1SKTA

Solution structure of apo n-domain of troponin c, nmr, 40 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords TROPONIN-C
publication title Low-temperature-induced structural changes in the Apo regulatory domain of skeletal muscle troponin C.
pubmed doi rcsb
source organism Gallus gallus
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1998-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sktA00
2R2IA 1J7QA 3I5FB 5JJGA 2G2BA 1QV1A 3H4SE 1NX1A 1CMGA 1V1FA 2E30A 5J3XA 3OX6A 1K94A 1LA0A 1SKTA 1B4CA 4ORAB 2LC5A 2LHIA 4PHKA 1AUIB 3BOWB 2KFGA 3ZNIA 2ZN9A 1KFXS 1N65A 1TCOB 5K89A 1Y0VH 1KQVA 2JULA 1ALWA 2LANA 1XFWO 3I5GB 2MA2A 3CTNA 4YRUA 1DJWA 1XFXO 1YURA 1IG5A 1IJ5A 1MQ1A 2KSPA 1QLKA 4YGBB 2LVIA 2JU0A 4M2QA 1CFCA 1LKJA 1K8UA 2L5XB 3CR5X 2L50A 1Y1AA 1C7WA 1YX7A 1WRLA 1GGZA 1UURA 1UP5A 3EKHA 5ER4X 4A4CA 2MLEC 2JT3A 2K7BA 1B9AA 1JBAA 2CCMA 5ER5A 1L2OB 2EGDA 1EXRA 3E3RA 1XFVO 2M49B 2B1UA 1F4QA 3LLEA 5CSFA 1DJIA 3DVKA 5B8IB 4OR9B 2WNDA 2JRFA 1X02A 3VGOA 5HKYA 4PHMA 1UHKA 4ORCB 2K2AA 1YUTA 2AAOA 1IWQA 2JT8A 5HYDA 1UHIA 2M3WA 2O60A 1M63B 3O4YA 1NSHA 1KWOC 1F70A 1Q80A 3A8RA 3ZWHA 2F3YA 1CMFA 1IQ5A 3VRQA 4CFRA 2KGBC 1NIWA 2CXJA 2LP3A 5I2LA 1QX7A 1SNLA 2NXQA 3AAJA 2JXCA 1B8CA 2KDHA 3CS1A 1BMOA 5BPJA 1PALA 1K2HA 1QATA 1UUSA 2M1KB 3BQ3A 1JF2A 4GAOA 4A4BA 1C07A 2MJWB 2M97A 3IQQA 2M29A 1BODA 3DF0A 1J55A 4PHNA 5TNCA 3PFVA 1SBJA 1ZOTB 2NZ0A 3I5HB 1RTP1 2BBNA 2GGMA 2KI4C 1PVBA 1SCVA 3DVJA 3LK1A 1S6JA 3D0YB 2KBIA 3LL8B 1OZOA 1NCXA 3O2PA 4L9MA 1N0YA 5D69A 2LVJA 1G8IA 1F8HA 3IF7A 2K0JA 2E6WA 3FWCA 1BR1B 1SYMA 3CWGA 2H61C 2KQ6A 5KTYA 1YUSA 2KAYA 3F45A 1K9PA 1UWOA 2F8PA 3JTDB 1QVIZ 3PN7B 2ZNDA 1M45A 4FQOA 2LNKA 2KFFA 2L2EA 1SL8A 2BECA 2HF5A 4UPGA 5KSZA 3TDUA 1NPQA 1CDLA 4BY4A 1AVSA 2PMYA 3TUYB 2MLFC 1C7VA 3GK2A 1KK8B 2JPTA 1K93D 4NDBA 1IGVA 1DF0B 3HX4A 3EK7A 1RROA 1M46A 1BLQA 1YX8A 1DMOA 2K8MB 1B7TY 1BU3A 4QJ5B 4MRYA 3NSLA 4M2OA 1BR4B 2LP2A 1ODBA 2GGZA 1H4BA 3D0YA 4USLA 4CIDA 4BY5A 4MSPA 5F6TA 1OQPA 1F71A 2H61A 2OPOA 2TN4A 1SR6B 1FI5A 2BKHB 1QASA 4C0LA 1DJYA 1B7TZ 2EC6C 2IS9A 3NSKA 3SIBA 1N2DA 1NX3A 1JWDA 1DVIA 3NSOA 2Y1NA 3CZTX 3SG7A 2JTZA 4ORBB 4XYNA 3OHMB 4D1EA 3VRPA 1CDNA 2HQWA 4XJKA 1ALVA 2HPSA 3KPXA 2WC8A 1WY9A 1PK0D 1CFFA 2CNPA 1FI6A 2L4IA 1CM1A 4CFQA 1GQMA 2I2RE 1DF0A 1NYAA 3CGAA 1AK8A 2PASA 2LUCA 1NP8A 1NX2A 2JT0A 2K7CA 3C1VA 3CLNA 1JC2A 3HCMA 4AQIA 1SK6D 1M39A 2JOJA 2PALA 1D1OA 1HT9A 1BF5A 2GV5A 1V1GA 3DF0B 3SG4A 1SCMC 2JC2A 4E68A 5AFPA 1XYDA 2M1UA 1HQVA 4PE0A 3I5FC 1B8RA 4Q04A 2LMUA 2WORA 1NCYA 3FWBA 4P5OE 3SJSA 3AAKA 2KYCA 2BL0B 1LVCD 4YI9A 2H2KA 2OS8C 1XFUO 1A2XA 1LINA 2JTTA 1XK4C 1PVAA 1TOPA 4I5LB 1WRKA 1KSMA 1AJ5A 1MF8B 1TRFA 4FTGA 1SPYA 1TNPA 1A29A 1UHJA 1EJ3A 3I5IC 5KU1A 1U5IA 4YGAA 4PE7A 5CSJA 1CFPA 1KK7Z 3CR4X 1YRUB 2WCFA 1YUUA 2L98A 2LM5A 4QJ3B 2KHNA 1XA5A 2AUCA 2CBLA 5HKWA 2KI4B 2Q91A 3SIAA 2KBMA 4N1GA 2F33A 3BUMB 2ZRTA 2NCPA 4PHJA 1NX0A 1IH0A 1WLZA 2LCPA 4NDDA 2LLSA 1QVIY 2L0PA 3VRRA 1R2UA 1A03A 4GBAA 2K61A 1YRTB 1TCFA 1K90D 2M7LA 2MBXA 1EG3A 1QV0A 1AJ4A 1S1EA 4PE1A 3RLZA 3BUWB 1CLMA 4DRWA 1Y1UA 4DUQA 1SMGA 2WCEA 3WHTB 4F0ZB 1BG1A 1FF1A 2KQYA 3VROA 3TS5B 1QS7A 1QX5B 4MN0A 1A75A 5G08A 2LHLA 2ZFDA 4OKHA 1F4OA 1QX2A 1BT6A 4PE4A 4MZJA 1TN4A 1A4PA 1J7RA 3OB1B 1OOJA 2LVKA 2LVVA 4HRGA 4XJKB 5CPVA 1CKKA 2LLUA 3BXKA 3I5HC 4N1FA 3KO0A 3JVTC 4YGEB 2DOQA 2JWWA 4MVFA 1F55A 1DT7B 2P6BB 4DCKA 4DS7A 1SRAA 5GQQC 4GPLB 5AEQA 4MLWA 1XFYO 5DKNA 3WHUB 5D7FA 2KI6D 1TTXA 1IJ6A 2Q4UA 5DKRA 2BCBA 5I2OA 3AKAA 1NWDA 1JFKA 3JTDC 1CNPA 3WXAA 3PN7C 2OTGC 1J1EA 1J7OA 3SG5A 1IKUA 4GNKB 1OE9B 3M0WA 2EHBA 1SY9A 3OP0A 2I94A 1K9UA 2NLNA 1G4YR 3TUYC 3BUOB 1NCZA 3EVUA 4ZCUA 1XVJA 1CTRA 2WCBA 2BE6A 4YGCB 4WQ3A 5CSNA 2K7OA 3PALA 2I7AA 1RECA 2QPTA 2A4JA 5HLVA 2VRGA 2LMVA 4C0KA 3VRNA 2KGRA 1YVLA 1W7JB 1BJFA 1CLBA 1PSRA 2BE4A 3K21A 1MR8A 3BUNB 1U5IB 2ZRSA 4WQ2A 4WRIA 1SR6C 1FPWA 1Y1XA 4DIRA 1KQMC 1YTZC 1Y6WA 2I18A 3TDZA 3EK4A 3GK4X 4OVNF 1AHRA 3OX5A 3NXAA 5HKZA 2Y5IA 3EK8A 4OCIA 1RFJA 1WDCC 1NUBA 4QJ4B 3BYAA 1TNQA 3MSEB 3TDIA 5PALA 3TZ1A 2M0RA 1B1GA 3D10A 1H8BA 3KEVA 4GGFC 4PDZA 4JQ0D 5HLOA 4P2YB 4YGDB 1KCYA 1QTXA 2OS8B 1S26D 2O5GA 2PSRA 3LCPC 2BKIB 2FCEA 1K95A 4TNCA 1B47A 2K7DA 1MWNA 1L7ZA 1R6PA 1MXEA 3ICBA 1MXLC 1CFDA 1S36A 1QJTA 3IQOA 1KK7Y 4AOMA 1VRKA 1SL7A 1KWOB 1S3PA 1RWYA 3O78A 3I5IB 1UHHA 2M9GA 3I5GC 4OV2A 2JNXA 3RM1A 1ZFSA 5AANA 1OMVA 2M7NA 3PM8A 4C0JA 2F3ZA 1A75B 1EL4A 2SCPA 2RGIA 5IBWA 1K9KA 2BCAA 1S6CA 3NSIA 2MRDA 1S5GY 2LV7A 1EH2A 3EVRA 1SL9A 4MRXA 4MZKA 2LLTA 1DTLA 2LMTA 3EVVA 1EG4A 5I8NA 3FS7A 1UHNA 2HETA 2V53A 1L2OC 1SW8A 4GGFA 2HQ8A 2QACA 1JUOA 4GFTA 1M31A 2L4HA 1S5GZ 4R1EA 1KFUL 2COLB 4I5JA 2BL0C 5DKQA 1TNWA 4MBEA 3BUXB 1JF0A 2CTNA 1DJHA 2LAPA 2KAXA 2LUXA 3A4UB 3BOWA 3DVMA 1KSOA 2CT9A 3DD4A 2KI6C 1FW4A 3SG6A 1QLSA 1IRJA 2PVBA 3OB2B 1XK4A 1CB1A 4I5NB 4NQGA 1YVHA 2BBMA 4HSZA 1XO5A 3SG2A 5AERA 1JFJA 4HRHA 1S6IA 4M2PA 4CLNA 1CDPA 1PSBA 3KHEA 1DJGA 3PSRA 1DGVA 2JZIA 3O6BA 1GJYA 4MEWA 1TNXA 2PRUA 1ZMZA 1W7IB 2AMIA 3JVTB 2F2PA 3PATA 1DGUA 4N5XA 4ETOA 4YI8A 2F2OA 1WLMA 1J7PA 4PALA 2ZN8A 1RJVA 3PLFB 2JNFA 3GK1A 4JPZB 3EKJA 3FIAA 3SG3A 2NCOA 4I5KA 1LXFC 2KOTA 2ISDA 2Y1MA 4U8DA 1AP4A 1IQ3A 5JOLA 2JXLA 2FJUB 1JSAA 1DJXA 2KAVA 4NDCA 2OTGB 1ZUZA 1YR5A 2KYFA 5I2QA 3CR2A 2FCDA 2KNEA 2SASA 1KFUS 3TS5C 4PCWA 1MUXA 3QRXA 2EC6B 2KFHA 1TIZA 2WOSA 1QIWA 2LE9B 1KFXL 4IL1A 1DJZA 2G9BA 2JQ6A 1CM4A 1QIVA 3AKBA 4ZCVA 2ZKMX 3KF9A 5CSIA 4CPVA 1OSAA 1KK8C 5FYXA 1GGWA 1OZSA 1RK9A 1G33A 1QXPA 4HREE 4ICBA 2M8UA 1BOCA 2BCXA 2D8NA 2ZNEA 4GGNA 1XFZO 1K96A 2L51A 3LK0A 1KQMB 3GOFA 1FBVA 1LA3A 2K2FA 3DVEA 2MHHA 4GUKA 4AQJA 4YBHB 1PULA 1PRWA 1MHOA 2MAZA 4MZLA 5AXIA 1OMDA 1F54A 1WRZA 1CDMA 1B8LA 1SCMB 1ZACA 1E8AA 2FOTA 3WNXB 1OMRA 1CLLA 1WDCB 2Y4QA 1J1DA 4JWQA
chains in the Genus database with same CATH superfamily
2R2IA 1J7QA 3I5FB 4INWA 3S0BA 5JJGA 2G2BA 1QV1A 3H4SE 1NX1A 1CMGA 1V1FA 2E30A 5J3XA 3OX6A 1K94A 1LA0A 1SKTA 1B4CA 4ORAB 2LC5A 2LHIA 3Q8IA 4PHKA 1AUIB 3BOWB 2KFGA 3ZNIA 2ZN9A 1KFXS 1N65A 1TCOB 5K89A 1Y0VH 1KQVA 2JULA 1ALWA 2LANA 1XFWO 3I5GB 2MA2A 3CTNA 4YRUA 1IIOA 1DJWA 1XFXO 1YURA 1IG5A 1IJ5A 1MQ1A 2KSPA 1QLKA 4YGBB 2LVIA 2JU0A 4M2QA 1CFCA 1LKJA 1K8UA 2L5XB 3CR5X 2L50A 1Y1AA 1C7WA 1YX7A 1WRLA 1GGZA 1UURA 1UP5A 3EKHA 2H8VA 5ER4X 4A4CA 2MLEC 2JT3A 2K7BA 1B9AA 1JBAA 2CCMA 5ER5A 1L2OB 2EGDA 1EXRA 3E3RA 1XFVO 2M49B 5EL2A 2B1UA 1F4QA 3LLEA 5CSFA 1DJIA 3DVKA 5B8IB 4OR9B 2WNDA 2JRFA 1X02A 3DXLA 3VGOA 5HKYA 4PHMA 4PT1A 1UHKA 4ORCB 2K2AA 2ERBA 1DC1A 3L47A 1YUTA 2YGUA 2AAOA 1IWQA 2BNXA 2JT8A 5HYDA 1UHIA 2QEOA 2M3WA 2O60A 1M63B 3O4YA 1NSHA 1KWOC 3UO9A 1Q80A 1F70A 3A8RA 3ZWHA 2F3YA 1CMFA 1IQ5A 3VRQA 4CFRA 2KGBC 1NIWA 2CXJA 2LP3A 5I2LA 1QX7A 1SNLA 2NXQA 2WCLA 3AAJA 2JXCA 1B8CA 2KDHA 3CS1A 1BMOA 5BPJA 1PALA 2WC6A 1K2HA 1QATA 1UUSA 2M1KB 3BQ3A 1JF2A 4GAOA 4A4BA 1C07A 2MJWB 2M97A 3IQQA 2M29A 1BODA 3DF0A 1J55A 4PHNA 5TNCA 3PFVA 1SBJA 1ZOTB 4KYNA 2NZ0A 3I5HB 1RTP1 2BBNA 2GGMA 2KI4C 2L2CA 1PVBA 1SCVA 3DVJA 3LK1A 1S6JA 3D0YB 2KBIA 3LL8B 1OZOA 1NCXA 3O2PA 4L9MA 1N0YA 5D69A 2LVJA 1G8IA 1F8HA 3IF7A 2K0JA 2E6WA 1TWOA 3FWCA 1BR1B 3DZTA 1SYMA 3CWGA 3R1VA 2H61C 2KQ6A 5KTYA 1YUSA 2KAYA 3L4AA 3F45A 1K9PA 1UWOA 2F8PA 3JTDB 1QVIZ 3PN7B 3CZ0A 2ZNDA 1M45A 4FQOA 2LNKA 2KFFA 2L2EA 3CZ1A 1SL8A 2BECA 2HF5A 2QEVA 4UPGA 5KSZA 3TDUA 1NPQA 1CDLA 4BY4A 1AVSA 1GM0A 2PMYA 3TUYB 1LS8A 2MLFC 1C7VA 3GK2A 3CYZA 1KK8B 2JPTA 1K93D 4NDBA 1IGVA 1DF0B 3HX4A 1W9ZA 3EK7A 1RROA 1M46A 3R1PA 1BLQA 1YX8A 1DMOA 2K8MB 1B7TY 1BU3A 1SSEB 4MRYA 4QJ5B 3D78A 3NSLA 4M2OA 1BR4B 3NGVA 2LP2A 1ODBA 2GGZA 1H4BA 3D0YA 4USLA 4CIDA 3IVTA 4BY5A 4MSPA 5F6TA 1OQPA 1F71A 2H61A 2OPOA 2TN4A 1TUJA 1SR6B 1FI5A 3CABA 2BKHB 1QASA 4C0LA 1DJYA 1B7TZ 2EC6C 2IS9A 3NSKA 3SIBA 3D75A 1N2DA 1NX3A 4JD9A 1JWDA 1DVIA 3NSOA 2Y1NA 3CZTX 3SG7A 2JTZA 4ORBB 4XYNA 3OHMB 4D1EA 3VRPA 1CDNA 2HQWA 4XJKA 1ALVA 2HPSA 3KPXA 3SS5A 3FE9A 2WC8A 1WY9A 1PK0D 1CFFA 2CNPA 1FI6A 2L4IA 3BFHA 1CM1A 4CFQA 1GQMA 1Z4HA 2I2RE 1DF0A 1NYAA 3CGAA 1AK8A 2PASA 2LUCA 1NP8A 1NX2A 2JT0A 2K7CA 3C1VA 3CLNA 1JC2A 3HCMA 3B86A 1SK6D 4AQIA 1M39A 4IJ7A 2JOJA 2PALA 1D1OA 3S0GA 1HT9A 1BF5A 2GV5A 1V1GA 3DF0B 3SG4A 1SCMC 2JC2A 3CZ2A 3B88A 4E68A 5AFPA 1XYDA 2M1UA 1HQVA 3B7AA 4PE0A 3I5FC 3S0AA 1B8RA 1XFRA 3L4LA 4Q04A 2LMUA 2WORA 1NCYA 3FWBA 4P5OE 3SJSA 3AAKA 2KYCA 2BL0B 1LVCD 4YI9A 2GTEA 2H2KA 1XFUO 2OS8C 2P71A 1A2XA 1LINA 2JTTA 1XK4C 1PVAA 1TOPA 4I5LB 1WRKA 1KSMA 1AJ5A 1MF8B 1TRFA 4FTGA 1SPYA 1TNPA 1A29A 1UHJA 1EJ3A 3I5IC 5KU1A 1U5IA 4YGAA 4PE7A 5CSJA 1CFPA 1KK7Z 3B6XA 3CR4X 1YRUB 5I94A 2WCFA 1YUUA 2L98A 2LM5A 4QJ3B 2KHNA 1XA5A 1C3ZA 2AUCA 2CBLA 5HKWA 2KI4B 2Q91A 3SIAA 2P70A 2KBMA 4N1GA 2F33A 3BUMB 2PQLA 2ZRTA 3BFAA 3BFBA 3QMEA 2NCPA 4PHJA 1NX0A 1IH0A 1WLZA 2LCPA 4NDDA 2LLSA 1QVIY 2L0PA 3VRRA 1R2UA 1A03A 4GBAA 2JPOA 2K61A 1YRTB 1TCFA 1K90D 2M7LA 2MBXA 1EG3A 1QV0A 1AJ4A 1S1EA 4PE1A 3RLZA 3BUWB 3O4XA 1CLMA 4DRWA 1Y1UA 4DUQA 1SMGA 2WCEA 3WHTB 4F0ZB 3PM2A 1BG1A 1FF1A 2KQYA 3VROA 3TS5B 1QS7A 4JKTA 1QX5B 4MN0A 1A75A 5G08A 2LHLA 2PYQA 2ZFDA 4OKHA 1F4OA 1QX2A 1BT6A 4PE4A 4MZJA 1TN4A 1A4PA 1J7RA 3OB1B 1OOJA 2LVKA 2LVVA 4HRGA 4XJKB 5CPVA 1CKKA 5DICA 2LLUA 3BXKA 3I5HC 4N1FA 3KO0A 3JVTC 3SS4A 4YGEB 2DOQA 2JWWA 4MVFA 1F55A 1DT7B 2P6BB 4DCKA 4DS7A 1SRAA 5GQQC 4GPLB 5AEQA 4MLWA 1C3YA 1XFYO 3BJHA 5DKNA 3WHUB 5D7FA 3RZSA 2KI6D 1TTXA 1IJ6A 2Q4UA 5DKRA 2BCBA 5I2OA 3AKAA 1NWDA 1JFKA 3JTDC 1DELA 1CNPA 3WXAA 3PN7C 2OTGC 1J1EA 3S0EA 1J7OA 3SG5A 1IKUA 5FI2A 3D77A 1Z2CB 2KLEA 1OE9B 4GNKB 3M0WA 2EHBA 1SY9A 3OP0A 2I94A 1K9UA 2NLNA 1G4YR 3TUYC 3BUOB 1NCZA 3EVUA 4ZCUA 1XVJA 1CTRA 2WCBA 1OW4A 2BE6A 4YGCB 4WQ3A 5CSNA 2K7OA 3PALA 2I7AA 3D74A 1RECA 2QEBA 2QPTA 2A4JA 5HLVA 2FJYA 2VRGA 2LMVA 3N7HA 3VRNA 4C0KA 2KGRA 3S0FA 1P28A 1W7JB 1YVLA 1BJFA 4F7FA 1CLBA 1PSRA 2BE4A 3K21A 1MR8A 3BUNB 1U5IB 3S0DA 2ZRSA 4WQ2A 4WRIA 1SR6C 3UNWA 1FPWA 1Y1XA 4DIRA 1KQMC 1YTZC 1Y6WA 2I18A 4OZDA 3TDZA 3EK4A 3GK4X 3EG5B 4OVNF 1AHRA 3OX5A 3NXAA 5HKZA 2Y5IA 3EK8A 4OCIA 1RFJA 1WDCC 1NUBA 4QJ4B 3BYAA 1TNQA 2WCMA 3MSEB 3D73A 3TDIA 5PALA 3TZ1A 2M0RA 1B1GA 3D10A 1H8BA 3KEVA 4GGFC 4FQTA 4PDZA 4JQ0D 5HLOA 4P2YB 4YGDB 1KCYA 1OOFA 1QTXA 2OS8B 1S26D 2O5GA 2PSRA 3LCPC 2BKIB 2FCEA 1K95A 1OOIX 1B47A 2K7DA 4TNCA 1MWNA 1L7ZA 1R6PA 1MXEA 5HL1A 3ICBA 2L5YA 1MXLC 1CFDA 1S36A 1QJTA 3IQOA 1KK7Y 3NHTA 4AOMA 1VRKA 1SL7A 1KWOB 1S3PA 1RWYA 3O78A 3I5IB 1UHHA 2M9GA 3I5GC 4OV2A 2JNXA 3RM1A 1ZFSA 5AANA 1OMVA 2M7NA 2WC5A 3PM8A 4INXA 2F3ZA 4C0JA 1A75B 1EL4A 2SCPA 2RGIA 5IBWA 1K9KA 1S6CA 2BCAA 3NSIA 2MRDA 1S5GY 2LV7A 3D76A 1EH2A 3EVRA 1SL9A 4MRXA 4MZKA 2LLTA 1DTLA 2LMTA 3EVVA 1DQEA 1TUZA 1EG4A 5I8NA 3FS7A 1UHNA 2HETA 2V53A 1L2OC 1SW8A 4GGFA 2HQ8A 2QACA 1JUOA 4GFTA 1M31A 2L4HA 3CDNA 1S5GZ 4R1EA 1KFUL 2COLB 3K1EA 2BL0C 4I5JA 5DKQA 1TNWA 4MBEA 3BUXB 3V2LA 3PJIA 1OOHA 1JF0A 2CTNA 1DJHA 2LAPA 2KAXA 2LUXA 3A4UB 3BOWA 3DVMA 1KSOA 2CT9A 3DD4A 2KI6C 1FW4A 3SG6A 3FE8A 1QLSA 2WCHA 1IRJA 2PVBA 3OB2B 1XK4A 1CB1A 4I5NB 4NQGA 1YVHA 2BBMA 2KLDA 1XO5A 4HSZA 3SG2A 5AERA 1JFJA 4HRHA 1S6IA 4M2PA 4CLNA 1CDPA 1PSBA 3KHEA 1DJGA 3PSRA 3VB1A 1DGVA 2JZIA 3O6BA 1GJYA 4MEWA 1TNXA 2PRUA 1ZMZA 1W7IB 2AMIA 3JVTB 2F2PA 3PATA 1DGUA 4N5XA 3OGNA 3FE6A 4YI8A 3B87A 4ETOA 2F2OA 1WLMA 1ORGA 1J7PA 4PALA 2ZN8A 1RJVA 3PLFB 2JNFA 3GK1A 4JPZB 3EKJA 2QDIA 3FIAA 2K60A 5FI7A 3SG3A 1OOGA 2NCOA 1LXFC 2KOTA 4I5KA 2Y1MA 4U8DA 2ISDA 1AP4A 1IQ3A 5JOLA 2JXLA 2FJUB 1JSAA 3R72A 1DJXA 2KAVA 4NDCA 3R1OA 2OTGB 1ZUZA 1YR5A 2KYFA 5I2QA 3CR2A 3DY9A 2FCDA 2KNEA 2SASA 2KPHA 1KFUS 1QWVA 3TS5C 4PCWA 1MUXA 2WCJA 3QRXA 2EC6B 2KFHA 1TIZA 2WOSA 1QIWA 2LE9B 1KFXL 4IL1A 3OBVA 2WCKA 1DJZA 2G9BA 2JQ6A 1CM4A 1QIVA 1DEKA 3AKBA 4ZCVA 2ZKMX 3KF9A 5CSIA 3SS3A 4CPVA 1OSAA 1T14A 1KK8C 5FYXA 1GGWA 1OZSA 1RK9A 1G33A 1QXPA 4HREE 4ICBA 2M8UA 1BOCA 2BCXA 2D8NA 2ZNEA 4GGNA 3DYEA 1XFZO 1K96A 2L51A 3LK0A 1KQMB 3GOFA 1FBVA 1LA3A 2K2FA 3DVEA 2MHHA 4GUKA 4AQJA 4YBHB 1PULA 2BAPA 1PRWA 1MHOA 5FI6A 2MAZA 3NHIA 4MZLA 2QEHA 5AXIA 1OMDA 5D3OA 1WRZA 1CDMA 1F54A 1B8LA 1SCMB 1ZACA 1E8AA 2FOTA 3WNXB 1OMRA 1CLLA 1WDCB 2Y4QA 1J1DA 4JWQA
chains in the Genus database with same CATH topology
2R2IA 1J7QA 3I5FB 5JJGA 2G2BA 1QV1A 3H4SE 1NX1A 1CMGA 1V1FA 2E30A 5J3XA 3OX6A 1K94A 1LA0A 1SKTA 1B4CA 4ORAB 2LC5A 2LHIA 4PHKA 1AUIB 3BOWB 2KFGA 3ZNIA 2ZN9A 1KFXS 1N65A 1TCOB 5K89A 1Y0VH 1KQVA 2JULA 1ALWA 2LANA 1XFWO 3I5GB 2MA2A 3CTNA 4YRUA 1DJWA 1XFXO 1YURA 1IG5A 1IJ5A 1MQ1A 2KSPA 1QLKA 4YGBB 2LVIA 2JU0A 4M2QA 1CFCA 1LKJA 1K8UA 2L5XB 3CR5X 2L50A 1Y1AA 1C7WA 1YX7A 1WRLA 1GGZA 1UURA 1UP5A 3EKHA 5ER4X 4A4CA 2MLEC 2JT3A 2K7BA 1B9AA 1JBAA 2CCMA 5ER5A 1L2OB 2EGDA 1EXRA 3E3RA 1XFVO 2M49B 2B1UA 1F4QA 3LLEA 5CSFA 1DJIA 3DVKA 5B8IB 4OR9B 2WNDA 2JRFA 1X02A 3VGOA 5HKYA 4PHMA 1UHKA 4ORCB 2K2AA 1YUTA 2AAOA 1IWQA 2JT8A 5HYDA 1UHIA 2M3WA 2O60A 1M63B 3O4YA 1NSHA 1KWOC 1F70A 1Q80A 3A8RA 3ZWHA 2F3YA 1CMFA 1IQ5A 3VRQA 4CFRA 2KGBC 1NIWA 2CXJA 2LP3A 5I2LA 1QX7A 1SNLA 2NXQA 3AAJA 2JXCA 1B8CA 2KDHA 3CS1A 1BMOA 5BPJA 1PALA 1K2HA 1QATA 1UUSA 2M1KB 3BQ3A 1JF2A 4GAOA 4A4BA 1C07A 2MJWB 2M97A 3IQQA 2M29A 1BODA 3DF0A 1J55A 4PHNA 5TNCA 3PFVA 1SBJA 1ZOTB 2NZ0A 3I5HB 1RTP1 2BBNA 2GGMA 2KI4C 1PVBA 1SCVA 3DVJA 3LK1A 1S6JA 3D0YB 2KBIA 3LL8B 1OZOA 1NCXA 3O2PA 4L9MA 1N0YA 5D69A 2LVJA 1G8IA 1F8HA 3IF7A 2K0JA 2E6WA 3FWCA 1BR1B 1SYMA 3CWGA 2H61C 2KQ6A 5KTYA 1YUSA 2KAYA 3F45A 1K9PA 1UWOA 2F8PA 3JTDB 1QVIZ 3PN7B 2ZNDA 1M45A 4FQOA 2LNKA 2KFFA 2L2EA 1SL8A 2BECA 2HF5A 4UPGA 5KSZA 3TDUA 1NPQA 1CDLA 4BY4A 1AVSA 2PMYA 3TUYB 2MLFC 1C7VA 3GK2A 1KK8B 2JPTA 1K93D 4NDBA 1IGVA 1DF0B 3HX4A 3EK7A 1RROA 1M46A 1BLQA 1YX8A 1DMOA 2K8MB 1B7TY 1BU3A 4QJ5B 4MRYA 3NSLA 4M2OA 1BR4B 2LP2A 1ODBA 2GGZA 1H4BA 3D0YA 4USLA 4CIDA 4BY5A 4MSPA 5F6TA 1OQPA 1F71A 2H61A 2OPOA 2TN4A 1SR6B 1FI5A 2BKHB 1QASA 4C0LA 1DJYA 1B7TZ 2EC6C 2IS9A 3NSKA 3SIBA 1N2DA 1NX3A 1JWDA 1DVIA 3NSOA 2Y1NA 3CZTX 3SG7A 2JTZA 4ORBB 4XYNA 3OHMB 4D1EA 3VRPA 1CDNA 2HQWA 4XJKA 1ALVA 2HPSA 3KPXA 2WC8A 1WY9A 1PK0D 1CFFA 2CNPA 1FI6A 2L4IA 1CM1A 4CFQA 1GQMA 2I2RE 1DF0A 1NYAA 3CGAA 1AK8A 2PASA 2LUCA 1NP8A 1NX2A 2JT0A 2K7CA 3C1VA 3CLNA 1JC2A 3HCMA 4AQIA 1SK6D 1M39A 2JOJA 2PALA 1D1OA 1HT9A 1BF5A 2GV5A 1V1GA 3DF0B 3SG4A 1SCMC 2JC2A 4E68A 5AFPA 1XYDA 2M1UA 1HQVA 4PE0A 3I5FC 1B8RA 4Q04A 2LMUA 2WORA 1NCYA 3FWBA 4P5OE 3SJSA 3AAKA 2KYCA 2BL0B 1LVCD 4YI9A 2H2KA 2OS8C 1XFUO 1A2XA 1LINA 2JTTA 1XK4C 1PVAA 1TOPA 4I5LB 1WRKA 1KSMA 1AJ5A 1MF8B 1TRFA 4FTGA 1SPYA 1TNPA 1A29A 1UHJA 1EJ3A 3I5IC 5KU1A 1U5IA 4YGAA 4PE7A 5CSJA 1CFPA 1KK7Z 3CR4X 1YRUB 2WCFA 1YUUA 2L98A 2LM5A 4QJ3B 2KHNA 1XA5A 2AUCA 2CBLA 5HKWA 2KI4B 2Q91A 3SIAA 2KBMA 4N1GA 2F33A 3BUMB 2ZRTA 2NCPA 4PHJA 1NX0A 1IH0A 1WLZA 2LCPA 4NDDA 2LLSA 1QVIY 2L0PA 3VRRA 1R2UA 1A03A 4GBAA 2K61A 1YRTB 1TCFA 1K90D 2M7LA 2MBXA 1EG3A 1QV0A 1AJ4A 1S1EA 4PE1A 3RLZA 3BUWB 1CLMA 4DRWA 1Y1UA 4DUQA 1SMGA 2WCEA 3WHTB 4F0ZB 1BG1A 1FF1A 2KQYA 3VROA 3TS5B 1QS7A 1QX5B 4MN0A 1A75A 5G08A 2LHLA 2ZFDA 4OKHA 1F4OA 1QX2A 1BT6A 4PE4A 4MZJA 1TN4A 1A4PA 1J7RA 3OB1B 1OOJA 2LVKA 2LVVA 4HRGA 4XJKB 5CPVA 1CKKA 2LLUA 3BXKA 3I5HC 4N1FA 3KO0A 3JVTC 4YGEB 2DOQA 2JWWA 4MVFA 1F55A 1DT7B 2P6BB 4DCKA 4DS7A 1SRAA 5GQQC 4GPLB 5AEQA 4MLWA 1XFYO 5DKNA 3WHUB 5D7FA 2KI6D 1TTXA 1IJ6A 2Q4UA 5DKRA 2BCBA 5I2OA 3AKAA 1NWDA 1JFKA 3JTDC 1CNPA 3WXAA 3PN7C 2OTGC 1J1EA 1J7OA 3SG5A 1IKUA 4GNKB 1OE9B 3M0WA 2EHBA 1SY9A 3OP0A 2I94A 1K9UA 2NLNA 1G4YR 3TUYC 3BUOB 1NCZA 3EVUA 4ZCUA 1XVJA 1CTRA 2WCBA 2BE6A 4YGCB 4WQ3A 5CSNA 2K7OA 3PALA 2I7AA 1RECA 2QPTA 2A4JA 5HLVA 2VRGA 2LMVA 4C0KA 3VRNA 2KGRA 1YVLA 1W7JB 1BJFA 1CLBA 1PSRA 2BE4A 3K21A 1MR8A 3BUNB 1U5IB 2ZRSA 4WQ2A 4WRIA 1SR6C 1FPWA 1Y1XA 4DIRA 1KQMC 1YTZC 1Y6WA 2I18A 3TDZA 3EK4A 3GK4X 4OVNF 1AHRA 3OX5A 3NXAA 5HKZA 2Y5IA 3EK8A 4OCIA 1RFJA 1WDCC 1NUBA 4QJ4B 3BYAA 1TNQA 3MSEB 3TDIA 5PALA 3TZ1A 2M0RA 1B1GA 3D10A 1H8BA 3KEVA 4GGFC 4PDZA 4JQ0D 5HLOA 4P2YB 4YGDB 1KCYA 1QTXA 2OS8B 1S26D 2O5GA 2PSRA 3LCPC 2BKIB 2FCEA 1K95A 4TNCA 1B47A 2K7DA 1MWNA 1L7ZA 1R6PA 1MXEA 3ICBA 1MXLC 1CFDA 1S36A 1QJTA 3IQOA 1KK7Y 4AOMA 1VRKA 1SL7A 1KWOB 1S3PA 1RWYA 3O78A 3I5IB 1UHHA 2M9GA 3I5GC 4OV2A 2JNXA 3RM1A 1ZFSA 5AANA 1OMVA 2M7NA 3PM8A 4C0JA 2F3ZA 1A75B 1EL4A 2SCPA 2RGIA 5IBWA 1K9KA 2BCAA 1S6CA 3NSIA 2MRDA 1S5GY 2LV7A 1EH2A 3EVRA 1SL9A 4MRXA 4MZKA 2LLTA 1DTLA 2LMTA 3EVVA 1EG4A 5I8NA 3FS7A 1UHNA 2HETA 2V53A 1L2OC 1SW8A 4GGFA 2HQ8A 2QACA 1JUOA 4GFTA 1M31A 2L4HA 1S5GZ 4R1EA 1KFUL 2COLB 4I5JA 2BL0C 5DKQA 1TNWA 4MBEA 3BUXB 1JF0A 2CTNA 1DJHA 2LAPA 2KAXA 2LUXA 3A4UB 3BOWA 3DVMA 1KSOA 2CT9A 3DD4A 2KI6C 1FW4A 3SG6A 1QLSA 1IRJA 2PVBA 3OB2B 1XK4A 1CB1A 4I5NB 4NQGA 1YVHA 2BBMA 4HSZA 1XO5A 3SG2A 5AERA 1JFJA 4HRHA 1S6IA 4M2PA 4CLNA 1CDPA 1PSBA 3KHEA 1DJGA 3PSRA 1DGVA 2JZIA 3O6BA 1GJYA 4MEWA 1TNXA 2PRUA 1ZMZA 1W7IB 2AMIA 3JVTB 2F2PA 3PATA 1DGUA 4N5XA 4ETOA 4YI8A 2F2OA 1WLMA 1J7PA 4PALA 2ZN8A 1RJVA 3PLFB 2JNFA 3GK1A 4JPZB 3EKJA 3FIAA 3SG3A 2NCOA 4I5KA 1LXFC 2KOTA 2ISDA 2Y1MA 4U8DA 1AP4A 1IQ3A 5JOLA 2JXLA 2FJUB 1JSAA 1DJXA 2KAVA 4NDCA 2OTGB 1ZUZA 1YR5A 2KYFA 5I2QA 3CR2A 2FCDA 2KNEA 2SASA 1KFUS 3TS5C 4PCWA 1MUXA 3QRXA 2EC6B 2KFHA 1TIZA 2WOSA 1QIWA 2LE9B 1KFXL 4IL1A 1DJZA 2G9BA 2JQ6A 1CM4A 1QIVA 3AKBA 4ZCVA 2ZKMX 3KF9A 5CSIA 4CPVA 1OSAA 1KK8C 5FYXA 1GGWA 1OZSA 1RK9A 1G33A 1QXPA 4HREE 4ICBA 2M8UA 1BOCA 2BCXA 2D8NA 2ZNEA 4GGNA 1XFZO 1K96A 2L51A 3LK0A 1KQMB 3GOFA 1FBVA 1LA3A 2K2FA 3DVEA 2MHHA 4GUKA 4AQJA 4YBHB 1PULA 1PRWA 1MHOA 2MAZA 4MZLA 5AXIA 1OMDA 1F54A 1WRZA 1CDMA 1B8LA 1SCMB 1ZACA 1E8AA 2FOTA 3WNXB 1OMRA 1CLLA 1WDCB 2Y4QA 1J1DA 4JWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2I A;  1J7Q A;  3I5F B;  5JJG A;  2G2B A;  1QV1 A;  3H4S E;  1NX1 A;  1CMG A;  1V1F A;  2E30 A;  5J3X A;  3OX6 A;  1K94 A;  1LA0 A;  1SKT A;  1B4C A;  4ORA B;  2LC5 A;  2LHI A;  4PHK A;  1AUI B;  3BOW B;  2KFG A;  3ZNI A;  2ZN9 A;  1KFX S;  1N65 A;  1TCO B;  5K89 A;  1Y0V H;  1KQV A;  2JUL A;  1ALW A;  2LAN A;  1XFW O;  3I5G B;  2MA2 A;  3CTN A;  4YRU A;  1DJW A;  1XFX O;  1YUR A;  1IG5 A;  1IJ5 A;  1MQ1 A;  2KSP A;  1QLK A;  4YGB B;  2LVI A;  2JU0 A;  4M2Q A;  1CFC A;  1LKJ A;  1K8U A;  2L5X B;  3CR5 X;  2L50 A;  1Y1A A;  1C7W A;  1YX7 A;  1WRL A;  1GGZ A;  1UUR A;  1UP5 A;  3EKH A;  5ER4 X;  4A4C A;  2MLE C;  2JT3 A;  2K7B A;  1B9A A;  1JBA A;  2CCM A;  5ER5 A;  1L2O B;  2EGD A;  1EXR A;  3E3R A;  1XFV O;  2M49 B;  2B1U A;  1F4Q A;  3LLE A;  5CSF A;  1DJI A;  3DVK A;  5B8I B;  4OR9 B;  2WND A;  2JRF A;  1X02 A;  3VGO A;  5HKY A;  4PHM A;  1UHK A;  4ORC B;  2K2A A;  1YUT A;  2AAO A;  1IWQ A;  2JT8 A;  5HYD A;  1UHI A;  2M3W A;  2O60 A;  1M63 B;  3O4Y A;  1NSH A;  1KWO C;  1F70 A;  1Q80 A;  3A8R A;  3ZWH A;  2F3Y A;  1CMF A;  1IQ5 A;  3VRQ A;  4CFR A;  2KGB C;  1NIW A;  2CXJ A;  2LP3 A;  5I2L A;  1QX7 A;  1SNL A;  2NXQ A;  3AAJ A;  2JXC A;  1B8C A;  2KDH A;  3CS1 A;  1BMO A;  5BPJ A;  1PAL A;  1K2H A;  1QAT A;  1UUS A;  2M1K B;  3BQ3 A;  1JF2 A;  4GAO A;  4A4B A;  1C07 A;  2MJW B;  2M97 A;  3IQQ A;  2M29 A;  1BOD A;  3DF0 A;  1J55 A;  4PHN A;  5TNC A;  3PFV A;  1SBJ A;  1ZOT B;  2NZ0 A;  3I5H B;  1RTP 1;  2BBN A;  2GGM A;  2KI4 C;  1PVB A;  1SCV A;  3DVJ A;  3LK1 A;  1S6J A;  3D0Y B;  2KBI A;  3LL8 B;  1OZO A;  1NCX A;  3O2P A;  4L9M A;  1N0Y A;  5D69 A;  2LVJ A;  1G8I A;  1F8H A;  3IF7 A;  2K0J A;  2E6W A;  3FWC A;  1BR1 B;  1SYM A;  3CWG A;  2H61 C;  2KQ6 A;  5KTY A;  1YUS A;  2KAY A;  3F45 A;  1K9P A;  1UWO A;  2F8P A;  3JTD B;  1QVI Z;  3PN7 B;  2ZND A;  1M45 A;  4FQO A;  2LNK A;  2KFF A;  2L2E A;  1SL8 A;  2BEC A;  2HF5 A;  4UPG A;  5KSZ A;  3TDU A;  1NPQ A;  1CDL A;  4BY4 A;  1AVS A;  2PMY A;  3TUY B;  2MLF C;  1C7V A;  3GK2 A;  1KK8 B;  2JPT A;  1K93 D;  4NDB A;  1IGV A;  1DF0 B;  3HX4 A;  3EK7 A;  1RRO A;  1M46 A;  1BLQ A;  1YX8 A;  1DMO A;  2K8M B;  1B7T Y;  1BU3 A;  4QJ5 B;  4MRY A;  3NSL A;  4M2O A;  1BR4 B;  2LP2 A;  1ODB A;  2GGZ A;  1H4B A;  3D0Y A;  4USL A;  4CID A;  4BY5 A;  4MSP A;  5F6T A;  1OQP A;  1F71 A;  2H61 A;  2OPO A;  2TN4 A;  1SR6 B;  1FI5 A;  2BKH B;  1QAS A;  4C0L A;  1DJY A;  1B7T Z;  2EC6 C;  2IS9 A;  3NSK A;  3SIB A;  1N2D A;  1NX3 A;  1JWD A;  1DVI A;  3NSO A;  2Y1N A;  3CZT X;  3SG7 A;  2JTZ A;  4ORB B;  4XYN A;  3OHM B;  4D1E A;  3VRP A;  1CDN A;  2HQW A;  4XJK A;  1ALV A;  2HPS A;  3KPX A;  2WC8 A;  1WY9 A;  1PK0 D;  1CFF A;  2CNP A;  1FI6 A;  2L4I A;  1CM1 A;  4CFQ A;  1GQM A;  2I2R E;  1DF0 A;  1NYA A;  3CGA A;  1AK8 A;  2PAS A;  2LUC A;  1NP8 A;  1NX2 A;  2JT0 A;  2K7C A;  3C1V A;  3CLN A;  1JC2 A;  3HCM A;  4AQI A;  1SK6 D;  1M39 A;  2JOJ A;  2PAL A;  1D1O A;  1HT9 A;  1BF5 A;  2GV5 A;  1V1G A;  3DF0 B;  3SG4 A;  1SCM C;  2JC2 A;  4E68 A;  5AFP A;  1XYD A;  2M1U A;  1HQV A;  4PE0 A;  3I5F C;  1B8R A;  4Q04 A;  2LMU A;  2WOR A;  1NCY A;  3FWB A;  4P5O E;  3SJS A;  3AAK A;  2KYC A;  2BL0 B;  1LVC D;  4YI9 A;  2H2K A;  2OS8 C;  1XFU O;  1A2X A;  1LIN A;  2JTT A;  1XK4 C;  1PVA A;  1TOP A;  4I5L B;  1WRK A;  1KSM A;  1AJ5 A;  1MF8 B;  1TRF A;  4FTG A;  1SPY A;  1TNP A;  1A29 A;  1UHJ A;  1EJ3 A;  3I5I C;  5KU1 A;  1U5I A;  4YGA A;  4PE7 A;  5CSJ A;  1CFP A;  1KK7 Z;  3CR4 X;  1YRU B;  2WCF A;  1YUU A;  2L98 A;  2LM5 A;  4QJ3 B;  2KHN A;  1XA5 A;  2AUC A;  2CBL A;  5HKW A;  2KI4 B;  2Q91 A;  3SIA A;  2KBM A;  4N1G A;  2F33 A;  3BUM B;  2ZRT A;  2NCP A;  4PHJ A;  1NX0 A;  1IH0 A;  1WLZ A;  2LCP A;  4NDD A;  2LLS A;  1QVI Y;  2L0P A;  3VRR A;  1R2U A;  1A03 A;  4GBA A;  2K61 A;  1YRT B;  1TCF A;  1K90 D;  2M7L A;  2MBX A;  1EG3 A;  1QV0 A;  1AJ4 A;  1S1E A;  4PE1 A;  3RLZ A;  3BUW B;  1CLM A;  4DRW A;  1Y1U A;  4DUQ A;  1SMG A;  2WCE A;  3WHT B;  4F0Z B;  1BG1 A;  1FF1 A;  2KQY A;  3VRO A;  3TS5 B;  1QS7 A;  1QX5 B;  4MN0 A;  1A75 A;  5G08 A;  2LHL A;  2ZFD A;  4OKH A;  1F4O A;  1QX2 A;  1BT6 A;  4PE4 A;  4MZJ A;  1TN4 A;  1A4P A;  1J7R A;  3OB1 B;  1OOJ A;  2LVK A;  2LVV A;  4HRG A;  4XJK B;  5CPV A;  1CKK A;  2LLU A;  3BXK A;  3I5H C;  4N1F A;  3KO0 A;  3JVT C;  4YGE B;  2DOQ A;  2JWW A;  4MVF A;  1F55 A;  1DT7 B;  2P6B B;  4DCK A;  4DS7 A;  1SRA A;  5GQQ C;  4GPL B;  5AEQ A;  4MLW A;  1XFY O;  5DKN A;  3WHU B;  5D7F A;  2KI6 D;  1TTX A;  1IJ6 A;  2Q4U A;  5DKR A;  2BCB A;  5I2O A;  3AKA A;  1NWD A;  1JFK A;  3JTD C;  1CNP A;  3WXA A;  3PN7 C;  2OTG C;  1J1E A;  1J7O A;  3SG5 A;  1IKU A;  4GNK B;  1OE9 B;  3M0W A;  2EHB A;  1SY9 A;  3OP0 A;  2I94 A;  1K9U A;  2NLN A;  1G4Y R;  3TUY C;  3BUO B;  1NCZ A;  3EVU A;  4ZCU A;  1XVJ A;  1CTR A;  2WCB A;  2BE6 A;  4YGC B;  4WQ3 A;  5CSN A;  2K7O A;  3PAL A;  2I7A A;  1REC A;  2QPT A;  2A4J A;  5HLV A;  2VRG A;  2LMV A;  4C0K A;  3VRN A;  2KGR A;  1YVL A;  1W7J B;  1BJF A;  1CLB A;  1PSR A;  2BE4 A;  3K21 A;  1MR8 A;  3BUN B;  1U5I B;  2ZRS A;  4WQ2 A;  4WRI A;  1SR6 C;  1FPW A;  1Y1X A;  4DIR A;  1KQM C;  1YTZ C;  1Y6W A;  2I18 A;  3TDZ A;  3EK4 A;  3GK4 X;  4OVN F;  1AHR A;  3OX5 A;  3NXA A;  5HKZ A;  2Y5I A;  3EK8 A;  4OCI A;  1RFJ A;  1WDC C;  1NUB A;  4QJ4 B;  3BYA A;  1TNQ A;  3MSE B;  3TDI A;  5PAL A;  3TZ1 A;  2M0R A;  1B1G A;  3D10 A;  1H8B A;  3KEV A;  4GGF C;  4PDZ A;  4JQ0 D;  5HLO A;  4P2Y B;  4YGD B;  1KCY A;  1QTX A;  2OS8 B;  1S26 D;  2O5G A;  2PSR A;  3LCP C;  2BKI B;  2FCE A;  1K95 A;  4TNC A;  1B47 A;  2K7D A;  1MWN A;  1L7Z A;  1R6P A;  1MXE A;  3ICB A;  1MXL C;  1CFD A;  1S36 A;  1QJT A;  3IQO A;  1KK7 Y;  4AOM A;  1VRK A;  1SL7 A;  1KWO B;  1S3P A;  1RWY A;  3O78 A;  3I5I B;  1UHH A;  2M9G A;  3I5G C;  4OV2 A;  2JNX A;  3RM1 A;  1ZFS A;  5AAN A;  1OMV A;  2M7N A;  3PM8 A;  4C0J A;  2F3Z A;  1A75 B;  1EL4 A;  2SCP A;  2RGI A;  5IBW A;  1K9K A;  2BCA A;  1S6C A;  3NSI A;  2MRD A;  1S5G Y;  2LV7 A;  1EH2 A;  3EVR A;  1SL9 A;  4MRX A;  4MZK A;  2LLT A;  1DTL A;  2LMT A;  3EVV A;  1EG4 A;  5I8N A;  3FS7 A;  1UHN A;  2HET A;  2V53 A;  1L2O C;  1SW8 A;  4GGF A;  2HQ8 A;  2QAC A;  1JUO A;  4GFT A;  1M31 A;  2L4H A;  1S5G Z;  4R1E A;  1KFU L;  2COL B;  4I5J A;  2BL0 C;  5DKQ A;  1TNW A;  4MBE A;  3BUX B;  1JF0 A;  2CTN A;  1DJH A;  2LAP A;  2KAX A;  2LUX A;  3A4U B;  3BOW A;  3DVM A;  1KSO A;  2CT9 A;  3DD4 A;  2KI6 C;  1FW4 A;  3SG6 A;  1QLS A;  1IRJ A;  2PVB A;  3OB2 B;  1XK4 A;  1CB1 A;  4I5N B;  4NQG A;  1YVH A;  2BBM A;  4HSZ A;  1XO5 A;  3SG2 A;  5AER A;  1JFJ A;  4HRH A;  1S6I A;  4M2P A;  4CLN A;  1CDP A;  1PSB A;  3KHE A;  1DJG A;  3PSR A;  1DGV A;  2JZI A;  3O6B A;  1GJY A;  4MEW A;  1TNX A;  2PRU A;  1ZMZ A;  1W7I B;  2AMI A;  3JVT B;  2F2P A;  3PAT A;  1DGU A;  4N5X A;  4ETO A;  4YI8 A;  2F2O A;  1WLM A;  1J7P A;  4PAL A;  2ZN8 A;  1RJV A;  3PLF B;  2JNF A;  3GK1 A;  4JPZ B;  3EKJ A;  3FIA A;  3SG3 A;  2NCO A;  4I5K A;  1LXF C;  2KOT A;  2ISD A;  2Y1M A;  4U8D A;  1AP4 A;  1IQ3 A;  5JOL A;  2JXL A;  2FJU B;  1JSA A;  1DJX A;  2KAV A;  4NDC A;  2OTG B;  1ZUZ A;  1YR5 A;  2KYF A;  5I2Q A;  3CR2 A;  2FCD A;  2KNE A;  2SAS A;  1KFU S;  3TS5 C;  4PCW A;  1MUX A;  3QRX A;  2EC6 B;  2KFH A;  1TIZ A;  2WOS A;  1QIW A;  2LE9 B;  1KFX L;  4IL1 A;  1DJZ A;  2G9B A;  2JQ6 A;  1CM4 A;  1QIV A;  3AKB A;  4ZCV A;  2ZKM X;  3KF9 A;  5CSI A;  4CPV A;  1OSA A;  1KK8 C;  5FYX A;  1GGW A;  1OZS A;  1RK9 A;  1G33 A;  1QXP A;  4HRE E;  4ICB A;  2M8U A;  1BOC A;  2BCX A;  2D8N A;  2ZNE A;  4GGN A;  1XFZ O;  1K96 A;  2L51 A;  3LK0 A;  1KQM B;  3GOF A;  1FBV A;  1LA3 A;  2K2F A;  3DVE A;  2MHH A;  4GUK A;  4AQJ A;  4YBH B;  1PUL A;  1PRW A;  1MHO A;  2MAZ A;  4MZL A;  5AXI A;  1OMD A;  1F54 A;  1WRZ A;  1CDM A;  1B8L A;  1SCM B;  1ZAC A;  1E8A A;  2FOT A;  3WNX B;  1OMR A;  1CLL A;  1WDC B;  2Y4Q A;  1J1D A;  4JWQ A; 
#chains in the Genus database with same CATH topology
 2R2I A;  1J7Q A;  3I5F B;  4INW A;  3S0B A;  5JJG A;  2G2B A;  1QV1 A;  3H4S E;  1NX1 A;  1CMG A;  1V1F A;  2E30 A;  5J3X A;  3OX6 A;  1K94 A;  1LA0 A;  1SKT A;  1B4C A;  4ORA B;  2LC5 A;  2LHI A;  3Q8I A;  4PHK A;  1AUI B;  3BOW B;  2KFG A;  3ZNI A;  2ZN9 A;  1KFX S;  1N65 A;  1TCO B;  5K89 A;  1Y0V H;  1KQV A;  2JUL A;  1ALW A;  2LAN A;  1XFW O;  3I5G B;  2MA2 A;  3CTN A;  4YRU A;  1IIO A;  1DJW A;  1XFX O;  1YUR A;  1IG5 A;  1IJ5 A;  1MQ1 A;  2KSP A;  1QLK A;  4YGB B;  2LVI A;  2JU0 A;  4M2Q A;  1CFC A;  1LKJ A;  1K8U A;  2L5X B;  3CR5 X;  2L50 A;  1Y1A A;  1C7W A;  1YX7 A;  1WRL A;  1GGZ A;  1UUR A;  1UP5 A;  3EKH A;  2H8V A;  5ER4 X;  4A4C A;  2MLE C;  2JT3 A;  2K7B A;  1B9A A;  1JBA A;  2CCM A;  5ER5 A;  1L2O B;  2EGD A;  1EXR A;  3E3R A;  1XFV O;  2M49 B;  5EL2 A;  2B1U A;  1F4Q A;  3LLE A;  5CSF A;  1DJI A;  3DVK A;  5B8I B;  4OR9 B;  2WND A;  2JRF A;  1X02 A;  3DXL A;  3VGO A;  5HKY A;  4PHM A;  4PT1 A;  1UHK A;  4ORC B;  2K2A A;  2ERB A;  1DC1 A;  3L47 A;  1YUT A;  2YGU A;  2AAO A;  1IWQ A;  2BNX A;  2JT8 A;  5HYD A;  1UHI A;  2QEO A;  2M3W A;  2O60 A;  1M63 B;  3O4Y A;  1NSH A;  1KWO C;  3UO9 A;  1Q80 A;  1F70 A;  3A8R A;  3ZWH A;  2F3Y A;  1CMF A;  1IQ5 A;  3VRQ A;  4CFR A;  2KGB C;  1NIW A;  2CXJ A;  2LP3 A;  5I2L A;  1QX7 A;  1SNL A;  2NXQ A;  2WCL A;  3AAJ A;  2JXC A;  1B8C A;  2KDH A;  3CS1 A;  1BMO A;  5BPJ A;  1PAL A;  2WC6 A;  1K2H A;  1QAT A;  1UUS A;  2M1K B;  3BQ3 A;  1JF2 A;  4GAO A;  4A4B A;  1C07 A;  2MJW B;  2M97 A;  3IQQ A;  2M29 A;  1BOD A;  3DF0 A;  1J55 A;  4PHN A;  5TNC A;  3PFV A;  1SBJ A;  1ZOT B;  4KYN A;  2NZ0 A;  3I5H B;  1RTP 1;  2BBN A;  2GGM A;  2KI4 C;  2L2C A;  1PVB A;  1SCV A;  3DVJ A;  3LK1 A;  1S6J A;  3D0Y B;  2KBI A;  3LL8 B;  1OZO A;  1NCX A;  3O2P A;  4L9M A;  1N0Y A;  5D69 A;  2LVJ A;  1G8I A;  1F8H A;  3IF7 A;  2K0J A;  2E6W A;  1TWO A;  3FWC A;  1BR1 B;  3DZT A;  1SYM A;  3CWG A;  3R1V A;  2H61 C;  2KQ6 A;  5KTY A;  1YUS A;  2KAY A;  3L4A A;  3F45 A;  1K9P A;  1UWO A;  2F8P A;  3JTD B;  1QVI Z;  3PN7 B;  3CZ0 A;  2ZND A;  1M45 A;  4FQO A;  2LNK A;  2KFF A;  2L2E A;  3CZ1 A;  1SL8 A;  2BEC A;  2HF5 A;  2QEV A;  4UPG A;  5KSZ A;  3TDU A;  1NPQ A;  1CDL A;  4BY4 A;  1AVS A;  1GM0 A;  2PMY A;  3TUY B;  1LS8 A;  2MLF C;  1C7V A;  3GK2 A;  3CYZ A;  1KK8 B;  2JPT A;  1K93 D;  4NDB A;  1IGV A;  1DF0 B;  3HX4 A;  1W9Z A;  3EK7 A;  1RRO A;  1M46 A;  3R1P A;  1BLQ A;  1YX8 A;  1DMO A;  2K8M B;  1B7T Y;  1BU3 A;  1SSE B;  4MRY A;  4QJ5 B;  3D78 A;  3NSL A;  4M2O A;  1BR4 B;  3NGV A;  2LP2 A;  1ODB A;  2GGZ A;  1H4B A;  3D0Y A;  4USL A;  4CID A;  3IVT A;  4BY5 A;  4MSP A;  5F6T A;  1OQP A;  1F71 A;  2H61 A;  2OPO A;  2TN4 A;  1TUJ A;  1SR6 B;  1FI5 A;  3CAB A;  2BKH B;  1QAS A;  4C0L A;  1DJY A;  1B7T Z;  2EC6 C;  2IS9 A;  3NSK A;  3SIB A;  3D75 A;  1N2D A;  1NX3 A;  4JD9 A;  1JWD A;  1DVI A;  3NSO A;  2Y1N A;  3CZT X;  3SG7 A;  2JTZ A;  4ORB B;  4XYN A;  3OHM B;  4D1E A;  3VRP A;  1CDN A;  2HQW A;  4XJK A;  1ALV A;  2HPS A;  3KPX A;  3SS5 A;  3FE9 A;  2WC8 A;  1WY9 A;  1PK0 D;  1CFF A;  2CNP A;  1FI6 A;  2L4I A;  3BFH A;  1CM1 A;  4CFQ A;  1GQM A;  1Z4H A;  2I2R E;  1DF0 A;  1NYA A;  3CGA A;  1AK8 A;  2PAS A;  2LUC A;  1NP8 A;  1NX2 A;  2JT0 A;  2K7C A;  3C1V A;  3CLN A;  1JC2 A;  3HCM A;  3B86 A;  1SK6 D;  4AQI A;  1M39 A;  4IJ7 A;  2JOJ A;  2PAL A;  1D1O A;  3S0G A;  1HT9 A;  1BF5 A;  2GV5 A;  1V1G A;  3DF0 B;  3SG4 A;  1SCM C;  2JC2 A;  3CZ2 A;  3B88 A;  4E68 A;  5AFP A;  1XYD A;  2M1U A;  1HQV A;  3B7A A;  4PE0 A;  3I5F C;  3S0A A;  1B8R A;  1XFR A;  3L4L A;  4Q04 A;  2LMU A;  2WOR A;  1NCY A;  3FWB A;  4P5O E;  3SJS A;  3AAK A;  2KYC A;  2BL0 B;  1LVC D;  4YI9 A;  2GTE A;  2H2K A;  1XFU O;  2OS8 C;  2P71 A;  1A2X A;  1LIN A;  2JTT A;  1XK4 C;  1PVA A;  1TOP A;  4I5L B;  1WRK A;  1KSM A;  1AJ5 A;  1MF8 B;  1TRF A;  4FTG A;  1SPY A;  1TNP A;  1A29 A;  1UHJ A;  1EJ3 A;  3I5I C;  5KU1 A;  1U5I A;  4YGA A;  4PE7 A;  5CSJ A;  1CFP A;  1KK7 Z;  3B6X A;  3CR4 X;  1YRU B;  5I94 A;  2WCF A;  1YUU A;  2L98 A;  2LM5 A;  4QJ3 B;  2KHN A;  1XA5 A;  1C3Z A;  2AUC A;  2CBL A;  5HKW A;  2KI4 B;  2Q91 A;  3SIA A;  2P70 A;  2KBM A;  4N1G A;  2F33 A;  3BUM B;  2PQL A;  2ZRT A;  3BFA A;  3BFB A;  3QME A;  2NCP A;  4PHJ A;  1NX0 A;  1IH0 A;  1WLZ A;  2LCP A;  4NDD A;  2LLS A;  1QVI Y;  2L0P A;  3VRR A;  1R2U A;  1A03 A;  4GBA A;  2JPO A;  2K61 A;  1YRT B;  1TCF A;  1K90 D;  2M7L A;  2MBX A;  1EG3 A;  1QV0 A;  1AJ4 A;  1S1E A;  4PE1 A;  3RLZ A;  3BUW B;  3O4X A;  1CLM A;  4DRW A;  1Y1U A;  4DUQ A;  1SMG A;  2WCE A;  3WHT B;  4F0Z B;  3PM2 A;  1BG1 A;  1FF1 A;  2KQY A;  3VRO A;  3TS5 B;  1QS7 A;  4JKT A;  1QX5 B;  4MN0 A;  1A75 A;  5G08 A;  2LHL A;  2PYQ A;  2ZFD A;  4OKH A;  1F4O A;  1QX2 A;  1BT6 A;  4PE4 A;  4MZJ A;  1TN4 A;  1A4P A;  1J7R A;  3OB1 B;  1OOJ A;  2LVK A;  2LVV A;  4HRG A;  4XJK B;  5CPV A;  1CKK A;  5DIC A;  2LLU A;  3BXK A;  3I5H C;  4N1F A;  3KO0 A;  3JVT C;  3SS4 A;  4YGE B;  2DOQ A;  2JWW A;  4MVF A;  1F55 A;  1DT7 B;  2P6B B;  4DCK A;  4DS7 A;  1SRA A;  5GQQ C;  4GPL B;  5AEQ A;  4MLW A;  1C3Y A;  1XFY O;  3BJH A;  5DKN A;  3WHU B;  5D7F A;  3RZS A;  2KI6 D;  1TTX A;  1IJ6 A;  2Q4U A;  5DKR A;  2BCB A;  5I2O A;  3AKA A;  1NWD A;  1JFK A;  3JTD C;  1DEL A;  1CNP A;  3WXA A;  3PN7 C;  2OTG C;  1J1E A;  3S0E A;  1J7O A;  3SG5 A;  1IKU A;  5FI2 A;  3D77 A;  1Z2C B;  2KLE A;  1OE9 B;  4GNK B;  3M0W A;  2EHB A;  1SY9 A;  3OP0 A;  2I94 A;  1K9U A;  2NLN A;  1G4Y R;  3TUY C;  3BUO B;  1NCZ A;  3EVU A;  4ZCU A;  1XVJ A;  1CTR A;  2WCB A;  1OW4 A;  2BE6 A;  4YGC B;  4WQ3 A;  5CSN A;  2K7O A;  3PAL A;  2I7A A;  3D74 A;  1REC A;  2QEB A;  2QPT A;  2A4J A;  5HLV A;  2FJY A;  2VRG A;  2LMV A;  3N7H A;  3VRN A;  4C0K A;  2KGR A;  3S0F A;  1P28 A;  1W7J B;  1YVL A;  1BJF A;  4F7F A;  1CLB A;  1PSR A;  2BE4 A;  3K21 A;  1MR8 A;  3BUN B;  1U5I B;  3S0D A;  2ZRS A;  4WQ2 A;  4WRI A;  1SR6 C;  3UNW A;  1FPW A;  1Y1X A;  4DIR A;  1KQM C;  1YTZ C;  1Y6W A;  2I18 A;  4OZD A;  3TDZ A;  3EK4 A;  3GK4 X;  3EG5 B;  4OVN F;  1AHR A;  3OX5 A;  3NXA A;  5HKZ A;  2Y5I A;  3EK8 A;  4OCI A;  1RFJ A;  1WDC C;  1NUB A;  4QJ4 B;  3BYA A;  1TNQ A;  2WCM A;  3MSE B;  3D73 A;  3TDI A;  5PAL A;  3TZ1 A;  2M0R A;  1B1G A;  3D10 A;  1H8B A;  3KEV A;  4GGF C;  4FQT A;  4PDZ A;  4JQ0 D;  5HLO A;  4P2Y B;  4YGD B;  1KCY A;  1OOF A;  1QTX A;  2OS8 B;  1S26 D;  2O5G A;  2PSR A;  3LCP C;  2BKI B;  2FCE A;  1K95 A;  1OOI X;  1B47 A;  2K7D A;  4TNC A;  1MWN A;  1L7Z A;  1R6P A;  1MXE A;  5HL1 A;  3ICB A;  2L5Y A;  1MXL C;  1CFD A;  1S36 A;  1QJT A;  3IQO A;  1KK7 Y;  3NHT A;  4AOM A;  1VRK A;  1SL7 A;  1KWO B;  1S3P A;  1RWY A;  3O78 A;  3I5I B;  1UHH A;  2M9G A;  3I5G C;  4OV2 A;  2JNX A;  3RM1 A;  1ZFS A;  5AAN A;  1OMV A;  2M7N A;  2WC5 A;  3PM8 A;  4INX A;  2F3Z A;  4C0J A;  1A75 B;  1EL4 A;  2SCP A;  2RGI A;  5IBW A;  1K9K A;  1S6C A;  2BCA A;  3NSI A;  2MRD A;  1S5G Y;  2LV7 A;  3D76 A;  1EH2 A;  3EVR A;  1SL9 A;  4MRX A;  4MZK A;  2LLT A;  1DTL A;  2LMT A;  3EVV A;  1DQE A;  1TUZ A;  1EG4 A;  5I8N A;  3FS7 A;  1UHN A;  2HET A;  2V53 A;  1L2O C;  1SW8 A;  4GGF A;  2HQ8 A;  2QAC A;  1JUO A;  4GFT A;  1M31 A;  2L4H A;  3CDN A;  1S5G Z;  4R1E A;  1KFU L;  2COL B;  3K1E A;  2BL0 C;  4I5J A;  5DKQ A;  1TNW A;  4MBE A;  3BUX B;  3V2L A;  3PJI A;  1OOH A;  1JF0 A;  2CTN A;  1DJH A;  2LAP A;  2KAX A;  2LUX A;  3A4U B;  3BOW A;  3DVM A;  1KSO A;  2CT9 A;  3DD4 A;  2KI6 C;  1FW4 A;  3SG6 A;  3FE8 A;  1QLS A;  2WCH A;  1IRJ A;  2PVB A;  3OB2 B;  1XK4 A;  1CB1 A;  4I5N B;  4NQG A;  1YVH A;  2BBM A;  2KLD A;  1XO5 A;  4HSZ A;  3SG2 A;  5AER A;  1JFJ A;  4HRH A;  1S6I A;  4M2P A;  4CLN A;  1CDP A;  1PSB A;  3KHE A;  1DJG A;  3PSR A;  3VB1 A;  1DGV A;  2JZI A;  3O6B A;  1GJY A;  4MEW A;  1TNX A;  2PRU A;  1ZMZ A;  1W7I B;  2AMI A;  3JVT B;  2F2P A;  3PAT A;  1DGU A;  4N5X A;  3OGN A;  3FE6 A;  4YI8 A;  3B87 A;  4ETO A;  2F2O A;  1WLM A;  1ORG A;  1J7P A;  4PAL A;  2ZN8 A;  1RJV A;  3PLF B;  2JNF A;  3GK1 A;  4JPZ B;  3EKJ A;  2QDI A;  3FIA A;  2K60 A;  5FI7 A;  3SG3 A;  1OOG A;  2NCO A;  1LXF C;  2KOT A;  4I5K A;  2Y1M A;  4U8D A;  2ISD A;  1AP4 A;  1IQ3 A;  5JOL A;  2JXL A;  2FJU B;  1JSA A;  3R72 A;  1DJX A;  2KAV A;  4NDC A;  3R1O A;  2OTG B;  1ZUZ A;  1YR5 A;  2KYF A;  5I2Q A;  3CR2 A;  3DY9 A;  2FCD A;  2KNE A;  2SAS A;  2KPH A;  1KFU S;  1QWV A;  3TS5 C;  4PCW A;  1MUX A;  2WCJ A;  3QRX A;  2EC6 B;  2KFH A;  1TIZ A;  2WOS A;  1QIW A;  2LE9 B;  1KFX L;  4IL1 A;  3OBV A;  2WCK A;  1DJZ A;  2G9B A;  2JQ6 A;  1CM4 A;  1QIV A;  1DEK A;  3AKB A;  4ZCV A;  2ZKM X;  3KF9 A;  5CSI A;  3SS3 A;  4CPV A;  1OSA A;  1T14 A;  1KK8 C;  5FYX A;  1GGW A;  1OZS A;  1RK9 A;  1G33 A;  1QXP A;  4HRE E;  4ICB A;  2M8U A;  1BOC A;  2BCX A;  2D8N A;  2ZNE A;  4GGN A;  3DYE A;  1XFZ O;  1K96 A;  2L51 A;  3LK0 A;  1KQM B;  3GOF A;  1FBV A;  1LA3 A;  2K2F A;  3DVE A;  2MHH A;  4GUK A;  4AQJ A;  4YBH B;  1PUL A;  2BAP A;  1PRW A;  1MHO A;  5FI6 A;  2MAZ A;  3NHI A;  4MZL A;  2QEH A;  5AXI A;  1OMD A;  5D3O A;  1WRZ A;  1CDM A;  1F54 A;  1B8L A;  1SCM B;  1ZAC A;  1E8A A;  2FOT A;  3WNX B;  1OMR A;  1CLL A;  1WDC B;  2Y4Q A;  1J1D A;  4JWQ A; 
#chains in the Genus database with same CATH homology
 2R2I A;  1J7Q A;  3I5F B;  5JJG A;  2G2B A;  1QV1 A;  3H4S E;  1NX1 A;  1CMG A;  1V1F A;  2E30 A;  5J3X A;  3OX6 A;  1K94 A;  1LA0 A;  1SKT A;  1B4C A;  4ORA B;  2LC5 A;  2LHI A;  4PHK A;  1AUI B;  3BOW B;  2KFG A;  3ZNI A;  2ZN9 A;  1KFX S;  1N65 A;  1TCO B;  5K89 A;  1Y0V H;  1KQV A;  2JUL A;  1ALW A;  2LAN A;  1XFW O;  3I5G B;  2MA2 A;  3CTN A;  4YRU A;  1DJW A;  1XFX O;  1YUR A;  1IG5 A;  1IJ5 A;  1MQ1 A;  2KSP A;  1QLK A;  4YGB B;  2LVI A;  2JU0 A;  4M2Q A;  1CFC A;  1LKJ A;  1K8U A;  2L5X B;  3CR5 X;  2L50 A;  1Y1A A;  1C7W A;  1YX7 A;  1WRL A;  1GGZ A;  1UUR A;  1UP5 A;  3EKH A;  5ER4 X;  4A4C A;  2MLE C;  2JT3 A;  2K7B A;  1B9A A;  1JBA A;  2CCM A;  5ER5 A;  1L2O B;  2EGD A;  1EXR A;  3E3R A;  1XFV O;  2M49 B;  2B1U A;  1F4Q A;  3LLE A;  5CSF A;  1DJI A;  3DVK A;  5B8I B;  4OR9 B;  2WND A;  2JRF A;  1X02 A;  3VGO A;  5HKY A;  4PHM A;  1UHK A;  4ORC B;  2K2A A;  1YUT A;  2AAO A;  1IWQ A;  2JT8 A;  5HYD A;  1UHI A;  2M3W A;  2O60 A;  1M63 B;  3O4Y A;  1NSH A;  1KWO C;  1F70 A;  1Q80 A;  3A8R A;  3ZWH A;  2F3Y A;  1CMF A;  1IQ5 A;  3VRQ A;  4CFR A;  2KGB C;  1NIW A;  2CXJ A;  2LP3 A;  5I2L A;  1QX7 A;  1SNL A;  2NXQ A;  3AAJ A;  2JXC A;  1B8C A;  2KDH A;  3CS1 A;  1BMO A;  5BPJ A;  1PAL A;  1K2H A;  1QAT A;  1UUS A;  2M1K B;  3BQ3 A;  1JF2 A;  4GAO A;  4A4B A;  1C07 A;  2MJW B;  2M97 A;  3IQQ A;  2M29 A;  1BOD A;  3DF0 A;  1J55 A;  4PHN A;  5TNC A;  3PFV A;  1SBJ A;  1ZOT B;  2NZ0 A;  3I5H B;  1RTP 1;  2BBN A;  2GGM A;  2KI4 C;  1PVB A;  1SCV A;  3DVJ A;  3LK1 A;  1S6J A;  3D0Y B;  2KBI A;  3LL8 B;  1OZO A;  1NCX A;  3O2P A;  4L9M A;  1N0Y A;  5D69 A;  2LVJ A;  1G8I A;  1F8H A;  3IF7 A;  2K0J A;  2E6W A;  3FWC A;  1BR1 B;  1SYM A;  3CWG A;  2H61 C;  2KQ6 A;  5KTY A;  1YUS A;  2KAY A;  3F45 A;  1K9P A;  1UWO A;  2F8P A;  3JTD B;  1QVI Z;  3PN7 B;  2ZND A;  1M45 A;  4FQO A;  2LNK A;  2KFF A;  2L2E A;  1SL8 A;  2BEC A;  2HF5 A;  4UPG A;  5KSZ A;  3TDU A;  1NPQ A;  1CDL A;  4BY4 A;  1AVS A;  2PMY A;  3TUY B;  2MLF C;  1C7V A;  3GK2 A;  1KK8 B;  2JPT A;  1K93 D;  4NDB A;  1IGV A;  1DF0 B;  3HX4 A;  3EK7 A;  1RRO A;  1M46 A;  1BLQ A;  1YX8 A;  1DMO A;  2K8M B;  1B7T Y;  1BU3 A;  4QJ5 B;  4MRY A;  3NSL A;  4M2O A;  1BR4 B;  2LP2 A;  1ODB A;  2GGZ A;  1H4B A;  3D0Y A;  4USL A;  4CID A;  4BY5 A;  4MSP A;  5F6T A;  1OQP A;  1F71 A;  2H61 A;  2OPO A;  2TN4 A;  1SR6 B;  1FI5 A;  2BKH B;  1QAS A;  4C0L A;  1DJY A;  1B7T Z;  2EC6 C;  2IS9 A;  3NSK A;  3SIB A;  1N2D A;  1NX3 A;  1JWD A;  1DVI A;  3NSO A;  2Y1N A;  3CZT X;  3SG7 A;  2JTZ A;  4ORB B;  4XYN A;  3OHM B;  4D1E A;  3VRP A;  1CDN A;  2HQW A;  4XJK A;  1ALV A;  2HPS A;  3KPX A;  2WC8 A;  1WY9 A;  1PK0 D;  1CFF A;  2CNP A;  1FI6 A;  2L4I A;  1CM1 A;  4CFQ A;  1GQM A;  2I2R E;  1DF0 A;  1NYA A;  3CGA A;  1AK8 A;  2PAS A;  2LUC A;  1NP8 A;  1NX2 A;  2JT0 A;  2K7C A;  3C1V A;  3CLN A;  1JC2 A;  3HCM A;  4AQI A;  1SK6 D;  1M39 A;  2JOJ A;  2PAL A;  1D1O A;  1HT9 A;  1BF5 A;  2GV5 A;  1V1G A;  3DF0 B;  3SG4 A;  1SCM C;  2JC2 A;  4E68 A;  5AFP A;  1XYD A;  2M1U A;  1HQV A;  4PE0 A;  3I5F C;  1B8R A;  4Q04 A;  2LMU A;  2WOR A;  1NCY A;  3FWB A;  4P5O E;  3SJS A;  3AAK A;  2KYC A;  2BL0 B;  1LVC D;  4YI9 A;  2H2K A;  2OS8 C;  1XFU O;  1A2X A;  1LIN A;  2JTT A;  1XK4 C;  1PVA A;  1TOP A;  4I5L B;  1WRK A;  1KSM A;  1AJ5 A;  1MF8 B;  1TRF A;  4FTG A;  1SPY A;  1TNP A;  1A29 A;  1UHJ A;  1EJ3 A;  3I5I C;  5KU1 A;  1U5I A;  4YGA A;  4PE7 A;  5CSJ A;  1CFP A;  1KK7 Z;  3CR4 X;  1YRU B;  2WCF A;  1YUU A;  2L98 A;  2LM5 A;  4QJ3 B;  2KHN A;  1XA5 A;  2AUC A;  2CBL A;  5HKW A;  2KI4 B;  2Q91 A;  3SIA A;  2KBM A;  4N1G A;  2F33 A;  3BUM B;  2ZRT A;  2NCP A;  4PHJ A;  1NX0 A;  1IH0 A;  1WLZ A;  2LCP A;  4NDD A;  2LLS A;  1QVI Y;  2L0P A;  3VRR A;  1R2U A;  1A03 A;  4GBA A;  2K61 A;  1YRT B;  1TCF A;  1K90 D;  2M7L A;  2MBX A;  1EG3 A;  1QV0 A;  1AJ4 A;  1S1E A;  4PE1 A;  3RLZ A;  3BUW B;  1CLM A;  4DRW A;  1Y1U A;  4DUQ A;  1SMG A;  2WCE A;  3WHT B;  4F0Z B;  1BG1 A;  1FF1 A;  2KQY A;  3VRO A;  3TS5 B;  1QS7 A;  1QX5 B;  4MN0 A;  1A75 A;  5G08 A;  2LHL A;  2ZFD A;  4OKH A;  1F4O A;  1QX2 A;  1BT6 A;  4PE4 A;  4MZJ A;  1TN4 A;  1A4P A;  1J7R A;  3OB1 B;  1OOJ A;  2LVK A;  2LVV A;  4HRG A;  4XJK B;  5CPV A;  1CKK A;  2LLU A;  3BXK A;  3I5H C;  4N1F A;  3KO0 A;  3JVT C;  4YGE B;  2DOQ A;  2JWW A;  4MVF A;  1F55 A;  1DT7 B;  2P6B B;  4DCK A;  4DS7 A;  1SRA A;  5GQQ C;  4GPL B;  5AEQ A;  4MLW A;  1XFY O;  5DKN A;  3WHU B;  5D7F A;  2KI6 D;  1TTX A;  1IJ6 A;  2Q4U A;  5DKR A;  2BCB A;  5I2O A;  3AKA A;  1NWD A;  1JFK A;  3JTD C;  1CNP A;  3WXA A;  3PN7 C;  2OTG C;  1J1E A;  1J7O A;  3SG5 A;  1IKU A;  4GNK B;  1OE9 B;  3M0W A;  2EHB A;  1SY9 A;  3OP0 A;  2I94 A;  1K9U A;  2NLN A;  1G4Y R;  3TUY C;  3BUO B;  1NCZ A;  3EVU A;  4ZCU A;  1XVJ A;  1CTR A;  2WCB A;  2BE6 A;  4YGC B;  4WQ3 A;  5CSN A;  2K7O A;  3PAL A;  2I7A A;  1REC A;  2QPT A;  2A4J A;  5HLV A;  2VRG A;  2LMV A;  4C0K A;  3VRN A;  2KGR A;  1YVL A;  1W7J B;  1BJF A;  1CLB A;  1PSR A;  2BE4 A;  3K21 A;  1MR8 A;  3BUN B;  1U5I B;  2ZRS A;  4WQ2 A;  4WRI A;  1SR6 C;  1FPW A;  1Y1X A;  4DIR A;  1KQM C;  1YTZ C;  1Y6W A;  2I18 A;  3TDZ A;  3EK4 A;  3GK4 X;  4OVN F;  1AHR A;  3OX5 A;  3NXA A;  5HKZ A;  2Y5I A;  3EK8 A;  4OCI A;  1RFJ A;  1WDC C;  1NUB A;  4QJ4 B;  3BYA A;  1TNQ A;  3MSE B;  3TDI A;  5PAL A;  3TZ1 A;  2M0R A;  1B1G A;  3D10 A;  1H8B A;  3KEV A;  4GGF C;  4PDZ A;  4JQ0 D;  5HLO A;  4P2Y B;  4YGD B;  1KCY A;  1QTX A;  2OS8 B;  1S26 D;  2O5G A;  2PSR A;  3LCP C;  2BKI B;  2FCE A;  1K95 A;  4TNC A;  1B47 A;  2K7D A;  1MWN A;  1L7Z A;  1R6P A;  1MXE A;  3ICB A;  1MXL C;  1CFD A;  1S36 A;  1QJT A;  3IQO A;  1KK7 Y;  4AOM A;  1VRK A;  1SL7 A;  1KWO B;  1S3P A;  1RWY A;  3O78 A;  3I5I B;  1UHH A;  2M9G A;  3I5G C;  4OV2 A;  2JNX A;  3RM1 A;  1ZFS A;  5AAN A;  1OMV A;  2M7N A;  3PM8 A;  4C0J A;  2F3Z A;  1A75 B;  1EL4 A;  2SCP A;  2RGI A;  5IBW A;  1K9K A;  2BCA A;  1S6C A;  3NSI A;  2MRD A;  1S5G Y;  2LV7 A;  1EH2 A;  3EVR A;  1SL9 A;  4MRX A;  4MZK A;  2LLT A;  1DTL A;  2LMT A;  3EVV A;  1EG4 A;  5I8N A;  3FS7 A;  1UHN A;  2HET A;  2V53 A;  1L2O C;  1SW8 A;  4GGF A;  2HQ8 A;  2QAC A;  1JUO A;  4GFT A;  1M31 A;  2L4H A;  1S5G Z;  4R1E A;  1KFU L;  2COL B;  4I5J A;  2BL0 C;  5DKQ A;  1TNW A;  4MBE A;  3BUX B;  1JF0 A;  2CTN A;  1DJH A;  2LAP A;  2KAX A;  2LUX A;  3A4U B;  3BOW A;  3DVM A;  1KSO A;  2CT9 A;  3DD4 A;  2KI6 C;  1FW4 A;  3SG6 A;  1QLS A;  1IRJ A;  2PVB A;  3OB2 B;  1XK4 A;  1CB1 A;  4I5N B;  4NQG A;  1YVH A;  2BBM A;  4HSZ A;  1XO5 A;  3SG2 A;  5AER A;  1JFJ A;  4HRH A;  1S6I A;  4M2P A;  4CLN A;  1CDP A;  1PSB A;  3KHE A;  1DJG A;  3PSR A;  1DGV A;  2JZI A;  3O6B A;  1GJY A;  4MEW A;  1TNX A;  2PRU A;  1ZMZ A;  1W7I B;  2AMI A;  3JVT B;  2F2P A;  3PAT A;  1DGU A;  4N5X A;  4ETO A;  4YI8 A;  2F2O A;  1WLM A;  1J7P A;  4PAL A;  2ZN8 A;  1RJV A;  3PLF B;  2JNF A;  3GK1 A;  4JPZ B;  3EKJ A;  3FIA A;  3SG3 A;  2NCO A;  4I5K A;  1LXF C;  2KOT A;  2ISD A;  2Y1M A;  4U8D A;  1AP4 A;  1IQ3 A;  5JOL A;  2JXL A;  2FJU B;  1JSA A;  1DJX A;  2KAV A;  4NDC A;  2OTG B;  1ZUZ A;  1YR5 A;  2KYF A;  5I2Q A;  3CR2 A;  2FCD A;  2KNE A;  2SAS A;  1KFU S;  3TS5 C;  4PCW A;  1MUX A;  3QRX A;  2EC6 B;  2KFH A;  1TIZ A;  2WOS A;  1QIW A;  2LE9 B;  1KFX L;  4IL1 A;  1DJZ A;  2G9B A;  2JQ6 A;  1CM4 A;  1QIV A;  3AKB A;  4ZCV A;  2ZKM X;  3KF9 A;  5CSI A;  4CPV A;  1OSA A;  1KK8 C;  5FYX A;  1GGW A;  1OZS A;  1RK9 A;  1G33 A;  1QXP A;  4HRE E;  4ICB A;  2M8U A;  1BOC A;  2BCX A;  2D8N A;  2ZNE A;  4GGN A;  1XFZ O;  1K96 A;  2L51 A;  3LK0 A;  1KQM B;  3GOF A;  1FBV A;  1LA3 A;  2K2F A;  3DVE A;  2MHH A;  4GUK A;  4AQJ A;  4YBH B;  1PUL A;  1PRW A;  1MHO A;  2MAZ A;  4MZL A;  5AXI A;  1OMD A;  1F54 A;  1WRZ A;  1CDM A;  1B8L A;  1SCM B;  1ZAC A;  1E8A A;  2FOT A;  3WNX B;  1OMR A;  1CLL A;  1WDC B;  2Y4Q A;  1J1D A;  4JWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...