9PA 4DUQA 1A03A 1W7JB 3TZ1A 1J1DA 3SG2A 2JRFA 4P2YB 2LMUA 3LLEA 2MRDA 1LVCD 4M2OA 1IJ5A 4MEWA 2QACA 2BL0B 1S3PA 2JQ6A 4CFQA 3BUXB 1L2OB 4OV2A 1MXLC 2LLTA 4U8DA 1RK9A 4R1EA 1CLLA 5CPVA 2OTGB 1KSOA 1S26D 4HSZA 4PHMA 3SG5A 2Y1MA 1LKJA 4ETOA 4OKHA 4CFRA 1RWYA 1TNXA 1TCOB 3PLFB 4YI9A 4ZCUA 1F71A 2COLB 3CR2A 1N65A 2BBMA 1FI5A 3PALA 2LAPA 1KK8C 1IQ5A 2FCDA 1WRLA 2SCPA 2M97A 3TDUA 1AUIB 1VRKA 4M2QA 1B8CA 1XA5A 1QVIZ 2HETA 3EK4A 1NX3A 4MZLA 5CSFA 3WHUB 5K89A 1YRUB 2WOSA 3NSLA 2PASA 2PMYA 1AP4A 2LUXA 5CSJA 1Y1AA 3BUMB 2WC8A 1WLZA 4MZKA 3SG6A 1UUSA 5TNCA 1K2HA 1KK7Y 5B8IB 4NDDA 2PVBA 2SASA 2A4JA 2KDHA 1OZSA 1QLKA 1R2UA 3DVMA 1PRWA 2FJUB 1K90D 2CXJA 2G2BA 3ZWHA 1XFVO 3EVRA 3VRRA 2L51A 4PHJA 1F4QA 1SR6B 2L4IA 2KAXA 1IQ3A 1J7PA 5KU1A 1XO5A 4MBEA 1QASA 1KK7Z 2F3ZA 3CZTX 2WNDA 1DT7B 1QLSA 4YGEB 5HKYA 3BOWA 2KI4C 1EH2A 2M29A 3GOFA 3A4UB 1UHKA 2H61C 5CSIA 2JT0A 4NQGA 2KGBC 3AAKA 5AEQA 3CTNA 4UPGA 3OB2B 2DOQA 4DS7A 1Q80A 2HQ8A 2K2FA 1FBVA 4E68A 3K21A 1OMRA 1AVSA 2MLFC 1WY9A 2FOTA 3RM1A 4YI8A 4GPLB 1CFFA 3SIAA 1NWDA 1V1GA 4WQ3A 5BPJA 2K7DA 3O4YA 3BQ3A 1PVAA 1M46A 2M9GA 2EHBA 4ICBA 2KI4B 1CTRA 1LA0A 1SL9A 2M7NA 1K9UA 2LP2A 2JULA 5FYXA 4PHNA 3FWCA 2JT8A 5JJGA 1K95A 5KTYA 4QJ5B 3O6BA 1N0YA 1EXRA 1QV0A 3C1VA 4D1EA 2B1UA 3PM8A 2HPSA 4FQOA 4DRWA 2AMIA 2JTZA 3EK8A 4ORBB 1SBJA 3CR5X 2EC6C 3DF0B 1G8IA 1XFZO 1ZMZA 2LE9B 2MHHA 1LA3A 2AUCA 1J7OA 2LMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FF1 A;  1B4C A;  1LXF C;  2LVI A;  4N5X A;  4AOM A;  4JQ0 D;  2L50 A;  1CMF A;  1DF0 A;  2BBN A;  1L7Z A;  2D8N A;  1FI6 A;  1YX7 A;  1AJ4 A;  4OCI A;  2I7A A;  1M63 B;  5DKR A;  1G33 A;  2KAV A;  1YVL A;  2LMT A;  4I5N B;  5GQQ C;  5HKZ A;  5I2L A;  3I5H C;  1CDN A;  3GK2 A;  1TNP A;  1SY9 A;  1UHH A;  2HF5 A;  2H61 A;  2LLS A;  4TNC A;  4MVF A;  1C7V A;  4MN0 A;  2KAY A;  4PHK A;  3JTD B;  1EL4 A;  5PAL A;  1BMO A;  5HYD A;  1JC2 A;  1DGU A;  2E30 A;  3CLN A;  1BU3 A;  1SCM B;  1UHN A;  2KI6 D;  3SJS A;  2V53 A;  1UWO A;  3I5I C;  2O60 A;  1B1G A;  4N1F A;  1DJW A;  1EG4 A;  1MUX A;  4WRI A;  3DVE A;  1DGV A;  1IRJ A;  1NPQ A;  3DF0 A;  4DIR A;  2PAL A;  2KYF A;  2MLE C;  2WCB A;  3RLZ A;  1PK0 D;  2BKI B;  2Y1N A;  1QVI Y;  4HRH A;  3I5H B;  2MBX A;  1TIZ A;  3HCM A;  2KSP A;  4CID A;  1BOD A;  3E3R A;  2FCE A;  2WCE A;  3M0W A;  4I5J A;  1JF2 A;  4WQ2 A;  1YUU A;  3KF9 A;  1RFJ A;  1BLQ A;  1MQ1 A;  1S1E A;  2L0P A;  2K7O A;  1SMG A;  1XFY O;  1NCX A;  1K96 A;  1DJZ A;  5HKW A;  1QAT A;  3CR4 X;  1KWO C;  1NUB A;  3JVT C;  1PSB A;  3SG7 A;  3BOW B;  3CGA A;  5AFP A;  1W7I B;  1JWD A;  1TOP A;  2I18 A;  2JTT A;  1F55 A;  3TS5 C;  4GNK B;  3AAJ A;  5G08 A;  2NCO A;  2BCX A;  4YGC B;  1SRA A;  2L4H A;  3LCP C;  2I2R E;  4QJ3 B;  1QIW A;  1CLM A;  4YRU A;  1HQV A;  1KSM A;  2K61 A;  5D69 A;  4CLN A;  5I2Q A;  3FWB A;  1S6C A;  1QX5 B;  2KI6 C;  1B7T Y;  1QXP A;  1KK8 B;  2O5G A;  2P6B B;  1OE9 B;  1NX0 A;  1S6J A;  1QS7 A;  3D0Y A;  1BR4 B;  1AHR A;  1J1E A;  5I2O A;  2KNE A;  3PN7 C;  5AAN A;  2OS8 C;  1UP5 A;  3CWG A;  3TS5 B;  4QJ4 B;  2L2E A;  2QPT A;  1EG3 A;  1MHO A;  1OZO A;  3VRN A;  2LAN A;  1CLB A;  3PAT A;  3NSI A;  1TNW A;  1IGV A;  3SG4 A;  1B7T Z;  3KEV A;  1XFW O;  2K0J A;  1OSA A;  1TNQ A;  1BOC A;  3FS7 A;  4XJK B;  1UHJ A;  5D7F A;  2LHL A;  2F3Y A;  1A29 A;  1QX2 A;  1WDC C;  1Y6W A;  4HRG A;  1IWQ A;  2ZN9 A;  1GQM A;  1S5G Y;  1XVJ A;  1SYM A;  3OHM B;  2BEC A;  1DF0 B;  2KFH A;  1DJX A;  3I5F C;  3KO0 A;  5ER5 A;  2G9B A;  1B8L A;  2R2I A;  1TN4 A;  3PSR A;  4DCK A;  1YUS A;  1NCY A;  4I5L B;  2M7L A;  3GK4 X;  5DKQ A;  1H4B A;  1GGZ A;  1YX8 A;  3BUN B;  4YBH B;  1BG1 A;  1CMG A;  5IBW A;  1GJY A;  4PE7 A;  2I94 A;  3VRO A;  2LVJ A;  3I5G C;  3OB1 B;  2OPO A;  1S5G Z;  2RGI A;  2IS9 A;  1J7R A;  3DVJ A;  1SW8 A;  2KHN A;  4NDB A;  5F6T A;  3WNX B;  2WOR A;  3ICB A;  2JXL A;  1K8U A;  1PSR A;  4ORA B;  5JOL A;  1M39 A;  3I5F B;  3OP0 A;  2BCA A;  1A75 A;  1QTX A;  2KQ6 A;  2K7B A;  4XJK A;  1EJ3 A;  4OVN F;  4MRX A;  2ZFD A;  4BY5 A;  2LV7 A;  2KBI A;  2KOT A;  2K8M B;  4JWQ A;  4N1G A;  1KQV A;  1QIV A;  4C0K A;  3SG3 A;  3IQO A;  1SL7 A;  2F33 A;  4C0J A;  2GGM A;  2KGR A;  2MAZ A;  1DVI A;  3I5G B;  1G4Y R;  1QV1 A;  1M31 A;  2BE6 A;  2NLN A;  4NDC A;  2NCP A;  1YUR A;  4GAO A;  2HQW A;  3KHE A;  4MZJ A;  2LVV A;  2EC6 B;  1DJH A;  1KQM C;  2KQY A;  1BT6 A;  2H2K A;  2KBM A;  1XYD A;  1NIW A;  2JPT A;  3NSO A;  3CS1 A;  2JNF A;  3PFV A;  1NYA A;  4USL A;  2JC2 A;  3BXK A;  1NP8 A;  3FIA A;  4GGN A;  1XK4 C;  2AAO A;  1JBA A;  1H8B A;  1OOJ A;  1CB1 A;  3F45 A;  1TCF A;  4GGF C;  1L2O C;  1WRZ A;  3BYA A;  1SCV A;  2GGZ A;  4C0L A;  4F0Z B;  1NSH A;  2LP3 A;  1SPY A;  1ZAC A;  3TUY C;  1PUL A;  4CPV A;  3EVU A;  1PVB A;  1K94 A;  2F8P A;  1KQM B;  1Y1U A;  3D0Y B;  4PE0 A;  1CKK A;  4JPZ B;  1TRF A;  2L98 A;  3EKH A;  4PCW A;  3OX5 A;  1OMD A;  2EGD A;  3EVV A;  3I5I B;  4HRE E;  1KCY A;  3EK7 A;  1MWN A;  1AK8 A;  1YR5 A;  5CSN A;  2JZI A;  1MXE A;  1KFX L;  2WCF A;  1J55 A;  4ORC B;  3QRX A;  1E8A A;  1B47 A;  2M3W A;  5AER A;  4GBA A;  1JUO A;  1DTL A;  3DVK A;  2M1U A;  3TUY B;  1XFX O;  3HX4 A;  1YTZ C;  5HLV A;  2LC5 A;  4AQI A;  1QJT A;  1B9A A;  3AKB A;  1FW4 A;  3BUO B;  3ZNI A;  1IKU A;  2Y5I A;  1JFJ A;  3VRQ A;  1JF0 A;  2BKH B;  4M2P A;  3GK1 A;  1RTP 1;  3MSE B;  4P5O E;  1NX1 A;  2JU0 A;  1F70 A;  4IL1 A;  3BUW B;  2F2O A;  1S36 A;  3AKA A;  1F4O A;  1RRO A;  2ZNE A;  3DD4 A;  1MR8 A;  1ZUZ A;  4PE4 A;  1KWO B;  2ZN8 A;  1XFU O;  3TDZ A;  3JVT B;  4YGB B;  1DJG A;  2LHI A;  2M8U A;  1SR6 C;  2Y4Q A;  1YVH A;  1CFP A;  1XK4 A;  2L5X B;  2KFF A;  2E6W A;  2LLU A;  4GGF A;  1KFX S;  5I8N A;  1K93 D;  1PAL A;  1QX7 A;  2PSR A;  1UUR A;  2ZND A;  1CFC A;  1DJI A;  1A2X A;  1OQP A;  2M1K B;  1F54 A;  4MRY A;  2BCB A;  1TTX A;  1RJV A;  2JXC A;  1N2D A;  1CM4 A;  1BF5 A;  2JNX A;  1A75 B;  2K7C A;  4A4B A;  1ALV A;  4XYN A;  1UHI A;  1C7W A;  1Y1X A;  3PN7 B;  1JSA A;  1KFU L;  4FTG A;  2OS8 B;  4L9M A;  3LK1 A;  4MLW A;  1V1F A;  1CM1 A;  1U5I B;  2JOJ A;  1A4P A;  1DMO A;  1IJ6 A;  1CDP A;  3VGO A;  2GV5 A;  2VRG A;  4MSP A;  2Q4U A;  1X02 A;  1M45 A;  2MJW B;  1D1O A;  2KYC A;  1GGW A;  3IQQ A;  3NSK A;  1YRT B;  2LM5 A;  4I5K A;  1SKT A;  2ZKM X;  2JWW A;  3A8R A;  1SL8 A;  1HT9 A;  1B8R A;  3IF7 A;  5AXI A;  4BY4 A;  1IG5 A;  1C07 A;  1WDC B;  2ZRT A;  5KSZ A;  1LIN A;  2LVK A;  3O78 A;  4GUK A;  1ALW A;  2ISD A;  1Y0V H;  2TN4 A;  3EKJ A;  1F8H A;  2NZ0 A;  1CNP A;  1NCZ A;  2LNK A;  2CBL A;  1WLM A;  2CCM A;  1S6I A;  1FPW A;  1REC A;  1NX2 A;  2CTN A;  3SIB A;  2LUC A;  4A4C A;  4GFT A;  1KFU S;  3WHT B;  3NXA A;  1SNL A;  2CNP A;  1U5I A;  2BE4 A;  2NXQ A;  4Q04 A;  2ZRS A;  5ER4 X;  1AJ5 A;  1BR1 B;  1OMV A;  2MA2 A;  3KPX A;  5HLO A;  1YUT A;  2F2P A;  1CDL A;  1ZFS A;  3OX6 A;  2KFG A;  3JTD C;  2M0R A;  4PDZ A;  1SK6 D;  1JFK A;  5DKN A;  4PE1 A;  1IH0 A;  1BJF A;  2JT3 A;  1SCM C;  3O2P A;  4AQJ A;  4OR9 B;  1MF8 B;  4ZCV A;  2CT9 A;  1K9K A;  2K2A A;  1DJY A;  3LK0 A;  1WRK A;  1ZOT B;  2BL0 C;  1CFD A;  2M49 B;  2Q91 A;  4PAL A;  3VRP A;  3WXA A;  4YGA A;  3D10 A;  3TDI A;  1CDM A;  4YGD B;  5J3X A;  2OTG C;  1R6P A;  2PRU A;  2LCP A;  1J7Q A;  3LL8 B;  1ODB A;  3H4S E;  1K9P A;  4DUQ A;  1A03 A;  1W7J B;  3TZ1 A;  1J1D A;  3SG2 A;  2JRF A;  4P2Y B;  2LMU A;  3LLE A;  2MRD A;  1LVC D;  4M2O A;  1IJ5 A;  4MEW A;  2QAC A;  2BL0 B;  1S3P A;  2JQ6 A;  4CFQ A;  3BUX B;  1L2O B;  4OV2 A;  1MXL C;  2LLT A;  4U8D A;  1RK9 A;  4R1E A;  1CLL A;  5CPV A;  2OTG B;  1KSO A;  1S26 D;  4HSZ A;  4PHM A;  3SG5 A;  2Y1M A;  1LKJ A;  4ETO A;  4OKH A;  4CFR A;  1RWY A;  1TNX A;  1TCO B;  3PLF B;  4YI9 A;  4ZCU A;  1F71 A;  2COL B;  3CR2 A;  1N65 A;  2BBM A;  1FI5 A;  3PAL A;  2LAP A;  1KK8 C;  1IQ5 A;  2FCD A;  1WRL A;  2SCP A;  2M97 A;  3TDU A;  1AUI B;  1VRK A;  4M2Q A;  1B8C A;  1XA5 A;  1QVI Z;  2HET A;  3EK4 A;  1NX3 A;  4MZL A;  5CSF A;  3WHU B;  5K89 A;  1YRU B;  2WOS A;  3NSL A;  2PAS A;  2PMY A;  1AP4 A;  2LUX A;  5CSJ A;  1Y1A A;  3BUM B;  2WC8 A;  1WLZ A;  4MZK A;  3SG6 A;  1UUS A;  5TNC A;  1K2H A;  1KK7 Y;  5B8I B;  4NDD A;  2PVB A;  2SAS A;  2A4J A;  2KDH A;  1OZS A;  1QLK A;  1R2U A;  3DVM A;  1PRW A;  2FJU B;  1K90 D;  2CXJ A;  2G2B A;  3ZWH A;  1XFV O;  3EVR A;  3VRR A;  2L51 A;  4PHJ A;  1F4Q A;  1SR6 B;  2L4I A;  2KAX A;  1IQ3 A;  1J7P A;  5KU1 A;  1XO5 A;  4MBE A;  1QAS A;  1KK7 Z;  2F3Z A;  3CZT X;  2WND A;  1DT7 B;  1QLS A;  4YGE B;  5HKY A;  3BOW A;  2KI4 C;  1EH2 A;  2M29 A;  3GOF A;  3A4U B;  1UHK A;  2H61 C;  5CSI A;  2JT0 A;  4NQG A;  2KGB C;  3AAK A;  5AEQ A;  3CTN A;  4UPG A;  3OB2 B;  2DOQ A;  4DS7 A;  1Q80 A;  2HQ8 A;  2K2F A;  1FBV A;  4E68 A;  3K21 A;  1OMR A;  1AVS A;  2MLF C;  1WY9 A;  2FOT A;  3RM1 A;  4YI8 A;  4GPL B;  1CFF A;  3SIA A;  1NWD A;  1V1G A;  4WQ3 A;  5BPJ A;  2K7D A;  3O4Y A;  3BQ3 A;  1PVA A;  1M46 A;  2M9G A;  2EHB A;  4ICB A;  2KI4 B;  1CTR A;  1LA0 A;  1SL9 A;  2M7N A;  1K9U A;  2LP2 A;  2JUL A;  5FYX A;  4PHN A;  3FWC A;  2JT8 A;  5JJG A;  1K95 A;  5KTY A;  4QJ5 B;  3O6B A;  1N0Y A;  1EXR A;  1QV0 A;  3C1V A;  4D1E A;  2B1U A;  3PM8 A;  2HPS A;  4FQO A;  4DRW A;  2AMI A;  2JTZ A;  3EK8 A;  4ORB B;  1SBJ A;  3CR5 X;  2EC6 C;  3DF0 B;  1G8I A;  1XFZ O;  1ZMZ A;  2LE9 B;  2MHH A;  1LA3 A;  2AUC A;  1J7O A;  2LMV A; 
#chains in the Genus database with same CATH topology
 1FF1 A;  1B4C A;  1LXF C;  2LVI A;  4N5X A;  4AOM A;  4JQ0 D;  2L50 A;  1CMF A;  2P71 A;  1DF0 A;  3QME A;  2BBN A;  1L7Z A;  2D8N A;  1FI6 A;  1YX7 A;  1AJ4 A;  4OCI A;  2I7A A;  1M63 B;  5DKR A;  1G33 A;  2KAV A;  1YVL A;  2WCM A;  3S0B A;  2LMT A;  4I5N B;  5GQQ C;  5HKZ A;  5I2L A;  3I5H C;  1CDN A;  3GK2 A;  1TNP A;  1SY9 A;  1UHH A;  2HF5 A;  2H61 A;  2LLS A;  4TNC A;  4MVF A;  1C7V A;  4MN0 A;  2KAY A;  4PHK A;  3JTD B;  1EL4 A;  5PAL A;  1BMO A;  2WCJ A;  2PYQ A;  5HYD A;  1JC2 A;  1DGU A;  2E30 A;  3CLN A;  1BU3 A;  1SCM B;  1UHN A;  2KI6 D;  3L4A A;  3SJS A;  2V53 A;  1UWO A;  3I5I C;  2O60 A;  1B1G A;  4N1F A;  1DJW A;  1EG4 A;  1MUX A;  4WRI A;  3DVE A;  1DGV A;  1IRJ A;  1NPQ A;  3DF0 A;  4DIR A;  2PAL A;  2KYF A;  2MLE C;  2WCB A;  3RLZ A;  3S0A A;  1PK0 D;  3K1E A;  2BKI B;  3S0E A;  2Y1N A;  1QVI Y;  4HRH A;  3SS5 A;  3I5H B;  2MBX A;  1TIZ A;  3HCM A;  2KSP A;  3R1V A;  4CID A;  1BOD A;  3E3R A;  2FCE A;  2WCE A;  3M0W A;  4I5J A;  1JF2 A;  4WQ2 A;  3UNW A;  5DIC A;  3OGN A;  1YUU A;  3KF9 A;  1RFJ A;  1BLQ A;  1MQ1 A;  1S1E A;  2L0P A;  2K7O A;  1OW4 A;  1SMG A;  4KYN A;  1XFY O;  1NCX A;  1K96 A;  1DJZ A;  5HKW A;  1QAT A;  3CR4 X;  3S0G A;  1KWO C;  1NUB A;  3JVT C;  1PSB A;  3SG7 A;  3BOW B;  3CGA A;  5AFP A;  1W7I B;  1JWD A;  1TOP A;  2I18 A;  2JTT A;  1F55 A;  3TS5 C;  4GNK B;  3AAJ A;  5G08 A;  2NCO A;  2BCX A;  4FQT A;  4YGC B;  1SRA A;  3RZS A;  2L4H A;  3FE6 A;  3LCP C;  2I2R E;  4QJ3 B;  1QIW A;  1QWV A;  1CLM A;  3DYE A;  1HQV A;  1KSM A;  2K61 A;  5D69 A;  4CLN A;  4YRU A;  3FWB A;  5I2Q A;  2GTE A;  1S6C A;  1QX5 B;  2KI6 C;  1B7T Y;  1QXP A;  1KK8 B;  2O5G A;  2P6B B;  1OE9 B;  1NX0 A;  1S6J A;  1QS7 A;  3D0Y A;  1BR4 B;  1AHR A;  1J1E A;  5I2O A;  2KNE A;  3PN7 C;  5AAN A;  2OS8 C;  1UP5 A;  3CWG A;  3TS5 B;  4QJ4 B;  2L2E A;  2QPT A;  1EG3 A;  1MHO A;  1OZO A;  3D75 A;  3VRN A;  2LAN A;  3D77 A;  1CLB A;  3PAT A;  3NSI A;  1TNW A;  1IGV A;  3SG4 A;  1B7T Z;  3KEV A;  5D3O A;  1XFW O;  2K0J A;  1OSA A;  1TNQ A;  1BOC A;  2KLE A;  3DY9 A;  3FS7 A;  4XJK B;  1UHJ A;  5D7F A;  2LHL A;  2F3Y A;  3L4L A;  1A29 A;  1QX2 A;  1WDC C;  1Y6W A;  4HRG A;  1IWQ A;  2ZN9 A;  1GQM A;  1S5G Y;  1XVJ A;  1SYM A;  3OHM B;  1DF0 B;  2BEC A;  2KFH A;  1DJX A;  3I5F C;  3KO0 A;  5ER5 A;  2G9B A;  1B8L A;  2R2I A;  3PM2 A;  1TN4 A;  3PSR A;  4DCK A;  1OOG A;  3B87 A;  1YUS A;  1NCY A;  4I5L B;  2M7L A;  3CDN A;  1TWO A;  3GK4 X;  5DKQ A;  1H4B A;  1GGZ A;  1YX8 A;  3BUN B;  4YBH B;  1BG1 A;  1CMG A;  5IBW A;  1GJY A;  4PE7 A;  2I94 A;  3VRO A;  2LVJ A;  3I5G C;  3OB1 B;  2OPO A;  1S5G Z;  2RGI A;  2IS9 A;  1J7R A;  3DVJ A;  1SW8 A;  2KHN A;  4NDB A;  5F6T A;  3WNX B;  2WOR A;  3B7A A;  2JXL A;  3ICB A;  1K8U A;  1PSR A;  4ORA B;  5JOL A;  1M39 A;  3I5F B;  3IVT A;  3OP0 A;  2BCA A;  3R1O A;  1A75 A;  1QTX A;  2KQ6 A;  2K7B A;  4XJK A;  1EJ3 A;  4OVN F;  4MRX A;  2FJY A;  2ZFD A;  4BY5 A;  2LV7 A;  2KBI A;  2KOT A;  2K8M B;  4JWQ A;  4N1G A;  1KQV A;  1QIV A;  4C0K A;  3SG3 A;  3IQO A;  1SL7 A;  2F33 A;  4C0J A;  2GGM A;  2KGR A;  2MAZ A;  1DVI A;  3I5G B;  1G4Y R;  1ORG A;  1QV1 A;  1T14 A;  1M31 A;  2BE6 A;  2NLN A;  4NDC A;  2NCP A;  1YUR A;  1DEK A;  3R1P A;  4GAO A;  2HQW A;  3KHE A;  4MZJ A;  2LVV A;  2EC6 B;  1DJH A;  1KQM C;  2KQY A;  1BT6 A;  2H2K A;  2KBM A;  1XYD A;  1NIW A;  2JPT A;  3NSO A;  3CS1 A;  2JNF A;  3PFV A;  1NYA A;  4USL A;  1DQE A;  2JC2 A;  3NHI A;  3BXK A;  1NP8 A;  3FIA A;  4GGN A;  1XK4 C;  2AAO A;  1JBA A;  1H8B A;  1OOJ A;  1CB1 A;  3F45 A;  1TCF A;  4GGF C;  1L2O C;  1WRZ A;  3BYA A;  1SCV A;  2GGZ A;  4C0L A;  4F0Z B;  1NSH A;  2LP3 A;  1SPY A;  1ZAC A;  2ERB A;  3TUY C;  1PUL A;  4CPV A;  3EVU A;  1PVB A;  1K94 A;  2F8P A;  1KQM B;  1OOI X;  1Y1U A;  3D0Y B;  2PQL A;  4PE0 A;  3SS4 A;  1CKK A;  4JPZ B;  1TRF A;  2L98 A;  2WC6 A;  3EKH A;  4PCW A;  3OX5 A;  4JKT A;  1OMD A;  2EGD A;  3EVV A;  3I5I B;  4HRE E;  1KCY A;  3EK7 A;  1IIO A;  1MWN A;  1AK8 A;  2QEO A;  1YR5 A;  5CSN A;  2JZI A;  1MXE A;  1KFX L;  2WCF A;  1J55 A;  4ORC B;  3QRX A;  1E8A A;  1B47 A;  2M3W A;  5AER A;  4GBA A;  1JUO A;  1DTL A;  3DVK A;  2M1U A;  3TUY B;  1XFX O;  3HX4 A;  1P28 A;  1YTZ C;  5HLV A;  2LC5 A;  4AQI A;  1QJT A;  1B9A A;  3AKB A;  3B6X A;  1FW4 A;  3D73 A;  3BUO B;  3ZNI A;  1IKU A;  2Y5I A;  1JFJ A;  3VRQ A;  1JF0 A;  2BKH B;  4M2P A;  3GK1 A;  1RTP 1;  3MSE B;  4P5O E;  2QEH A;  1NX1 A;  2JU0 A;  1DC1 A;  1F70 A;  4IL1 A;  3BUW B;  3NGV A;  2F2O A;  1S36 A;  3AKA A;  1F4O A;  1RRO A;  2ZNE A;  3CYZ A;  3DD4 A;  1MR8 A;  3O4X A;  2WCH A;  2JPO A;  1ZUZ A;  4PE4 A;  1KWO B;  2ZN8 A;  1XFU O;  3TDZ A;  1GM0 A;  3JVT B;  4YGB B;  1DJG A;  2LHI A;  2M8U A;  3NHT A;  1SR6 C;  2Y4Q A;  1YVH A;  1CFP A;  1XK4 A;  2L5X B;  2KFF A;  2E6W A;  2LLU A;  4GGF A;  1KFX S;  5I8N A;  1K93 D;  1PAL A;  1QX7 A;  2PSR A;  1UUR A;  2ZND A;  1CFC A;  1DJI A;  1A2X A;  1OQP A;  2M1K B;  1F54 A;  4MRY A;  2BCB A;  1TTX A;  1RJV A;  2JXC A;  3D76 A;  1N2D A;  1CM4 A;  1BF5 A;  1SSE B;  2JNX A;  1A75 B;  2K7C A;  4A4B A;  1ALV A;  4XYN A;  1UHI A;  3PJI A;  3B86 A;  5EL2 A;  1C7W A;  1Y1X A;  3PN7 B;  1JSA A;  1KFU L;  4FTG A;  2OS8 B;  4L9M A;  3LK1 A;  4MLW A;  1V1F A;  1CM1 A;  1U5I B;  2JOJ A;  1A4P A;  1DMO A;  1IJ6 A;  1CDP A;  3VGO A;  2GV5 A;  2VRG A;  4MSP A;  2Q4U A;  1X02 A;  1M45 A;  2MJW B;  1D1O A;  2KYC A;  1GGW A;  3IQQ A;  3NSK A;  1OOF A;  1YRT B;  2LM5 A;  4I5K A;  1SKT A;  2ZKM X;  2JWW A;  3A8R A;  1SL8 A;  1HT9 A;  1B8R A;  3IF7 A;  5AXI A;  4BY4 A;  1IG5 A;  1C07 A;  1TUJ A;  1WDC B;  2ZRT A;  5KSZ A;  1LIN A;  2LVK A;  3O78 A;  4GUK A;  1ALW A;  2ISD A;  1Y0V H;  2TN4 A;  3EKJ A;  1F8H A;  2NZ0 A;  1CNP A;  1NCZ A;  1LS8 A;  2LNK A;  2CBL A;  1WLM A;  2CCM A;  1S6I A;  2K60 A;  1FPW A;  1REC A;  1NX2 A;  2CTN A;  3SIB A;  2LUC A;  3S0D A;  4A4C A;  3DXL A;  4GFT A;  3S0F A;  1KFU S;  3CZ1 A;  2H8V A;  3WHT B;  3NXA A;  1SNL A;  2CNP A;  1U5I A;  2BE4 A;  2NXQ A;  4Q04 A;  2ZRS A;  5ER4 X;  1AJ5 A;  1BR1 B;  1OMV A;  2MA2 A;  3KPX A;  5HLO A;  1YUT A;  2F2P A;  1CDL A;  1ZFS A;  2KLD A;  3BFH A;  3OX6 A;  2KFG A;  3CZ2 A;  2M0R A;  3JTD C;  4PDZ A;  4OZD A;  1SK6 D;  1JFK A;  5DKN A;  4PE1 A;  1IH0 A;  1BJF A;  2JT3 A;  1SCM C;  3O2P A;  4AQJ A;  4OR9 B;  1MF8 B;  4ZCV A;  2CT9 A;  1K9K A;  2K2A A;  1DJY A;  3LK0 A;  1WRK A;  1ZOT B;  2BL0 C;  1CFD A;  2M49 B;  1TUZ A;  2Q91 A;  4PAL A;  3VRP A;  3WXA A;  4YGA A;  1C3Z A;  3D10 A;  3TDI A;  1CDM A;  4YGD B;  5J3X A;  2OTG C;  1R6P A;  2PRU A;  3DZT A;  4IJ7 A;  2LCP A;  5FI2 A;  1J7Q A;  3LL8 B;  1ODB A;  3H4S E;  3BFB A;  1K9P A;  3R72 A;  4DUQ A;  1A03 A;  1W7J B;  3TZ1 A;  1J1D A;  3SG2 A;  2JRF A;  3UO9 A;  2L5Y A;  4P2Y B;  2LMU A;  3LLE A;  2MRD A;  1LVC D;  4M2O A;  1IJ5 A;  4MEW A;  2QAC A;  3L47 A;  2BL0 B;  5HL1 A;  5FI7 A;  1S3P A;  2JQ6 A;  4CFQ A;  3BUX B;  1L2O B;  4OV2 A;  1MXL C;  2LLT A;  3B88 A;  3FE8 A;  4F7F A;  3CZ0 A;  4U8D A;  1RK9 A;  4R1E A;  1CLL A;  5CPV A;  2OTG B;  3OBV A;  3N7H A;  1KSO A;  1S26 D;  4HSZ A;  5I94 A;  4PHM A;  3BJH A;  2BNX A;  3SG5 A;  2Y1M A;  1LKJ A;  3SS3 A;  4ETO A;  4OKH A;  4CFR A;  2QDI A;  1RWY A;  3CAB A;  1TNX A;  1TCO B;  3PLF B;  4YI9 A;  4ZCU A;  1F71 A;  2COL B;  3CR2 A;  1N65 A;  2WC5 A;  2BBM A;  1FI5 A;  3PAL A;  2LAP A;  1KK8 C;  1IQ5 A;  2FCD A;  1WRL A;  2SCP A;  2M97 A;  3TDU A;  1AUI B;  1VRK A;  4M2Q A;  1B8C A;  3FE9 A;  3Q8I A;  1XA5 A;  1QVI Z;  3EG5 B;  5FI6 A;  2HET A;  3EK4 A;  1NX3 A;  4MZL A;  5CSF A;  3VB1 A;  3WHU B;  5K89 A;  1YRU B;  2WOS A;  3NSL A;  2PAS A;  3V2L A;  2PMY A;  1AP4 A;  2LUX A;  5CSJ A;  1W9Z A;  1Y1A A;  3BUM B;  2WC8 A;  1WLZ A;  4MZK A;  3SG6 A;  1UUS A;  5TNC A;  1K2H A;  1KK7 Y;  5B8I B;  2QEB A;  2PVB A;  2SAS A;  4NDD A;  2A4J A;  2KDH A;  1OZS A;  1QLK A;  1R2U A;  3DVM A;  1PRW A;  2FJU B;  1K90 D;  3D78 A;  2CXJ A;  2G2B A;  2WCL A;  3ZWH A;  1XFV O;  3EVR A;  3VRR A;  2L51 A;  4PHJ A;  1F4Q A;  1SR6 B;  2L4I A;  2KAX A;  4INW A;  1IQ3 A;  1J7P A;  5KU1 A;  1XFR A;  1XO5 A;  2QEV A;  4MBE A;  1QAS A;  2BAP A;  1KK7 Z;  2F3Z A;  2YGU A;  3CZT X;  2WND A;  1DT7 B;  1QLS A;  4YGE B;  2WCK A;  5HKY A;  3BOW A;  2KI4 C;  1EH2 A;  2M29 A;  3GOF A;  3A4U B;  1UHK A;  2H61 C;  5CSI A;  2JT0 A;  4NQG A;  2KGB C;  3AAK A;  5AEQ A;  3CTN A;  2L2C A;  4UPG A;  3OB2 B;  2DOQ A;  4DS7 A;  1Q80 A;  2HQ8 A;  4PT1 A;  2K2F A;  1FBV A;  4E68 A;  3K21 A;  1OMR A;  1AVS A;  2MLF C;  1WY9 A;  2FOT A;  3RM1 A;  4YI8 A;  4GPL B;  1CFF A;  3SIA A;  1Z4H A;  1NWD A;  1V1G A;  1Z2C B;  4INX A;  4WQ3 A;  5BPJ A;  2K7D A;  3O4Y A;  3D74 A;  1C3Y A;  3BQ3 A;  1PVA A;  1M46 A;  2M9G A;  2EHB A;  4ICB A;  2KI4 B;  1CTR A;  1LA0 A;  1SL9 A;  2M7N A;  1K9U A;  2LP2 A;  2JUL A;  5FYX A;  4PHN A;  3FWC A;  2JT8 A;  5JJG A;  1OOH A;  2KPH A;  1K95 A;  5KTY A;  4QJ5 B;  3O6B A;  1N0Y A;  1EXR A;  1DEL A;  1QV0 A;  3C1V A;  4D1E A;  2B1U A;  3PM8 A;  2HPS A;  4FQO A;  4DRW A;  2P70 A;  2AMI A;  2JTZ A;  3EK8 A;  4ORB B;  1SBJ A;  3CR5 X;  2EC6 C;  3DF0 B;  1G8I A;  1XFZ O;  1ZMZ A;  3BFA A;  2LE9 B;  2MHH A;  1LA3 A;  2AUC A;  1J7O A;  4JD9 A;  2LMV A; 
#chains in the Genus database with same CATH homology
 1FF1 A;  1B4C A;  1LXF C;  2LVI A;  4N5X A;  4AOM A;  4JQ0 D;  2L50 A;  1CMF A;  1DF0 A;  2BBN A;  1L7Z A;  2D8N A;  1FI6 A;  1YX7 A;  1AJ4 A;  4OCI A;  2I7A A;  1M63 B;  5DKR A;  1G33 A;  2KAV A;  1YVL A;  2LMT A;  4I5N B;  5GQQ C;  5HKZ A;  5I2L A;  3I5H C;  1CDN A;  3GK2 A;  1TNP A;  1SY9 A;  1UHH A;  2HF5 A;  2H61 A;  2LLS A;  4TNC A;  4MVF A;  1C7V A;  4MN0 A;  2KAY A;  4PHK A;  3JTD B;  1EL4 A;  5PAL A;  1BMO A;  5HYD A;  1JC2 A;  1DGU A;  2E30 A;  3CLN A;  1BU3 A;  1SCM B;  1UHN A;  2KI6 D;  3SJS A;  2V53 A;  1UWO A;  3I5I C;  2O60 A;  1B1G A;  4N1F A;  1DJW A;  1EG4 A;  1MUX A;  4WRI A;  3DVE A;  1DGV A;  1IRJ A;  1NPQ A;  3DF0 A;  4DIR A;  2PAL A;  2KYF A;  2MLE C;  2WCB A;  3RLZ A;  1PK0 D;  2BKI B;  2Y1N A;  1QVI Y;  4HRH A;  3I5H B;  2MBX A;  1TIZ A;  3HCM A;  2KSP A;  4CID A;  1BOD A;  3E3R A;  2FCE A;  2WCE A;  3M0W A;  4I5J A;  1JF2 A;  4WQ2 A;  1YUU A;  3KF9 A;  1RFJ A;  1BLQ A;  1MQ1 A;  1S1E A;  2L0P A;  2K7O A;  1SMG A;  1XFY O;  1NCX A;  1K96 A;  1DJZ A;  5HKW A;  1QAT A;  3CR4 X;  1KWO C;  1NUB A;  3JVT C;  1PSB A;  3SG7 A;  3BOW B;  3CGA A;  5AFP A;  1W7I B;  1JWD A;  1TOP A;  2I18 A;  2JTT A;  1F55 A;  3TS5 C;  4GNK B;  3AAJ A;  5G08 A;  2NCO A;  2BCX A;  4YGC B;  1SRA A;  2L4H A;  3LCP C;  2I2R E;  4QJ3 B;  1QIW A;  1CLM A;  4YRU A;  1HQV A;  1KSM A;  2K61 A;  5D69 A;  4CLN A;  5I2Q A;  3FWB A;  1S6C A;  1QX5 B;  2KI6 C;  1B7T Y;  1QXP A;  1KK8 B;  2O5G A;  2P6B B;  1OE9 B;  1NX0 A;  1S6J A;  1QS7 A;  3D0Y A;  1BR4 B;  1AHR A;  1J1E A;  5I2O A;  2KNE A;  3PN7 C;  5AAN A;  2OS8 C;  1UP5 A;  3CWG A;  3TS5 B;  4QJ4 B;  2L2E A;  2QPT A;  1EG3 A;  1MHO A;  1OZO A;  3VRN A;  2LAN A;  1CLB A;  3PAT A;  3NSI A;  1TNW A;  1IGV A;  3SG4 A;  1B7T Z;  3KEV A;  1XFW O;  2K0J A;  1OSA A;  1TNQ A;  1BOC A;  3FS7 A;  4XJK B;  1UHJ A;  5D7F A;  2LHL A;  2F3Y A;  1A29 A;  1QX2 A;  1WDC C;  1Y6W A;  4HRG A;  1IWQ A;  2ZN9 A;  1GQM A;  1S5G Y;  1XVJ A;  1SYM A;  3OHM B;  2BEC A;  1DF0 B;  2KFH A;  1DJX A;  3I5F C;  3KO0 A;  5ER5 A;  2G9B A;  1B8L A;  2R2I A;  1TN4 A;  3PSR A;  4DCK A;  1YUS A;  1NCY A;  4I5L B;  2M7L A;  3GK4 X;  5DKQ A;  1H4B A;  1GGZ A;  1YX8 A;  3BUN B;  4YBH B;  1BG1 A;  1CMG A;  5IBW A;  1GJY A;  4PE7 A;  2I94 A;  3VRO A;  2LVJ A;  3I5G C;  3OB1 B;  2OPO A;  1S5G Z;  2RGI A;  2IS9 A;  1J7R A;  3DVJ A;  1SW8 A;  2KHN A;  4NDB A;  5F6T A;  3WNX B;  2WOR A;  3ICB A;  2JXL A;  1K8U A;  1PSR A;  4ORA B;  5JOL A;  1M39 A;  3I5F B;  3OP0 A;  2BCA A;  1A75 A;  1QTX A;  2KQ6 A;  2K7B A;  4XJK A;  1EJ3 A;  4OVN F;  4MRX A;  2ZFD A;  4BY5 A;  2LV7 A;  2KBI A;  2KOT A;  2K8M B;  4JWQ A;  4N1G A;  1KQV A;  1QIV A;  4C0K A;  3SG3 A;  3IQO A;  1SL7 A;  2F33 A;  4C0J A;  2GGM A;  2KGR A;  2MAZ A;  1DVI A;  3I5G B;  1G4Y R;  1QV1 A;  1M31 A;  2BE6 A;  2NLN A;  4NDC A;  2NCP A;  1YUR A;  4GAO A;  2HQW A;  3KHE A;  4MZJ A;  2LVV A;  2EC6 B;  1DJH A;  1KQM C;  2KQY A;  1BT6 A;  2H2K A;  2KBM A;  1XYD A;  1NIW A;  2JPT A;  3NSO A;  3CS1 A;  2JNF A;  3PFV A;  1NYA A;  4USL A;  2JC2 A;  3BXK A;  1NP8 A;  3FIA A;  4GGN A;  1XK4 C;  2AAO A;  1JBA A;  1H8B A;  1OOJ A;  1CB1 A;  3F45 A;  1TCF A;  4GGF C;  1L2O C;  1WRZ A;  3BYA A;  1SCV A;  2GGZ A;  4C0L A;  4F0Z B;  1NSH A;  2LP3 A;  1SPY A;  1ZAC A;  3TUY C;  1PUL A;  4CPV A;  3EVU A;  1PVB A;  1K94 A;  2F8P A;  1KQM B;  1Y1U A;  3D0Y B;  4PE0 A;  1CKK A;  4JPZ B;  1TRF A;  2L98 A;  3EKH A;  4PCW A;  3OX5 A;  1OMD A;  2EGD A;  3EVV A;  3I5I B;  4HRE E;  1KCY A;  3EK7 A;  1MWN A;  1AK8 A;  1YR5 A;  5CSN A;  2JZI A;  1MXE A;  1KFX L;  2WCF A;  1J55 A;  4ORC B;  3QRX A;  1E8A A;  1B47 A;  2M3W A;  5AER A;  4GBA A;  1JUO A;  1DTL A;  3DVK A;  2M1U A;  3TUY B;  1XFX O;  3HX4 A;  1YTZ C;  5HLV A;  2LC5 A;  4AQI A;  1QJT A;  1B9A A;  3AKB A;  1FW4 A;  3BUO B;  3ZNI A;  1IKU A;  2Y5I A;  1JFJ A;  3VRQ A;  1JF0 A;  2BKH B;  4M2P A;  3GK1 A;  1RTP 1;  3MSE B;  4P5O E;  1NX1 A;  2JU0 A;  1F70 A;  4IL1 A;  3BUW B;  2F2O A;  1S36 A;  3AKA A;  1F4O A;  1RRO A;  2ZNE A;  3DD4 A;  1MR8 A;  1ZUZ A;  4PE4 A;  1KWO B;  2ZN8 A;  1XFU O;  3TDZ A;  3JVT B;  4YGB B;  1DJG A;  2LHI A;  2M8U A;  1SR6 C;  2Y4Q A;  1YVH A;  1CFP A;  1XK4 A;  2L5X B;  2KFF A;  2E6W A;  2LLU A;  4GGF A;  1KFX S;  5I8N A;  1K93 D;  1PAL A;  1QX7 A;  2PSR A;  1UUR A;  2ZND A;  1CFC A;  1DJI A;  1A2X A;  1OQP A;  2M1K B;  1F54 A;  4MRY A;  2BCB A;  1TTX A;  1RJV A;  2JXC A;  1N2D A;  1CM4 A;  1BF5 A;  2JNX A;  1A75 B;  2K7C A;  4A4B A;  1ALV A;  4XYN A;  1UHI A;  1C7W A;  1Y1X A;  3PN7 B;  1JSA A;  1KFU L;  4FTG A;  2OS8 B;  4L9M A;  3LK1 A;  4MLW A;  1V1F A;  1CM1 A;  1U5I B;  2JOJ A;  1A4P A;  1DMO A;  1IJ6 A;  1CDP A;  3VGO A;  2GV5 A;  2VRG A;  4MSP A;  2Q4U A;  1X02 A;  1M45 A;  2MJW B;  1D1O A;  2KYC A;  1GGW A;  3IQQ A;  3NSK A;  1YRT B;  2LM5 A;  4I5K A;  1SKT A;  2ZKM X;  2JWW A;  3A8R A;  1SL8 A;  1HT9 A;  1B8R A;  3IF7 A;  5AXI A;  4BY4 A;  1IG5 A;  1C07 A;  1WDC B;  2ZRT A;  5KSZ A;  1LIN A;  2LVK A;  3O78 A;  4GUK A;  1ALW A;  2ISD A;  1Y0V H;  2TN4 A;  3EKJ A;  1F8H A;  2NZ0 A;  1CNP A;  1NCZ A;  2LNK A;  2CBL A;  1WLM A;  2CCM A;  1S6I A;  1FPW A;  1REC A;  1NX2 A;  2CTN A;  3SIB A;  2LUC A;  4A4C A;  4GFT A;  1KFU S;  3WHT B;  3NXA A;  1SNL A;  2CNP A;  1U5I A;  2BE4 A;  2NXQ A;  4Q04 A;  2ZRS A;  5ER4 X;  1AJ5 A;  1BR1 B;  1OMV A;  2MA2 A;  3KPX A;  5HLO A;  1YUT A;  2F2P A;  1CDL A;  1ZFS A;  3OX6 A;  2KFG A;  3JTD C;  2M0R A;  4PDZ A;  1SK6 D;  1JFK A;  5DKN A;  4PE1 A;  1IH0 A;  1BJF A;  2JT3 A;  1SCM C;  3O2P A;  4AQJ A;  4OR9 B;  1MF8 B;  4ZCV A;  2CT9 A;  1K9K A;  2K2A A;  1DJY A;  3LK0 A;  1WRK A;  1ZOT B;  2BL0 C;  1CFD A;  2M49 B;  2Q91 A;  4PAL A;  3VRP A;  3WXA A;  4YGA A;  3D10 A;  3TDI A;  1CDM A;  4YGD B;  5J3X A;  2OTG C;  1R6P A;  2PRU A;  2LCP A;  1J7Q A;  3LL8 B;  1ODB A;  3H4S E;  1K9P A;  4DUQ A;  1A03 A;  1W7J B;  3TZ1 A;  1J1D A;  3SG2 A;  2JRF A;  4P2Y B;  2LMU A;  3LLE A;  2MRD A;  1LVC D;  4M2O A;  1IJ5 A;  4MEW A;  2QAC A;  2BL0 B;  1S3P A;  2JQ6 A;  4CFQ A;  3BUX B;  1L2O B;  4OV2 A;  1MXL C;  2LLT A;  4U8D A;  1RK9 A;  4R1E A;  1CLL A;  5CPV A;  2OTG B;  1KSO A;  1S26 D;  4HSZ A;  4PHM A;  3SG5 A;  2Y1M A;  1LKJ A;  4ETO A;  4OKH A;  4CFR A;  1RWY A;  1TNX A;  1TCO B;  3PLF B;  4YI9 A;  4ZCU A;  1F71 A;  2COL B;  3CR2 A;  1N65 A;  2BBM A;  1FI5 A;  3PAL A;  2LAP A;  1KK8 C;  1IQ5 A;  2FCD A;  1WRL A;  2SCP A;  2M97 A;  3TDU A;  1AUI B;  1VRK A;  4M2Q A;  1B8C A;  1XA5 A;  1QVI Z;  2HET A;  3EK4 A;  1NX3 A;  4MZL A;  5CSF A;  3WHU B;  5K89 A;  1YRU B;  2WOS A;  3NSL A;  2PAS A;  2PMY A;  1AP4 A;  2LUX A;  5CSJ A;  1Y1A A;  3BUM B;  2WC8 A;  1WLZ A;  4MZK A;  3SG6 A;  1UUS A;  5TNC A;  1K2H A;  1KK7 Y;  5B8I B;  4NDD A;  2PVB A;  2SAS A;  2A4J A;  2KDH A;  1OZS A;  1QLK A;  1R2U A;  3DVM A;  1PRW A;  2FJU B;  1K90 D;  2CXJ A;  2G2B A;  3ZWH A;  1XFV O;  3EVR A;  3VRR A;  2L51 A;  4PHJ A;  1F4Q A;  1SR6 B;  2L4I A;  2KAX A;  1IQ3 A;  1J7P A;  5KU1 A;  1XO5 A;  4MBE A;  1QAS A;  1KK7 Z;  2F3Z A;  3CZT X;  2WND A;  1DT7 B;  1QLS A;  4YGE B;  5HKY A;  3BOW A;  2KI4 C;  1EH2 A;  2M29 A;  3GOF A;  3A4U B;  1UHK A;  2H61 C;  5CSI A;  2JT0 A;  4NQG A;  2KGB C;  3AAK A;  5AEQ A;  3CTN A;  4UPG A;  3OB2 B;  2DOQ A;  4DS7 A;  1Q80 A;  2HQ8 A;  2K2F A;  1FBV A;  4E68 A;  3K21 A;  1OMR A;  1AVS A;  2MLF C;  1WY9 A;  2FOT A;  3RM1 A;  4YI8 A;  4GPL B;  1CFF A;  3SIA A;  1NWD A;  1V1G A;  4WQ3 A;  5BPJ A;  2K7D A;  3O4Y A;  3BQ3 A;  1PVA A;  1M46 A;  2M9G A;  2EHB A;  4ICB A;  2KI4 B;  1CTR A;  1LA0 A;  1SL9 A;  2M7N A;  1K9U A;  2LP2 A;  2JUL A;  5FYX A;  4PHN A;  3FWC A;  2JT8 A;  5JJG A;  1K95 A;  5KTY A;  4QJ5 B;  3O6B A;  1N0Y A;  1EXR A;  1QV0 A;  3C1V A;  4D1E A;  2B1U A;  3PM8 A;  2HPS A;  4FQO A;  4DRW A;  2AMI A;  2JTZ A;  3EK8 A;  4ORB B;  1SBJ A;  3CR5 X;  2EC6 C;  3DF0 B;  1G8I A;  1XFZ O;  1ZMZ A;  2LE9 B;  2MHH A;  1LA3 A;  2AUC A;  1J7O A;  2LMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...