4YRUA

Crystal structure of c-terminally truncated neuronal calcium sensor (ncs-1) from rattus norvegicus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
159
structure length
151
Chain Sequence
LTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTTPEKRVDRIFAMMDKNADGKLTLQEFQEGSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Neuronal calcium sensor 1
publication title Neuronal Calcium Sensor-1 Binds the D2 Dopamine Receptor and G-protein-coupled Receptor Kinase 1 (GRK1) Peptides Using Different Modes of Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 47
structure length 151
sequence length 159
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yruA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4yruA02
1QX5B 1E8AA 1F54A 1RK9A 1BR4B 5JOLA 2F2PA 4BY4A 4Q04A 2SASA 2F2OA 1QV0A 2JPTA 1CDLA 3CR5X 1NYAA 4PE7A 1UHHA 1BT6A 4JQ0D 1W7JB 2KAYA 1DGVA 5D69A 1TN4A 2DOQA 2OS8B 1B9AA 5F6TA 1BF5A 1WRZA 4ORBB 2Y5IA 4I5JA 4CIDA 1JC2A 3PALA 3PN7B 1S1EA 3QRXA 3VRQA 2HPSA 1BG1A 2LLSA 2LHLA 1SKTA 1CFDA 3BOWB 1NX0A 4FQOA 4U8DA 1CMGA 1J7PA 1ALWA 1CDNA 1MWNA 2KBMA 3EVUA 4WQ3A 3OP0A 1QVIY 1S5GZ 3OB1B 1ZOTB 1SY9A 4HRHA 1DJHA 2M9GA 1OZSA 3FWBA 2BCXA 4MZKA 4ETOA 4UPGA 1ODBA 4MLWA 1WDCC 1DJGA 4CLNA 1SCMC 1GGWA 1UHIA 1UHJA 3OX6A 1SBJA 1KQVA 2L51A 3SG2A 4PE0A 1DJWA 1RTP1 1WY9A 2F3ZA 3VROA 4C0JA 1DJZA 3D10A 1DJXA 2ZNDA 1SR6C 4YGCB 1PSBA 1HT9A 5KTYA 1BU3A 1OMDA 1M63B 2LVJA 2KAVA 2L0PA 1DVIA 1FF1A 1BMOA 4R1EA 1QLSA 4GGFC 2KFHA 1QIVA 1TNWA 1ALVA 1BJFA 1XFZO 2Q91A 5DKQA 2M8UA 5IBWA 2L4HA 2JULA 2BL0C 3HCMA 1OMVA 1QJTA 2PSRA 4XYNA 1QIWA 3JTDB 2LANA 4OKHA 1HQVA 3H4SE 3DD4A 3FIAA 4XJKA 1JF2A 2MLFC 4P2YB 3O78A 4PHMA 2KAXA 1L7ZA 1B8RA 5ER4X 2OPOA 4DCKA 2WCEA 3I5FB 4HSZA 2FJUB 1LA3A 2JT8A 1U5IB 2FCDA 1MHOA 3OHMB 4C0LA 3TS5B 1FBVA 1JF0A 1V1GA 1N0YA 4P5OE 1OE9B 3DF0B 1TNQA 1G33A 2JT0A 1DJIA 2K7CA 4MVFA 1XFWO 1IQ5A 2E30A 1ZMZA 5GQQC 1BR1B 1K2HA 3GOFA 3I5IB 3VRPA 4PE4A 1UURA 3LK1A 5FYXA 1K9KA 4YI8A 3EKJA 4YGBB 3LL8B 3A8RA 3KHEA 2V53A 2COLB 4MRXA 2JTTA 2GGZA 5KU1A 4I5LB 3HX4A 4TNCA 2BBNA 4QJ4B 3DVEA 4OVNF 4MZJA 5ER5A 4YRUA 2JWWA 3DVMA 2ZNEA 1K93D 2HF5A 1SL8A 4N1GA 1B47A 1AK8A 3TDUA 2KGBC 2ZN8A 2LLUA 2L4IA 1TRFA 2Y1MA 1KCYA 1J1DA 2BE6A 5AANA 3SIAA 3NSIA 1KFXL 1YVHA 1Y1AA 4ICBA 4PCWA 2BKIB 1XYDA 2M29A 4DIRA 1G8IA 2WNDA 3GK4X 2M49B 3KEVA 3PSRA 1B1GA 4ORCB 2AMIA 2ZN9A 5J3XA 1PK0D 1SNLA 2I7AA 3JVTB 2M7LA 2OTGB 3I5HB 3IF7A 2LUXA 1S6IA 1KFXS 1MR8A 1A2XA 1TTXA 1NWDA 1OOJA 5AFPA 1ZFSA 2FOTA 5TNCA 1WLMA 1YRTB 2KYCA 4A4BA 3DVJA 3BUXB 4HREE 1IJ6A 3LCPC 1NCYA 2OTGC 2H61C 3I5GC 3AAJA 1EJ3A 4DS7A 1KWOB 1QX2A 2KQ6A 4I5KA 1TOPA 4F0ZB 2KGRA 1XFVO 3O4YA 1YURA 1L2OB 2PVBA 1KFUL 1SCVA 2WC8A 1S6CA 2LAPA 1A03A 1IRJA 1TCFA 1BLQA 1JFKA 2KSPA 1GGZA 2EGDA 3PATA 5AXIA 3F45A 1UWOA 1S36A 3NSLA 2CCMA 1R6PA 4NDCA 2K8MB 2OS8C 1JBAA 4IL1A 1KWOC 2PRUA 5PALA 4QJ5B 2L2EA 1CTRA 2F8PA 1KSMA 2LMUA 2A4JA 1L2OC 1SK6D 3PN7C 1CLBA 2F3YA 3D0YB 1F71A 1IG5A 1J7OA 3CS1A 2JNFA 2K61A 2KI6D 2M3WA 2NCOA 2BE4A 3NSKA 2JXLA 1J1EA 2M0RA 1V1FA 5DKNA 2CTNA 1SL7A 3EK8A 3ZNIA 1UUSA 1AUIB 1PVBA 1DTLA 1YRUB 2EHBA 4DRWA 4PHKA 1F70A 1QX7A 2KHNA 2NZ0A 3D0YA 2MRDA 3IQOA 1RECA 5CSJA 1LVCD 1YUSA 5HKWA 1YX7A 3CR4X 2KI6C 4M2OA 1PULA 2H2KA 2LC5A 5DKRA 5G08A 4YBHB 1CFFA 1WLZA 4XJKB 4CPVA 2ZRSA 4GFTA 2JZIA 1LKJA 1LA0A 1EXRA 1AVSA 3C1VA 1IQ3A 1EH2A 1FPWA 4JWQA 3TZ1A 2CXJA 5HLVA 1XK4C 2LP3A 2JT3A 1S5GY 4GAOA 1B8LA 3RLZA 3M0WA 3NXAA 4MZLA 5HYDA 2GGMA 4AOMA 1F55A 3SIBA 1CKKA 1C07A 3EK4A 1F4OA 1W7IB 4CFRA 1FI6A 3FWCA 3JTDC 2BCAA 2LV7A 2PALA 1YR5A 3BUMB 1KK7Z 3CTNA 2JRFA 5I8NA 2ZFDA 3O6BA 1JUOA 2AUCA 2CNPA 2KI4B 2WOSA 2NXQA 1SRAA 3I5FC 2CBLA 1BOCA 1K90D 2KQYA 2M97A 3A4UB 3EVRA 5HKYA 3TDZA 2LCPA 1NX3A 3TS5C 2MJWB 4MBEA 1BODA 1CM1A 2WCBA 5JJGA 1OMRA 2KI4C 1QV1A 2ZRTA 4ZCVA 4OV2A 1EL4A 2KBIA 4C0KA 2M1UA 3I5IC 1DT7B 1XFXO 4PDZA 1XA5A 2QPTA 1PALA 1M45A 1J7RA 1DGUA 1RWYA 3EK7A 4WRIA 1SYMA 1AP4A 2K7BA 4A4CA 1A29A 4ZCUA 2JC2A 2I18A 1X02A 1IWQA 3VRNA 5BPJA 1RJVA 2E6WA 1KQMB 1YUTA 2BCBA 2LM5A 3EKHA 1GQMA 4JPZB 3SG4A 1NIWA 4OCIA 1DJYA 1CLMA 1UHNA 1R2UA 1NUBA 3E3RA 1UHKA 1TNPA 1S3PA 1QLKA 1RROA 5CPVA 5B8IB 1YX8A 2JNXA 1N65A 1NP8A 4FTGA 1A4PA 2MHHA 3GK2A 1KQMC 1QS7A 4N5XA 4GUKA 4BY5A 1S6JA 3JVTC 1AHRA 3CWGA 1DF0A 4D1EA 1RFJA 3BYAA 3I5HC 3ZWHA 2KFGA 1QVIZ 2VRGA 4GBAA 2QACA 2ISDA 3DVKA 1DMOA 1CNPA 1F4QA 2LP2A 3SG7A 4MRYA 1QTXA 3IQQA 3GK1A 3O2PA 1YUUA 4YGEB 1IGVA 2K7OA 1PRWA 2L98A 2LVKA 1FI5A 4OR9B 1GJYA 1NX1A 2JQ6A 1KFUS 1QATA 2PASA 4L9MA 2LMVA 5AEQA 2KDHA 1CFPA 2BKHB 1VRKA 2LHIA 2H61A 3BUNB 1M46A 1TIZA 2I2RE 1QASA 1TNXA 3CR2A 1A75B 2KFFA 5CSIA 1CLLA 3KF9A 3WXAA 1IH0A 1XVJA 2Q4UA 2JTZA 3SJSA 1WDCB 2MAZA 1SCMB 3EVVA 1NCZA 2O60A 1KK8B 4E68A 3ICBA 5CSFA 4PHJA 3VRRA 4GPLB 2EC6B 1K94A 2L50A 1A75A 2CT9A 5KSZA 1K95A 3SG6A 1SL9A 4GNKB 2O5GA 4CFQA 1MXLC 2Y1NA 1SR6B 3BOWA 3MSEB 3PM8A 1M31A 1H4BA 4PALA 1KK8C 2K0JA 1JFJA 3KPXA 1YVLA 2SCPA 1Y1XA 1SMGA 2EC6C 2LE9B 3SG3A 3OX5A 4YI9A 3SG5A 4I5NB 2MA2A 1N2DA 3BUWB 5K89A 1XFUO 2B1UA 2LUCA 1MF8B 2BL0B 4MN0A 3LLEA 1SW8A 1PSRA 5I2LA 3WNXB 2HQWA 4NDBA 4YGDB 3FS7A 2MLEC 2KNEA 2NCPA 2Y4QA 4GGFA 3OB2B 1SPYA 1TCOB 2L5XB 1S26D 1D1OA 1UP5A 4N1FA 2M7NA 2WCFA 1NX2A 1YTZC 1ZUZA 1XK4A 4AQIA 3TDIA 5HLOA 3NSOA 3WHUB 2I94A 4M2PA 2JOJA 1MQ1A 1WRKA 2K7DA 3BXKA 3LK0A 1Y6WA 1KSOA 1LINA 1CDPA 3AAKA 2MBXA 1Y1UA 1IKUA 2BBMA 2WORA 3RM1A 2RGIA 1M39A 2G9BA 2KOTA 2LVIA 3WHTB 4NDDA 1AJ5A 1B7TZ 2KYFA 1OQPA 1QXPA 2F33A 3K21A 4HRGA 5AERA 1FW4A 3VGOA 1JSAA 1XFYO 2ZKMX 3CGAA 1NCXA 2LLTA 2R2IA 3AKBA 2BECA 2M1KB 1CMFA 1C7VA 3PFVA 1K8UA 3BUOB 3PLFB 1K9PA 1G4YR 2HQ8A 2JU0A 1U5IA 1C7WA 3TUYB 1NPQA 2K2AA 2D8NA 1K96A 1MXEA 1F8HA 1Q80A 1KK7Y 2GV5A 1B4CA 3DF0A 4USLA 2LNKA 1DF0B 1IJ5A 1XO5A 2IS9A 1B8CA 1J55A 1Y0VH 4PE1A 4YGAA 1MUXA 4M2QA 4QJ3B 4WQ2A 4DUQA 4PHNA 3TUYC 2JXCA 5I2QA 4MEWA 1CFCA 1CB1A 2HETA 1ZACA 2K2FA 2LVVA 1PVAA 1OSAA 1J7QA 2AAOA 1JWDA 2G2BA 5D7FA 2NLNA 5HKZA 1K9UA 1B7TY 1EG4A 1EG3A 2P6BB 5I2OA 2TN4A 1AJ4A 2LMTA 4GGNA 3KO0A 3BQ3A 4NQGA 2FCEA 4AQJA 1LXFC 1CDMA 3CLNA 3AKAA 4ORAB 3I5GB 4MSPA 5CSNA 1H8BA 1WRLA 1OZOA 1CM4A 1NSHA 3CZTX 2PMYA
chains in the Genus database with same CATH superfamily
1QX5B 1E8AA 1F54A 4F7FA 1RK9A 1BR4B 3L4LA 2F2PA 5JOLA 4BY4A 4Q04A 2SASA 2F2OA 1QV0A 2JPTA 1CDLA 3CR5X 1NYAA 4PE7A 1UHHA 1BT6A 4JQ0D 1W7JB 2KAYA 1DGVA 5D69A 3BJHA 1TN4A 2DOQA 2OS8B 1B9AA 3FE8A 3K1EA 5F6TA 1BF5A 1WRZA 3B7AA 4ORBB 2Y5IA 4I5JA 4CIDA 1JC2A 3PALA 3PN7B 1ORGA 1S1EA 3QRXA 3VRQA 2HPSA 1BG1A 3R1VA 2LLSA 2LHLA 1SKTA 1CFDA 3BOWB 1NX0A 4FQOA 3CYZA 4U8DA 3SS3A 1CMGA 1J7PA 1ALWA 1CDNA 1MWNA 3S0GA 2KBMA 2WCLA 3EVUA 4WQ3A 3OP0A 1QVIY 2L5YA 2WC6A 1S5GZ 1OW4A 3OB1B 1ZOTB 1SY9A 4HRHA 1DJHA 2M9GA 1OOHA 1OZSA 3FWBA 2BCXA 4MZKA 2JPOA 4ETOA 4UPGA 1ODBA 4MLWA 1WDCC 2KLEA 1DJGA 4CLNA 1SCMC 1GGWA 1UHIA 1UHJA 3OX6A 1SBJA 1DC1A 2KLDA 5FI6A 1KQVA 2L51A 3SG2A 4PE0A 1DJWA 1RTP1 4OZDA 1WY9A 2F3ZA 2WCJA 3VROA 4C0JA 5DICA 1DJZA 3D10A 1DJXA 2ZNDA 1SR6C 4YGCB 1PSBA 1HT9A 5KTYA 1BU3A 1OMDA 1M63B 2LVJA 2KAVA 2L0PA 1DVIA 1T14A 1FF1A 1BMOA 4R1EA 5FI2A 4JD9A 1QLSA 1GM0A 4GGFC 2KFHA 1OOIX 4PT1A 1QIVA 1TNWA 1ALVA 1BJFA 1XFZO 5HL1A 2Q91A 5DKQA 2M8UA 5IBWA 2L4HA 2JULA 2BL0C 3HCMA 1P28A 1OMVA 1QJTA 2PSRA 3BFAA 4XYNA 1QIWA 3JTDB 2LANA 4OKHA 1HQVA 3H4SE 3DD4A 3FIAA 4XJKA 1JF2A 2ERBA 2MLFC 3O78A 4P2YB 4PHMA 2KAXA 1L7ZA 1B8RA 5ER4X 2OPOA 4DCKA 2WCEA 3I5FB 4HSZA 2FJUB 1LA3A 2JT8A 3QMEA 1U5IB 2FCDA 1MHOA 3OHMB 3B86A 4C0LA 3TS5B 2PYQA 1FBVA 1JF0A 1V1GA 1N0YA 4P5OE 1OE9B 3DF0B 3CZ2A 1TNQA 1G33A 2JT0A 1DJIA 2K7CA 4MVFA 3FE9A 1XFWO 1IQ5A 2E30A 1ZMZA 5GQQC 1BR1B 1K2HA 3GOFA 2PQLA 3L4AA 3I5IB 3VRPA 4PE4A 1UURA 3LK1A 5FYXA 1K9KA 4YI8A 3EKJA 4JKTA 4YGBB 3LL8B 1SSEB 3A8RA 3KHEA 2V53A 2COLB 4MRXA 2JTTA 2GGZA 5KU1A 4I5LB 3HX4A 4TNCA 2BBNA 4QJ4B 3DVEA 4OVNF 4MZJA 5ER5A 4YRUA 2JWWA 3DVMA 2ZNEA 1K93D 2HF5A 1SL8A 4N1GA 1B47A 1AK8A 3TDUA 2KGBC 2ZN8A 2LLUA 3SS4A 2L4IA 1TRFA 2Y1MA 1KCYA 1J1DA 2BE6A 4KYNA 5AANA 3SIAA 3NSIA 1KFXL 1YVHA 1Y1AA 4ICBA 4PCWA 2BKIB 1XYDA 2M29A 4DIRA 1G8IA 2WNDA 3GK4X 3PM2A 2M49B 3UO9A 3KEVA 3B87A 3PSRA 1B1GA 4ORCB 2AMIA 2ZN9A 5J3XA 1PK0D 1SNLA 2I7AA 3JVTB 2M7LA 1TUJA 2OTGB 3I5HB 3IF7A 2LUXA 1S6IA 2WCMA 1KFXS 1MR8A 1A2XA 1OOFA 1TTXA 1NWDA 1OOJA 1LS8A 5AFPA 1ZFSA 2FOTA 5TNCA 1WLMA 1YRTB 2KYCA 4A4BA 3DVJA 3BUXB 4HREE 1DQEA 1IJ6A 3LCPC 1NCYA 2OTGC 3B88A 2H61C 3I5GC 3AAJA 1EJ3A 4DS7A 1KWOB 1QX2A 2KQ6A 4I5KA 1TOPA 2K60A 4F0ZB 2KGRA 1XFVO 3O4YA 1YURA 1L2OB 2PVBA 1KFUL 1SCVA 2WC8A 1S6CA 2LAPA 1A03A 1IRJA 1TCFA 1BLQA 1JFKA 2KSPA 3BFBA 2EGDA 3PATA 5AXIA 3F45A 1UWOA 1S36A 3NSLA 2CCMA 1R6PA 1XFRA 4NDCA 2GTEA 2K8MB 2OS8C 1JBAA 4IL1A 1KWOC 2PRUA 5PALA 3O4XA 4QJ5B 2L2EA 1CTRA 2F8PA 1KSMA 2LMUA 2A4JA 1L2OC 1SK6D 3PN7C 1CLBA 2F3YA 3D0YB 1F71A 1IG5A 3IVTA 3CS1A 1J7OA 2JNFA 2K61A 2KI6D 2M3WA 2NCOA 2BE4A 3NSKA 2JXLA 1J1EA 3S0BA 2M0RA 1V1FA 5DKNA 2CTNA 1SL7A 3EK8A 3ZNIA 1UUSA 1AUIB 1PVBA 1DTLA 4INXA 1YRUB 2EHBA 4DRWA 4PHKA 1F70A 1QX7A 2KHNA 2NZ0A 3D0YA 2MRDA 3DZTA 1RECA 3IQOA 2FJYA 1LVCD 5CSJA 1YUSA 5HKWA 1YX7A 3CR4X 2KI6C 4M2OA 1PULA 2H2KA 2LC5A 5DKRA 5G08A 4YBHB 1CFFA 1WLZA 4XJKB 4CPVA 2ZRSA 3S0AA 2WCKA 4GFTA 2JZIA 1LKJA 1LA0A 1EXRA 1AVSA 3C1VA 3OGNA 1IQ3A 1EH2A 1TUZA 3CABA 1FPWA 4JWQA 3TZ1A 2CXJA 2KPHA 2BNXA 1XK4C 2LP3A 5HLVA 2JT3A 1S5GY 3D76A 4GAOA 1B8LA 3RLZA 3M0WA 3D73A 3NXAA 4MZLA 5FI7A 3B6XA 2GGMA 5HYDA 4AOMA 1F55A 2QEBA 3SIBA 1CKKA 1C07A 3EK4A 5I94A 1IIOA 1F4OA 1W7IB 3CDNA 4CFRA 1FI6A 3FWCA 3JTDC 2BCAA 2LV7A 2PALA 1YR5A 3BUMB 1KK7Z 3CTNA 3DXLA 2JRFA 5I8NA 2ZFDA 3O6BA 1JUOA 2AUCA 2CNPA 2KI4B 2WOSA 2NXQA 1SRAA 2YGUA 3I5FC 2CBLA 3V2LA 1K90D 2KQYA 1BOCA 2M97A 3A4UB 3UNWA 3EVRA 5HKYA 3TDZA 2LCPA 1NX3A 3TS5C 3NGVA 2MJWB 4MBEA 1BODA 1CM1A 2WCBA 5JJGA 3NHIA 1OMRA 2KI4C 1QV1A 2ZRTA 2QEOA 4ZCVA 2L2CA 4OV2A 1EL4A 3CZ1A 3D77A 2KBIA 4C0KA 2M1UA 3I5IC 1DT7B 1XFXO 4PDZA 1XA5A 2QPTA 3D74A 1PALA 1M45A 2H8VA 1J7RA 1DGUA 1RWYA 3EK7A 4WRIA 1SYMA 1AP4A 3CZ0A 2K7BA 1DEKA 1A29A 4A4CA 4ZCUA 2JC2A 2I18A 1X02A 1IWQA 2QEVA 3VRNA 5BPJA 1RJVA 2E6WA 1KQMB 1YUTA 2BCBA 2LM5A 3RZSA 3EKHA 1GQMA 4JPZB 2BAPA 1NIWA 4OCIA 5D3OA 1DJYA 1CLMA 1UHNA 3SG4A 1R2UA 1NUBA 3E3RA 1UHKA 1TNPA 1S3PA 1QLKA 1RROA 5CPVA 5B8IB 1YX8A 2JNXA 1N65A 1NP8A 2QDIA 4FTGA 1A4PA 2MHHA 3GK2A 1KQMC 1QS7A 4N5XA 4GUKA 4BY5A 3R1OA 1S6JA 3JVTC 1Z2CB 1AHRA 3CWGA 1DF0A 4D1EA 1RFJA 3BYAA 3I5HC 3ZWHA 2KFGA 1QVIZ 3EG5B 2VRGA 3R72A 4GBAA 3N7HA 2QACA 2ISDA 3DVKA 1DMOA 1CNPA 1F4QA 2LP2A 5EL2A 3SG7A 4MRYA 1QTXA 3IQQA 3GK1A 3O2PA 1YUUA 4YGEB 1IGVA 2K7OA 1PRWA 2L98A 2LVKA 1FI5A 4OR9B 1GJYA 1NX1A 2JQ6A 1KFUS 1QATA 2PASA 4L9MA 2LMVA 5AEQA 2KDHA 1CFPA 2BKHB 1VRKA 2LHIA 2H61A 3BUNB 1M46A 1TIZA 2I2RE 1QASA 1TNXA 3CR2A 1OOGA 1A75B 2KFFA 5CSIA 1CLLA 3KF9A 3WXAA 1IH0A 1XVJA 2Q4UA 2JTZA 3SJSA 1DELA 1WDCB 2MAZA 1SCMB 3EVVA 1NCZA 2O60A 1KK8B 4E68A 3ICBA 5CSFA 2WCHA 4PHJA 3VRRA 4GPLB 2EC6B 1K94A 2L50A 1A75A 2CT9A 5KSZA 1K95A 3SG6A 1SL9A 4GNKB 2O5GA 4CFQA 1MXLC 2Y1NA 1SR6B 3BOWA 3MSEB 3PM8A 1M31A 1H4BA 4PALA 1KK8C 2K0JA 1JFJA 3KPXA 1YVLA 2SCPA 1Y1XA 1SMGA 2EC6C 2LE9B 3SG3A 3OX5A 4YI9A 3SG5A 4I5NB 1C3ZA 2MA2A 1N2DA 1Z4HA 3BUWB 5K89A 1XFUO 2B1UA 2LUCA 1MF8B 2BL0B 2P70A 4MN0A 3LLEA 1SW8A 3DY9A 1PSRA 5I2LA 3WNXB 2HQWA 4NDBA 4YGDB 3FS7A 2MLEC 3S0DA 2KNEA 2NCPA 2Y4QA 4GGFA 3OB2B 1SPYA 1TCOB 2L5XB 1S26D 3SS5A 1D1OA 1UP5A 4N1FA 2M7NA 2WCFA 1NX2A 1YTZC 1ZUZA 1XK4A 4AQIA 3TDIA 3PJIA 5HLOA 1C3YA 3FE6A 4FQTA 3NSOA 3WHUB 2I94A 3Q8IA 4M2PA 2JOJA 1MQ1A 1WRKA 3L47A 2K7DA 3BXKA 3LK0A 1Y6WA 1KSOA 1LINA 1CDPA 3AAKA 2MBXA 1Y1UA 1IKUA 2BBMA 2WORA 3RM1A 2RGIA 1M39A 3DYEA 2G9BA 2KOTA 2LVIA 3D78A 4NDDA 3WHTB 1AJ5A 1B7TZ 2KYFA 1OQPA 3VB1A 1QXPA 2F33A 3K21A 4HRGA 5AERA 1FW4A 3VGOA 1JSAA 1XFYO 2ZKMX 3CGAA 1NCXA 2LLTA 2R2IA 3AKBA 3S0FA 2BECA 3NHTA 2M1KB 3S0EA 1CMFA 1C7VA 2QEHA 3PFVA 1K8UA 2P71A 3BUOB 3PLFB 1K9PA 1G4YR 2HQ8A 2JU0A 1U5IA 1C7WA 3TUYB 1NPQA 2K2AA 3OBVA 2D8NA 1K96A 1MXEA 1F8HA 1Q80A 3R1PA 3BFHA 1KK7Y 2GV5A 1CM4A 1B4CA 3DF0A 4USLA 2LNKA 1DF0B 1IJ5A 1XO5A 2IS9A 1B8CA 1J55A 1Y0VH 4PE1A 4YGAA 1MUXA 4M2QA 4QJ3B 4WQ2A 4DUQA 4PHNA 3TUYC 2JXCA 5I2QA 4MEWA 1CFCA 1CB1A 2HETA 1ZACA 2K2FA 2LVVA 3D75A 1PVAA 1OSAA 1W9ZA 1J7QA 2AAOA 1JWDA 2G2BA 5D7FA 2NLNA 5HKZA 1K9UA 1B7TY 1EG4A 1EG3A 2P6BB 5I2OA 4INWA 2TN4A 1AJ4A 2LMTA 4GGNA 3KO0A 2WC5A 4IJ7A 3BQ3A 4NQGA 2FCEA 4AQJA 1LXFC 1QWVA 1CDMA 1TWOA 3CLNA 3AKAA 4ORAB 3I5GB 4MSPA 5CSNA 1H8BA 1WRLA 1OZOA 1GGZA 1NSHA 3CZTX 2PMYA
chains in the Genus database with same CATH topology
1QX5B 1E8AA 1F54A 1RK9A 1BR4B 5JOLA 2F2PA 4BY4A 4Q04A 2SASA 2F2OA 1QV0A 2JPTA 1CDLA 3CR5X 1NYAA 4PE7A 1UHHA 1BT6A 4JQ0D 1W7JB 2KAYA 1DGVA 5D69A 1TN4A 2DOQA 2OS8B 1B9AA 5F6TA 1BF5A 1WRZA 4ORBB 2Y5IA 4I5JA 4CIDA 1JC2A 3PALA 3PN7B 1S1EA 3QRXA 3VRQA 2HPSA 1BG1A 2LLSA 2LHLA 1SKTA 1CFDA 3BOWB 1NX0A 4FQOA 4U8DA 1CMGA 1J7PA 1ALWA 1CDNA 1MWNA 2KBMA 3EVUA 4WQ3A 3OP0A 1QVIY 1S5GZ 3OB1B 1ZOTB 1SY9A 4HRHA 1DJHA 2M9GA 1OZSA 3FWBA 2BCXA 4MZKA 4ETOA 4UPGA 1ODBA 4MLWA 1WDCC 1DJGA 4CLNA 1SCMC 1GGWA 1UHIA 1UHJA 3OX6A 1SBJA 1KQVA 2L51A 3SG2A 4PE0A 1DJWA 1RTP1 1WY9A 2F3ZA 3VROA 4C0JA 1DJZA 3D10A 1DJXA 2ZNDA 1SR6C 4YGCB 1PSBA 1HT9A 5KTYA 1BU3A 1OMDA 1M63B 2LVJA 2KAVA 2L0PA 1DVIA 1FF1A 1BMOA 4R1EA 1QLSA 4GGFC 2KFHA 1QIVA 1TNWA 1ALVA 1BJFA 1XFZO 2Q91A 5DKQA 2M8UA 5IBWA 2L4HA 2JULA 2BL0C 3HCMA 1OMVA 1QJTA 2PSRA 4XYNA 1QIWA 3JTDB 2LANA 4OKHA 1HQVA 3H4SE 3DD4A 3FIAA 4XJKA 1JF2A 2MLFC 4P2YB 3O78A 4PHMA 2KAXA 1L7ZA 1B8RA 5ER4X 2OPOA 4DCKA 2WCEA 3I5FB 4HSZA 2FJUB 1LA3A 2JT8A 1U5IB 2FCDA 1MHOA 3OHMB 4C0LA 3TS5B 1FBVA 1JF0A 1V1GA 1N0YA 4P5OE 1OE9B 3DF0B 1TNQA 1G33A 2JT0A 1DJIA 2K7CA 4MVFA 1XFWO 1IQ5A 2E30A 1ZMZA 5GQQC 1BR1B 1K2HA 3GOFA 3I5IB 3VRPA 4PE4A 1UURA 3LK1A 5FYXA 1K9KA 4YI8A 3EKJA 4YGBB 3LL8B 3A8RA 3KHEA 2V53A 2COLB 4MRXA 2JTTA 2GGZA 5KU1A 4I5LB 3HX4A 4TNCA 2BBNA 4QJ4B 3DVEA 4OVNF 4MZJA 5ER5A 4YRUA 2JWWA 3DVMA 2ZNEA 1K93D 2HF5A 1SL8A 4N1GA 1B47A 1AK8A 3TDUA 2KGBC 2ZN8A 2LLUA 2L4IA 1TRFA 2Y1MA 1KCYA 1J1DA 2BE6A 5AANA 3SIAA 3NSIA 1KFXL 1YVHA 1Y1AA 4ICBA 4PCWA 2BKIB 1XYDA 2M29A 4DIRA 1G8IA 2WNDA 3GK4X 2M49B 3KEVA 3PSRA 1B1GA 4ORCB 2AMIA 2ZN9A 5J3XA 1PK0D 1SNLA 2I7AA 3JVTB 2M7LA 2OTGB 3I5HB 3IF7A 2LUXA 1S6IA 1KFXS 1MR8A 1A2XA 1TTXA 1NWDA 1OOJA 5AFPA 1ZFSA 2FOTA 5TNCA 1WLMA 1YRTB 2KYCA 4A4BA 3DVJA 3BUXB 4HREE 1IJ6A 3LCPC 1NCYA 2OTGC 2H61C 3I5GC 3AAJA 1EJ3A 4DS7A 1KWOB 1QX2A 2KQ6A 4I5KA 1TOPA 4F0ZB 2KGRA 1XFVO 3O4YA 1YURA 1L2OB 2PVBA 1KFUL 1SCVA 2WC8A 1S6CA 2LAPA 1A03A 1IRJA 1TCFA 1BLQA 1JFKA 2KSPA 1GGZA 2EGDA 3PATA 5AXIA 3F45A 1UWOA 1S36A 3NSLA 2CCMA 1R6PA 4NDCA 2K8MB 2OS8C 1JBAA 4IL1A 1KWOC 2PRUA 5PALA 4QJ5B 2L2EA 1CTRA 2F8PA 1KSMA 2LMUA 2A4JA 1L2OC 1SK6D 3PN7C 1CLBA 2F3YA 3D0YB 1F71A 1IG5A 1J7OA 3CS1A 2JNFA 2K61A 2KI6D 2M3WA 2NCOA 2BE4A 3NSKA 2JXLA 1J1EA 2M0RA 1V1FA 5DKNA 2CTNA 1SL7A 3EK8A 3ZNIA 1UUSA 1AUIB 1PVBA 1DTLA 1YRUB 2EHBA 4DRWA 4PHKA 1F70A 1QX7A 2KHNA 2NZ0A 3D0YA 2MRDA 3IQOA 1RECA 5CSJA 1LVCD 1YUSA 5HKWA 1YX7A 3CR4X 2KI6C 4M2OA 1PULA 2H2KA 2LC5A 5DKRA 5G08A 4YBHB 1CFFA 1WLZA 4XJKB 4CPVA 2ZRSA 4GFTA 2JZIA 1LKJA 1LA0A 1EXRA 1AVSA 3C1VA 1IQ3A 1EH2A 1FPWA 4JWQA 3TZ1A 2CXJA 5HLVA 1XK4C 2LP3A 2JT3A 1S5GY 4GAOA 1B8LA 3RLZA 3M0WA 3NXAA 4MZLA 5HYDA 2GGMA 4AOMA 1F55A 3SIBA 1CKKA 1C07A 3EK4A 1F4OA 1W7IB 4CFRA 1FI6A 3FWCA 3JTDC 2BCAA 2LV7A 2PALA 1YR5A 3BUMB 1KK7Z 3CTNA 2JRFA 5I8NA 2ZFDA 3O6BA 1JUOA 2AUCA 2CNPA 2KI4B 2WOSA 2NXQA 1SRAA 3I5FC 2CBLA 1BOCA 1K90D 2KQYA 2M97A 3A4UB 3EVRA 5HKYA 3TDZA 2LCPA 1NX3A 3TS5C 2MJWB 4MBEA 1BODA 1CM1A 2WCBA 5JJGA 1OMRA 2KI4C 1QV1A 2ZRTA 4ZCVA 4OV2A 1EL4A 2KBIA 4C0KA 2M1UA 3I5IC 1DT7B 1XFXO 4PDZA 1XA5A 2QPTA 1PALA 1M45A 1J7RA 1DGUA 1RWYA 3EK7A 4WRIA 1SYMA 1AP4A 2K7BA 4A4CA 1A29A 4ZCUA 2JC2A 2I18A 1X02A 1IWQA 3VRNA 5BPJA 1RJVA 2E6WA 1KQMB 1YUTA 2BCBA 2LM5A 3EKHA 1GQMA 4JPZB 3SG4A 1NIWA 4OCIA 1DJYA 1CLMA 1UHNA 1R2UA 1NUBA 3E3RA 1UHKA 1TNPA 1S3PA 1QLKA 1RROA 5CPVA 5B8IB 1YX8A 2JNXA 1N65A 1NP8A 4FTGA 1A4PA 2MHHA 3GK2A 1KQMC 1QS7A 4N5XA 4GUKA 4BY5A 1S6JA 3JVTC 1AHRA 3CWGA 1DF0A 4D1EA 1RFJA 3BYAA 3I5HC 3ZWHA 2KFGA 1QVIZ 2VRGA 4GBAA 2QACA 2ISDA 3DVKA 1DMOA 1CNPA 1F4QA 2LP2A 3SG7A 4MRYA 1QTXA 3IQQA 3GK1A 3O2PA 1YUUA 4YGEB 1IGVA 2K7OA 1PRWA 2L98A 2LVKA 1FI5A 4OR9B 1GJYA 1NX1A 2JQ6A 1KFUS 1QATA 2PASA 4L9MA 2LMVA 5AEQA 2KDHA 1CFPA 2BKHB 1VRKA 2LHIA 2H61A 3BUNB 1M46A 1TIZA 2I2RE 1QASA 1TNXA 3CR2A 1A75B 2KFFA 5CSIA 1CLLA 3KF9A 3WXAA 1IH0A 1XVJA 2Q4UA 2JTZA 3SJSA 1WDCB 2MAZA 1SCMB 3EVVA 1NCZA 2O60A 1KK8B 4E68A 3ICBA 5CSFA 4PHJA 3VRRA 4GPLB 2EC6B 1K94A 2L50A 1A75A 2CT9A 5KSZA 1K95A 3SG6A 1SL9A 4GNKB 2O5GA 4CFQA 1MXLC 2Y1NA 1SR6B 3BOWA 3MSEB 3PM8A 1M31A 1H4BA 4PALA 1KK8C 2K0JA 1JFJA 3KPXA 1YVLA 2SCPA 1Y1XA 1SMGA 2EC6C 2LE9B 3SG3A 3OX5A 4YI9A 3SG5A 4I5NB 2MA2A 1N2DA 3BUWB 5K89A 1XFUO 2B1UA 2LUCA 1MF8B 2BL0B 4MN0A 3LLEA 1SW8A 1PSRA 5I2LA 3WNXB 2HQWA 4NDBA 4YGDB 3FS7A 2MLEC 2KNEA 2NCPA 2Y4QA 4GGFA 3OB2B 1SPYA 1TCOB 2L5XB 1S26D 1D1OA 1UP5A 4N1FA 2M7NA 2WCFA 1NX2A 1YTZC 1ZUZA 1XK4A 4AQIA 3TDIA 5HLOA 3NSOA 3WHUB 2I94A 4M2PA 2JOJA 1MQ1A 1WRKA 2K7DA 3BXKA 3LK0A 1Y6WA 1KSOA 1LINA 1CDPA 3AAKA 2MBXA 1Y1UA 1IKUA 2BBMA 2WORA 3RM1A 2RGIA 1M39A 2G9BA 2KOTA 2LVIA 3WHTB 4NDDA 1AJ5A 1B7TZ 2KYFA 1OQPA 1QXPA 2F33A 3K21A 4HRGA 5AERA 1FW4A 3VGOA 1JSAA 1XFYO 2ZKMX 3CGAA 1NCXA 2LLTA 2R2IA 3AKBA 2BECA 2M1KB 1CMFA 1C7VA 3PFVA 1K8UA 3BUOB 3PLFB 1K9PA 1G4YR 2HQ8A 2JU0A 1U5IA 1C7WA 3TUYB 1NPQA 2K2AA 2D8NA 1K96A 1MXEA 1F8HA 1Q80A 1KK7Y 2GV5A 1B4CA 3DF0A 4USLA 2LNKA 1DF0B 1IJ5A 1XO5A 2IS9A 1B8CA 1J55A 1Y0VH 4PE1A 4YGAA 1MUXA 4M2QA 4QJ3B 4WQ2A 4DUQA 4PHNA 3TUYC 2JXCA 5I2QA 4MEWA 1CFCA 1CB1A 2HETA 1ZACA 2K2FA 2LVVA 1PVAA 1OSAA 1J7QA 2AAOA 1JWDA 2G2BA 5D7FA 2NLNA 5HKZA 1K9UA 1B7TY 1EG4A 1EG3A 2P6BB 5I2OA 2TN4A 1AJ4A 2LMTA 4GGNA 3KO0A 3BQ3A 4NQGA 2FCEA 4AQJA 1LXFC 1CDMA 3CLNA 3AKAA 4ORAB 3I5GB 4MSPA 5CSNA 1H8BA 1WRLA 1OZOA 1CM4A 1NSHA 3CZTX 2PMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX5 B;  1E8A A;  1F54 A;  1RK9 A;  1BR4 B;  5JOL A;  2F2P A;  4BY4 A;  4Q04 A;  2SAS A;  2F2O A;  1QV0 A;  2JPT A;  1CDL A;  3CR5 X;  1NYA A;  4PE7 A;  1UHH A;  1BT6 A;  4JQ0 D;  1W7J B;  2KAY A;  1DGV A;  5D69 A;  1TN4 A;  2DOQ A;  2OS8 B;  1B9A A;  5F6T A;  1BF5 A;  1WRZ A;  4ORB B;  2Y5I A;  4I5J A;  4CID A;  1JC2 A;  3PAL A;  3PN7 B;  1S1E A;  3QRX A;  3VRQ A;  2HPS A;  1BG1 A;  2LLS A;  2LHL A;  1SKT A;  1CFD A;  3BOW B;  1NX0 A;  4FQO A;  4U8D A;  1CMG A;  1J7P A;  1ALW A;  1CDN A;  1MWN A;  2KBM A;  3EVU A;  4WQ3 A;  3OP0 A;  1QVI Y;  1S5G Z;  3OB1 B;  1ZOT B;  1SY9 A;  4HRH A;  1DJH A;  2M9G A;  1OZS A;  3FWB A;  2BCX A;  4MZK A;  4ETO A;  4UPG A;  1ODB A;  4MLW A;  1WDC C;  1DJG A;  4CLN A;  1SCM C;  1GGW A;  1UHI A;  1UHJ A;  3OX6 A;  1SBJ A;  1KQV A;  2L51 A;  3SG2 A;  4PE0 A;  1DJW A;  1RTP 1;  1WY9 A;  2F3Z A;  3VRO A;  4C0J A;  1DJZ A;  3D10 A;  1DJX A;  2ZND A;  1SR6 C;  4YGC B;  1PSB A;  1HT9 A;  5KTY A;  1BU3 A;  1OMD A;  1M63 B;  2LVJ A;  2KAV A;  2L0P A;  1DVI A;  1FF1 A;  1BMO A;  4R1E A;  1QLS A;  4GGF C;  2KFH A;  1QIV A;  1TNW A;  1ALV A;  1BJF A;  1XFZ O;  2Q91 A;  5DKQ A;  2M8U A;  5IBW A;  2L4H A;  2JUL A;  2BL0 C;  3HCM A;  1OMV A;  1QJT A;  2PSR A;  4XYN A;  1QIW A;  3JTD B;  2LAN A;  4OKH A;  1HQV A;  3H4S E;  3DD4 A;  3FIA A;  4XJK A;  1JF2 A;  2MLF C;  4P2Y B;  3O78 A;  4PHM A;  2KAX A;  1L7Z A;  1B8R A;  5ER4 X;  2OPO A;  4DCK A;  2WCE A;  3I5F B;  4HSZ A;  2FJU B;  1LA3 A;  2JT8 A;  1U5I B;  2FCD A;  1MHO A;  3OHM B;  4C0L A;  3TS5 B;  1FBV A;  1JF0 A;  1V1G A;  1N0Y A;  4P5O E;  1OE9 B;  3DF0 B;  1TNQ A;  1G33 A;  2JT0 A;  1DJI A;  2K7C A;  4MVF A;  1XFW O;  1IQ5 A;  2E30 A;  1ZMZ A;  5GQQ C;  1BR1 B;  1K2H A;  3GOF A;  3I5I B;  3VRP A;  4PE4 A;  1UUR A;  3LK1 A;  5FYX A;  1K9K A;  4YI8 A;  3EKJ A;  4YGB B;  3LL8 B;  3A8R A;  3KHE A;  2V53 A;  2COL B;  4MRX A;  2JTT A;  2GGZ A;  5KU1 A;  4I5L B;  3HX4 A;  4TNC A;  2BBN A;  4QJ4 B;  3DVE A;  4OVN F;  4MZJ A;  5ER5 A;  4YRU A;  2JWW A;  3DVM A;  2ZNE A;  1K93 D;  2HF5 A;  1SL8 A;  4N1G A;  1B47 A;  1AK8 A;  3TDU A;  2KGB C;  2ZN8 A;  2LLU A;  2L4I A;  1TRF A;  2Y1M A;  1KCY A;  1J1D A;  2BE6 A;  5AAN A;  3SIA A;  3NSI A;  1KFX L;  1YVH A;  1Y1A A;  4ICB A;  4PCW A;  2BKI B;  1XYD A;  2M29 A;  4DIR A;  1G8I A;  2WND A;  3GK4 X;  2M49 B;  3KEV A;  3PSR A;  1B1G A;  4ORC B;  2AMI A;  2ZN9 A;  5J3X A;  1PK0 D;  1SNL A;  2I7A A;  3JVT B;  2M7L A;  2OTG B;  3I5H B;  3IF7 A;  2LUX A;  1S6I A;  1KFX S;  1MR8 A;  1A2X A;  1TTX A;  1NWD A;  1OOJ A;  5AFP A;  1ZFS A;  2FOT A;  5TNC A;  1WLM A;  1YRT B;  2KYC A;  4A4B A;  3DVJ A;  3BUX B;  4HRE E;  1IJ6 A;  3LCP C;  1NCY A;  2OTG C;  2H61 C;  3I5G C;  3AAJ A;  1EJ3 A;  4DS7 A;  1KWO B;  1QX2 A;  2KQ6 A;  4I5K A;  1TOP A;  4F0Z B;  2KGR A;  1XFV O;  3O4Y A;  1YUR A;  1L2O B;  2PVB A;  1KFU L;  1SCV A;  2WC8 A;  1S6C A;  2LAP A;  1A03 A;  1IRJ A;  1TCF A;  1BLQ A;  1JFK A;  2KSP A;  1GGZ A;  2EGD A;  3PAT A;  5AXI A;  3F45 A;  1UWO A;  1S36 A;  3NSL A;  2CCM A;  1R6P A;  4NDC A;  2K8M B;  2OS8 C;  1JBA A;  4IL1 A;  1KWO C;  2PRU A;  5PAL A;  4QJ5 B;  2L2E A;  1CTR A;  2F8P A;  1KSM A;  2LMU A;  2A4J A;  1L2O C;  1SK6 D;  3PN7 C;  1CLB A;  2F3Y A;  3D0Y B;  1F71 A;  1IG5 A;  1J7O A;  3CS1 A;  2JNF A;  2K61 A;  2KI6 D;  2M3W A;  2NCO A;  2BE4 A;  3NSK A;  2JXL A;  1J1E A;  2M0R A;  1V1F A;  5DKN A;  2CTN A;  1SL7 A;  3EK8 A;  3ZNI A;  1UUS A;  1AUI B;  1PVB A;  1DTL A;  1YRU B;  2EHB A;  4DRW A;  4PHK A;  1F70 A;  1QX7 A;  2KHN A;  2NZ0 A;  3D0Y A;  2MRD A;  3IQO A;  1REC A;  5CSJ A;  1LVC D;  1YUS A;  5HKW A;  1YX7 A;  3CR4 X;  2KI6 C;  4M2O A;  1PUL A;  2H2K A;  2LC5 A;  5DKR A;  5G08 A;  4YBH B;  1CFF A;  1WLZ A;  4XJK B;  4CPV A;  2ZRS A;  4GFT A;  2JZI A;  1LKJ A;  1LA0 A;  1EXR A;  1AVS A;  3C1V A;  1IQ3 A;  1EH2 A;  1FPW A;  4JWQ A;  3TZ1 A;  2CXJ A;  5HLV A;  1XK4 C;  2LP3 A;  2JT3 A;  1S5G Y;  4GAO A;  1B8L A;  3RLZ A;  3M0W A;  3NXA A;  4MZL A;  5HYD A;  2GGM A;  4AOM A;  1F55 A;  3SIB A;  1CKK A;  1C07 A;  3EK4 A;  1F4O A;  1W7I B;  4CFR A;  1FI6 A;  3FWC A;  3JTD C;  2BCA A;  2LV7 A;  2PAL A;  1YR5 A;  3BUM B;  1KK7 Z;  3CTN A;  2JRF A;  5I8N A;  2ZFD A;  3O6B A;  1JUO A;  2AUC A;  2CNP A;  2KI4 B;  2WOS A;  2NXQ A;  1SRA A;  3I5F C;  2CBL A;  1BOC A;  1K90 D;  2KQY A;  2M97 A;  3A4U B;  3EVR A;  5HKY A;  3TDZ A;  2LCP A;  1NX3 A;  3TS5 C;  2MJW B;  4MBE A;  1BOD A;  1CM1 A;  2WCB A;  5JJG A;  1OMR A;  2KI4 C;  1QV1 A;  2ZRT A;  4ZCV A;  4OV2 A;  1EL4 A;  2KBI A;  4C0K A;  2M1U A;  3I5I C;  1DT7 B;  1XFX O;  4PDZ A;  1XA5 A;  2QPT A;  1PAL A;  1M45 A;  1J7R A;  1DGU A;  1RWY A;  3EK7 A;  4WRI A;  1SYM A;  1AP4 A;  2K7B A;  4A4C A;  1A29 A;  4ZCU A;  2JC2 A;  2I18 A;  1X02 A;  1IWQ A;  3VRN A;  5BPJ A;  1RJV A;  2E6W A;  1KQM B;  1YUT A;  2BCB A;  2LM5 A;  3EKH A;  1GQM A;  4JPZ B;  3SG4 A;  1NIW A;  4OCI A;  1DJY A;  1CLM A;  1UHN A;  1R2U A;  1NUB A;  3E3R A;  1UHK A;  1TNP A;  1S3P A;  1QLK A;  1RRO A;  5CPV A;  5B8I B;  1YX8 A;  2JNX A;  1N65 A;  1NP8 A;  4FTG A;  1A4P A;  2MHH A;  3GK2 A;  1KQM C;  1QS7 A;  4N5X A;  4GUK A;  4BY5 A;  1S6J A;  3JVT C;  1AHR A;  3CWG A;  1DF0 A;  4D1E A;  1RFJ A;  3BYA A;  3I5H C;  3ZWH A;  2KFG A;  1QVI Z;  2VRG A;  4GBA A;  2QAC A;  2ISD A;  3DVK A;  1DMO A;  1CNP A;  1F4Q A;  2LP2 A;  3SG7 A;  4MRY A;  1QTX A;  3IQQ A;  3GK1 A;  3O2P A;  1YUU A;  4YGE B;  1IGV A;  2K7O A;  1PRW A;  2L98 A;  2LVK A;  1FI5 A;  4OR9 B;  1GJY A;  1NX1 A;  2JQ6 A;  1KFU S;  1QAT A;  2PAS A;  4L9M A;  2LMV A;  5AEQ A;  2KDH A;  1CFP A;  2BKH B;  1VRK A;  2LHI A;  2H61 A;  3BUN B;  1M46 A;  1TIZ A;  2I2R E;  1QAS A;  1TNX A;  3CR2 A;  1A75 B;  2KFF A;  5CSI A;  1CLL A;  3KF9 A;  3WXA A;  1IH0 A;  1XVJ A;  2Q4U A;  2JTZ A;  3SJS A;  1WDC B;  2MAZ A;  1SCM B;  3EVV A;  1NCZ A;  2O60 A;  1KK8 B;  4E68 A;  3ICB A;  5CSF A;  4PHJ A;  3VRR A;  4GPL B;  2EC6 B;  1K94 A;  2L50 A;  1A75 A;  2CT9 A;  5KSZ A;  1K95 A;  3SG6 A;  1SL9 A;  4GNK B;  2O5G A;  4CFQ A;  1MXL C;  2Y1N A;  1SR6 B;  3BOW A;  3MSE B;  3PM8 A;  1M31 A;  1H4B A;  4PAL A;  1KK8 C;  2K0J A;  1JFJ A;  3KPX A;  1YVL A;  2SCP A;  1Y1X A;  1SMG A;  2EC6 C;  2LE9 B;  3SG3 A;  3OX5 A;  4YI9 A;  3SG5 A;  4I5N B;  2MA2 A;  1N2D A;  3BUW B;  5K89 A;  1XFU O;  2B1U A;  2LUC A;  1MF8 B;  2BL0 B;  4MN0 A;  3LLE A;  1SW8 A;  1PSR A;  5I2L A;  3WNX B;  2HQW A;  4NDB A;  4YGD B;  3FS7 A;  2MLE C;  2KNE A;  2NCP A;  2Y4Q A;  4GGF A;  3OB2 B;  1SPY A;  1TCO B;  2L5X B;  1S26 D;  1D1O A;  1UP5 A;  4N1F A;  2M7N A;  2WCF A;  1NX2 A;  1YTZ C;  1ZUZ A;  1XK4 A;  4AQI A;  3TDI A;  5HLO A;  3NSO A;  3WHU B;  2I94 A;  4M2P A;  2JOJ A;  1MQ1 A;  1WRK A;  2K7D A;  3BXK A;  3LK0 A;  1Y6W A;  1KSO A;  1LIN A;  1CDP A;  3AAK A;  2MBX A;  1Y1U A;  1IKU A;  2BBM A;  2WOR A;  3RM1 A;  2RGI A;  1M39 A;  2G9B A;  2KOT A;  2LVI A;  3WHT B;  4NDD A;  1AJ5 A;  1B7T Z;  2KYF A;  1OQP A;  1QXP A;  2F33 A;  3K21 A;  4HRG A;  5AER A;  1FW4 A;  3VGO A;  1JSA A;  1XFY O;  2ZKM X;  3CGA A;  1NCX A;  2LLT A;  2R2I A;  3AKB A;  2BEC A;  2M1K B;  1CMF A;  1C7V A;  3PFV A;  1K8U A;  3BUO B;  3PLF B;  1K9P A;  1G4Y R;  2HQ8 A;  2JU0 A;  1U5I A;  1C7W A;  3TUY B;  1NPQ A;  2K2A A;  2D8N A;  1K96 A;  1MXE A;  1F8H A;  1Q80 A;  1KK7 Y;  2GV5 A;  1B4C A;  3DF0 A;  4USL A;  2LNK A;  1DF0 B;  1IJ5 A;  1XO5 A;  2IS9 A;  1B8C A;  1J55 A;  1Y0V H;  4PE1 A;  4YGA A;  1MUX A;  4M2Q A;  4QJ3 B;  4WQ2 A;  4DUQ A;  4PHN A;  3TUY C;  2JXC A;  5I2Q A;  4MEW A;  1CFC A;  1CB1 A;  2HET A;  1ZAC A;  2K2F A;  2LVV A;  1PVA A;  1OSA A;  1J7Q A;  2AAO A;  1JWD A;  2G2B A;  5D7F A;  2NLN A;  5HKZ A;  1K9U A;  1B7T Y;  1EG4 A;  1EG3 A;  2P6B B;  5I2O A;  2TN4 A;  1AJ4 A;  2LMT A;  4GGN A;  3KO0 A;  3BQ3 A;  4NQG A;  2FCE A;  4AQJ A;  1LXF C;  1CDM A;  3CLN A;  3AKA A;  4ORA B;  3I5G B;  4MSP A;  5CSN A;  1H8B A;  1WRL A;  1OZO A;  1CM4 A;  1NSH A;  3CZT X;  2PMY A; 
#chains in the Genus database with same CATH topology
 1QX5 B;  1E8A A;  1F54 A;  4F7F A;  1RK9 A;  1BR4 B;  3L4L A;  2F2P A;  5JOL A;  4BY4 A;  4Q04 A;  2SAS A;  2F2O A;  1QV0 A;  2JPT A;  1CDL A;  3CR5 X;  1NYA A;  4PE7 A;  1UHH A;  1BT6 A;  4JQ0 D;  1W7J B;  2KAY A;  1DGV A;  5D69 A;  3BJH A;  1TN4 A;  2DOQ A;  2OS8 B;  1B9A A;  3FE8 A;  3K1E A;  5F6T A;  1BF5 A;  1WRZ A;  3B7A A;  4ORB B;  2Y5I A;  4I5J A;  4CID A;  1JC2 A;  3PAL A;  3PN7 B;  1ORG A;  1S1E A;  3QRX A;  3VRQ A;  2HPS A;  1BG1 A;  3R1V A;  2LLS A;  2LHL A;  1SKT A;  1CFD A;  3BOW B;  1NX0 A;  4FQO A;  3CYZ A;  4U8D A;  3SS3 A;  1CMG A;  1J7P A;  1ALW A;  1CDN A;  1MWN A;  3S0G A;  2KBM A;  2WCL A;  3EVU A;  4WQ3 A;  3OP0 A;  1QVI Y;  2L5Y A;  2WC6 A;  1S5G Z;  1OW4 A;  3OB1 B;  1ZOT B;  1SY9 A;  4HRH A;  1DJH A;  2M9G A;  1OOH A;  1OZS A;  3FWB A;  2BCX A;  4MZK A;  2JPO A;  4ETO A;  4UPG A;  1ODB A;  4MLW A;  1WDC C;  2KLE A;  1DJG A;  4CLN A;  1SCM C;  1GGW A;  1UHI A;  1UHJ A;  3OX6 A;  1SBJ A;  1DC1 A;  2KLD A;  5FI6 A;  1KQV A;  2L51 A;  3SG2 A;  4PE0 A;  1DJW A;  1RTP 1;  4OZD A;  1WY9 A;  2F3Z A;  2WCJ A;  3VRO A;  4C0J A;  5DIC A;  1DJZ A;  3D10 A;  1DJX A;  2ZND A;  1SR6 C;  4YGC B;  1PSB A;  1HT9 A;  5KTY A;  1BU3 A;  1OMD A;  1M63 B;  2LVJ A;  2KAV A;  2L0P A;  1DVI A;  1T14 A;  1FF1 A;  1BMO A;  4R1E A;  5FI2 A;  4JD9 A;  1QLS A;  1GM0 A;  4GGF C;  2KFH A;  1OOI X;  4PT1 A;  1QIV A;  1TNW A;  1ALV A;  1BJF A;  1XFZ O;  5HL1 A;  2Q91 A;  5DKQ A;  2M8U A;  5IBW A;  2L4H A;  2JUL A;  2BL0 C;  3HCM A;  1P28 A;  1OMV A;  1QJT A;  2PSR A;  3BFA A;  4XYN A;  1QIW A;  3JTD B;  2LAN A;  4OKH A;  1HQV A;  3H4S E;  3DD4 A;  3FIA A;  4XJK A;  1JF2 A;  2ERB A;  2MLF C;  3O78 A;  4P2Y B;  4PHM A;  2KAX A;  1L7Z A;  1B8R A;  5ER4 X;  2OPO A;  4DCK A;  2WCE A;  3I5F B;  4HSZ A;  2FJU B;  1LA3 A;  2JT8 A;  3QME A;  1U5I B;  2FCD A;  1MHO A;  3OHM B;  3B86 A;  4C0L A;  3TS5 B;  2PYQ A;  1FBV A;  1JF0 A;  1V1G A;  1N0Y A;  4P5O E;  1OE9 B;  3DF0 B;  3CZ2 A;  1TNQ A;  1G33 A;  2JT0 A;  1DJI A;  2K7C A;  4MVF A;  3FE9 A;  1XFW O;  1IQ5 A;  2E30 A;  1ZMZ A;  5GQQ C;  1BR1 B;  1K2H A;  3GOF A;  2PQL A;  3L4A A;  3I5I B;  3VRP A;  4PE4 A;  1UUR A;  3LK1 A;  5FYX A;  1K9K A;  4YI8 A;  3EKJ A;  4JKT A;  4YGB B;  3LL8 B;  1SSE B;  3A8R A;  3KHE A;  2V53 A;  2COL B;  4MRX A;  2JTT A;  2GGZ A;  5KU1 A;  4I5L B;  3HX4 A;  4TNC A;  2BBN A;  4QJ4 B;  3DVE A;  4OVN F;  4MZJ A;  5ER5 A;  4YRU A;  2JWW A;  3DVM A;  2ZNE A;  1K93 D;  2HF5 A;  1SL8 A;  4N1G A;  1B47 A;  1AK8 A;  3TDU A;  2KGB C;  2ZN8 A;  2LLU A;  3SS4 A;  2L4I A;  1TRF A;  2Y1M A;  1KCY A;  1J1D A;  2BE6 A;  4KYN A;  5AAN A;  3SIA A;  3NSI A;  1KFX L;  1YVH A;  1Y1A A;  4ICB A;  4PCW A;  2BKI B;  1XYD A;  2M29 A;  4DIR A;  1G8I A;  2WND A;  3GK4 X;  3PM2 A;  2M49 B;  3UO9 A;  3KEV A;  3B87 A;  3PSR A;  1B1G A;  4ORC B;  2AMI A;  2ZN9 A;  5J3X A;  1PK0 D;  1SNL A;  2I7A A;  3JVT B;  2M7L A;  1TUJ A;  2OTG B;  3I5H B;  3IF7 A;  2LUX A;  1S6I A;  2WCM A;  1KFX S;  1MR8 A;  1A2X A;  1OOF A;  1TTX A;  1NWD A;  1OOJ A;  1LS8 A;  5AFP A;  1ZFS A;  2FOT A;  5TNC A;  1WLM A;  1YRT B;  2KYC A;  4A4B A;  3DVJ A;  3BUX B;  4HRE E;  1DQE A;  1IJ6 A;  3LCP C;  1NCY A;  2OTG C;  3B88 A;  2H61 C;  3I5G C;  3AAJ A;  1EJ3 A;  4DS7 A;  1KWO B;  1QX2 A;  2KQ6 A;  4I5K A;  1TOP A;  2K60 A;  4F0Z B;  2KGR A;  1XFV O;  3O4Y A;  1YUR A;  1L2O B;  2PVB A;  1KFU L;  1SCV A;  2WC8 A;  1S6C A;  2LAP A;  1A03 A;  1IRJ A;  1TCF A;  1BLQ A;  1JFK A;  2KSP A;  3BFB A;  2EGD A;  3PAT A;  5AXI A;  3F45 A;  1UWO A;  1S36 A;  3NSL A;  2CCM A;  1R6P A;  1XFR A;  4NDC A;  2GTE A;  2K8M B;  2OS8 C;  1JBA A;  4IL1 A;  1KWO C;  2PRU A;  5PAL A;  3O4X A;  4QJ5 B;  2L2E A;  1CTR A;  2F8P A;  1KSM A;  2LMU A;  2A4J A;  1L2O C;  1SK6 D;  3PN7 C;  1CLB A;  2F3Y A;  3D0Y B;  1F71 A;  1IG5 A;  3IVT A;  3CS1 A;  1J7O A;  2JNF A;  2K61 A;  2KI6 D;  2M3W A;  2NCO A;  2BE4 A;  3NSK A;  2JXL A;  1J1E A;  3S0B A;  2M0R A;  1V1F A;  5DKN A;  2CTN A;  1SL7 A;  3EK8 A;  3ZNI A;  1UUS A;  1AUI B;  1PVB A;  1DTL A;  4INX A;  1YRU B;  2EHB A;  4DRW A;  4PHK A;  1F70 A;  1QX7 A;  2KHN A;  2NZ0 A;  3D0Y A;  2MRD A;  3DZT A;  1REC A;  3IQO A;  2FJY A;  1LVC D;  5CSJ A;  1YUS A;  5HKW A;  1YX7 A;  3CR4 X;  2KI6 C;  4M2O A;  1PUL A;  2H2K A;  2LC5 A;  5DKR A;  5G08 A;  4YBH B;  1CFF A;  1WLZ A;  4XJK B;  4CPV A;  2ZRS A;  3S0A A;  2WCK A;  4GFT A;  2JZI A;  1LKJ A;  1LA0 A;  1EXR A;  1AVS A;  3C1V A;  3OGN A;  1IQ3 A;  1EH2 A;  1TUZ A;  3CAB A;  1FPW A;  4JWQ A;  3TZ1 A;  2CXJ A;  2KPH A;  2BNX A;  1XK4 C;  2LP3 A;  5HLV A;  2JT3 A;  1S5G Y;  3D76 A;  4GAO A;  1B8L A;  3RLZ A;  3M0W A;  3D73 A;  3NXA A;  4MZL A;  5FI7 A;  3B6X A;  2GGM A;  5HYD A;  4AOM A;  1F55 A;  2QEB A;  3SIB A;  1CKK A;  1C07 A;  3EK4 A;  5I94 A;  1IIO A;  1F4O A;  1W7I B;  3CDN A;  4CFR A;  1FI6 A;  3FWC A;  3JTD C;  2BCA A;  2LV7 A;  2PAL A;  1YR5 A;  3BUM B;  1KK7 Z;  3CTN A;  3DXL A;  2JRF A;  5I8N A;  2ZFD A;  3O6B A;  1JUO A;  2AUC A;  2CNP A;  2KI4 B;  2WOS A;  2NXQ A;  1SRA A;  2YGU A;  3I5F C;  2CBL A;  3V2L A;  1K90 D;  2KQY A;  1BOC A;  2M97 A;  3A4U B;  3UNW A;  3EVR A;  5HKY A;  3TDZ A;  2LCP A;  1NX3 A;  3TS5 C;  3NGV A;  2MJW B;  4MBE A;  1BOD A;  1CM1 A;  2WCB A;  5JJG A;  3NHI A;  1OMR A;  2KI4 C;  1QV1 A;  2ZRT A;  2QEO A;  4ZCV A;  2L2C A;  4OV2 A;  1EL4 A;  3CZ1 A;  3D77 A;  2KBI A;  4C0K A;  2M1U A;  3I5I C;  1DT7 B;  1XFX O;  4PDZ A;  1XA5 A;  2QPT A;  3D74 A;  1PAL A;  1M45 A;  2H8V A;  1J7R A;  1DGU A;  1RWY A;  3EK7 A;  4WRI A;  1SYM A;  1AP4 A;  3CZ0 A;  2K7B A;  1DEK A;  1A29 A;  4A4C A;  4ZCU A;  2JC2 A;  2I18 A;  1X02 A;  1IWQ A;  2QEV A;  3VRN A;  5BPJ A;  1RJV A;  2E6W A;  1KQM B;  1YUT A;  2BCB A;  2LM5 A;  3RZS A;  3EKH A;  1GQM A;  4JPZ B;  2BAP A;  1NIW A;  4OCI A;  5D3O A;  1DJY A;  1CLM A;  1UHN A;  3SG4 A;  1R2U A;  1NUB A;  3E3R A;  1UHK A;  1TNP A;  1S3P A;  1QLK A;  1RRO A;  5CPV A;  5B8I B;  1YX8 A;  2JNX A;  1N65 A;  1NP8 A;  2QDI A;  4FTG A;  1A4P A;  2MHH A;  3GK2 A;  1KQM C;  1QS7 A;  4N5X A;  4GUK A;  4BY5 A;  3R1O A;  1S6J A;  3JVT C;  1Z2C B;  1AHR A;  3CWG A;  1DF0 A;  4D1E A;  1RFJ A;  3BYA A;  3I5H C;  3ZWH A;  2KFG A;  1QVI Z;  3EG5 B;  2VRG A;  3R72 A;  4GBA A;  3N7H A;  2QAC A;  2ISD A;  3DVK A;  1DMO A;  1CNP A;  1F4Q A;  2LP2 A;  5EL2 A;  3SG7 A;  4MRY A;  1QTX A;  3IQQ A;  3GK1 A;  3O2P A;  1YUU A;  4YGE B;  1IGV A;  2K7O A;  1PRW A;  2L98 A;  2LVK A;  1FI5 A;  4OR9 B;  1GJY A;  1NX1 A;  2JQ6 A;  1KFU S;  1QAT A;  2PAS A;  4L9M A;  2LMV A;  5AEQ A;  2KDH A;  1CFP A;  2BKH B;  1VRK A;  2LHI A;  2H61 A;  3BUN B;  1M46 A;  1TIZ A;  2I2R E;  1QAS A;  1TNX A;  3CR2 A;  1OOG A;  1A75 B;  2KFF A;  5CSI A;  1CLL A;  3KF9 A;  3WXA A;  1IH0 A;  1XVJ A;  2Q4U A;  2JTZ A;  3SJS A;  1DEL A;  1WDC B;  2MAZ A;  1SCM B;  3EVV A;  1NCZ A;  2O60 A;  1KK8 B;  4E68 A;  3ICB A;  5CSF A;  2WCH A;  4PHJ A;  3VRR A;  4GPL B;  2EC6 B;  1K94 A;  2L50 A;  1A75 A;  2CT9 A;  5KSZ A;  1K95 A;  3SG6 A;  1SL9 A;  4GNK B;  2O5G A;  4CFQ A;  1MXL C;  2Y1N A;  1SR6 B;  3BOW A;  3MSE B;  3PM8 A;  1M31 A;  1H4B A;  4PAL A;  1KK8 C;  2K0J A;  1JFJ A;  3KPX A;  1YVL A;  2SCP A;  1Y1X A;  1SMG A;  2EC6 C;  2LE9 B;  3SG3 A;  3OX5 A;  4YI9 A;  3SG5 A;  4I5N B;  1C3Z A;  2MA2 A;  1N2D A;  1Z4H A;  3BUW B;  5K89 A;  1XFU O;  2B1U A;  2LUC A;  1MF8 B;  2BL0 B;  2P70 A;  4MN0 A;  3LLE A;  1SW8 A;  3DY9 A;  1PSR A;  5I2L A;  3WNX B;  2HQW A;  4NDB A;  4YGD B;  3FS7 A;  2MLE C;  3S0D A;  2KNE A;  2NCP A;  2Y4Q A;  4GGF A;  3OB2 B;  1SPY A;  1TCO B;  2L5X B;  1S26 D;  3SS5 A;  1D1O A;  1UP5 A;  4N1F A;  2M7N A;  2WCF A;  1NX2 A;  1YTZ C;  1ZUZ A;  1XK4 A;  4AQI A;  3TDI A;  3PJI A;  5HLO A;  1C3Y A;  3FE6 A;  4FQT A;  3NSO A;  3WHU B;  2I94 A;  3Q8I A;  4M2P A;  2JOJ A;  1MQ1 A;  1WRK A;  3L47 A;  2K7D A;  3BXK A;  3LK0 A;  1Y6W A;  1KSO A;  1LIN A;  1CDP A;  3AAK A;  2MBX A;  1Y1U A;  1IKU A;  2BBM A;  2WOR A;  3RM1 A;  2RGI A;  1M39 A;  3DYE A;  2G9B A;  2KOT A;  2LVI A;  3D78 A;  4NDD A;  3WHT B;  1AJ5 A;  1B7T Z;  2KYF A;  1OQP A;  3VB1 A;  1QXP A;  2F33 A;  3K21 A;  4HRG A;  5AER A;  1FW4 A;  3VGO A;  1JSA A;  1XFY O;  2ZKM X;  3CGA A;  1NCX A;  2LLT A;  2R2I A;  3AKB A;  3S0F A;  2BEC A;  3NHT A;  2M1K B;  3S0E A;  1CMF A;  1C7V A;  2QEH A;  3PFV A;  1K8U A;  2P71 A;  3BUO B;  3PLF B;  1K9P A;  1G4Y R;  2HQ8 A;  2JU0 A;  1U5I A;  1C7W A;  3TUY B;  1NPQ A;  2K2A A;  3OBV A;  2D8N A;  1K96 A;  1MXE A;  1F8H A;  1Q80 A;  3R1P A;  3BFH A;  1KK7 Y;  2GV5 A;  1CM4 A;  1B4C A;  3DF0 A;  4USL A;  2LNK A;  1DF0 B;  1IJ5 A;  1XO5 A;  2IS9 A;  1B8C A;  1J55 A;  1Y0V H;  4PE1 A;  4YGA A;  1MUX A;  4M2Q A;  4QJ3 B;  4WQ2 A;  4DUQ A;  4PHN A;  3TUY C;  2JXC A;  5I2Q A;  4MEW A;  1CFC A;  1CB1 A;  2HET A;  1ZAC A;  2K2F A;  2LVV A;  3D75 A;  1PVA A;  1OSA A;  1W9Z A;  1J7Q A;  2AAO A;  1JWD A;  2G2B A;  5D7F A;  2NLN A;  5HKZ A;  1K9U A;  1B7T Y;  1EG4 A;  1EG3 A;  2P6B B;  5I2O A;  4INW A;  2TN4 A;  1AJ4 A;  2LMT A;  4GGN A;  3KO0 A;  2WC5 A;  4IJ7 A;  3BQ3 A;  4NQG A;  2FCE A;  4AQJ A;  1LXF C;  1QWV A;  1CDM A;  1TWO A;  3CLN A;  3AKA A;  4ORA B;  3I5G B;  4MSP A;  5CSN A;  1H8B A;  1WRL A;  1OZO A;  1GGZ A;  1NSH A;  3CZT X;  2PMY A; 
#chains in the Genus database with same CATH homology
 1QX5 B;  1E8A A;  1F54 A;  1RK9 A;  1BR4 B;  5JOL A;  2F2P A;  4BY4 A;  4Q04 A;  2SAS A;  2F2O A;  1QV0 A;  2JPT A;  1CDL A;  3CR5 X;  1NYA A;  4PE7 A;  1UHH A;  1BT6 A;  4JQ0 D;  1W7J B;  2KAY A;  1DGV A;  5D69 A;  1TN4 A;  2DOQ A;  2OS8 B;  1B9A A;  5F6T A;  1BF5 A;  1WRZ A;  4ORB B;  2Y5I A;  4I5J A;  4CID A;  1JC2 A;  3PAL A;  3PN7 B;  1S1E A;  3QRX A;  3VRQ A;  2HPS A;  1BG1 A;  2LLS A;  2LHL A;  1SKT A;  1CFD A;  3BOW B;  1NX0 A;  4FQO A;  4U8D A;  1CMG A;  1J7P A;  1ALW A;  1CDN A;  1MWN A;  2KBM A;  3EVU A;  4WQ3 A;  3OP0 A;  1QVI Y;  1S5G Z;  3OB1 B;  1ZOT B;  1SY9 A;  4HRH A;  1DJH A;  2M9G A;  1OZS A;  3FWB A;  2BCX A;  4MZK A;  4ETO A;  4UPG A;  1ODB A;  4MLW A;  1WDC C;  1DJG A;  4CLN A;  1SCM C;  1GGW A;  1UHI A;  1UHJ A;  3OX6 A;  1SBJ A;  1KQV A;  2L51 A;  3SG2 A;  4PE0 A;  1DJW A;  1RTP 1;  1WY9 A;  2F3Z A;  3VRO A;  4C0J A;  1DJZ A;  3D10 A;  1DJX A;  2ZND A;  1SR6 C;  4YGC B;  1PSB A;  1HT9 A;  5KTY A;  1BU3 A;  1OMD A;  1M63 B;  2LVJ A;  2KAV A;  2L0P A;  1DVI A;  1FF1 A;  1BMO A;  4R1E A;  1QLS A;  4GGF C;  2KFH A;  1QIV A;  1TNW A;  1ALV A;  1BJF A;  1XFZ O;  2Q91 A;  5DKQ A;  2M8U A;  5IBW A;  2L4H A;  2JUL A;  2BL0 C;  3HCM A;  1OMV A;  1QJT A;  2PSR A;  4XYN A;  1QIW A;  3JTD B;  2LAN A;  4OKH A;  1HQV A;  3H4S E;  3DD4 A;  3FIA A;  4XJK A;  1JF2 A;  2MLF C;  4P2Y B;  3O78 A;  4PHM A;  2KAX A;  1L7Z A;  1B8R A;  5ER4 X;  2OPO A;  4DCK A;  2WCE A;  3I5F B;  4HSZ A;  2FJU B;  1LA3 A;  2JT8 A;  1U5I B;  2FCD A;  1MHO A;  3OHM B;  4C0L A;  3TS5 B;  1FBV A;  1JF0 A;  1V1G A;  1N0Y A;  4P5O E;  1OE9 B;  3DF0 B;  1TNQ A;  1G33 A;  2JT0 A;  1DJI A;  2K7C A;  4MVF A;  1XFW O;  1IQ5 A;  2E30 A;  1ZMZ A;  5GQQ C;  1BR1 B;  1K2H A;  3GOF A;  3I5I B;  3VRP A;  4PE4 A;  1UUR A;  3LK1 A;  5FYX A;  1K9K A;  4YI8 A;  3EKJ A;  4YGB B;  3LL8 B;  3A8R A;  3KHE A;  2V53 A;  2COL B;  4MRX A;  2JTT A;  2GGZ A;  5KU1 A;  4I5L B;  3HX4 A;  4TNC A;  2BBN A;  4QJ4 B;  3DVE A;  4OVN F;  4MZJ A;  5ER5 A;  4YRU A;  2JWW A;  3DVM A;  2ZNE A;  1K93 D;  2HF5 A;  1SL8 A;  4N1G A;  1B47 A;  1AK8 A;  3TDU A;  2KGB C;  2ZN8 A;  2LLU A;  2L4I A;  1TRF A;  2Y1M A;  1KCY A;  1J1D A;  2BE6 A;  5AAN A;  3SIA A;  3NSI A;  1KFX L;  1YVH A;  1Y1A A;  4ICB A;  4PCW A;  2BKI B;  1XYD A;  2M29 A;  4DIR A;  1G8I A;  2WND A;  3GK4 X;  2M49 B;  3KEV A;  3PSR A;  1B1G A;  4ORC B;  2AMI A;  2ZN9 A;  5J3X A;  1PK0 D;  1SNL A;  2I7A A;  3JVT B;  2M7L A;  2OTG B;  3I5H B;  3IF7 A;  2LUX A;  1S6I A;  1KFX S;  1MR8 A;  1A2X A;  1TTX A;  1NWD A;  1OOJ A;  5AFP A;  1ZFS A;  2FOT A;  5TNC A;  1WLM A;  1YRT B;  2KYC A;  4A4B A;  3DVJ A;  3BUX B;  4HRE E;  1IJ6 A;  3LCP C;  1NCY A;  2OTG C;  2H61 C;  3I5G C;  3AAJ A;  1EJ3 A;  4DS7 A;  1KWO B;  1QX2 A;  2KQ6 A;  4I5K A;  1TOP A;  4F0Z B;  2KGR A;  1XFV O;  3O4Y A;  1YUR A;  1L2O B;  2PVB A;  1KFU L;  1SCV A;  2WC8 A;  1S6C A;  2LAP A;  1A03 A;  1IRJ A;  1TCF A;  1BLQ A;  1JFK A;  2KSP A;  1GGZ A;  2EGD A;  3PAT A;  5AXI A;  3F45 A;  1UWO A;  1S36 A;  3NSL A;  2CCM A;  1R6P A;  4NDC A;  2K8M B;  2OS8 C;  1JBA A;  4IL1 A;  1KWO C;  2PRU A;  5PAL A;  4QJ5 B;  2L2E A;  1CTR A;  2F8P A;  1KSM A;  2LMU A;  2A4J A;  1L2O C;  1SK6 D;  3PN7 C;  1CLB A;  2F3Y A;  3D0Y B;  1F71 A;  1IG5 A;  1J7O A;  3CS1 A;  2JNF A;  2K61 A;  2KI6 D;  2M3W A;  2NCO A;  2BE4 A;  3NSK A;  2JXL A;  1J1E A;  2M0R A;  1V1F A;  5DKN A;  2CTN A;  1SL7 A;  3EK8 A;  3ZNI A;  1UUS A;  1AUI B;  1PVB A;  1DTL A;  1YRU B;  2EHB A;  4DRW A;  4PHK A;  1F70 A;  1QX7 A;  2KHN A;  2NZ0 A;  3D0Y A;  2MRD A;  3IQO A;  1REC A;  5CSJ A;  1LVC D;  1YUS A;  5HKW A;  1YX7 A;  3CR4 X;  2KI6 C;  4M2O A;  1PUL A;  2H2K A;  2LC5 A;  5DKR A;  5G08 A;  4YBH B;  1CFF A;  1WLZ A;  4XJK B;  4CPV A;  2ZRS A;  4GFT A;  2JZI A;  1LKJ A;  1LA0 A;  1EXR A;  1AVS A;  3C1V A;  1IQ3 A;  1EH2 A;  1FPW A;  4JWQ A;  3TZ1 A;  2CXJ A;  5HLV A;  1XK4 C;  2LP3 A;  2JT3 A;  1S5G Y;  4GAO A;  1B8L A;  3RLZ A;  3M0W A;  3NXA A;  4MZL A;  5HYD A;  2GGM A;  4AOM A;  1F55 A;  3SIB A;  1CKK A;  1C07 A;  3EK4 A;  1F4O A;  1W7I B;  4CFR A;  1FI6 A;  3FWC A;  3JTD C;  2BCA A;  2LV7 A;  2PAL A;  1YR5 A;  3BUM B;  1KK7 Z;  3CTN A;  2JRF A;  5I8N A;  2ZFD A;  3O6B A;  1JUO A;  2AUC A;  2CNP A;  2KI4 B;  2WOS A;  2NXQ A;  1SRA A;  3I5F C;  2CBL A;  1BOC A;  1K90 D;  2KQY A;  2M97 A;  3A4U B;  3EVR A;  5HKY A;  3TDZ A;  2LCP A;  1NX3 A;  3TS5 C;  2MJW B;  4MBE A;  1BOD A;  1CM1 A;  2WCB A;  5JJG A;  1OMR A;  2KI4 C;  1QV1 A;  2ZRT A;  4ZCV A;  4OV2 A;  1EL4 A;  2KBI A;  4C0K A;  2M1U A;  3I5I C;  1DT7 B;  1XFX O;  4PDZ A;  1XA5 A;  2QPT A;  1PAL A;  1M45 A;  1J7R A;  1DGU A;  1RWY A;  3EK7 A;  4WRI A;  1SYM A;  1AP4 A;  2K7B A;  4A4C A;  1A29 A;  4ZCU A;  2JC2 A;  2I18 A;  1X02 A;  1IWQ A;  3VRN A;  5BPJ A;  1RJV A;  2E6W A;  1KQM B;  1YUT A;  2BCB A;  2LM5 A;  3EKH A;  1GQM A;  4JPZ B;  3SG4 A;  1NIW A;  4OCI A;  1DJY A;  1CLM A;  1UHN A;  1R2U A;  1NUB A;  3E3R A;  1UHK A;  1TNP A;  1S3P A;  1QLK A;  1RRO A;  5CPV A;  5B8I B;  1YX8 A;  2JNX A;  1N65 A;  1NP8 A;  4FTG A;  1A4P A;  2MHH A;  3GK2 A;  1KQM C;  1QS7 A;  4N5X A;  4GUK A;  4BY5 A;  1S6J A;  3JVT C;  1AHR A;  3CWG A;  1DF0 A;  4D1E A;  1RFJ A;  3BYA A;  3I5H C;  3ZWH A;  2KFG A;  1QVI Z;  2VRG A;  4GBA A;  2QAC A;  2ISD A;  3DVK A;  1DMO A;  1CNP A;  1F4Q A;  2LP2 A;  3SG7 A;  4MRY A;  1QTX A;  3IQQ A;  3GK1 A;  3O2P A;  1YUU A;  4YGE B;  1IGV A;  2K7O A;  1PRW A;  2L98 A;  2LVK A;  1FI5 A;  4OR9 B;  1GJY A;  1NX1 A;  2JQ6 A;  1KFU S;  1QAT A;  2PAS A;  4L9M A;  2LMV A;  5AEQ A;  2KDH A;  1CFP A;  2BKH B;  1VRK A;  2LHI A;  2H61 A;  3BUN B;  1M46 A;  1TIZ A;  2I2R E;  1QAS A;  1TNX A;  3CR2 A;  1A75 B;  2KFF A;  5CSI A;  1CLL A;  3KF9 A;  3WXA A;  1IH0 A;  1XVJ A;  2Q4U A;  2JTZ A;  3SJS A;  1WDC B;  2MAZ A;  1SCM B;  3EVV A;  1NCZ A;  2O60 A;  1KK8 B;  4E68 A;  3ICB A;  5CSF A;  4PHJ A;  3VRR A;  4GPL B;  2EC6 B;  1K94 A;  2L50 A;  1A75 A;  2CT9 A;  5KSZ A;  1K95 A;  3SG6 A;  1SL9 A;  4GNK B;  2O5G A;  4CFQ A;  1MXL C;  2Y1N A;  1SR6 B;  3BOW A;  3MSE B;  3PM8 A;  1M31 A;  1H4B A;  4PAL A;  1KK8 C;  2K0J A;  1JFJ A;  3KPX A;  1YVL A;  2SCP A;  1Y1X A;  1SMG A;  2EC6 C;  2LE9 B;  3SG3 A;  3OX5 A;  4YI9 A;  3SG5 A;  4I5N B;  2MA2 A;  1N2D A;  3BUW B;  5K89 A;  1XFU O;  2B1U A;  2LUC A;  1MF8 B;  2BL0 B;  4MN0 A;  3LLE A;  1SW8 A;  1PSR A;  5I2L A;  3WNX B;  2HQW A;  4NDB A;  4YGD B;  3FS7 A;  2MLE C;  2KNE A;  2NCP A;  2Y4Q A;  4GGF A;  3OB2 B;  1SPY A;  1TCO B;  2L5X B;  1S26 D;  1D1O A;  1UP5 A;  4N1F A;  2M7N A;  2WCF A;  1NX2 A;  1YTZ C;  1ZUZ A;  1XK4 A;  4AQI A;  3TDI A;  5HLO A;  3NSO A;  3WHU B;  2I94 A;  4M2P A;  2JOJ A;  1MQ1 A;  1WRK A;  2K7D A;  3BXK A;  3LK0 A;  1Y6W A;  1KSO A;  1LIN A;  1CDP A;  3AAK A;  2MBX A;  1Y1U A;  1IKU A;  2BBM A;  2WOR A;  3RM1 A;  2RGI A;  1M39 A;  2G9B A;  2KOT A;  2LVI A;  3WHT B;  4NDD A;  1AJ5 A;  1B7T Z;  2KYF A;  1OQP A;  1QXP A;  2F33 A;  3K21 A;  4HRG A;  5AER A;  1FW4 A;  3VGO A;  1JSA A;  1XFY O;  2ZKM X;  3CGA A;  1NCX A;  2LLT A;  2R2I A;  3AKB A;  2BEC A;  2M1K B;  1CMF A;  1C7V A;  3PFV A;  1K8U A;  3BUO B;  3PLF B;  1K9P A;  1G4Y R;  2HQ8 A;  2JU0 A;  1U5I A;  1C7W A;  3TUY B;  1NPQ A;  2K2A A;  2D8N A;  1K96 A;  1MXE A;  1F8H A;  1Q80 A;  1KK7 Y;  2GV5 A;  1B4C A;  3DF0 A;  4USL A;  2LNK A;  1DF0 B;  1IJ5 A;  1XO5 A;  2IS9 A;  1B8C A;  1J55 A;  1Y0V H;  4PE1 A;  4YGA A;  1MUX A;  4M2Q A;  4QJ3 B;  4WQ2 A;  4DUQ A;  4PHN A;  3TUY C;  2JXC A;  5I2Q A;  4MEW A;  1CFC A;  1CB1 A;  2HET A;  1ZAC A;  2K2F A;  2LVV A;  1PVA A;  1OSA A;  1J7Q A;  2AAO A;  1JWD A;  2G2B A;  5D7F A;  2NLN A;  5HKZ A;  1K9U A;  1B7T Y;  1EG4 A;  1EG3 A;  2P6B B;  5I2O A;  2TN4 A;  1AJ4 A;  2LMT A;  4GGN A;  3KO0 A;  3BQ3 A;  4NQG A;  2FCE A;  4AQJ A;  1LXF C;  1CDM A;  3CLN A;  3AKA A;  4ORA B;  3I5G B;  4MSP A;  5CSN A;  1H8B A;  1WRL A;  1OZO A;  1CM4 A;  1NSH A;  3CZT X;  2PMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...