1SKTA

Solution structure of apo n-domain of troponin c, nmr, 40 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TROPONIN-C
publication title Low-temperature-induced structural changes in the Apo regulatory domain of skeletal muscle troponin C.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Calcium-binding protein
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sktA00
1KSMA 2JRFA 2K8MB 1V1GA 3ZWHA 3BXKA 3D10A 1W7IB 1LKJA 2ISDA 3A4UB 3LK0A 1DGUA 1DMOA 2MLFC 4ORBB 1D1OA 1DVIA 1SCVA 2KAXA 1KK8B 1XFWO 1OE9B 3I5IB 1JFJA 2LV7A 1K90D 1KQMC 1L7ZA 4R1EA 1CM4A 4HREE 4GFTA 1SBJA 4U8DA 2LANA 2AAOA 4MLWA 4CLNA 3PFVA 1BOCA 3TDIA 5HKYA 2I7AA 1H8BA 1OMDA 2BCXA 1XK4C 1CFPA 1V1FA 1UP5A 2Y5IA 3NSLA 4CFRA 2KQYA 1YUTA 5HLVA 3CR2A 4QJ4B 1WY9A 1QIWA 1BR4B 1LXFC 2LNKA 3HX4A 3PN7C 1DJHA 5TNCA 1PVAA 4F0ZB 1SR6C 2GV5A 1RROA 1OSAA 4YGDB 1KFXS 2KYFA 1A75B 2F33A 2ZRTA 2F8PA 2O5GA 1B7TY 2K2AA 1K9UA 1UHNA 1E8AA 3CLNA 4GPLB 2M7LA 2JC2A 2F3ZA 5JOLA 1SL7A 1BODA 4I5KA 1NIWA 3BQ3A 4NQGA 4ORAB 1KFXL 4GBAA 3EKHA 5ER4X 2PVBA 4I5JA 3RM1A 2KGRA 5CSNA 2K0JA 1IG5A 4CFQA 1ALVA 1DGVA 1DT7B 1F70A 1KQMB 4AOMA 1F8HA 3HCMA 1B7TZ 4YGCB 5G08A 1NX0A 3FIAA 3VGOA 4UPGA 1KK7Y 3VRQA 2TN4A 4GGFC 1QV1A 3O6BA 3D0YB 4YI9A 2LVKA 1GJYA 1W7JB 2M8UA 4MZKA 2WOSA 1DF0B 1DJYA 2BCBA 3BOWA 2CCMA 2KFHA 2WORA 2RGIA 1K9KA 1QV0A 1N65A 1SMGA 4ICBA 4M2QA 3PN7B 2JPTA 3VRNA 1ZOTB 1NYAA 2EGDA 1KK7Z 3CWGA 1SR6B 4GAOA 3IQQA 3I5FB 2WCFA 3PLFB 2JXLA 1WRKA 1NWDA 1FF1A 1PK0D 1G4YR 4C0KA 2FCDA 2KYCA 3IQOA 2ZFDA 3F45A 3SG5A 1RECA 1WRZA 2CTNA 3VROA 1EXRA 3NSOA 3GOFA 2K7BA 3DVKA 3EK7A 2KNEA 2BKHB 4A4CA 4NDDA 4NDBA 1XFUO 1L2OB 1HQVA 1S6IA 1TRFA 1PVBA 2LVVA 3O4YA 2NCPA 2MRDA 4WQ2A 2JOJA 2K7DA 1S1EA 2LLTA 5AANA 2LMUA 1Y0VH 5HLOA 1NP8A 1UWOA 2M1KB 1IGVA 1UUSA 4C0JA 4D1EA 3SIAA 1BR1B 2OPOA 1A75A 4YGEB 2MHHA 1C7WA 1KWOB 1IKUA 1XFXO 2LAPA 3WHTB 1OQPA 4HRHA 4MRYA 4BY5A 1PULA 1OOJA 1S5GY 1KSOA 2BL0C 3CR4X 3SG6A 2KGBC 3OP0A 2L0PA 1AJ5A 2KOTA 3EK8A 4DUQA 1OZOA 4USLA 1M45A 3TDZA 1H4BA 2I2RE 1HT9A 1X02A 1K95A 2HQ8A 1BT6A 5CPVA 1M39A 4MBEA 4P2YB 4ZCVA 1C7VA 1B1GA 2MAZA 3PSRA 2KBIA 1B8CA 1DJXA 3KPXA 2JQ6A 4QJ5B 2MA2A 3FS7A 1FW4A 1WRLA 1IJ5A 1XK4A 3PM8A 3D0YA 1XVJA 3BOWB 1KQVA 1EJ3A 1A4PA 2COLB 2ZKMX 2KSPA 1JC2A 1J7RA 4GGNA 1DF0A 5GQQC 2Q91A 3BUNB 3OB2B 2E30A 5AERA 1TIZA 4OV2A 1YX8A 1S6CA 2WCBA 3BUMB 2SASA 1RFJA 2BBMA 3EKJA 2KDHA 1K93D 1J1DA 2LVIA 3CS1A 1BMOA 4PHNA 2PASA 1CB1A 1EG4A 1F4QA 1BF5A 1J7OA 4PDZA 1DJGA 1B8LA 5HYDA 1QLSA 1QATA 1JWDA 5AEQA 2M3WA 1QJTA 3SG4A 5J3XA 4WRIA 1A2XA 3I5HB 2JZIA 1SCMB 4DS7A 2BCAA 5I2OA 1IH0A 2JNFA 5CSFA 2HF5A 5DKNA 1M63B 3BUWB 3I5GC 4OVNF 1VRKA 5FYXA 3DF0B 4DIRA 1GGZA 2JNXA 3TS5C 4Q04A 2ZN8A 2KI4C 3BUOB 1MUXA 1NPQA 2B1UA 4OCIA 3WHUB 5I2QA 1TNQA 2I94A 1YR5A 4PE0A 1DJWA 2JU0A 2MBXA 1ALWA 5D7FA 1TNPA 4AQJA 1AHRA 1QS7A 2KI6D 1A29A 4PHKA 1LINA 3CTNA 1AJ4A 3KF9A 1NX2A 1R2UA 5K89A 1FBVA 2LC5A 1J1EA 4PE1A 4E68A 2M1UA 1QX5B 4YI8A 1NCYA 1TNXA 4CPVA 4GUKA 4YRUA 2MLEC 4XJKB 2L4HA 3TUYC 1CFDA 1K8UA 2KAVA 4HRGA 1U5IB 1S3PA 1AVSA 2LHLA 1UHKA 1MWNA 1CLMA 3CZTX 4JWQA 3AKBA 4I5NB 4MVFA 2LLSA 1XYDA 3TDUA 3TZ1A 1CDPA 2LVJA 2P6BB 1WLMA 2LHIA 2LUCA 1CDLA 2L50A 3JVTC 3OX5A 1TCFA 1IQ5A 2NZ0A 2O60A 4M2OA 3TS5B 4JPZB 2EC6C 1NX3A 2KI4B 1XO5A 1B8RA 4XYNA 1F71A 4P5OE 1ZMZA 2ZNEA 3H4SE 4DRWA 1F55A 4N1GA 2L5XB 3NSIA 1BJFA 1GGWA 1CLLA 5KTYA 1B47A 1QTXA 5JJGA 1KK8C 3ICBA 3SG7A 1IWQA 3DF0A 2K2FA 1J7QA 3SJSA 2K61A 5B8IB 2CNPA 1MXLC 2G9BA 3CGAA 2KFGA 3IF7A 1RTP1 2KBMA 3SG2A 2LMVA 4HSZA 4BY4A 1RWYA 1CKKA 1YX7A 5HKZA 1BU3A 3OHMB 1MQ1A 1AK8A 1G8IA 2JT8A 2VRGA 3DVJA 2JXCA 1B4CA 1AP4A 2V53A 1ZFSA 1QXPA 4ORCB 2KHNA 5KSZA 1C07A 2BKIB 1CDMA 1YUSA 5HKWA 1SRAA 2LE9B 2Q4UA 1F54A 2F2OA 1EG3A 2D8NA 2PSRA 5CSIA 3M0WA 4MN0A 1CLBA 1JF0A 2GGMA 1QASA 2LP3A 1S5GZ 2KI6C 2JTZA 1EH2A 3AAJA 2EHBA 3FWBA 4XJKA 4TNCA 1UHJA 1CTRA 1SKTA 1LA3A 1Q80A 1U5IA 2K7CA 2KFFA 1NX1A 3NXAA 1SL8A 1A03A 1PALA 1Y1UA 1DJIA 4DCKA 1YRTB 4PE7A 2H61C 2SCPA 3WNXB 1EL4A 2M0RA 1S36A 2LCPA 1TNWA 2NLNA 4YGAA 2ZN9A 1S26D 3VRPA 1ODBA 4PALA 1OMRA 4A4BA 5ER5A 1IRJA 1ZUZA 1Y1AA 1UHIA 3ZNIA 1J7PA 2NXQA 2BE6A 5KU1A 2WNDA 2JTTA 2JWWA 1XFVO 2QPTA 4AQIA 2H2KA 2WC8A 2BL0B 2JT3A 1BG1A 2M7NA 3NSKA 4FTGA 3PALA 3KHEA 4OKHA 1IJ6A 2ZRSA 1CFCA 5DKRA 3PATA 2HETA 3EK4A 1QX7A 1TTXA 1G33A 2BECA 1S6JA 4YBHB 2CXJA 4QJ3B 1JBAA 1PRWA 1LVCD 4N5XA 4FQOA 1N2DA 1NSHA 3KO0A 4YGBB 1OMVA 1PSRA 2L51A 2I18A 2OS8C 1LA0A 2HPSA 4GGFA 1XA5A 3E3RA 2FCEA 2MJWB 2Y4QA 1TOPA 2LLUA 1XFYO 4NDCA 3KEVA 1K2HA 3I5FC 4I5LB 1CMFA 1FPWA 1YUUA 4ETOA 1SK6D 4MZLA 5CSJA 1WDCC 2JULA 3BUXB 1ZACA 2R2IA 1JF2A 1QLKA 1J55A 1F4OA 2LMTA 3MSEB 3EVVA 1K9PA 3AAKA 1QVIY 5IBWA 1L2OC 4PE4A 3C1VA 1SY9A 3BYAA 2BE4A 1M31A 4OR9B 3DD4A 2FJUB 1UHHA 2FOTA 1NUBA 2L4IA 1CDNA 1R6PA 1KFUS 3WXAA 4JQ0D 4IL1A 1CFFA 1MF8B 2Y1MA 2ZNDA 1KWOC 3OB1B 2OTGC 1SL9A 1PSBA 1WLZA 3EVRA 2CT9A 3DVMA 1QVIZ 4WQ3A 2G2BA 3JTDC 1SPYA 3I5GB 1K96A 1KFUL 2CBLA 1MXEA 1QIVA 1YURA 2L98A 4PHMA 3SG3A 1AUIB 3O2PA 1B9AA 1RJVA 2GGZA 2LUXA 2LP2A 3A8RA 2OS8B 3VRRA 4MEWA 5D69A 1QX2A 2AUCA 2M49B 1YVHA 1CNPA 1FI6A 3OX6A 1TN4A 1CM1A 1JFKA 2BBNA 1JUOA 1WDCB 3EVUA 4PHJA 4C0LA 1SNLA 1MHOA 1KCYA 1Y6WA 3I5IC 2M29A 3RLZA 5I8NA 2PMYA 5BPJA 2F3YA 4PCWA 2Y1NA 2M97A 1OZSA 1SYMA 1NCZA 2F2PA 3O78A 3TUYB 4M2PA 2PRUA 1NCXA 2QACA 2K7OA 3FWCA 5I2LA 1YRUB 2KAYA 5AXIA 2E6WA 2HQWA 3LL8B 5DKQA 1SW8A 1JSAA 3GK4X 2WCEA 4L9MA 2DOQA 1IQ3A 2L2EA 3LCPC 1M46A 1YTZC 2A4JA 4CIDA 5F6TA 2LM5A 2H61A 2JT0A 2OTGB 3GK2A 2NCOA 1CMGA 4N1FA 2KQ6A 5AFPA 3JTDB 3JVTB 4MSPA 1K94A 1Y1XA 4GNKB 1YVLA 2PALA 3GK1A 1XFZO 3LK1A 1TCOB 1UURA 3SIBA 3AKAA 2AMIA 3CR5X 2EC6B 3I5HC 4MZJA 1DJZA 4MRXA 1SCMC 3QRXA 1BLQA 3DVEA 2M9GA 5PALA 1MR8A 3LLEA 1GQMA 2IS9A 3K21A 4ZCUA 1N0YA 1FI5A 1DTLA 1RK9A
chains in the Genus database with same CATH superfamily
1KSMA 2JRFA 2K8MB 1V1GA 3R1OA 1C3YA 3ZWHA 3BXKA 3D10A 1W7IB 1LKJA 2ISDA 3A4UB 3LK0A 1DGUA 1DMOA 2MLFC 4ORBB 1D1OA 1DVIA 1SCVA 2KAXA 1KK8B 1XFWO 1OE9B 3I5IB 1JFJA 3PM2A 3CZ1A 2LV7A 1K90D 1KQMC 1L7ZA 1W9ZA 4R1EA 1CM4A 3EG5B 4HREE 4GFTA 3S0GA 1SBJA 1SSEB 4U8DA 2LANA 2AAOA 4MLWA 4CLNA 3PFVA 1BOCA 3TDIA 5HKYA 2P71A 2I7AA 3CYZA 1H8BA 1OMDA 2BCXA 1XK4C 1CFPA 1V1FA 1UP5A 2Y5IA 3CABA 3NSLA 4CFRA 2KQYA 1YUTA 1DQEA 5HLVA 3CR2A 4QJ4B 1WY9A 1QIWA 1BR4B 1LXFC 2LNKA 2QEOA 1OOGA 3D75A 3HX4A 3PN7C 1DJHA 5TNCA 3SS5A 1PVAA 4F0ZB 4JKTA 1OW4A 1SR6C 2GV5A 1RROA 1OSAA 4YGDB 3B7AA 1KFXS 2KYFA 1A75B 2F33A 2ZRTA 2F8PA 2O5GA 1B7TY 2K2AA 1K9UA 1UHNA 1E8AA 3CLNA 1T14A 3D74A 4GPLB 2JC2A 2F3ZA 2M7LA 5JOLA 1SL7A 4FQTA 1BODA 4I5KA 1NIWA 3BQ3A 4NQGA 4ORAB 1KFXL 4GBAA 3EKHA 5ER4X 2PVBA 4I5JA 3S0FA 3RM1A 2KGRA 5CSNA 4KYNA 2K0JA 1IG5A 3D73A 4CFQA 1ALVA 1DGVA 1DT7B 1F70A 1KQMB 4AOMA 1F8HA 3HCMA 1B7TZ 4YGCB 5G08A 5D3OA 1NX0A 3FIAA 3VGOA 5FI7A 4UPGA 1KK7Y 3VRQA 2TN4A 3BJHA 4GGFC 1QV1A 2PQLA 3O6BA 3D0YB 4YI9A 2LVKA 1GJYA 3SS3A 1W7JB 3D78A 2M8UA 4MZKA 2WOSA 1DF0B 1DJYA 2BCBA 3BOWA 2CCMA 2KFHA 2WORA 3K1EA 2RGIA 1K9KA 1QV0A 1N65A 1SMGA 4ICBA 4M2QA 3PN7B 3CDNA 2JPTA 3VRNA 4INWA 1ZOTB 1NYAA 2EGDA 1KK7Z 3CWGA 1SR6B 4GAOA 3IQQA 3I5FB 2WCFA 3PLFB 2JXLA 1WRKA 1NWDA 1FF1A 1PK0D 1G4YR 4C0KA 3RZSA 2FCDA 2KYCA 3IQOA 2ZFDA 3F45A 3SG5A 3DXLA 1RECA 1WRZA 2CTNA 3VROA 1EXRA 3NSOA 3GOFA 2K7BA 3DVKA 3CZ0A 3EK7A 2KNEA 2BKHB 3OGNA 4NDDA 4NDBA 1XFUO 4A4CA 1L2OB 1HQVA 1S6IA 1TRFA 1PVBA 2LVVA 3B86A 2NCPA 2MRDA 3O4YA 4WQ2A 2JOJA 2K7DA 1S1EA 2LLTA 5AANA 2LMUA 1Y0VH 5HLOA 1NP8A 1UWOA 2M1KB 1IGVA 1UUSA 4C0JA 4D1EA 3L4AA 1BR1B 3SIAA 1QWVA 2OPOA 1A75A 4YGEB 2MHHA 1C7WA 2GTEA 1KWOB 2QDIA 1IKUA 1XFXO 2LAPA 2P70A 3WHTB 1OQPA 4HRHA 4MRYA 4BY5A 1PULA 1OOJA 3IVTA 1S5GY 1KSOA 2BL0C 2WC5A 3CR4X 3SG6A 2KGBC 3OP0A 2L0PA 1AJ5A 2KOTA 3EK8A 3S0AA 1Z4HA 4DUQA 1OZOA 4OZDA 4USLA 1M45A 3TDZA 1H4BA 2I2RE 1HT9A 1X02A 1K95A 2HQ8A 1BT6A 5CPVA 1M39A 4MBEA 4P2YB 4ZCVA 1C7VA 1B1GA 2MAZA 3PSRA 2KBIA 1B8CA 1DJXA 3KPXA 2JQ6A 4QJ5B 3BFAA 2MA2A 1C3ZA 3FS7A 3VB1A 1FW4A 1WRLA 1IJ5A 1XK4A 1ORGA 3PM8A 3D0YA 1XVJA 3BOWB 1KQVA 1EJ3A 1A4PA 2COLB 2BAPA 2ZKMX 2KSPA 1JC2A 1J7RA 1XFRA 4GGNA 1DF0A 5GQQC 2Q91A 3BUNB 3OB2B 2E30A 5FI6A 5AERA 1TIZA 4OV2A 1YX8A 2KLEA 1S6CA 2WCBA 3BUMB 2SASA 1RFJA 2BBMA 3EKJA 2KDHA 1K93D 1J1DA 2LVIA 3CS1A 1BMOA 4PHNA 2PASA 1CB1A 1EG4A 1F4QA 1BF5A 1J7OA 4PDZA 3CZ2A 1OOIX 1DJGA 1B8LA 3Q8IA 5HYDA 1QLSA 1QATA 1JWDA 5AEQA 2ERBA 1QJTA 2M3WA 3SG4A 5J3XA 4WRIA 1A2XA 3I5HB 2JZIA 1SCMB 4DS7A 2BCAA 3B6XA 5I2OA 1IH0A 2JNFA 5CSFA 2HF5A 5DKNA 1M63B 3BUWB 3I5GC 4OVNF 1VRKA 5FYXA 3DF0B 4DIRA 1GGZA 2JNXA 4F7FA 3TS5C 4Q04A 2ZN8A 2KI4C 3BUOB 1MUXA 1NPQA 2B1UA 4OCIA 3WHUB 5I2QA 1TNQA 2I94A 1YR5A 4PE0A 1DJWA 2JU0A 2MBXA 1ALWA 5D7FA 1TNPA 4AQJA 1AHRA 1QS7A 2KI6D 3L4LA 1A29A 4PHKA 1LINA 3CTNA 1AJ4A 3KF9A 1NX2A 1OOFA 1R2UA 5K89A 1FBVA 2LC5A 1J1EA 4PE1A 4E68A 2M1UA 1QX5B 4YI8A 3UO9A 1NCYA 1TWOA 1TNXA 4CPVA 4GUKA 4YRUA 2JPOA 2FJYA 2MLEC 2L4HA 4XJKB 3TUYC 1CFDA 1K8UA 2KAVA 4HRGA 1U5IB 3O4XA 1S3PA 3QMEA 5HL1A 1AVSA 2LHLA 1UHKA 1MWNA 1CLMA 2H8VA 3CZTX 4JWQA 3AKBA 4I5NB 4INXA 2QEVA 4MVFA 2LLSA 1XYDA 3TDUA 3TZ1A 1CDPA 2LVJA 3R1VA 3R72A 2P6BB 1WLMA 1TUZA 2LHIA 2LUCA 1CDLA 2L50A 3JVTC 3OX5A 1TCFA 1IQ5A 3DZTA 2NZ0A 2O60A 4M2OA 3TS5B 4JPZB 2EC6C 1NX3A 2KI4B 5DICA 1XO5A 1B8RA 4XYNA 5EL2A 1F71A 1GM0A 4P5OE 3V2LA 1ZMZA 2WCKA 2ZNEA 3H4SE 4DRWA 1F55A 4N1GA 2L5XB 3NGVA 1OOHA 3NSIA 3NHTA 1BJFA 1GGWA 1CLLA 5KTYA 1B47A 3NHIA 1QTXA 5JJGA 1KK8C 3ICBA 3SG7A 1IWQA 3DYEA 3DF0A 2K2FA 1J7QA 1LS8A 3SJSA 2K61A 5B8IB 3S0BA 2CNPA 1MXLC 2G9BA 3CGAA 2KFGA 3IF7A 1RTP1 2KBMA 3DY9A 3SG2A 2LMVA 4HSZA 4BY4A 1RWYA 1CKKA 1YX7A 5HKZA 1BU3A 3OHMB 1MQ1A 1AK8A 1G8IA 2JT8A 2VRGA 3DVJA 2JXCA 2QEBA 1B4CA 1AP4A 2V53A 1ZFSA 1QXPA 4ORCB 2WCLA 2KHNA 3PJIA 5KSZA 1C07A 2BKIB 1CDMA 1YUSA 2QEHA 5HKWA 1SRAA 5I94A 2LE9B 2Q4UA 1F54A 2F2OA 1EG3A 2D8NA 2PSRA 5CSIA 3M0WA 4MN0A 1CLBA 1JF0A 2GGMA 1QASA 2LP3A 1S5GZ 2KI6C 4JD9A 3BFBA 2JTZA 1EH2A 3AAJA 2EHBA 3FWBA 4XJKA 4TNCA 1UHJA 1CTRA 1SKTA 1LA3A 1Q80A 1U5IA 2K7CA 2KFFA 1NX1A 3NXAA 1SL8A 1A03A 1PALA 1Y1UA 1DJIA 4DCKA 1YRTB 4PE7A 2H61C 2SCPA 3WNXB 1EL4A 2M0RA 1S36A 2LCPA 1TNWA 2NLNA 4YGAA 2ZN9A 1S26D 3VRPA 1ODBA 4PALA 1OMRA 3D77A 4A4BA 5ER5A 1IRJA 1ZUZA 1Y1AA 1UHIA 3ZNIA 1J7PA 2NXQA 2BE6A 5KU1A 2WNDA 2JTTA 2JWWA 1XFVO 2QPTA 3FE8A 2H2KA 2WC8A 4AQIA 2BL0B 2JT3A 1BG1A 2M7NA 3NSKA 4FTGA 3PALA 3KHEA 4OKHA 1IJ6A 2ZRSA 1CFCA 5DKRA 3PATA 2HETA 3EK4A 1QX7A 1TTXA 1G33A 1S6JA 2BECA 4YBHB 2CXJA 4QJ3B 1JBAA 1PRWA 1LVCD 4N5XA 4FQOA 1N2DA 1NSHA 3KO0A 4YGBB 1OMVA 1PSRA 2L51A 2I18A 1DELA 3B88A 2OS8C 4PT1A 1LA0A 2HPSA 3D76A 4GGFA 1XA5A 3UNWA 3E3RA 2FCEA 2MJWB 2Y4QA 2YGUA 1TOPA 2LLUA 1XFYO 4NDCA 2L2CA 3KEVA 1K2HA 3I5FC 4I5LB 1CMFA 1FPWA 1YUUA 4ETOA 1SK6D 4MZLA 5CSJA 1WDCC 2JULA 3BUXB 1ZACA 2R2IA 3SS4A 3B87A 1JF2A 1QLKA 1J55A 1F4OA 3L47A 2LMTA 3MSEB 3EVVA 3FE6A 1K9PA 3AAKA 1QVIY 5IBWA 1Z2CB 1L2OC 4PE4A 2BNXA 3C1VA 1SY9A 3BYAA 2BE4A 1M31A 3FE9A 4OR9B 3S0DA 3DD4A 2FJUB 1UHHA 2FOTA 4IJ7A 1NUBA 2L4IA 1CDNA 1R6PA 1KFUS 3WXAA 4JQ0D 4IL1A 1CFFA 1MF8B 2Y1MA 2ZNDA 1KWOC 3OB1B 2OTGC 1SL9A 1PSBA 1WLZA 3EVRA 3OBVA 2CT9A 3DVMA 1QVIZ 2WCMA 4WQ3A 2G2BA 3JTDC 1SPYA 3I5GB 1K96A 1KFUL 1MXEA 2CBLA 1QIVA 1YURA 2L98A 4PHMA 3SG3A 1AUIB 3O2PA 1B9AA 1RJVA 2GGZA 2LUXA 2LP2A 3A8RA 2OS8B 3VRRA 4MEWA 5D69A 1DEKA 1QX2A 2AUCA 2M49B 1YVHA 1CNPA 5FI2A 2KLDA 1IIOA 1FI6A 3OX6A 1TN4A 1CM1A 1JFKA 2BBNA 1TUJA 1JUOA 1WDCB 3EVUA 4PHJA 4C0LA 1SNLA 1MHOA 1KCYA 1Y6WA 3I5IC 1P28A 2M29A 3RLZA 5I8NA 2PMYA 5BPJA 2K60A 2F3YA 4PCWA 2Y1NA 2M97A 1OZSA 1SYMA 1NCZA 2L5YA 2F2PA 3O78A 3TUYB 4M2PA 2PRUA 1NCXA 2QACA 2K7OA 3FWCA 2PYQA 5I2LA 1YRUB 2KAYA 5AXIA 2E6WA 2HQWA 3LL8B 5DKQA 1SW8A 1JSAA 3GK4X 2WCEA 3R1PA 4L9MA 2DOQA 2KPHA 2L2EA 3LCPC 1IQ3A 1M46A 1YTZC 2A4JA 4CIDA 3BFHA 5F6TA 2LM5A 2H61A 2JT0A 2OTGB 3GK2A 2NCOA 1CMGA 2WCHA 2WCJA 4N1FA 2KQ6A 5AFPA 3JTDB 3JVTB 4MSPA 1K94A 1Y1XA 4GNKB 1YVLA 2PALA 3GK1A 1XFZO 3LK1A 1TCOB 1UURA 3SIBA 3AKAA 2AMIA 3CR5X 2EC6B 3I5HC 4MZJA 1DJZA 4MRXA 1SCMC 3QRXA 1BLQA 3DVEA 2M9GA 3N7HA 5PALA 1DC1A 1MR8A 3LLEA 1GQMA 2IS9A 3K21A 4ZCUA 1N0YA 2WC6A 3S0EA 1FI5A 1DTLA 1RK9A
chains in the Genus database with same CATH topology
1KSMA 2JRFA 2K8MB 1V1GA 3ZWHA 3BXKA 3D10A 1W7IB 1LKJA 2ISDA 3A4UB 3LK0A 1DGUA 1DMOA 2MLFC 4ORBB 1D1OA 1DVIA 1SCVA 2KAXA 1KK8B 1XFWO 1OE9B 3I5IB 1JFJA 2LV7A 1K90D 1KQMC 1L7ZA 4R1EA 1CM4A 4HREE 4GFTA 1SBJA 4U8DA 2LANA 2AAOA 4MLWA 4CLNA 3PFVA 1BOCA 3TDIA 5HKYA 2I7AA 1H8BA 1OMDA 2BCXA 1XK4C 1CFPA 1V1FA 1UP5A 2Y5IA 3NSLA 4CFRA 2KQYA 1YUTA 5HLVA 3CR2A 4QJ4B 1WY9A 1QIWA 1BR4B 1LXFC 2LNKA 3HX4A 3PN7C 1DJHA 5TNCA 1PVAA 4F0ZB 1SR6C 2GV5A 1RROA 1OSAA 4YGDB 1KFXS 2KYFA 1A75B 2F33A 2ZRTA 2F8PA 2O5GA 1B7TY 2K2AA 1K9UA 1UHNA 1E8AA 3CLNA 4GPLB 2M7LA 2JC2A 2F3ZA 5JOLA 1SL7A 1BODA 4I5KA 1NIWA 3BQ3A 4NQGA 4ORAB 1KFXL 4GBAA 3EKHA 5ER4X 2PVBA 4I5JA 3RM1A 2KGRA 5CSNA 2K0JA 1IG5A 4CFQA 1ALVA 1DGVA 1DT7B 1F70A 1KQMB 4AOMA 1F8HA 3HCMA 1B7TZ 4YGCB 5G08A 1NX0A 3FIAA 3VGOA 4UPGA 1KK7Y 3VRQA 2TN4A 4GGFC 1QV1A 3O6BA 3D0YB 4YI9A 2LVKA 1GJYA 1W7JB 2M8UA 4MZKA 2WOSA 1DF0B 1DJYA 2BCBA 3BOWA 2CCMA 2KFHA 2WORA 2RGIA 1K9KA 1QV0A 1N65A 1SMGA 4ICBA 4M2QA 3PN7B 2JPTA 3VRNA 1ZOTB 1NYAA 2EGDA 1KK7Z 3CWGA 1SR6B 4GAOA 3IQQA 3I5FB 2WCFA 3PLFB 2JXLA 1WRKA 1NWDA 1FF1A 1PK0D 1G4YR 4C0KA 2FCDA 2KYCA 3IQOA 2ZFDA 3F45A 3SG5A 1RECA 1WRZA 2CTNA 3VROA 1EXRA 3NSOA 3GOFA 2K7BA 3DVKA 3EK7A 2KNEA 2BKHB 4A4CA 4NDDA 4NDBA 1XFUO 1L2OB 1HQVA 1S6IA 1TRFA 1PVBA 2LVVA 3O4YA 2NCPA 2MRDA 4WQ2A 2JOJA 2K7DA 1S1EA 2LLTA 5AANA 2LMUA 1Y0VH 5HLOA 1NP8A 1UWOA 2M1KB 1IGVA 1UUSA 4C0JA 4D1EA 3SIAA 1BR1B 2OPOA 1A75A 4YGEB 2MHHA 1C7WA 1KWOB 1IKUA 1XFXO 2LAPA 3WHTB 1OQPA 4HRHA 4MRYA 4BY5A 1PULA 1OOJA 1S5GY 1KSOA 2BL0C 3CR4X 3SG6A 2KGBC 3OP0A 2L0PA 1AJ5A 2KOTA 3EK8A 4DUQA 1OZOA 4USLA 1M45A 3TDZA 1H4BA 2I2RE 1HT9A 1X02A 1K95A 2HQ8A 1BT6A 5CPVA 1M39A 4MBEA 4P2YB 4ZCVA 1C7VA 1B1GA 2MAZA 3PSRA 2KBIA 1B8CA 1DJXA 3KPXA 2JQ6A 4QJ5B 2MA2A 3FS7A 1FW4A 1WRLA 1IJ5A 1XK4A 3PM8A 3D0YA 1XVJA 3BOWB 1KQVA 1EJ3A 1A4PA 2COLB 2ZKMX 2KSPA 1JC2A 1J7RA 4GGNA 1DF0A 5GQQC 2Q91A 3BUNB 3OB2B 2E30A 5AERA 1TIZA 4OV2A 1YX8A 1S6CA 2WCBA 3BUMB 2SASA 1RFJA 2BBMA 3EKJA 2KDHA 1K93D 1J1DA 2LVIA 3CS1A 1BMOA 4PHNA 2PASA 1CB1A 1EG4A 1F4QA 1BF5A 1J7OA 4PDZA 1DJGA 1B8LA 5HYDA 1QLSA 1QATA 1JWDA 5AEQA 2M3WA 1QJTA 3SG4A 5J3XA 4WRIA 1A2XA 3I5HB 2JZIA 1SCMB 4DS7A 2BCAA 5I2OA 1IH0A 2JNFA 5CSFA 2HF5A 5DKNA 1M63B 3BUWB 3I5GC 4OVNF 1VRKA 5FYXA 3DF0B 4DIRA 1GGZA 2JNXA 3TS5C 4Q04A 2ZN8A 2KI4C 3BUOB 1MUXA 1NPQA 2B1UA 4OCIA 3WHUB 5I2QA 1TNQA 2I94A 1YR5A 4PE0A 1DJWA 2JU0A 2MBXA 1ALWA 5D7FA 1TNPA 4AQJA 1AHRA 1QS7A 2KI6D 1A29A 4PHKA 1LINA 3CTNA 1AJ4A 3KF9A 1NX2A 1R2UA 5K89A 1FBVA 2LC5A 1J1EA 4PE1A 4E68A 2M1UA 1QX5B 4YI8A 1NCYA 1TNXA 4CPVA 4GUKA 4YRUA 2MLEC 4XJKB 2L4HA 3TUYC 1CFDA 1K8UA 2KAVA 4HRGA 1U5IB 1S3PA 1AVSA 2LHLA 1UHKA 1MWNA 1CLMA 3CZTX 4JWQA 3AKBA 4I5NB 4MVFA 2LLSA 1XYDA 3TDUA 3TZ1A 1CDPA 2LVJA 2P6BB 1WLMA 2LHIA 2LUCA 1CDLA 2L50A 3JVTC 3OX5A 1TCFA 1IQ5A 2NZ0A 2O60A 4M2OA 3TS5B 4JPZB 2EC6C 1NX3A 2KI4B 1XO5A 1B8RA 4XYNA 1F71A 4P5OE 1ZMZA 2ZNEA 3H4SE 4DRWA 1F55A 4N1GA 2L5XB 3NSIA 1BJFA 1GGWA 1CLLA 5KTYA 1B47A 1QTXA 5JJGA 1KK8C 3ICBA 3SG7A 1IWQA 3DF0A 2K2FA 1J7QA 3SJSA 2K61A 5B8IB 2CNPA 1MXLC 2G9BA 3CGAA 2KFGA 3IF7A 1RTP1 2KBMA 3SG2A 2LMVA 4HSZA 4BY4A 1RWYA 1CKKA 1YX7A 5HKZA 1BU3A 3OHMB 1MQ1A 1AK8A 1G8IA 2JT8A 2VRGA 3DVJA 2JXCA 1B4CA 1AP4A 2V53A 1ZFSA 1QXPA 4ORCB 2KHNA 5KSZA 1C07A 2BKIB 1CDMA 1YUSA 5HKWA 1SRAA 2LE9B 2Q4UA 1F54A 2F2OA 1EG3A 2D8NA 2PSRA 5CSIA 3M0WA 4MN0A 1CLBA 1JF0A 2GGMA 1QASA 2LP3A 1S5GZ 2KI6C 2JTZA 1EH2A 3AAJA 2EHBA 3FWBA 4XJKA 4TNCA 1UHJA 1CTRA 1SKTA 1LA3A 1Q80A 1U5IA 2K7CA 2KFFA 1NX1A 3NXAA 1SL8A 1A03A 1PALA 1Y1UA 1DJIA 4DCKA 1YRTB 4PE7A 2H61C 2SCPA 3WNXB 1EL4A 2M0RA 1S36A 2LCPA 1TNWA 2NLNA 4YGAA 2ZN9A 1S26D 3VRPA 1ODBA 4PALA 1OMRA 4A4BA 5ER5A 1IRJA 1ZUZA 1Y1AA 1UHIA 3ZNIA 1J7PA 2NXQA 2BE6A 5KU1A 2WNDA 2JTTA 2JWWA 1XFVO 2QPTA 4AQIA 2H2KA 2WC8A 2BL0B 2JT3A 1BG1A 2M7NA 3NSKA 4FTGA 3PALA 3KHEA 4OKHA 1IJ6A 2ZRSA 1CFCA 5DKRA 3PATA 2HETA 3EK4A 1QX7A 1TTXA 1G33A 2BECA 1S6JA 4YBHB 2CXJA 4QJ3B 1JBAA 1PRWA 1LVCD 4N5XA 4FQOA 1N2DA 1NSHA 3KO0A 4YGBB 1OMVA 1PSRA 2L51A 2I18A 2OS8C 1LA0A 2HPSA 4GGFA 1XA5A 3E3RA 2FCEA 2MJWB 2Y4QA 1TOPA 2LLUA 1XFYO 4NDCA 3KEVA 1K2HA 3I5FC 4I5LB 1CMFA 1FPWA 1YUUA 4ETOA 1SK6D 4MZLA 5CSJA 1WDCC 2JULA 3BUXB 1ZACA 2R2IA 1JF2A 1QLKA 1J55A 1F4OA 2LMTA 3MSEB 3EVVA 1K9PA 3AAKA 1QVIY 5IBWA 1L2OC 4PE4A 3C1VA 1SY9A 3BYAA 2BE4A 1M31A 4OR9B 3DD4A 2FJUB 1UHHA 2FOTA 1NUBA 2L4IA 1CDNA 1R6PA 1KFUS 3WXAA 4JQ0D 4IL1A 1CFFA 1MF8B 2Y1MA 2ZNDA 1KWOC 3OB1B 2OTGC 1SL9A 1PSBA 1WLZA 3EVRA 2CT9A 3DVMA 1QVIZ 4WQ3A 2G2BA 3JTDC 1SPYA 3I5GB 1K96A 1KFUL 2CBLA 1MXEA 1QIVA 1YURA 2L98A 4PHMA 3SG3A 1AUIB 3O2PA 1B9AA 1RJVA 2GGZA 2LUXA 2LP2A 3A8RA 2OS8B 3VRRA 4MEWA 5D69A 1QX2A 2AUCA 2M49B 1YVHA 1CNPA 1FI6A 3OX6A 1TN4A 1CM1A 1JFKA 2BBNA 1JUOA 1WDCB 3EVUA 4PHJA 4C0LA 1SNLA 1MHOA 1KCYA 1Y6WA 3I5IC 2M29A 3RLZA 5I8NA 2PMYA 5BPJA 2F3YA 4PCWA 2Y1NA 2M97A 1OZSA 1SYMA 1NCZA 2F2PA 3O78A 3TUYB 4M2PA 2PRUA 1NCXA 2QACA 2K7OA 3FWCA 5I2LA 1YRUB 2KAYA 5AXIA 2E6WA 2HQWA 3LL8B 5DKQA 1SW8A 1JSAA 3GK4X 2WCEA 4L9MA 2DOQA 1IQ3A 2L2EA 3LCPC 1M46A 1YTZC 2A4JA 4CIDA 5F6TA 2LM5A 2H61A 2JT0A 2OTGB 3GK2A 2NCOA 1CMGA 4N1FA 2KQ6A 5AFPA 3JTDB 3JVTB 4MSPA 1K94A 1Y1XA 4GNKB 1YVLA 2PALA 3GK1A 1XFZO 3LK1A 1TCOB 1UURA 3SIBA 3AKAA 2AMIA 3CR5X 2EC6B 3I5HC 4MZJA 1DJZA 4MRXA 1SCMC 3QRXA 1BLQA 3DVEA 2M9GA 5PALA 1MR8A 3LLEA 1GQMA 2IS9A 3K21A 4ZCUA 1N0YA 1FI5A 1DTLA 1RK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSM A;  2JRF A;  2K8M B;  1V1G A;  3ZWH A;  3BXK A;  3D10 A;  1W7I B;  1LKJ A;  2ISD A;  3A4U B;  3LK0 A;  1DGU A;  1DMO A;  2MLF C;  4ORB B;  1D1O A;  1DVI A;  1SCV A;  2KAX A;  1KK8 B;  1XFW O;  1OE9 B;  3I5I B;  1JFJ A;  2LV7 A;  1K90 D;  1KQM C;  1L7Z A;  4R1E A;  1CM4 A;  4HRE E;  4GFT A;  1SBJ A;  4U8D A;  2LAN A;  2AAO A;  4MLW A;  4CLN A;  3PFV A;  1BOC A;  3TDI A;  5HKY A;  2I7A A;  1H8B A;  1OMD A;  2BCX A;  1XK4 C;  1CFP A;  1V1F A;  1UP5 A;  2Y5I A;  3NSL A;  4CFR A;  2KQY A;  1YUT A;  5HLV A;  3CR2 A;  4QJ4 B;  1WY9 A;  1QIW A;  1BR4 B;  1LXF C;  2LNK A;  3HX4 A;  3PN7 C;  1DJH A;  5TNC A;  1PVA A;  4F0Z B;  1SR6 C;  2GV5 A;  1RRO A;  1OSA A;  4YGD B;  1KFX S;  2KYF A;  1A75 B;  2F33 A;  2ZRT A;  2F8P A;  2O5G A;  1B7T Y;  2K2A A;  1K9U A;  1UHN A;  1E8A A;  3CLN A;  4GPL B;  2M7L A;  2JC2 A;  2F3Z A;  5JOL A;  1SL7 A;  1BOD A;  4I5K A;  1NIW A;  3BQ3 A;  4NQG A;  4ORA B;  1KFX L;  4GBA A;  3EKH A;  5ER4 X;  2PVB A;  4I5J A;  3RM1 A;  2KGR A;  5CSN A;  2K0J A;  1IG5 A;  4CFQ A;  1ALV A;  1DGV A;  1DT7 B;  1F70 A;  1KQM B;  4AOM A;  1F8H A;  3HCM A;  1B7T Z;  4YGC B;  5G08 A;  1NX0 A;  3FIA A;  3VGO A;  4UPG A;  1KK7 Y;  3VRQ A;  2TN4 A;  4GGF C;  1QV1 A;  3O6B A;  3D0Y B;  4YI9 A;  2LVK A;  1GJY A;  1W7J B;  2M8U A;  4MZK A;  2WOS A;  1DF0 B;  1DJY A;  2BCB A;  3BOW A;  2CCM A;  2KFH A;  2WOR A;  2RGI A;  1K9K A;  1QV0 A;  1N65 A;  1SMG A;  4ICB A;  4M2Q A;  3PN7 B;  2JPT A;  3VRN A;  1ZOT B;  1NYA A;  2EGD A;  1KK7 Z;  3CWG A;  1SR6 B;  4GAO A;  3IQQ A;  3I5F B;  2WCF A;  3PLF B;  2JXL A;  1WRK A;  1NWD A;  1FF1 A;  1PK0 D;  1G4Y R;  4C0K A;  2FCD A;  2KYC A;  3IQO A;  2ZFD A;  3F45 A;  3SG5 A;  1REC A;  1WRZ A;  2CTN A;  3VRO A;  1EXR A;  3NSO A;  3GOF A;  2K7B A;  3DVK A;  3EK7 A;  2KNE A;  2BKH B;  4A4C A;  4NDD A;  4NDB A;  1XFU O;  1L2O B;  1HQV A;  1S6I A;  1TRF A;  1PVB A;  2LVV A;  3O4Y A;  2NCP A;  2MRD A;  4WQ2 A;  2JOJ A;  2K7D A;  1S1E A;  2LLT A;  5AAN A;  2LMU A;  1Y0V H;  5HLO A;  1NP8 A;  1UWO A;  2M1K B;  1IGV A;  1UUS A;  4C0J A;  4D1E A;  3SIA A;  1BR1 B;  2OPO A;  1A75 A;  4YGE B;  2MHH A;  1C7W A;  1KWO B;  1IKU A;  1XFX O;  2LAP A;  3WHT B;  1OQP A;  4HRH A;  4MRY A;  4BY5 A;  1PUL A;  1OOJ A;  1S5G Y;  1KSO A;  2BL0 C;  3CR4 X;  3SG6 A;  2KGB C;  3OP0 A;  2L0P A;  1AJ5 A;  2KOT A;  3EK8 A;  4DUQ A;  1OZO A;  4USL A;  1M45 A;  3TDZ A;  1H4B A;  2I2R E;  1HT9 A;  1X02 A;  1K95 A;  2HQ8 A;  1BT6 A;  5CPV A;  1M39 A;  4MBE A;  4P2Y B;  4ZCV A;  1C7V A;  1B1G A;  2MAZ A;  3PSR A;  2KBI A;  1B8C A;  1DJX A;  3KPX A;  2JQ6 A;  4QJ5 B;  2MA2 A;  3FS7 A;  1FW4 A;  1WRL A;  1IJ5 A;  1XK4 A;  3PM8 A;  3D0Y A;  1XVJ A;  3BOW B;  1KQV A;  1EJ3 A;  1A4P A;  2COL B;  2ZKM X;  2KSP A;  1JC2 A;  1J7R A;  4GGN A;  1DF0 A;  5GQQ C;  2Q91 A;  3BUN B;  3OB2 B;  2E30 A;  5AER A;  1TIZ A;  4OV2 A;  1YX8 A;  1S6C A;  2WCB A;  3BUM B;  2SAS A;  1RFJ A;  2BBM A;  3EKJ A;  2KDH A;  1K93 D;  1J1D A;  2LVI A;  3CS1 A;  1BMO A;  4PHN A;  2PAS A;  1CB1 A;  1EG4 A;  1F4Q A;  1BF5 A;  1J7O A;  4PDZ A;  1DJG A;  1B8L A;  5HYD A;  1QLS A;  1QAT A;  1JWD A;  5AEQ A;  2M3W A;  1QJT A;  3SG4 A;  5J3X A;  4WRI A;  1A2X A;  3I5H B;  2JZI A;  1SCM B;  4DS7 A;  2BCA A;  5I2O A;  1IH0 A;  2JNF A;  5CSF A;  2HF5 A;  5DKN A;  1M63 B;  3BUW B;  3I5G C;  4OVN F;  1VRK A;  5FYX A;  3DF0 B;  4DIR A;  1GGZ A;  2JNX A;  3TS5 C;  4Q04 A;  2ZN8 A;  2KI4 C;  3BUO B;  1MUX A;  1NPQ A;  2B1U A;  4OCI A;  3WHU B;  5I2Q A;  1TNQ A;  2I94 A;  1YR5 A;  4PE0 A;  1DJW A;  2JU0 A;  2MBX A;  1ALW A;  5D7F A;  1TNP A;  4AQJ A;  1AHR A;  1QS7 A;  2KI6 D;  1A29 A;  4PHK A;  1LIN A;  3CTN A;  1AJ4 A;  3KF9 A;  1NX2 A;  1R2U A;  5K89 A;  1FBV A;  2LC5 A;  1J1E A;  4PE1 A;  4E68 A;  2M1U A;  1QX5 B;  4YI8 A;  1NCY A;  1TNX A;  4CPV A;  4GUK A;  4YRU A;  2MLE C;  4XJK B;  2L4H A;  3TUY C;  1CFD A;  1K8U A;  2KAV A;  4HRG A;  1U5I B;  1S3P A;  1AVS A;  2LHL A;  1UHK A;  1MWN A;  1CLM A;  3CZT X;  4JWQ A;  3AKB A;  4I5N B;  4MVF A;  2LLS A;  1XYD A;  3TDU A;  3TZ1 A;  1CDP A;  2LVJ A;  2P6B B;  1WLM A;  2LHI A;  2LUC A;  1CDL A;  2L50 A;  3JVT C;  3OX5 A;  1TCF A;  1IQ5 A;  2NZ0 A;  2O60 A;  4M2O A;  3TS5 B;  4JPZ B;  2EC6 C;  1NX3 A;  2KI4 B;  1XO5 A;  1B8R A;  4XYN A;  1F71 A;  4P5O E;  1ZMZ A;  2ZNE A;  3H4S E;  4DRW A;  1F55 A;  4N1G A;  2L5X B;  3NSI A;  1BJF A;  1GGW A;  1CLL A;  5KTY A;  1B47 A;  1QTX A;  5JJG A;  1KK8 C;  3ICB A;  3SG7 A;  1IWQ A;  3DF0 A;  2K2F A;  1J7Q A;  3SJS A;  2K61 A;  5B8I B;  2CNP A;  1MXL C;  2G9B A;  3CGA A;  2KFG A;  3IF7 A;  1RTP 1;  2KBM A;  3SG2 A;  2LMV A;  4HSZ A;  4BY4 A;  1RWY A;  1CKK A;  1YX7 A;  5HKZ A;  1BU3 A;  3OHM B;  1MQ1 A;  1AK8 A;  1G8I A;  2JT8 A;  2VRG A;  3DVJ A;  2JXC A;  1B4C A;  1AP4 A;  2V53 A;  1ZFS A;  1QXP A;  4ORC B;  2KHN A;  5KSZ A;  1C07 A;  2BKI B;  1CDM A;  1YUS A;  5HKW A;  1SRA A;  2LE9 B;  2Q4U A;  1F54 A;  2F2O A;  1EG3 A;  2D8N A;  2PSR A;  5CSI A;  3M0W A;  4MN0 A;  1CLB A;  1JF0 A;  2GGM A;  1QAS A;  2LP3 A;  1S5G Z;  2KI6 C;  2JTZ A;  1EH2 A;  3AAJ A;  2EHB A;  3FWB A;  4XJK A;  4TNC A;  1UHJ A;  1CTR A;  1SKT A;  1LA3 A;  1Q80 A;  1U5I A;  2K7C A;  2KFF A;  1NX1 A;  3NXA A;  1SL8 A;  1A03 A;  1PAL A;  1Y1U A;  1DJI A;  4DCK A;  1YRT B;  4PE7 A;  2H61 C;  2SCP A;  3WNX B;  1EL4 A;  2M0R A;  1S36 A;  2LCP A;  1TNW A;  2NLN A;  4YGA A;  2ZN9 A;  1S26 D;  3VRP A;  1ODB A;  4PAL A;  1OMR A;  4A4B A;  5ER5 A;  1IRJ A;  1ZUZ A;  1Y1A A;  1UHI A;  3ZNI A;  1J7P A;  2NXQ A;  2BE6 A;  5KU1 A;  2WND A;  2JTT A;  2JWW A;  1XFV O;  2QPT A;  4AQI A;  2H2K A;  2WC8 A;  2BL0 B;  2JT3 A;  1BG1 A;  2M7N A;  3NSK A;  4FTG A;  3PAL A;  3KHE A;  4OKH A;  1IJ6 A;  2ZRS A;  1CFC A;  5DKR A;  3PAT A;  2HET A;  3EK4 A;  1QX7 A;  1TTX A;  1G33 A;  2BEC A;  1S6J A;  4YBH B;  2CXJ A;  4QJ3 B;  1JBA A;  1PRW A;  1LVC D;  4N5X A;  4FQO A;  1N2D A;  1NSH A;  3KO0 A;  4YGB B;  1OMV A;  1PSR A;  2L51 A;  2I18 A;  2OS8 C;  1LA0 A;  2HPS A;  4GGF A;  1XA5 A;  3E3R A;  2FCE A;  2MJW B;  2Y4Q A;  1TOP A;  2LLU A;  1XFY O;  4NDC A;  3KEV A;  1K2H A;  3I5F C;  4I5L B;  1CMF A;  1FPW A;  1YUU A;  4ETO A;  1SK6 D;  4MZL A;  5CSJ A;  1WDC C;  2JUL A;  3BUX B;  1ZAC A;  2R2I A;  1JF2 A;  1QLK A;  1J55 A;  1F4O A;  2LMT A;  3MSE B;  3EVV A;  1K9P A;  3AAK A;  1QVI Y;  5IBW A;  1L2O C;  4PE4 A;  3C1V A;  1SY9 A;  3BYA A;  2BE4 A;  1M31 A;  4OR9 B;  3DD4 A;  2FJU B;  1UHH A;  2FOT A;  1NUB A;  2L4I A;  1CDN A;  1R6P A;  1KFU S;  3WXA A;  4JQ0 D;  4IL1 A;  1CFF A;  1MF8 B;  2Y1M A;  2ZND A;  1KWO C;  3OB1 B;  2OTG C;  1SL9 A;  1PSB A;  1WLZ A;  3EVR A;  2CT9 A;  3DVM A;  1QVI Z;  4WQ3 A;  2G2B A;  3JTD C;  1SPY A;  3I5G B;  1K96 A;  1KFU L;  2CBL A;  1MXE A;  1QIV A;  1YUR A;  2L98 A;  4PHM A;  3SG3 A;  1AUI B;  3O2P A;  1B9A A;  1RJV A;  2GGZ A;  2LUX A;  2LP2 A;  3A8R A;  2OS8 B;  3VRR A;  4MEW A;  5D69 A;  1QX2 A;  2AUC A;  2M49 B;  1YVH A;  1CNP A;  1FI6 A;  3OX6 A;  1TN4 A;  1CM1 A;  1JFK A;  2BBN A;  1JUO A;  1WDC B;  3EVU A;  4PHJ A;  4C0L A;  1SNL A;  1MHO A;  1KCY A;  1Y6W A;  3I5I C;  2M29 A;  3RLZ A;  5I8N A;  2PMY A;  5BPJ A;  2F3Y A;  4PCW A;  2Y1N A;  2M97 A;  1OZS A;  1SYM A;  1NCZ A;  2F2P A;  3O78 A;  3TUY B;  4M2P A;  2PRU A;  1NCX A;  2QAC A;  2K7O A;  3FWC A;  5I2L A;  1YRU B;  2KAY A;  5AXI A;  2E6W A;  2HQW A;  3LL8 B;  5DKQ A;  1SW8 A;  1JSA A;  3GK4 X;  2WCE A;  4L9M A;  2DOQ A;  1IQ3 A;  2L2E A;  3LCP C;  1M46 A;  1YTZ C;  2A4J A;  4CID A;  5F6T A;  2LM5 A;  2H61 A;  2JT0 A;  2OTG B;  3GK2 A;  2NCO A;  1CMG A;  4N1F A;  2KQ6 A;  5AFP A;  3JTD B;  3JVT B;  4MSP A;  1K94 A;  1Y1X A;  4GNK B;  1YVL A;  2PAL A;  3GK1 A;  1XFZ O;  3LK1 A;  1TCO B;  1UUR A;  3SIB A;  3AKA A;  2AMI A;  3CR5 X;  2EC6 B;  3I5H C;  4MZJ A;  1DJZ A;  4MRX A;  1SCM C;  3QRX A;  1BLQ A;  3DVE A;  2M9G A;  5PAL A;  1MR8 A;  3LLE A;  1GQM A;  2IS9 A;  3K21 A;  4ZCU A;  1N0Y A;  1FI5 A;  1DTL A;  1RK9 A; 
#chains in the Genus database with same CATH topology
 1KSM A;  2JRF A;  2K8M B;  1V1G A;  3R1O A;  1C3Y A;  3ZWH A;  3BXK A;  3D10 A;  1W7I B;  1LKJ A;  2ISD A;  3A4U B;  3LK0 A;  1DGU A;  1DMO A;  2MLF C;  4ORB B;  1D1O A;  1DVI A;  1SCV A;  2KAX A;  1KK8 B;  1XFW O;  1OE9 B;  3I5I B;  1JFJ A;  3PM2 A;  3CZ1 A;  2LV7 A;  1K90 D;  1KQM C;  1L7Z A;  1W9Z A;  4R1E A;  1CM4 A;  3EG5 B;  4HRE E;  4GFT A;  3S0G A;  1SBJ A;  1SSE B;  4U8D A;  2LAN A;  2AAO A;  4MLW A;  4CLN A;  3PFV A;  1BOC A;  3TDI A;  5HKY A;  2P71 A;  2I7A A;  3CYZ A;  1H8B A;  1OMD A;  2BCX A;  1XK4 C;  1CFP A;  1V1F A;  1UP5 A;  2Y5I A;  3CAB A;  3NSL A;  4CFR A;  2KQY A;  1YUT A;  1DQE A;  5HLV A;  3CR2 A;  4QJ4 B;  1WY9 A;  1QIW A;  1BR4 B;  1LXF C;  2LNK A;  2QEO A;  1OOG A;  3D75 A;  3HX4 A;  3PN7 C;  1DJH A;  5TNC A;  3SS5 A;  1PVA A;  4F0Z B;  4JKT A;  1OW4 A;  1SR6 C;  2GV5 A;  1RRO A;  1OSA A;  4YGD B;  3B7A A;  1KFX S;  2KYF A;  1A75 B;  2F33 A;  2ZRT A;  2F8P A;  2O5G A;  1B7T Y;  2K2A A;  1K9U A;  1UHN A;  1E8A A;  3CLN A;  1T14 A;  3D74 A;  4GPL B;  2JC2 A;  2F3Z A;  2M7L A;  5JOL A;  1SL7 A;  4FQT A;  1BOD A;  4I5K A;  1NIW A;  3BQ3 A;  4NQG A;  4ORA B;  1KFX L;  4GBA A;  3EKH A;  5ER4 X;  2PVB A;  4I5J A;  3S0F A;  3RM1 A;  2KGR A;  5CSN A;  4KYN A;  2K0J A;  1IG5 A;  3D73 A;  4CFQ A;  1ALV A;  1DGV A;  1DT7 B;  1F70 A;  1KQM B;  4AOM A;  1F8H A;  3HCM A;  1B7T Z;  4YGC B;  5G08 A;  5D3O A;  1NX0 A;  3FIA A;  3VGO A;  5FI7 A;  4UPG A;  1KK7 Y;  3VRQ A;  2TN4 A;  3BJH A;  4GGF C;  1QV1 A;  2PQL A;  3O6B A;  3D0Y B;  4YI9 A;  2LVK A;  1GJY A;  3SS3 A;  1W7J B;  3D78 A;  2M8U A;  4MZK A;  2WOS A;  1DF0 B;  1DJY A;  2BCB A;  3BOW A;  2CCM A;  2KFH A;  2WOR A;  3K1E A;  2RGI A;  1K9K A;  1QV0 A;  1N65 A;  1SMG A;  4ICB A;  4M2Q A;  3PN7 B;  3CDN A;  2JPT A;  3VRN A;  4INW A;  1ZOT B;  1NYA A;  2EGD A;  1KK7 Z;  3CWG A;  1SR6 B;  4GAO A;  3IQQ A;  3I5F B;  2WCF A;  3PLF B;  2JXL A;  1WRK A;  1NWD A;  1FF1 A;  1PK0 D;  1G4Y R;  4C0K A;  3RZS A;  2FCD A;  2KYC A;  3IQO A;  2ZFD A;  3F45 A;  3SG5 A;  3DXL A;  1REC A;  1WRZ A;  2CTN A;  3VRO A;  1EXR A;  3NSO A;  3GOF A;  2K7B A;  3DVK A;  3CZ0 A;  3EK7 A;  2KNE A;  2BKH B;  3OGN A;  4NDD A;  4NDB A;  1XFU O;  4A4C A;  1L2O B;  1HQV A;  1S6I A;  1TRF A;  1PVB A;  2LVV A;  3B86 A;  2NCP A;  2MRD A;  3O4Y A;  4WQ2 A;  2JOJ A;  2K7D A;  1S1E A;  2LLT A;  5AAN A;  2LMU A;  1Y0V H;  5HLO A;  1NP8 A;  1UWO A;  2M1K B;  1IGV A;  1UUS A;  4C0J A;  4D1E A;  3L4A A;  1BR1 B;  3SIA A;  1QWV A;  2OPO A;  1A75 A;  4YGE B;  2MHH A;  1C7W A;  2GTE A;  1KWO B;  2QDI A;  1IKU A;  1XFX O;  2LAP A;  2P70 A;  3WHT B;  1OQP A;  4HRH A;  4MRY A;  4BY5 A;  1PUL A;  1OOJ A;  3IVT A;  1S5G Y;  1KSO A;  2BL0 C;  2WC5 A;  3CR4 X;  3SG6 A;  2KGB C;  3OP0 A;  2L0P A;  1AJ5 A;  2KOT A;  3EK8 A;  3S0A A;  1Z4H A;  4DUQ A;  1OZO A;  4OZD A;  4USL A;  1M45 A;  3TDZ A;  1H4B A;  2I2R E;  1HT9 A;  1X02 A;  1K95 A;  2HQ8 A;  1BT6 A;  5CPV A;  1M39 A;  4MBE A;  4P2Y B;  4ZCV A;  1C7V A;  1B1G A;  2MAZ A;  3PSR A;  2KBI A;  1B8C A;  1DJX A;  3KPX A;  2JQ6 A;  4QJ5 B;  3BFA A;  2MA2 A;  1C3Z A;  3FS7 A;  3VB1 A;  1FW4 A;  1WRL A;  1IJ5 A;  1XK4 A;  1ORG A;  3PM8 A;  3D0Y A;  1XVJ A;  3BOW B;  1KQV A;  1EJ3 A;  1A4P A;  2COL B;  2BAP A;  2ZKM X;  2KSP A;  1JC2 A;  1J7R A;  1XFR A;  4GGN A;  1DF0 A;  5GQQ C;  2Q91 A;  3BUN B;  3OB2 B;  2E30 A;  5FI6 A;  5AER A;  1TIZ A;  4OV2 A;  1YX8 A;  2KLE A;  1S6C A;  2WCB A;  3BUM B;  2SAS A;  1RFJ A;  2BBM A;  3EKJ A;  2KDH A;  1K93 D;  1J1D A;  2LVI A;  3CS1 A;  1BMO A;  4PHN A;  2PAS A;  1CB1 A;  1EG4 A;  1F4Q A;  1BF5 A;  1J7O A;  4PDZ A;  3CZ2 A;  1OOI X;  1DJG A;  1B8L A;  3Q8I A;  5HYD A;  1QLS A;  1QAT A;  1JWD A;  5AEQ A;  2ERB A;  1QJT A;  2M3W A;  3SG4 A;  5J3X A;  4WRI A;  1A2X A;  3I5H B;  2JZI A;  1SCM B;  4DS7 A;  2BCA A;  3B6X A;  5I2O A;  1IH0 A;  2JNF A;  5CSF A;  2HF5 A;  5DKN A;  1M63 B;  3BUW B;  3I5G C;  4OVN F;  1VRK A;  5FYX A;  3DF0 B;  4DIR A;  1GGZ A;  2JNX A;  4F7F A;  3TS5 C;  4Q04 A;  2ZN8 A;  2KI4 C;  3BUO B;  1MUX A;  1NPQ A;  2B1U A;  4OCI A;  3WHU B;  5I2Q A;  1TNQ A;  2I94 A;  1YR5 A;  4PE0 A;  1DJW A;  2JU0 A;  2MBX A;  1ALW A;  5D7F A;  1TNP A;  4AQJ A;  1AHR A;  1QS7 A;  2KI6 D;  3L4L A;  1A29 A;  4PHK A;  1LIN A;  3CTN A;  1AJ4 A;  3KF9 A;  1NX2 A;  1OOF A;  1R2U A;  5K89 A;  1FBV A;  2LC5 A;  1J1E A;  4PE1 A;  4E68 A;  2M1U A;  1QX5 B;  4YI8 A;  3UO9 A;  1NCY A;  1TWO A;  1TNX A;  4CPV A;  4GUK A;  4YRU A;  2JPO A;  2FJY A;  2MLE C;  2L4H A;  4XJK B;  3TUY C;  1CFD A;  1K8U A;  2KAV A;  4HRG A;  1U5I B;  3O4X A;  1S3P A;  3QME A;  5HL1 A;  1AVS A;  2LHL A;  1UHK A;  1MWN A;  1CLM A;  2H8V A;  3CZT X;  4JWQ A;  3AKB A;  4I5N B;  4INX A;  2QEV A;  4MVF A;  2LLS A;  1XYD A;  3TDU A;  3TZ1 A;  1CDP A;  2LVJ A;  3R1V A;  3R72 A;  2P6B B;  1WLM A;  1TUZ A;  2LHI A;  2LUC A;  1CDL A;  2L50 A;  3JVT C;  3OX5 A;  1TCF A;  1IQ5 A;  3DZT A;  2NZ0 A;  2O60 A;  4M2O A;  3TS5 B;  4JPZ B;  2EC6 C;  1NX3 A;  2KI4 B;  5DIC A;  1XO5 A;  1B8R A;  4XYN A;  5EL2 A;  1F71 A;  1GM0 A;  4P5O E;  3V2L A;  1ZMZ A;  2WCK A;  2ZNE A;  3H4S E;  4DRW A;  1F55 A;  4N1G A;  2L5X B;  3NGV A;  1OOH A;  3NSI A;  3NHT A;  1BJF A;  1GGW A;  1CLL A;  5KTY A;  1B47 A;  3NHI A;  1QTX A;  5JJG A;  1KK8 C;  3ICB A;  3SG7 A;  1IWQ A;  3DYE A;  3DF0 A;  2K2F A;  1J7Q A;  1LS8 A;  3SJS A;  2K61 A;  5B8I B;  3S0B A;  2CNP A;  1MXL C;  2G9B A;  3CGA A;  2KFG A;  3IF7 A;  1RTP 1;  2KBM A;  3DY9 A;  3SG2 A;  2LMV A;  4HSZ A;  4BY4 A;  1RWY A;  1CKK A;  1YX7 A;  5HKZ A;  1BU3 A;  3OHM B;  1MQ1 A;  1AK8 A;  1G8I A;  2JT8 A;  2VRG A;  3DVJ A;  2JXC A;  2QEB A;  1B4C A;  1AP4 A;  2V53 A;  1ZFS A;  1QXP A;  4ORC B;  2WCL A;  2KHN A;  3PJI A;  5KSZ A;  1C07 A;  2BKI B;  1CDM A;  1YUS A;  2QEH A;  5HKW A;  1SRA A;  5I94 A;  2LE9 B;  2Q4U A;  1F54 A;  2F2O A;  1EG3 A;  2D8N A;  2PSR A;  5CSI A;  3M0W A;  4MN0 A;  1CLB A;  1JF0 A;  2GGM A;  1QAS A;  2LP3 A;  1S5G Z;  2KI6 C;  4JD9 A;  3BFB A;  2JTZ A;  1EH2 A;  3AAJ A;  2EHB A;  3FWB A;  4XJK A;  4TNC A;  1UHJ A;  1CTR A;  1SKT A;  1LA3 A;  1Q80 A;  1U5I A;  2K7C A;  2KFF A;  1NX1 A;  3NXA A;  1SL8 A;  1A03 A;  1PAL A;  1Y1U A;  1DJI A;  4DCK A;  1YRT B;  4PE7 A;  2H61 C;  2SCP A;  3WNX B;  1EL4 A;  2M0R A;  1S36 A;  2LCP A;  1TNW A;  2NLN A;  4YGA A;  2ZN9 A;  1S26 D;  3VRP A;  1ODB A;  4PAL A;  1OMR A;  3D77 A;  4A4B A;  5ER5 A;  1IRJ A;  1ZUZ A;  1Y1A A;  1UHI A;  3ZNI A;  1J7P A;  2NXQ A;  2BE6 A;  5KU1 A;  2WND A;  2JTT A;  2JWW A;  1XFV O;  2QPT A;  3FE8 A;  2H2K A;  2WC8 A;  4AQI A;  2BL0 B;  2JT3 A;  1BG1 A;  2M7N A;  3NSK A;  4FTG A;  3PAL A;  3KHE A;  4OKH A;  1IJ6 A;  2ZRS A;  1CFC A;  5DKR A;  3PAT A;  2HET A;  3EK4 A;  1QX7 A;  1TTX A;  1G33 A;  1S6J A;  2BEC A;  4YBH B;  2CXJ A;  4QJ3 B;  1JBA A;  1PRW A;  1LVC D;  4N5X A;  4FQO A;  1N2D A;  1NSH A;  3KO0 A;  4YGB B;  1OMV A;  1PSR A;  2L51 A;  2I18 A;  1DEL A;  3B88 A;  2OS8 C;  4PT1 A;  1LA0 A;  2HPS A;  3D76 A;  4GGF A;  1XA5 A;  3UNW A;  3E3R A;  2FCE A;  2MJW B;  2Y4Q A;  2YGU A;  1TOP A;  2LLU A;  1XFY O;  4NDC A;  2L2C A;  3KEV A;  1K2H A;  3I5F C;  4I5L B;  1CMF A;  1FPW A;  1YUU A;  4ETO A;  1SK6 D;  4MZL A;  5CSJ A;  1WDC C;  2JUL A;  3BUX B;  1ZAC A;  2R2I A;  3SS4 A;  3B87 A;  1JF2 A;  1QLK A;  1J55 A;  1F4O A;  3L47 A;  2LMT A;  3MSE B;  3EVV A;  3FE6 A;  1K9P A;  3AAK A;  1QVI Y;  5IBW A;  1Z2C B;  1L2O C;  4PE4 A;  2BNX A;  3C1V A;  1SY9 A;  3BYA A;  2BE4 A;  1M31 A;  3FE9 A;  4OR9 B;  3S0D A;  3DD4 A;  2FJU B;  1UHH A;  2FOT A;  4IJ7 A;  1NUB A;  2L4I A;  1CDN A;  1R6P A;  1KFU S;  3WXA A;  4JQ0 D;  4IL1 A;  1CFF A;  1MF8 B;  2Y1M A;  2ZND A;  1KWO C;  3OB1 B;  2OTG C;  1SL9 A;  1PSB A;  1WLZ A;  3EVR A;  3OBV A;  2CT9 A;  3DVM A;  1QVI Z;  2WCM A;  4WQ3 A;  2G2B A;  3JTD C;  1SPY A;  3I5G B;  1K96 A;  1KFU L;  1MXE A;  2CBL A;  1QIV A;  1YUR A;  2L98 A;  4PHM A;  3SG3 A;  1AUI B;  3O2P A;  1B9A A;  1RJV A;  2GGZ A;  2LUX A;  2LP2 A;  3A8R A;  2OS8 B;  3VRR A;  4MEW A;  5D69 A;  1DEK A;  1QX2 A;  2AUC A;  2M49 B;  1YVH A;  1CNP A;  5FI2 A;  2KLD A;  1IIO A;  1FI6 A;  3OX6 A;  1TN4 A;  1CM1 A;  1JFK A;  2BBN A;  1TUJ A;  1JUO A;  1WDC B;  3EVU A;  4PHJ A;  4C0L A;  1SNL A;  1MHO A;  1KCY A;  1Y6W A;  3I5I C;  1P28 A;  2M29 A;  3RLZ A;  5I8N A;  2PMY A;  5BPJ A;  2K60 A;  2F3Y A;  4PCW A;  2Y1N A;  2M97 A;  1OZS A;  1SYM A;  1NCZ A;  2L5Y A;  2F2P A;  3O78 A;  3TUY B;  4M2P A;  2PRU A;  1NCX A;  2QAC A;  2K7O A;  3FWC A;  2PYQ A;  5I2L A;  1YRU B;  2KAY A;  5AXI A;  2E6W A;  2HQW A;  3LL8 B;  5DKQ A;  1SW8 A;  1JSA A;  3GK4 X;  2WCE A;  3R1P A;  4L9M A;  2DOQ A;  2KPH A;  2L2E A;  3LCP C;  1IQ3 A;  1M46 A;  1YTZ C;  2A4J A;  4CID A;  3BFH A;  5F6T A;  2LM5 A;  2H61 A;  2JT0 A;  2OTG B;  3GK2 A;  2NCO A;  1CMG A;  2WCH A;  2WCJ A;  4N1F A;  2KQ6 A;  5AFP A;  3JTD B;  3JVT B;  4MSP A;  1K94 A;  1Y1X A;  4GNK B;  1YVL A;  2PAL A;  3GK1 A;  1XFZ O;  3LK1 A;  1TCO B;  1UUR A;  3SIB A;  3AKA A;  2AMI A;  3CR5 X;  2EC6 B;  3I5H C;  4MZJ A;  1DJZ A;  4MRX A;  1SCM C;  3QRX A;  1BLQ A;  3DVE A;  2M9G A;  3N7H A;  5PAL A;  1DC1 A;  1MR8 A;  3LLE A;  1GQM A;  2IS9 A;  3K21 A;  4ZCU A;  1N0Y A;  2WC6 A;  3S0E A;  1FI5 A;  1DTL A;  1RK9 A; 
#chains in the Genus database with same CATH homology
 1KSM A;  2JRF A;  2K8M B;  1V1G A;  3ZWH A;  3BXK A;  3D10 A;  1W7I B;  1LKJ A;  2ISD A;  3A4U B;  3LK0 A;  1DGU A;  1DMO A;  2MLF C;  4ORB B;  1D1O A;  1DVI A;  1SCV A;  2KAX A;  1KK8 B;  1XFW O;  1OE9 B;  3I5I B;  1JFJ A;  2LV7 A;  1K90 D;  1KQM C;  1L7Z A;  4R1E A;  1CM4 A;  4HRE E;  4GFT A;  1SBJ A;  4U8D A;  2LAN A;  2AAO A;  4MLW A;  4CLN A;  3PFV A;  1BOC A;  3TDI A;  5HKY A;  2I7A A;  1H8B A;  1OMD A;  2BCX A;  1XK4 C;  1CFP A;  1V1F A;  1UP5 A;  2Y5I A;  3NSL A;  4CFR A;  2KQY A;  1YUT A;  5HLV A;  3CR2 A;  4QJ4 B;  1WY9 A;  1QIW A;  1BR4 B;  1LXF C;  2LNK A;  3HX4 A;  3PN7 C;  1DJH A;  5TNC A;  1PVA A;  4F0Z B;  1SR6 C;  2GV5 A;  1RRO A;  1OSA A;  4YGD B;  1KFX S;  2KYF A;  1A75 B;  2F33 A;  2ZRT A;  2F8P A;  2O5G A;  1B7T Y;  2K2A A;  1K9U A;  1UHN A;  1E8A A;  3CLN A;  4GPL B;  2M7L A;  2JC2 A;  2F3Z A;  5JOL A;  1SL7 A;  1BOD A;  4I5K A;  1NIW A;  3BQ3 A;  4NQG A;  4ORA B;  1KFX L;  4GBA A;  3EKH A;  5ER4 X;  2PVB A;  4I5J A;  3RM1 A;  2KGR A;  5CSN A;  2K0J A;  1IG5 A;  4CFQ A;  1ALV A;  1DGV A;  1DT7 B;  1F70 A;  1KQM B;  4AOM A;  1F8H A;  3HCM A;  1B7T Z;  4YGC B;  5G08 A;  1NX0 A;  3FIA A;  3VGO A;  4UPG A;  1KK7 Y;  3VRQ A;  2TN4 A;  4GGF C;  1QV1 A;  3O6B A;  3D0Y B;  4YI9 A;  2LVK A;  1GJY A;  1W7J B;  2M8U A;  4MZK A;  2WOS A;  1DF0 B;  1DJY A;  2BCB A;  3BOW A;  2CCM A;  2KFH A;  2WOR A;  2RGI A;  1K9K A;  1QV0 A;  1N65 A;  1SMG A;  4ICB A;  4M2Q A;  3PN7 B;  2JPT A;  3VRN A;  1ZOT B;  1NYA A;  2EGD A;  1KK7 Z;  3CWG A;  1SR6 B;  4GAO A;  3IQQ A;  3I5F B;  2WCF A;  3PLF B;  2JXL A;  1WRK A;  1NWD A;  1FF1 A;  1PK0 D;  1G4Y R;  4C0K A;  2FCD A;  2KYC A;  3IQO A;  2ZFD A;  3F45 A;  3SG5 A;  1REC A;  1WRZ A;  2CTN A;  3VRO A;  1EXR A;  3NSO A;  3GOF A;  2K7B A;  3DVK A;  3EK7 A;  2KNE A;  2BKH B;  4A4C A;  4NDD A;  4NDB A;  1XFU O;  1L2O B;  1HQV A;  1S6I A;  1TRF A;  1PVB A;  2LVV A;  3O4Y A;  2NCP A;  2MRD A;  4WQ2 A;  2JOJ A;  2K7D A;  1S1E A;  2LLT A;  5AAN A;  2LMU A;  1Y0V H;  5HLO A;  1NP8 A;  1UWO A;  2M1K B;  1IGV A;  1UUS A;  4C0J A;  4D1E A;  3SIA A;  1BR1 B;  2OPO A;  1A75 A;  4YGE B;  2MHH A;  1C7W A;  1KWO B;  1IKU A;  1XFX O;  2LAP A;  3WHT B;  1OQP A;  4HRH A;  4MRY A;  4BY5 A;  1PUL A;  1OOJ A;  1S5G Y;  1KSO A;  2BL0 C;  3CR4 X;  3SG6 A;  2KGB C;  3OP0 A;  2L0P A;  1AJ5 A;  2KOT A;  3EK8 A;  4DUQ A;  1OZO A;  4USL A;  1M45 A;  3TDZ A;  1H4B A;  2I2R E;  1HT9 A;  1X02 A;  1K95 A;  2HQ8 A;  1BT6 A;  5CPV A;  1M39 A;  4MBE A;  4P2Y B;  4ZCV A;  1C7V A;  1B1G A;  2MAZ A;  3PSR A;  2KBI A;  1B8C A;  1DJX A;  3KPX A;  2JQ6 A;  4QJ5 B;  2MA2 A;  3FS7 A;  1FW4 A;  1WRL A;  1IJ5 A;  1XK4 A;  3PM8 A;  3D0Y A;  1XVJ A;  3BOW B;  1KQV A;  1EJ3 A;  1A4P A;  2COL B;  2ZKM X;  2KSP A;  1JC2 A;  1J7R A;  4GGN A;  1DF0 A;  5GQQ C;  2Q91 A;  3BUN B;  3OB2 B;  2E30 A;  5AER A;  1TIZ A;  4OV2 A;  1YX8 A;  1S6C A;  2WCB A;  3BUM B;  2SAS A;  1RFJ A;  2BBM A;  3EKJ A;  2KDH A;  1K93 D;  1J1D A;  2LVI A;  3CS1 A;  1BMO A;  4PHN A;  2PAS A;  1CB1 A;  1EG4 A;  1F4Q A;  1BF5 A;  1J7O A;  4PDZ A;  1DJG A;  1B8L A;  5HYD A;  1QLS A;  1QAT A;  1JWD A;  5AEQ A;  2M3W A;  1QJT A;  3SG4 A;  5J3X A;  4WRI A;  1A2X A;  3I5H B;  2JZI A;  1SCM B;  4DS7 A;  2BCA A;  5I2O A;  1IH0 A;  2JNF A;  5CSF A;  2HF5 A;  5DKN A;  1M63 B;  3BUW B;  3I5G C;  4OVN F;  1VRK A;  5FYX A;  3DF0 B;  4DIR A;  1GGZ A;  2JNX A;  3TS5 C;  4Q04 A;  2ZN8 A;  2KI4 C;  3BUO B;  1MUX A;  1NPQ A;  2B1U A;  4OCI A;  3WHU B;  5I2Q A;  1TNQ A;  2I94 A;  1YR5 A;  4PE0 A;  1DJW A;  2JU0 A;  2MBX A;  1ALW A;  5D7F A;  1TNP A;  4AQJ A;  1AHR A;  1QS7 A;  2KI6 D;  1A29 A;  4PHK A;  1LIN A;  3CTN A;  1AJ4 A;  3KF9 A;  1NX2 A;  1R2U A;  5K89 A;  1FBV A;  2LC5 A;  1J1E A;  4PE1 A;  4E68 A;  2M1U A;  1QX5 B;  4YI8 A;  1NCY A;  1TNX A;  4CPV A;  4GUK A;  4YRU A;  2MLE C;  4XJK B;  2L4H A;  3TUY C;  1CFD A;  1K8U A;  2KAV A;  4HRG A;  1U5I B;  1S3P A;  1AVS A;  2LHL A;  1UHK A;  1MWN A;  1CLM A;  3CZT X;  4JWQ A;  3AKB A;  4I5N B;  4MVF A;  2LLS A;  1XYD A;  3TDU A;  3TZ1 A;  1CDP A;  2LVJ A;  2P6B B;  1WLM A;  2LHI A;  2LUC A;  1CDL A;  2L50 A;  3JVT C;  3OX5 A;  1TCF A;  1IQ5 A;  2NZ0 A;  2O60 A;  4M2O A;  3TS5 B;  4JPZ B;  2EC6 C;  1NX3 A;  2KI4 B;  1XO5 A;  1B8R A;  4XYN A;  1F71 A;  4P5O E;  1ZMZ A;  2ZNE A;  3H4S E;  4DRW A;  1F55 A;  4N1G A;  2L5X B;  3NSI A;  1BJF A;  1GGW A;  1CLL A;  5KTY A;  1B47 A;  1QTX A;  5JJG A;  1KK8 C;  3ICB A;  3SG7 A;  1IWQ A;  3DF0 A;  2K2F A;  1J7Q A;  3SJS A;  2K61 A;  5B8I B;  2CNP A;  1MXL C;  2G9B A;  3CGA A;  2KFG A;  3IF7 A;  1RTP 1;  2KBM A;  3SG2 A;  2LMV A;  4HSZ A;  4BY4 A;  1RWY A;  1CKK A;  1YX7 A;  5HKZ A;  1BU3 A;  3OHM B;  1MQ1 A;  1AK8 A;  1G8I A;  2JT8 A;  2VRG A;  3DVJ A;  2JXC A;  1B4C A;  1AP4 A;  2V53 A;  1ZFS A;  1QXP A;  4ORC B;  2KHN A;  5KSZ A;  1C07 A;  2BKI B;  1CDM A;  1YUS A;  5HKW A;  1SRA A;  2LE9 B;  2Q4U A;  1F54 A;  2F2O A;  1EG3 A;  2D8N A;  2PSR A;  5CSI A;  3M0W A;  4MN0 A;  1CLB A;  1JF0 A;  2GGM A;  1QAS A;  2LP3 A;  1S5G Z;  2KI6 C;  2JTZ A;  1EH2 A;  3AAJ A;  2EHB A;  3FWB A;  4XJK A;  4TNC A;  1UHJ A;  1CTR A;  1SKT A;  1LA3 A;  1Q80 A;  1U5I A;  2K7C A;  2KFF A;  1NX1 A;  3NXA A;  1SL8 A;  1A03 A;  1PAL A;  1Y1U A;  1DJI A;  4DCK A;  1YRT B;  4PE7 A;  2H61 C;  2SCP A;  3WNX B;  1EL4 A;  2M0R A;  1S36 A;  2LCP A;  1TNW A;  2NLN A;  4YGA A;  2ZN9 A;  1S26 D;  3VRP A;  1ODB A;  4PAL A;  1OMR A;  4A4B A;  5ER5 A;  1IRJ A;  1ZUZ A;  1Y1A A;  1UHI A;  3ZNI A;  1J7P A;  2NXQ A;  2BE6 A;  5KU1 A;  2WND A;  2JTT A;  2JWW A;  1XFV O;  2QPT A;  4AQI A;  2H2K A;  2WC8 A;  2BL0 B;  2JT3 A;  1BG1 A;  2M7N A;  3NSK A;  4FTG A;  3PAL A;  3KHE A;  4OKH A;  1IJ6 A;  2ZRS A;  1CFC A;  5DKR A;  3PAT A;  2HET A;  3EK4 A;  1QX7 A;  1TTX A;  1G33 A;  2BEC A;  1S6J A;  4YBH B;  2CXJ A;  4QJ3 B;  1JBA A;  1PRW A;  1LVC D;  4N5X A;  4FQO A;  1N2D A;  1NSH A;  3KO0 A;  4YGB B;  1OMV A;  1PSR A;  2L51 A;  2I18 A;  2OS8 C;  1LA0 A;  2HPS A;  4GGF A;  1XA5 A;  3E3R A;  2FCE A;  2MJW B;  2Y4Q A;  1TOP A;  2LLU A;  1XFY O;  4NDC A;  3KEV A;  1K2H A;  3I5F C;  4I5L B;  1CMF A;  1FPW A;  1YUU A;  4ETO A;  1SK6 D;  4MZL A;  5CSJ A;  1WDC C;  2JUL A;  3BUX B;  1ZAC A;  2R2I A;  1JF2 A;  1QLK A;  1J55 A;  1F4O A;  2LMT A;  3MSE B;  3EVV A;  1K9P A;  3AAK A;  1QVI Y;  5IBW A;  1L2O C;  4PE4 A;  3C1V A;  1SY9 A;  3BYA A;  2BE4 A;  1M31 A;  4OR9 B;  3DD4 A;  2FJU B;  1UHH A;  2FOT A;  1NUB A;  2L4I A;  1CDN A;  1R6P A;  1KFU S;  3WXA A;  4JQ0 D;  4IL1 A;  1CFF A;  1MF8 B;  2Y1M A;  2ZND A;  1KWO C;  3OB1 B;  2OTG C;  1SL9 A;  1PSB A;  1WLZ A;  3EVR A;  2CT9 A;  3DVM A;  1QVI Z;  4WQ3 A;  2G2B A;  3JTD C;  1SPY A;  3I5G B;  1K96 A;  1KFU L;  2CBL A;  1MXE A;  1QIV A;  1YUR A;  2L98 A;  4PHM A;  3SG3 A;  1AUI B;  3O2P A;  1B9A A;  1RJV A;  2GGZ A;  2LUX A;  2LP2 A;  3A8R A;  2OS8 B;  3VRR A;  4MEW A;  5D69 A;  1QX2 A;  2AUC A;  2M49 B;  1YVH A;  1CNP A;  1FI6 A;  3OX6 A;  1TN4 A;  1CM1 A;  1JFK A;  2BBN A;  1JUO A;  1WDC B;  3EVU A;  4PHJ A;  4C0L A;  1SNL A;  1MHO A;  1KCY A;  1Y6W A;  3I5I C;  2M29 A;  3RLZ A;  5I8N A;  2PMY A;  5BPJ A;  2F3Y A;  4PCW A;  2Y1N A;  2M97 A;  1OZS A;  1SYM A;  1NCZ A;  2F2P A;  3O78 A;  3TUY B;  4M2P A;  2PRU A;  1NCX A;  2QAC A;  2K7O A;  3FWC A;  5I2L A;  1YRU B;  2KAY A;  5AXI A;  2E6W A;  2HQW A;  3LL8 B;  5DKQ A;  1SW8 A;  1JSA A;  3GK4 X;  2WCE A;  4L9M A;  2DOQ A;  1IQ3 A;  2L2E A;  3LCP C;  1M46 A;  1YTZ C;  2A4J A;  4CID A;  5F6T A;  2LM5 A;  2H61 A;  2JT0 A;  2OTG B;  3GK2 A;  2NCO A;  1CMG A;  4N1F A;  2KQ6 A;  5AFP A;  3JTD B;  3JVT B;  4MSP A;  1K94 A;  1Y1X A;  4GNK B;  1YVL A;  2PAL A;  3GK1 A;  1XFZ O;  3LK1 A;  1TCO B;  1UUR A;  3SIB A;  3AKA A;  2AMI A;  3CR5 X;  2EC6 B;  3I5H C;  4MZJ A;  1DJZ A;  4MRX A;  1SCM C;  3QRX A;  1BLQ A;  3DVE A;  2M9G A;  5PAL A;  1MR8 A;  3LLE A;  1GQM A;  2IS9 A;  3K21 A;  4ZCU A;  1N0Y A;  1FI5 A;  1DTL A;  1RK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...