4NDBA

X-ray structure of a mutant (t61d) of calexcitin - a neuronal calcium-signalling protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
187
structure length
187
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARADLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGTLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray, spectroscopic and normal-mode dynamics of calexcitin: structure-function studies of a neuronal calcium-signalling protein.
pubmed doi rcsb
source organism Doryteuthis pealeii
molecule tags Signaling protein
molecule keywords Calexcitin
total genus 80
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ndbA00
1QASA 1OSAA 1KQMC 2KNEA 4R1EA 1SR6C 4YRUA 3SG5A 4WRIA 4PE4A 1YVHA 4AOMA 1EXRA 1M39A 2LLSA 2Y1NA 2ZNDA 2ZFDA 5DKNA 1SKTA 2BL0C 2Q91A 4HREE 1KQVA 1K95A 1N2DA 3VRQA 4DS7A 1LXFC 5I2OA 4HRGA 5I8NA 1LKJA 1SCMC 2CNPA 3SG6A 1YUUA 2KI6D 3AAKA 2KGRA 3VGOA 3WHUB 1M45A 1TCFA 3OP0A 1SMGA 2K7BA 2QPTA 4GFTA 1BG1A 3C1VA 1BLQA 2KDHA 2BE4A 2NXQA 1DF0A 2KQ6A 5KSZA 3O4YA 1QLSA 2CCMA 2EC6C 3KO0A 4GGFC 4U8DA 2HF5A 3LLEA 5AEQA 3CTNA 2M7LA 1WY9A 3TDUA 3PM8A 3WNXB 3O78A 2DOQA 1XO5A 1KK8B 1SK6D 4NDBA 1K8UA 1NX0A 1NCYA 5F6TA 2L50A 4C0LA 1NX2A 4GAOA 1DJZA 4CPVA 1AVSA 4ORBB 1AK8A 2PVBA 2CTNA 2K0JA 1KSMA 3GK1A 1QIVA 3GK2A 3TUYC 1MWNA 3RLZA 2LVJA 1BT6A 2JU0A 1C07A 1TNQA 1FI5A 2BKHB 5GQQC 1QV1A 1M31A 5HKWA 1MR8A 1DGUA 1SY9A 1LVCD 1B7TY 3NSLA 3A8RA 2EGDA 2BL0B 3K21A 3TDZA 1TRFA 4MVFA 1A2XA 1ALVA 2VRGA 4OCIA 2I2RE 2LMVA 1ZMZA 2M3WA 4DIRA 1Y6WA 2JWWA 5TNCA 3JVTB 1S6IA 5KTYA 4QJ5B 2KGBC 1Q80A 4PCWA 3CR5X 2PASA 4GUKA 2ISDA 3VRNA 2KAVA 2Y1MA 1SL8A 1KSOA 1ODBA 1YTZC 1UP5A 2LM5A 4MZJA 1XYDA 2JT8A 2MAZA 1PVAA 2F3YA 1QX7A 3HCMA 2LMTA 2Y5IA 1FW4A 2K7CA 2BECA 1IH0A 2HQ8A 1NYAA 2JT0A 3PATA 1SCVA 4I5JA 1CLBA 1TNPA 1C7WA 1FBVA 1CDMA 2KFHA 3FS7A 3DVJA 2MRDA 5BPJA 1SL9A 1MF8B 1SYMA 3TS5B 2EC6B 3PFVA 2LUXA 1CTRA 3SG4A 1XA5A 4P5OE 2LAPA 2KBIA 5D69A 2AMIA 2CBLA 4GBAA 1S26D 3KHEA 1J55A 3BOWA 1Y1UA 1EJ3A 4CLNA 5HKYA 1K2HA 1YUTA 3A4UB 1UHIA 2KHNA 3CLNA 5AERA 5HLVA 1FPWA 1DGVA 2L0PA 4QJ4B 4ICBA 1GJYA 1DJXA 1UWOA 2L5XB 2KYFA 5CSJA 4YGBB 5I2LA 2NZ0A 3CR4X 1VRKA 4I5NB 5B8IB 1CFDA 4E68A 1QLKA 1K93D 1XFXO 4TNCA 4PHJA 5JJGA 1B47A 1A75B 2NLNA 1XFVO 1IQ3A 3I5GC 4JWQA 2LANA 3PLFB 4MN0A 4N5XA 1BMOA 1KFXL 1SNLA 2G9BA 4XJKB 3OHMB 1QIWA 2KOTA 2MA2A 2OPOA 3JTDB 3M0WA 1A4PA 3SG3A 4BY5A 1J7PA 3AKAA 3NSOA 3CZTX 1XFZO 3TS5C 2L4IA 4AQIA 2M97A 2NCPA 3TZ1A 2MBXA 1DF0B 1MXLC 2TN4A 1NUBA 1DTLA 3CGAA 2E30A 3ICBA 1ZUZA 2FCDA 2L4HA 1UHNA 4YGEB 2WCBA 2WORA 1FI6A 3SG2A 2MJWB 1QTXA 4PALA 4FQOA 1YVLA 1Y1AA 2M8UA 1TIZA 1RK9A 3I5HB 3SIBA 1QJTA 1QS7A 1L2OC 3DF0A 2LHIA 1B8LA 3PSRA 1QX2A 1ZACA 1F4OA 3PN7C 1EG4A 1OMVA 1QV0A 1TN4A 1WRZA 4M2QA 4I5KA 1NP8A 2L51A 1BF5A 3IQQA 3VRPA 1MUXA 2LHLA 3BUNB 1G4YR 1SRAA 1IGVA 5I2QA 1CB1A 1IJ6A 1UURA 3EVVA 3JTDC 2AUCA 2V53A 5HLOA 5AFPA 1DJYA 1ZOTB 3I5FC 4C0KA 3EK7A 1S6JA 2LLUA 2OS8B 2LP3A 3D10A 1W7IB 1KK7Z 4HRHA 1NIWA 1RECA 3AAJA 1CDLA 1SR6B 3DF0B 1CNPA 3O2PA 1ZFSA 2KSPA 1R2UA 2E6WA 3FIAA 2LE9B 4PHNA 4XJKA 2JRFA 1HT9A 1GQMA 2JPTA 3QRXA 4A4BA 1KFUS 2OTGC 1KFXS 1W7JB 3I5IB 1SL7A 4DRWA 1N0YA 2F2OA 4MZKA 2WCFA 1S1EA 1TNXA 1JFJA 1L7ZA 1RROA 1CFFA 4OV2A 2LCPA 1EL4A 2KI6C 4JQ0D 1NX1A 1CFCA 2ZKMX 1B7TZ 3BUWB 1AUIB 1IWQA 1YRTB 4YBHB 1FF1A 4GPLB 5D7FA 1CDPA 1J1DA 3DVEA 2O5GA 4ZCVA 2LUCA 3EVRA 4GGFA 2JC2A 3EK8A 4MSPA 1A75A 1J7RA 1F54A 2I18A 1EH2A 2LVVA 2JNXA 4DCKA 4XYNA 1ALWA 2GGMA 5ER5A 5AXIA 2L2EA 4M2OA 2LVKA 1K9UA 1SPYA 1IRJA 2KAYA 4M2PA 2M9GA 3DD4A 2OTGB 2PALA 1CMFA 2K61A 4PE0A 2KYCA 1GGWA 1NX3A 3GK4X 1MHOA 2KFFA 1XFUO 2K7OA 3JVTC 4NDDA 3EKJA 1IQ5A 4PDZA 5J3XA 1XK4A 1RJVA 3WXAA 1IG5A 1WRKA 1DJGA 1X02A 1XK4C 2EHBA 2GV5A 1UUSA 1CMGA 4YI8A 2OS8C 2FJUB 5FYXA 4MZLA 1S5GZ 1PULA 1OQPA 4D1EA 1U5IB 4YGAA 1BODA 1XFYO 1JC2A 1B1GA 5G08A 4F0ZB 4WQ2A 1J7OA 3KF9A 3I5IC 1A29A 2F3ZA 1TTXA 1XFWO 1PRWA 2R2IA 3BUXB 1QVIZ 4MEWA 4BY4A 3KEVA 2ZRSA 1J1EA 4NQGA 4CFRA 1U5IA 1QVIY 2LLTA 1F8HA 4QJ3B 3MSEB 2BCXA 2IS9A 1M63B 1NCZA 1V1FA 1BR1B 2HETA 1KFUL 1SCMB 5JOLA 1WLZA 1LINA 4MRXA 1TOPA 5DKRA 2SASA 3TDIA 2F8PA 3D0YA 5HYDA 3OB1B 1S3PA 1OZOA 2BE6A 2WOSA 1C7VA 2BBMA 1CLMA 2F2PA 2JNFA 1IJ5A 1YX7A 1K9KA 1K94A 1WDCB 4P2YB 1MXEA 4N1FA 4YGDB 4YGCB 3LK1A 1WRLA 5IBWA 1A03A 1KK8C 2BBNA 2G2BA 2LNKA 5KU1A 1RTP1 2H61C 2M1KB 2P6BB 2WNDA 2ZN8A 1BJFA 3HX4A 2D8NA 1G8IA 1L2OB 1Y1XA 1F70A 1BU3A 3LL8B 3I5HC 4AQJA 1OE9B 3TUYB 1DJIA 1CM4A 1PSBA 2ZNEA 4OVNF 2LVIA 1DT7B 3VROA 2WC8A 3H4SE 1UHJA 1NPQA 1QATA 4GGNA 1S36A 1BR4B 1Y0VH 2CXJA 2BCAA 2LP2A 3F45A 1YRUB 2PSRA 1HQVA 4NDCA 5AANA 4WQ3A 1LA0A 2KI4C 1CKKA 1NCXA 5CSIA 2KBMA 1S6CA 1K96A 1CLLA 2H61A 2JTZA 3I5FB 2M49B 1WLMA 1K90D 1E8AA 1GGZA 1NWDA 4Q04A 2RGIA 1KCYA 4CIDA 1RWYA 4I5LB 1CFPA 4HSZA 5K89A 1V1GA 4CFQA 1TNWA 5PALA 1UHHA 3PN7B 1DJWA 3WHTB 3AKBA 3ZNIA 1F55A 1MQ1A 1B4CA 3BUOB 1TCOB 2QACA 3NSIA 5CSFA 2KAXA 3D0YB 1AJ5A 2Y4QA 1PSRA 2JOJA 4MLWA 1DJHA 1KK7Y 2A4JA 3KPXA 3RM1A 2K7DA 5CPVA 1BOCA 2JT3A 4PE1A 1JF0A 1DVIA 1YURA 2CT9A 2K2AA 4DUQA 1QXPA 2JTTA 2SCPA 1OMRA 1OOJA 4JPZB 5HKZA 4A4CA 3BXKA 3EVUA 1JWDA 3BQ3A 3CR2A 2BKIB 1YUSA 1SBJA 4ORAB 1G33A 4USLA 1F4QA 4L9MA 2KI4B 3IQOA 1OZSA 4PHMA 1AJ4A 4IL1A 2KFGA 2BCBA 5CSNA 1YX8A 1PALA 2MLFC 2B1UA 2LC5A 1H4BA 3O6BA 1B8RA 4PE7A 1WDCC 3CS1A 2F33A 1LA3A 1J7QA 2M0RA 3NXAA 2LMUA 3OB2B 3BYAA 1CDNA 2COLB 1F71A 2ZRTA 3DVMA 1SW8A 1PK0D 2JZIA 1PVBA 1YR5A 1JF2A 2I7AA 2Q4UA 1KWOC 1KQMB 2KQYA 3LK0A 4MRYA 4UPGA 4PHKA 2JULA 2NCOA 2M29A 2MHHA 1M46A 1RFJA 4N1GA 5ER4X 1OMDA 1NSHA 1JUOA 1D1OA 2MLEC 3SG7A 4ETOA 3I5GB 4OKHA 2AAOA 4YI9A 2JQ6A 2WCEA 1JSAA 1CM1A 2PMYA 2JXLA 3NSKA 3CWGA 2M7NA 3EKHA 3ZWHA 4C0JA 2FOTA 3BUMB 2K8MB 3BOWB 2PRUA 3LCPC 2L98A 1S5GY 1B8CA 2M1UA 3IF7A 4OR9B 1UHKA 4FTGA 5DKQA 1IKUA 1H8BA 1DMOA 3SIAA 3GOFA 4MBEA 4ORCB 1XVJA 2LV7A 3FWCA 3OX6A 1QX5B 2FCEA 1AP4A 3PALA 1B9AA 2GGZA 3OX5A 3E3RA 1JFKA 1K9PA 4GNKB 1N65A 1JBAA 2ZN9A 3DVKA 2H2KA 4ZCUA 1AHRA 1R6PA 3EK4A 2HPSA 2I94A 2O60A 3VRRA 3FWBA 2K2FA 2HQWA 2JXCA 3SJSA 1EG3A 1KWOB
chains in the Genus database with same CATH superfamily
1QASA 3RZSA 1Z2CB 3CZ1A 3NHTA 1OSAA 1KQMC 2KNEA 4R1EA 1SR6C 4YRUA 3SG5A 4WRIA 2P71A 3CABA 4INWA 1YVHA 4PE4A 1EXRA 3V2LA 3NGVA 4AOMA 2K60A 1M39A 2LLSA 2Y1NA 2ZNDA 3DY9A 2ZFDA 5DKNA 1SKTA 2BL0C 2ERBA 1SSEB 2Q91A 4HREE 3DXLA 1KQVA 1K95A 1N2DA 3VRQA 4DS7A 1LXFC 5I2OA 5FI6A 4HRGA 5I8NA 1LKJA 1SCMC 1OOFA 2CNPA 1C3YA 3SG6A 1YUUA 2KI6D 3AAKA 2KGRA 3VGOA 3WHUB 5HL1A 1M45A 1TCFA 3OP0A 1SMGA 2K7BA 2QPTA 4GFTA 1BG1A 2WCHA 3C1VA 1BLQA 2KDHA 2BE4A 2NXQA 4IJ7A 1DF0A 2KQ6A 5KSZA 3O4YA 1QLSA 2CCMA 3B88A 2EC6C 3KO0A 4GGFC 4U8DA 2HF5A 3LLEA 5AEQA 3CTNA 2M7LA 1WY9A 3TDUA 3PM8A 3WNXB 3O78A 2DOQA 1XO5A 1KK8B 1SK6D 4NDBA 1K8UA 1NX0A 1NCYA 5F6TA 2L50A 4C0LA 1NX2A 4GAOA 1DJZA 4CPVA 1AVSA 4ORBB 3VB1A 1AK8A 2PVBA 3SS5A 2CTNA 2K0JA 1KSMA 3GK1A 1OW4A 1QIVA 2P70A 3GK2A 3TUYC 1MWNA 3RLZA 2LVJA 1BT6A 2JU0A 1C07A 1TNQA 1FI5A 2BKHB 3K1EA 5GQQC 1QV1A 1M31A 5HKWA 1MR8A 1DGUA 1SY9A 1LVCD 1B7TY 3NSLA 3A8RA 2EGDA 2BL0B 1DQEA 3K21A 3TDZA 1TRFA 4MVFA 1A2XA 1ALVA 2VRGA 3O4XA 4OCIA 2I2RE 2LMVA 1ZMZA 2M3WA 4DIRA 1Y6WA 2JWWA 2WC6A 5TNCA 3JVTB 2PQLA 1S6IA 5KTYA 4QJ5B 2KGBC 1DEKA 1Q80A 3FE8A 4PCWA 3CR5X 2PASA 4GUKA 2WCKA 5FI7A 2ISDA 3VRNA 3D77A 2KAVA 3QMEA 2Y1MA 1SL8A 3SS4A 1KSOA 1ODBA 1YTZC 1UP5A 2LM5A 4MZJA 1XYDA 2JT8A 2MAZA 1PVAA 1P28A 2F3YA 1QX7A 3HCMA 2LMTA 2Y5IA 1FW4A 2K7CA 2BECA 1IH0A 2HQ8A 1NYAA 2JT0A 3PATA 1SCVA 4I5JA 1CLBA 1TNPA 1C7WA 1FBVA 1CDMA 3D78A 2KFHA 3FS7A 3DVJA 4INXA 2MRDA 2L2CA 5BPJA 1SL9A 1QWVA 1MF8B 1SYMA 3TS5B 2EC6B 3PFVA 2LUXA 1CTRA 3SG4A 1XA5A 4P5OE 2LAPA 2KBIA 5D69A 2AMIA 2CBLA 4GBAA 1S26D 3KHEA 1J55A 3BOWA 1Y1UA 1EJ3A 4CLNA 5HKYA 1K2HA 1YUTA 3A4UB 1UHIA 2KHNA 3CLNA 5AERA 5HLVA 1FPWA 1DGVA 2L0PA 4QJ4B 4ICBA 1GJYA 1DJXA 1UWOA 2L5XB 2KYFA 5CSJA 4YGBB 5I2LA 2NZ0A 3CR4X 1VRKA 4I5NB 5B8IB 1CFDA 4E68A 1QLKA 1K93D 1XFXO 4TNCA 4PHJA 5JJGA 1B47A 1A75B 2NLNA 1XFVO 1IQ3A 3I5GC 4JWQA 2LANA 3PLFB 4MN0A 4N5XA 1BMOA 1KFXL 1SNLA 2G9BA 3CZ0A 3OHMB 4XJKB 1QIWA 2KOTA 2MA2A 2OPOA 3JTDB 3M0WA 1A4PA 2KPHA 3SG3A 4BY5A 1J7PA 3AKAA 3NSOA 3CZTX 1XFZO 3TS5C 2L4IA 4AQIA 2M97A 2NCPA 3TZ1A 2MBXA 1DF0B 1MXLC 2TN4A 1NUBA 1DTLA 5FI2A 3CGAA 2E30A 2WC5A 3ICBA 1ZUZA 2FCDA 2L4HA 1UHNA 4YGEB 2WCBA 2WORA 1FI6A 3SG2A 2MJWB 1QTXA 4PALA 3R1VA 4FQOA 1YVLA 1Y1AA 2M8UA 1TIZA 1RK9A 3I5HB 3SIBA 1QJTA 1QS7A 1L2OC 3DF0A 2LHIA 1B8LA 3PSRA 1TWOA 3CDNA 1QX2A 1ZACA 1F4OA 3PN7C 3UNWA 1EG4A 1OMVA 1QV0A 1TN4A 1WRZA 4M2QA 4I5KA 1NP8A 1T14A 2L51A 1BF5A 3IQQA 3DZTA 3VRPA 1MUXA 2LHLA 3BUNB 1G4YR 1SRAA 1IGVA 5I2QA 4OZDA 1IJ6A 1UURA 3EVVA 1CB1A 1OOIX 3JTDC 2AUCA 2V53A 5HLOA 5AFPA 1DJYA 1ZOTB 3I5FC 3S0EA 4C0KA 3EK7A 1S6JA 2LLUA 2OS8B 3R1PA 2LP3A 3D10A 1W7IB 1KK7Z 4HRHA 1NIWA 1RECA 1TUZA 3AAJA 1CDLA 1SR6B 2GTEA 3DF0B 1CNPA 3O2PA 3PM2A 1ZFSA 2KSPA 3SS3A 1R2UA 1IIOA 2E6WA 3FIAA 2LE9B 4PHNA 4XJKA 2JRFA 1HT9A 1GQMA 2JPTA 3QRXA 4A4BA 1KFUS 2OTGC 1KFXS 1W7JB 1ORGA 2FJYA 3I5IB 1SL7A 3BFAA 4DRWA 1N0YA 2F2OA 4MZKA 2WCFA 1S1EA 1TNXA 1JFJA 1L7ZA 4JKTA 1RROA 1CFFA 3D73A 4OV2A 2LCPA 1EL4A 2KI6C 4JQ0D 1NX1A 3BFHA 1CFCA 2ZKMX 1B7TZ 3BUWB 3IVTA 1AUIB 1IWQA 1YRTB 4YBHB 1FF1A 2WCJA 4GPLB 5D7FA 1CDPA 1J1DA 3DVEA 2O5GA 4ZCVA 2LUCA 3EVRA 4GGFA 2JC2A 3EK8A 4MSPA 1A75A 1J7RA 3FE9A 1F54A 2I18A 1EH2A 2LVVA 2JNXA 4DCKA 4XYNA 1ALWA 4PT1A 2GGMA 5ER5A 5AXIA 2L2EA 4M2OA 2LVKA 1K9UA 1SPYA 1IRJA 2KAYA 3B87A 3Q8IA 4M2PA 2M9GA 3DD4A 2OTGB 2PALA 1CMFA 2K61A 4PE0A 2KYCA 1GGWA 1NX3A 3GK4X 1MHOA 2KFFA 1XFUO 2K7OA 3JVTC 4NDDA 3EKJA 4FQTA 2QEBA 1IQ5A 4PDZA 5J3XA 1XK4A 1RJVA 3WXAA 1IG5A 1WRKA 1DJGA 1X02A 1XK4C 2EHBA 2GV5A 1UUSA 1CMGA 4YI8A 2OS8C 2H8VA 2FJUB 5FYXA 4MZLA 3DYEA 3N7HA 1S5GZ 1PULA 1OQPA 3OBVA 4D1EA 1U5IB 4YGAA 1BODA 1XFYO 1JC2A 1B1GA 5G08A 4F0ZB 4WQ2A 1J7OA 3KF9A 1DELA 3I5IC 1A29A 2F3ZA 1TTXA 1XFWO 1PRWA 1XFRA 2R2IA 1QVIZ 3BUXB 4MEWA 4BY4A 3KEVA 2ZRSA 1J1EA 4NQGA 4CFRA 1U5IA 1QVIY 2LLTA 3D76A 1F8HA 4QJ3B 3B6XA 3S0DA 3MSEB 2BCXA 2IS9A 1M63B 1NCZA 1V1FA 1BR1B 3NHIA 5D3OA 2HETA 1KFUL 3D74A 1SCMB 5JOLA 1WLZA 1LINA 4MRXA 3BJHA 1TOPA 5DKRA 2SASA 3TDIA 2F8PA 3D0YA 5HYDA 3OB1B 1S3PA 1OZOA 2BE6A 2WOSA 1C7VA 2BBMA 1CLMA 2F2PA 2JNFA 1IJ5A 1YX7A 1K9KA 1K94A 1WDCB 3D75A 4P2YB 1MXEA 4N1FA 4YGDB 3S0BA 4YGCB 3LK1A 1WRLA 5IBWA 1A03A 3CZ2A 1KK8C 2BBNA 2BNXA 2G2BA 2LNKA 5KU1A 1TUJA 1RTP1 2H61C 2M1KB 2P6BB 2WNDA 2ZN8A 1BJFA 3EG5B 5DICA 3R72A 3HX4A 2D8NA 1G8IA 1L2OB 1Y1XA 2QEVA 1BU3A 3LL8B 1F70A 3I5HC 4AQJA 1OE9B 3L4LA 3TUYB 1DJIA 1CM4A 1PSBA 2WCLA 2ZNEA 4F7FA 4OVNF 2LVIA 1DT7B 3VROA 2WC8A 3H4SE 1UHJA 1NPQA 1QATA 2BAPA 2JPOA 4GGNA 1S36A 1BR4B 1Y0VH 2CXJA 2BCAA 2LP2A 3F45A 1YRUB 2PSRA 1HQVA 4NDCA 5AANA 4WQ3A 1LA0A 2KI4C 1CKKA 1NCXA 5CSIA 2KBMA 1S6CA 2WCMA 1K96A 1CLLA 2H61A 2JTZA 3I5FB 2M49B 1WLMA 1K90D 1E8AA 1GGZA 1NWDA 4Q04A 1OOGA 2RGIA 1KCYA 4CIDA 1RWYA 4I5LB 1CFPA 4HSZA 5K89A 1V1GA 4CFQA 1TNWA 1GM0A 5PALA 1UHHA 3PN7B 1DJWA 3WHTB 3AKBA 3ZNIA 1F55A 1MQ1A 1B4CA 3BUOB 1TCOB 2QACA 3NSIA 5CSFA 2KAXA 3D0YB 1AJ5A 2Y4QA 1PSRA 2JOJA 4MLWA 1DJHA 1KK7Y 2A4JA 3KPXA 3RM1A 2K7DA 5CPVA 1BOCA 2JT3A 4PE1A 2KLDA 3UO9A 1JF0A 1DVIA 1YURA 2CT9A 2K2AA 4DUQA 2L5YA 1QXPA 3L4AA 2JTTA 1OOHA 2SCPA 1OMRA 1OOJA 4JPZB 5HKZA 4A4CA 3BXKA 3EVUA 1JWDA 3BQ3A 3CR2A 2BKIB 4JD9A 1YUSA 1LS8A 1SBJA 4ORAB 1G33A 4USLA 1F4QA 4L9MA 3OGNA 2KI4B 3IQOA 1OZSA 2PYQA 1AJ4A 3B7AA 4IL1A 4PHMA 2KFGA 2BCBA 5CSNA 1YX8A 1PALA 3B86A 2MLFC 2B1UA 2LC5A 1H4BA 3O6BA 1B8RA 4PE7A 1WDCC 3CS1A 3FE6A 2F33A 1LA3A 1J7QA 2M0RA 3NXAA 2LMUA 3OB2B 3BYAA 3S0FA 1CDNA 2COLB 1F71A 2YGUA 2ZRTA 2QDIA 3DVMA 1SW8A 1PK0D 2JZIA 1PVBA 1YR5A 1JF2A 2I7AA 2Q4UA 1KWOC 1KQMB 2KQYA 3LK0A 4MRYA 4UPGA 4PHKA 2JULA 2NCOA 2M29A 2MHHA 1DC1A 1M46A 1RFJA 4N1GA 5ER4X 1OMDA 1W9ZA 5EL2A 1NSHA 1JUOA 3S0GA 2QEOA 1C3ZA 1D1OA 2MLEC 3SG7A 4ETOA 3I5GB 4OKHA 2AAOA 4YI9A 2JQ6A 3R1OA 4KYNA 2WCEA 2KLEA 1JSAA 1CM1A 2PMYA 2JXLA 3NSKA 3CWGA 2M7NA 5I94A 3EKHA 3ZWHA 4C0JA 2FOTA 3BUMB 2K8MB 3BOWB 2PRUA 3LCPC 2L98A 1S5GY 1B8CA 2M1UA 3IF7A 4OR9B 1UHKA 4FTGA 5DKQA 1IKUA 1H8BA 1DMOA 3SIAA 3GOFA 3L47A 3BFBA 3PJIA 4MBEA 4ORCB 1XVJA 2LV7A 3FWCA 3OX6A 1QX5B 2FCEA 1AP4A 3PALA 1B9AA 2GGZA 2QEHA 3OX5A 3E3RA 1JFKA 1K9PA 4GNKB 1N65A 1JBAA 2ZN9A 3DVKA 2H2KA 3S0AA 4ZCUA 1AHRA 1R6PA 3CYZA 2HPSA 3EK4A 2I94A 2O60A 3VRRA 1Z4HA 3FWBA 2K2FA 2HQWA 2JXCA 3SJSA 1EG3A 1KWOB
chains in the Genus database with same CATH topology
1QASA 1OSAA 1KQMC 2KNEA 4R1EA 1SR6C 4YRUA 3SG5A 4WRIA 4PE4A 1YVHA 4AOMA 1EXRA 1M39A 2LLSA 2Y1NA 2ZNDA 2ZFDA 5DKNA 1SKTA 2BL0C 2Q91A 4HREE 1KQVA 1K95A 1N2DA 3VRQA 4DS7A 1LXFC 5I2OA 4HRGA 5I8NA 1LKJA 1SCMC 2CNPA 3SG6A 1YUUA 2KI6D 3AAKA 2KGRA 3VGOA 3WHUB 1M45A 1TCFA 3OP0A 1SMGA 2K7BA 2QPTA 4GFTA 1BG1A 3C1VA 1BLQA 2KDHA 2BE4A 2NXQA 1DF0A 2KQ6A 5KSZA 3O4YA 1QLSA 2CCMA 2EC6C 3KO0A 4GGFC 4U8DA 2HF5A 3LLEA 5AEQA 3CTNA 2M7LA 1WY9A 3TDUA 3PM8A 3WNXB 3O78A 2DOQA 1XO5A 1KK8B 1SK6D 4NDBA 1K8UA 1NX0A 1NCYA 5F6TA 2L50A 4C0LA 1NX2A 4GAOA 1DJZA 4CPVA 1AVSA 4ORBB 1AK8A 2PVBA 2CTNA 2K0JA 1KSMA 3GK1A 1QIVA 3GK2A 3TUYC 1MWNA 3RLZA 2LVJA 1BT6A 2JU0A 1C07A 1TNQA 1FI5A 2BKHB 5GQQC 1QV1A 1M31A 5HKWA 1MR8A 1DGUA 1SY9A 1LVCD 1B7TY 3NSLA 3A8RA 2EGDA 2BL0B 3K21A 3TDZA 1TRFA 4MVFA 1A2XA 1ALVA 2VRGA 4OCIA 2I2RE 2LMVA 1ZMZA 2M3WA 4DIRA 1Y6WA 2JWWA 5TNCA 3JVTB 1S6IA 5KTYA 4QJ5B 2KGBC 1Q80A 4PCWA 3CR5X 2PASA 4GUKA 2ISDA 3VRNA 2KAVA 2Y1MA 1SL8A 1KSOA 1ODBA 1YTZC 1UP5A 2LM5A 4MZJA 1XYDA 2JT8A 2MAZA 1PVAA 2F3YA 1QX7A 3HCMA 2LMTA 2Y5IA 1FW4A 2K7CA 2BECA 1IH0A 2HQ8A 1NYAA 2JT0A 3PATA 1SCVA 4I5JA 1CLBA 1TNPA 1C7WA 1FBVA 1CDMA 2KFHA 3FS7A 3DVJA 2MRDA 5BPJA 1SL9A 1MF8B 1SYMA 3TS5B 2EC6B 3PFVA 2LUXA 1CTRA 3SG4A 1XA5A 4P5OE 2LAPA 2KBIA 5D69A 2AMIA 2CBLA 4GBAA 1S26D 3KHEA 1J55A 3BOWA 1Y1UA 1EJ3A 4CLNA 5HKYA 1K2HA 1YUTA 3A4UB 1UHIA 2KHNA 3CLNA 5AERA 5HLVA 1FPWA 1DGVA 2L0PA 4QJ4B 4ICBA 1GJYA 1DJXA 1UWOA 2L5XB 2KYFA 5CSJA 4YGBB 5I2LA 2NZ0A 3CR4X 1VRKA 4I5NB 5B8IB 1CFDA 4E68A 1QLKA 1K93D 1XFXO 4TNCA 4PHJA 5JJGA 1B47A 1A75B 2NLNA 1XFVO 1IQ3A 3I5GC 4JWQA 2LANA 3PLFB 4MN0A 4N5XA 1BMOA 1KFXL 1SNLA 2G9BA 4XJKB 3OHMB 1QIWA 2KOTA 2MA2A 2OPOA 3JTDB 3M0WA 1A4PA 3SG3A 4BY5A 1J7PA 3AKAA 3NSOA 3CZTX 1XFZO 3TS5C 2L4IA 4AQIA 2M97A 2NCPA 3TZ1A 2MBXA 1DF0B 1MXLC 2TN4A 1NUBA 1DTLA 3CGAA 2E30A 3ICBA 1ZUZA 2FCDA 2L4HA 1UHNA 4YGEB 2WCBA 2WORA 1FI6A 3SG2A 2MJWB 1QTXA 4PALA 4FQOA 1YVLA 1Y1AA 2M8UA 1TIZA 1RK9A 3I5HB 3SIBA 1QJTA 1QS7A 1L2OC 3DF0A 2LHIA 1B8LA 3PSRA 1QX2A 1ZACA 1F4OA 3PN7C 1EG4A 1OMVA 1QV0A 1TN4A 1WRZA 4M2QA 4I5KA 1NP8A 2L51A 1BF5A 3IQQA 3VRPA 1MUXA 2LHLA 3BUNB 1G4YR 1SRAA 1IGVA 5I2QA 1CB1A 1IJ6A 1UURA 3EVVA 3JTDC 2AUCA 2V53A 5HLOA 5AFPA 1DJYA 1ZOTB 3I5FC 4C0KA 3EK7A 1S6JA 2LLUA 2OS8B 2LP3A 3D10A 1W7IB 1KK7Z 4HRHA 1NIWA 1RECA 3AAJA 1CDLA 1SR6B 3DF0B 1CNPA 3O2PA 1ZFSA 2KSPA 1R2UA 2E6WA 3FIAA 2LE9B 4PHNA 4XJKA 2JRFA 1HT9A 1GQMA 2JPTA 3QRXA 4A4BA 1KFUS 2OTGC 1KFXS 1W7JB 3I5IB 1SL7A 4DRWA 1N0YA 2F2OA 4MZKA 2WCFA 1S1EA 1TNXA 1JFJA 1L7ZA 1RROA 1CFFA 4OV2A 2LCPA 1EL4A 2KI6C 4JQ0D 1NX1A 1CFCA 2ZKMX 1B7TZ 3BUWB 1AUIB 1IWQA 1YRTB 4YBHB 1FF1A 4GPLB 5D7FA 1CDPA 1J1DA 3DVEA 2O5GA 4ZCVA 2LUCA 3EVRA 4GGFA 2JC2A 3EK8A 4MSPA 1A75A 1J7RA 1F54A 2I18A 1EH2A 2LVVA 2JNXA 4DCKA 4XYNA 1ALWA 2GGMA 5ER5A 5AXIA 2L2EA 4M2OA 2LVKA 1K9UA 1SPYA 1IRJA 2KAYA 4M2PA 2M9GA 3DD4A 2OTGB 2PALA 1CMFA 2K61A 4PE0A 2KYCA 1GGWA 1NX3A 3GK4X 1MHOA 2KFFA 1XFUO 2K7OA 3JVTC 4NDDA 3EKJA 1IQ5A 4PDZA 5J3XA 1XK4A 1RJVA 3WXAA 1IG5A 1WRKA 1DJGA 1X02A 1XK4C 2EHBA 2GV5A 1UUSA 1CMGA 4YI8A 2OS8C 2FJUB 5FYXA 4MZLA 1S5GZ 1PULA 1OQPA 4D1EA 1U5IB 4YGAA 1BODA 1XFYO 1JC2A 1B1GA 5G08A 4F0ZB 4WQ2A 1J7OA 3KF9A 3I5IC 1A29A 2F3ZA 1TTXA 1XFWO 1PRWA 2R2IA 3BUXB 1QVIZ 4MEWA 4BY4A 3KEVA 2ZRSA 1J1EA 4NQGA 4CFRA 1U5IA 1QVIY 2LLTA 1F8HA 4QJ3B 3MSEB 2BCXA 2IS9A 1M63B 1NCZA 1V1FA 1BR1B 2HETA 1KFUL 1SCMB 5JOLA 1WLZA 1LINA 4MRXA 1TOPA 5DKRA 2SASA 3TDIA 2F8PA 3D0YA 5HYDA 3OB1B 1S3PA 1OZOA 2BE6A 2WOSA 1C7VA 2BBMA 1CLMA 2F2PA 2JNFA 1IJ5A 1YX7A 1K9KA 1K94A 1WDCB 4P2YB 1MXEA 4N1FA 4YGDB 4YGCB 3LK1A 1WRLA 5IBWA 1A03A 1KK8C 2BBNA 2G2BA 2LNKA 5KU1A 1RTP1 2H61C 2M1KB 2P6BB 2WNDA 2ZN8A 1BJFA 3HX4A 2D8NA 1G8IA 1L2OB 1Y1XA 1F70A 1BU3A 3LL8B 3I5HC 4AQJA 1OE9B 3TUYB 1DJIA 1CM4A 1PSBA 2ZNEA 4OVNF 2LVIA 1DT7B 3VROA 2WC8A 3H4SE 1UHJA 1NPQA 1QATA 4GGNA 1S36A 1BR4B 1Y0VH 2CXJA 2BCAA 2LP2A 3F45A 1YRUB 2PSRA 1HQVA 4NDCA 5AANA 4WQ3A 1LA0A 2KI4C 1CKKA 1NCXA 5CSIA 2KBMA 1S6CA 1K96A 1CLLA 2H61A 2JTZA 3I5FB 2M49B 1WLMA 1K90D 1E8AA 1GGZA 1NWDA 4Q04A 2RGIA 1KCYA 4CIDA 1RWYA 4I5LB 1CFPA 4HSZA 5K89A 1V1GA 4CFQA 1TNWA 5PALA 1UHHA 3PN7B 1DJWA 3WHTB 3AKBA 3ZNIA 1F55A 1MQ1A 1B4CA 3BUOB 1TCOB 2QACA 3NSIA 5CSFA 2KAXA 3D0YB 1AJ5A 2Y4QA 1PSRA 2JOJA 4MLWA 1DJHA 1KK7Y 2A4JA 3KPXA 3RM1A 2K7DA 5CPVA 1BOCA 2JT3A 4PE1A 1JF0A 1DVIA 1YURA 2CT9A 2K2AA 4DUQA 1QXPA 2JTTA 2SCPA 1OMRA 1OOJA 4JPZB 5HKZA 4A4CA 3BXKA 3EVUA 1JWDA 3BQ3A 3CR2A 2BKIB 1YUSA 1SBJA 4ORAB 1G33A 4USLA 1F4QA 4L9MA 2KI4B 3IQOA 1OZSA 4PHMA 1AJ4A 4IL1A 2KFGA 2BCBA 5CSNA 1YX8A 1PALA 2MLFC 2B1UA 2LC5A 1H4BA 3O6BA 1B8RA 4PE7A 1WDCC 3CS1A 2F33A 1LA3A 1J7QA 2M0RA 3NXAA 2LMUA 3OB2B 3BYAA 1CDNA 2COLB 1F71A 2ZRTA 3DVMA 1SW8A 1PK0D 2JZIA 1PVBA 1YR5A 1JF2A 2I7AA 2Q4UA 1KWOC 1KQMB 2KQYA 3LK0A 4MRYA 4UPGA 4PHKA 2JULA 2NCOA 2M29A 2MHHA 1M46A 1RFJA 4N1GA 5ER4X 1OMDA 1NSHA 1JUOA 1D1OA 2MLEC 3SG7A 4ETOA 3I5GB 4OKHA 2AAOA 4YI9A 2JQ6A 2WCEA 1JSAA 1CM1A 2PMYA 2JXLA 3NSKA 3CWGA 2M7NA 3EKHA 3ZWHA 4C0JA 2FOTA 3BUMB 2K8MB 3BOWB 2PRUA 3LCPC 2L98A 1S5GY 1B8CA 2M1UA 3IF7A 4OR9B 1UHKA 4FTGA 5DKQA 1IKUA 1H8BA 1DMOA 3SIAA 3GOFA 4MBEA 4ORCB 1XVJA 2LV7A 3FWCA 3OX6A 1QX5B 2FCEA 1AP4A 3PALA 1B9AA 2GGZA 3OX5A 3E3RA 1JFKA 1K9PA 4GNKB 1N65A 1JBAA 2ZN9A 3DVKA 2H2KA 4ZCUA 1AHRA 1R6PA 3EK4A 2HPSA 2I94A 2O60A 3VRRA 3FWBA 2K2FA 2HQWA 2JXCA 3SJSA 1EG3A 1KWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAS A;  1OSA A;  1KQM C;  2KNE A;  4R1E A;  1SR6 C;  4YRU A;  3SG5 A;  4WRI A;  4PE4 A;  1YVH A;  4AOM A;  1EXR A;  1M39 A;  2LLS A;  2Y1N A;  2ZND A;  2ZFD A;  5DKN A;  1SKT A;  2BL0 C;  2Q91 A;  4HRE E;  1KQV A;  1K95 A;  1N2D A;  3VRQ A;  4DS7 A;  1LXF C;  5I2O A;  4HRG A;  5I8N A;  1LKJ A;  1SCM C;  2CNP A;  3SG6 A;  1YUU A;  2KI6 D;  3AAK A;  2KGR A;  3VGO A;  3WHU B;  1M45 A;  1TCF A;  3OP0 A;  1SMG A;  2K7B A;  2QPT A;  4GFT A;  1BG1 A;  3C1V A;  1BLQ A;  2KDH A;  2BE4 A;  2NXQ A;  1DF0 A;  2KQ6 A;  5KSZ A;  3O4Y A;  1QLS A;  2CCM A;  2EC6 C;  3KO0 A;  4GGF C;  4U8D A;  2HF5 A;  3LLE A;  5AEQ A;  3CTN A;  2M7L A;  1WY9 A;  3TDU A;  3PM8 A;  3WNX B;  3O78 A;  2DOQ A;  1XO5 A;  1KK8 B;  1SK6 D;  4NDB A;  1K8U A;  1NX0 A;  1NCY A;  5F6T A;  2L50 A;  4C0L A;  1NX2 A;  4GAO A;  1DJZ A;  4CPV A;  1AVS A;  4ORB B;  1AK8 A;  2PVB A;  2CTN A;  2K0J A;  1KSM A;  3GK1 A;  1QIV A;  3GK2 A;  3TUY C;  1MWN A;  3RLZ A;  2LVJ A;  1BT6 A;  2JU0 A;  1C07 A;  1TNQ A;  1FI5 A;  2BKH B;  5GQQ C;  1QV1 A;  1M31 A;  5HKW A;  1MR8 A;  1DGU A;  1SY9 A;  1LVC D;  1B7T Y;  3NSL A;  3A8R A;  2EGD A;  2BL0 B;  3K21 A;  3TDZ A;  1TRF A;  4MVF A;  1A2X A;  1ALV A;  2VRG A;  4OCI A;  2I2R E;  2LMV A;  1ZMZ A;  2M3W A;  4DIR A;  1Y6W A;  2JWW A;  5TNC A;  3JVT B;  1S6I A;  5KTY A;  4QJ5 B;  2KGB C;  1Q80 A;  4PCW A;  3CR5 X;  2PAS A;  4GUK A;  2ISD A;  3VRN A;  2KAV A;  2Y1M A;  1SL8 A;  1KSO A;  1ODB A;  1YTZ C;  1UP5 A;  2LM5 A;  4MZJ A;  1XYD A;  2JT8 A;  2MAZ A;  1PVA A;  2F3Y A;  1QX7 A;  3HCM A;  2LMT A;  2Y5I A;  1FW4 A;  2K7C A;  2BEC A;  1IH0 A;  2HQ8 A;  1NYA A;  2JT0 A;  3PAT A;  1SCV A;  4I5J A;  1CLB A;  1TNP A;  1C7W A;  1FBV A;  1CDM A;  2KFH A;  3FS7 A;  3DVJ A;  2MRD A;  5BPJ A;  1SL9 A;  1MF8 B;  1SYM A;  3TS5 B;  2EC6 B;  3PFV A;  2LUX A;  1CTR A;  3SG4 A;  1XA5 A;  4P5O E;  2LAP A;  2KBI A;  5D69 A;  2AMI A;  2CBL A;  4GBA A;  1S26 D;  3KHE A;  1J55 A;  3BOW A;  1Y1U A;  1EJ3 A;  4CLN A;  5HKY A;  1K2H A;  1YUT A;  3A4U B;  1UHI A;  2KHN A;  3CLN A;  5AER A;  5HLV A;  1FPW A;  1DGV A;  2L0P A;  4QJ4 B;  4ICB A;  1GJY A;  1DJX A;  1UWO A;  2L5X B;  2KYF A;  5CSJ A;  4YGB B;  5I2L A;  2NZ0 A;  3CR4 X;  1VRK A;  4I5N B;  5B8I B;  1CFD A;  4E68 A;  1QLK A;  1K93 D;  1XFX O;  4TNC A;  4PHJ A;  5JJG A;  1B47 A;  1A75 B;  2NLN A;  1XFV O;  1IQ3 A;  3I5G C;  4JWQ A;  2LAN A;  3PLF B;  4MN0 A;  4N5X A;  1BMO A;  1KFX L;  1SNL A;  2G9B A;  4XJK B;  3OHM B;  1QIW A;  2KOT A;  2MA2 A;  2OPO A;  3JTD B;  3M0W A;  1A4P A;  3SG3 A;  4BY5 A;  1J7P A;  3AKA A;  3NSO A;  3CZT X;  1XFZ O;  3TS5 C;  2L4I A;  4AQI A;  2M97 A;  2NCP A;  3TZ1 A;  2MBX A;  1DF0 B;  1MXL C;  2TN4 A;  1NUB A;  1DTL A;  3CGA A;  2E30 A;  3ICB A;  1ZUZ A;  2FCD A;  2L4H A;  1UHN A;  4YGE B;  2WCB A;  2WOR A;  1FI6 A;  3SG2 A;  2MJW B;  1QTX A;  4PAL A;  4FQO A;  1YVL A;  1Y1A A;  2M8U A;  1TIZ A;  1RK9 A;  3I5H B;  3SIB A;  1QJT A;  1QS7 A;  1L2O C;  3DF0 A;  2LHI A;  1B8L A;  3PSR A;  1QX2 A;  1ZAC A;  1F4O A;  3PN7 C;  1EG4 A;  1OMV A;  1QV0 A;  1TN4 A;  1WRZ A;  4M2Q A;  4I5K A;  1NP8 A;  2L51 A;  1BF5 A;  3IQQ A;  3VRP A;  1MUX A;  2LHL A;  3BUN B;  1G4Y R;  1SRA A;  1IGV A;  5I2Q A;  1CB1 A;  1IJ6 A;  1UUR A;  3EVV A;  3JTD C;  2AUC A;  2V53 A;  5HLO A;  5AFP A;  1DJY A;  1ZOT B;  3I5F C;  4C0K A;  3EK7 A;  1S6J A;  2LLU A;  2OS8 B;  2LP3 A;  3D10 A;  1W7I B;  1KK7 Z;  4HRH A;  1NIW A;  1REC A;  3AAJ A;  1CDL A;  1SR6 B;  3DF0 B;  1CNP A;  3O2P A;  1ZFS A;  2KSP A;  1R2U A;  2E6W A;  3FIA A;  2LE9 B;  4PHN A;  4XJK A;  2JRF A;  1HT9 A;  1GQM A;  2JPT A;  3QRX A;  4A4B A;  1KFU S;  2OTG C;  1KFX S;  1W7J B;  3I5I B;  1SL7 A;  4DRW A;  1N0Y A;  2F2O A;  4MZK A;  2WCF A;  1S1E A;  1TNX A;  1JFJ A;  1L7Z A;  1RRO A;  1CFF A;  4OV2 A;  2LCP A;  1EL4 A;  2KI6 C;  4JQ0 D;  1NX1 A;  1CFC A;  2ZKM X;  1B7T Z;  3BUW B;  1AUI B;  1IWQ A;  1YRT B;  4YBH B;  1FF1 A;  4GPL B;  5D7F A;  1CDP A;  1J1D A;  3DVE A;  2O5G A;  4ZCV A;  2LUC A;  3EVR A;  4GGF A;  2JC2 A;  3EK8 A;  4MSP A;  1A75 A;  1J7R A;  1F54 A;  2I18 A;  1EH2 A;  2LVV A;  2JNX A;  4DCK A;  4XYN A;  1ALW A;  2GGM A;  5ER5 A;  5AXI A;  2L2E A;  4M2O A;  2LVK A;  1K9U A;  1SPY A;  1IRJ A;  2KAY A;  4M2P A;  2M9G A;  3DD4 A;  2OTG B;  2PAL A;  1CMF A;  2K61 A;  4PE0 A;  2KYC A;  1GGW A;  1NX3 A;  3GK4 X;  1MHO A;  2KFF A;  1XFU O;  2K7O A;  3JVT C;  4NDD A;  3EKJ A;  1IQ5 A;  4PDZ A;  5J3X A;  1XK4 A;  1RJV A;  3WXA A;  1IG5 A;  1WRK A;  1DJG A;  1X02 A;  1XK4 C;  2EHB A;  2GV5 A;  1UUS A;  1CMG A;  4YI8 A;  2OS8 C;  2FJU B;  5FYX A;  4MZL A;  1S5G Z;  1PUL A;  1OQP A;  4D1E A;  1U5I B;  4YGA A;  1BOD A;  1XFY O;  1JC2 A;  1B1G A;  5G08 A;  4F0Z B;  4WQ2 A;  1J7O A;  3KF9 A;  3I5I C;  1A29 A;  2F3Z A;  1TTX A;  1XFW O;  1PRW A;  2R2I A;  3BUX B;  1QVI Z;  4MEW A;  4BY4 A;  3KEV A;  2ZRS A;  1J1E A;  4NQG A;  4CFR A;  1U5I A;  1QVI Y;  2LLT A;  1F8H A;  4QJ3 B;  3MSE B;  2BCX A;  2IS9 A;  1M63 B;  1NCZ A;  1V1F A;  1BR1 B;  2HET A;  1KFU L;  1SCM B;  5JOL A;  1WLZ A;  1LIN A;  4MRX A;  1TOP A;  5DKR A;  2SAS A;  3TDI A;  2F8P A;  3D0Y A;  5HYD A;  3OB1 B;  1S3P A;  1OZO A;  2BE6 A;  2WOS A;  1C7V A;  2BBM A;  1CLM A;  2F2P A;  2JNF A;  1IJ5 A;  1YX7 A;  1K9K A;  1K94 A;  1WDC B;  4P2Y B;  1MXE A;  4N1F A;  4YGD B;  4YGC B;  3LK1 A;  1WRL A;  5IBW A;  1A03 A;  1KK8 C;  2BBN A;  2G2B A;  2LNK A;  5KU1 A;  1RTP 1;  2H61 C;  2M1K B;  2P6B B;  2WND A;  2ZN8 A;  1BJF A;  3HX4 A;  2D8N A;  1G8I A;  1L2O B;  1Y1X A;  1F70 A;  1BU3 A;  3LL8 B;  3I5H C;  4AQJ A;  1OE9 B;  3TUY B;  1DJI A;  1CM4 A;  1PSB A;  2ZNE A;  4OVN F;  2LVI A;  1DT7 B;  3VRO A;  2WC8 A;  3H4S E;  1UHJ A;  1NPQ A;  1QAT A;  4GGN A;  1S36 A;  1BR4 B;  1Y0V H;  2CXJ A;  2BCA A;  2LP2 A;  3F45 A;  1YRU B;  2PSR A;  1HQV A;  4NDC A;  5AAN A;  4WQ3 A;  1LA0 A;  2KI4 C;  1CKK A;  1NCX A;  5CSI A;  2KBM A;  1S6C A;  1K96 A;  1CLL A;  2H61 A;  2JTZ A;  3I5F B;  2M49 B;  1WLM A;  1K90 D;  1E8A A;  1GGZ A;  1NWD A;  4Q04 A;  2RGI A;  1KCY A;  4CID A;  1RWY A;  4I5L B;  1CFP A;  4HSZ A;  5K89 A;  1V1G A;  4CFQ A;  1TNW A;  5PAL A;  1UHH A;  3PN7 B;  1DJW A;  3WHT B;  3AKB A;  3ZNI A;  1F55 A;  1MQ1 A;  1B4C A;  3BUO B;  1TCO B;  2QAC A;  3NSI A;  5CSF A;  2KAX A;  3D0Y B;  1AJ5 A;  2Y4Q A;  1PSR A;  2JOJ A;  4MLW A;  1DJH A;  1KK7 Y;  2A4J A;  3KPX A;  3RM1 A;  2K7D A;  5CPV A;  1BOC A;  2JT3 A;  4PE1 A;  1JF0 A;  1DVI A;  1YUR A;  2CT9 A;  2K2A A;  4DUQ A;  1QXP A;  2JTT A;  2SCP A;  1OMR A;  1OOJ A;  4JPZ B;  5HKZ A;  4A4C A;  3BXK A;  3EVU A;  1JWD A;  3BQ3 A;  3CR2 A;  2BKI B;  1YUS A;  1SBJ A;  4ORA B;  1G33 A;  4USL A;  1F4Q A;  4L9M A;  2KI4 B;  3IQO A;  1OZS A;  4PHM A;  1AJ4 A;  4IL1 A;  2KFG A;  2BCB A;  5CSN A;  1YX8 A;  1PAL A;  2MLF C;  2B1U A;  2LC5 A;  1H4B A;  3O6B A;  1B8R A;  4PE7 A;  1WDC C;  3CS1 A;  2F33 A;  1LA3 A;  1J7Q A;  2M0R A;  3NXA A;  2LMU A;  3OB2 B;  3BYA A;  1CDN A;  2COL B;  1F71 A;  2ZRT A;  3DVM A;  1SW8 A;  1PK0 D;  2JZI A;  1PVB A;  1YR5 A;  1JF2 A;  2I7A A;  2Q4U A;  1KWO C;  1KQM B;  2KQY A;  3LK0 A;  4MRY A;  4UPG A;  4PHK A;  2JUL A;  2NCO A;  2M29 A;  2MHH A;  1M46 A;  1RFJ A;  4N1G A;  5ER4 X;  1OMD A;  1NSH A;  1JUO A;  1D1O A;  2MLE C;  3SG7 A;  4ETO A;  3I5G B;  4OKH A;  2AAO A;  4YI9 A;  2JQ6 A;  2WCE A;  1JSA A;  1CM1 A;  2PMY A;  2JXL A;  3NSK A;  3CWG A;  2M7N A;  3EKH A;  3ZWH A;  4C0J A;  2FOT A;  3BUM B;  2K8M B;  3BOW B;  2PRU A;  3LCP C;  2L98 A;  1S5G Y;  1B8C A;  2M1U A;  3IF7 A;  4OR9 B;  1UHK A;  4FTG A;  5DKQ A;  1IKU A;  1H8B A;  1DMO A;  3SIA A;  3GOF A;  4MBE A;  4ORC B;  1XVJ A;  2LV7 A;  3FWC A;  3OX6 A;  1QX5 B;  2FCE A;  1AP4 A;  3PAL A;  1B9A A;  2GGZ A;  3OX5 A;  3E3R A;  1JFK A;  1K9P A;  4GNK B;  1N65 A;  1JBA A;  2ZN9 A;  3DVK A;  2H2K A;  4ZCU A;  1AHR A;  1R6P A;  3EK4 A;  2HPS A;  2I94 A;  2O60 A;  3VRR A;  3FWB A;  2K2F A;  2HQW A;  2JXC A;  3SJS A;  1EG3 A;  1KWO B; 
#chains in the Genus database with same CATH topology
 1QAS A;  3RZS A;  1Z2C B;  3CZ1 A;  3NHT A;  1OSA A;  1KQM C;  2KNE A;  4R1E A;  1SR6 C;  4YRU A;  3SG5 A;  4WRI A;  2P71 A;  3CAB A;  4INW A;  1YVH A;  4PE4 A;  1EXR A;  3V2L A;  3NGV A;  4AOM A;  2K60 A;  1M39 A;  2LLS A;  2Y1N A;  2ZND A;  3DY9 A;  2ZFD A;  5DKN A;  1SKT A;  2BL0 C;  2ERB A;  1SSE B;  2Q91 A;  4HRE E;  3DXL A;  1KQV A;  1K95 A;  1N2D A;  3VRQ A;  4DS7 A;  1LXF C;  5I2O A;  5FI6 A;  4HRG A;  5I8N A;  1LKJ A;  1SCM C;  1OOF A;  2CNP A;  1C3Y A;  3SG6 A;  1YUU A;  2KI6 D;  3AAK A;  2KGR A;  3VGO A;  3WHU B;  5HL1 A;  1M45 A;  1TCF A;  3OP0 A;  1SMG A;  2K7B A;  2QPT A;  4GFT A;  1BG1 A;  2WCH A;  3C1V A;  1BLQ A;  2KDH A;  2BE4 A;  2NXQ A;  4IJ7 A;  1DF0 A;  2KQ6 A;  5KSZ A;  3O4Y A;  1QLS A;  2CCM A;  3B88 A;  2EC6 C;  3KO0 A;  4GGF C;  4U8D A;  2HF5 A;  3LLE A;  5AEQ A;  3CTN A;  2M7L A;  1WY9 A;  3TDU A;  3PM8 A;  3WNX B;  3O78 A;  2DOQ A;  1XO5 A;  1KK8 B;  1SK6 D;  4NDB A;  1K8U A;  1NX0 A;  1NCY A;  5F6T A;  2L50 A;  4C0L A;  1NX2 A;  4GAO A;  1DJZ A;  4CPV A;  1AVS A;  4ORB B;  3VB1 A;  1AK8 A;  2PVB A;  3SS5 A;  2CTN A;  2K0J A;  1KSM A;  3GK1 A;  1OW4 A;  1QIV A;  2P70 A;  3GK2 A;  3TUY C;  1MWN A;  3RLZ A;  2LVJ A;  1BT6 A;  2JU0 A;  1C07 A;  1TNQ A;  1FI5 A;  2BKH B;  3K1E A;  5GQQ C;  1QV1 A;  1M31 A;  5HKW A;  1MR8 A;  1DGU A;  1SY9 A;  1LVC D;  1B7T Y;  3NSL A;  3A8R A;  2EGD A;  2BL0 B;  1DQE A;  3K21 A;  3TDZ A;  1TRF A;  4MVF A;  1A2X A;  1ALV A;  2VRG A;  3O4X A;  4OCI A;  2I2R E;  2LMV A;  1ZMZ A;  2M3W A;  4DIR A;  1Y6W A;  2JWW A;  2WC6 A;  5TNC A;  3JVT B;  2PQL A;  1S6I A;  5KTY A;  4QJ5 B;  2KGB C;  1DEK A;  1Q80 A;  3FE8 A;  4PCW A;  3CR5 X;  2PAS A;  4GUK A;  2WCK A;  5FI7 A;  2ISD A;  3VRN A;  3D77 A;  2KAV A;  3QME A;  2Y1M A;  1SL8 A;  3SS4 A;  1KSO A;  1ODB A;  1YTZ C;  1UP5 A;  2LM5 A;  4MZJ A;  1XYD A;  2JT8 A;  2MAZ A;  1PVA A;  1P28 A;  2F3Y A;  1QX7 A;  3HCM A;  2LMT A;  2Y5I A;  1FW4 A;  2K7C A;  2BEC A;  1IH0 A;  2HQ8 A;  1NYA A;  2JT0 A;  3PAT A;  1SCV A;  4I5J A;  1CLB A;  1TNP A;  1C7W A;  1FBV A;  1CDM A;  3D78 A;  2KFH A;  3FS7 A;  3DVJ A;  4INX A;  2MRD A;  2L2C A;  5BPJ A;  1SL9 A;  1QWV A;  1MF8 B;  1SYM A;  3TS5 B;  2EC6 B;  3PFV A;  2LUX A;  1CTR A;  3SG4 A;  1XA5 A;  4P5O E;  2LAP A;  2KBI A;  5D69 A;  2AMI A;  2CBL A;  4GBA A;  1S26 D;  3KHE A;  1J55 A;  3BOW A;  1Y1U A;  1EJ3 A;  4CLN A;  5HKY A;  1K2H A;  1YUT A;  3A4U B;  1UHI A;  2KHN A;  3CLN A;  5AER A;  5HLV A;  1FPW A;  1DGV A;  2L0P A;  4QJ4 B;  4ICB A;  1GJY A;  1DJX A;  1UWO A;  2L5X B;  2KYF A;  5CSJ A;  4YGB B;  5I2L A;  2NZ0 A;  3CR4 X;  1VRK A;  4I5N B;  5B8I B;  1CFD A;  4E68 A;  1QLK A;  1K93 D;  1XFX O;  4TNC A;  4PHJ A;  5JJG A;  1B47 A;  1A75 B;  2NLN A;  1XFV O;  1IQ3 A;  3I5G C;  4JWQ A;  2LAN A;  3PLF B;  4MN0 A;  4N5X A;  1BMO A;  1KFX L;  1SNL A;  2G9B A;  3CZ0 A;  3OHM B;  4XJK B;  1QIW A;  2KOT A;  2MA2 A;  2OPO A;  3JTD B;  3M0W A;  1A4P A;  2KPH A;  3SG3 A;  4BY5 A;  1J7P A;  3AKA A;  3NSO A;  3CZT X;  1XFZ O;  3TS5 C;  2L4I A;  4AQI A;  2M97 A;  2NCP A;  3TZ1 A;  2MBX A;  1DF0 B;  1MXL C;  2TN4 A;  1NUB A;  1DTL A;  5FI2 A;  3CGA A;  2E30 A;  2WC5 A;  3ICB A;  1ZUZ A;  2FCD A;  2L4H A;  1UHN A;  4YGE B;  2WCB A;  2WOR A;  1FI6 A;  3SG2 A;  2MJW B;  1QTX A;  4PAL A;  3R1V A;  4FQO A;  1YVL A;  1Y1A A;  2M8U A;  1TIZ A;  1RK9 A;  3I5H B;  3SIB A;  1QJT A;  1QS7 A;  1L2O C;  3DF0 A;  2LHI A;  1B8L A;  3PSR A;  1TWO A;  3CDN A;  1QX2 A;  1ZAC A;  1F4O A;  3PN7 C;  3UNW A;  1EG4 A;  1OMV A;  1QV0 A;  1TN4 A;  1WRZ A;  4M2Q A;  4I5K A;  1NP8 A;  1T14 A;  2L51 A;  1BF5 A;  3IQQ A;  3DZT A;  3VRP A;  1MUX A;  2LHL A;  3BUN B;  1G4Y R;  1SRA A;  1IGV A;  5I2Q A;  4OZD A;  1IJ6 A;  1UUR A;  3EVV A;  1CB1 A;  1OOI X;  3JTD C;  2AUC A;  2V53 A;  5HLO A;  5AFP A;  1DJY A;  1ZOT B;  3I5F C;  3S0E A;  4C0K A;  3EK7 A;  1S6J A;  2LLU A;  2OS8 B;  3R1P A;  2LP3 A;  3D10 A;  1W7I B;  1KK7 Z;  4HRH A;  1NIW A;  1REC A;  1TUZ A;  3AAJ A;  1CDL A;  1SR6 B;  2GTE A;  3DF0 B;  1CNP A;  3O2P A;  3PM2 A;  1ZFS A;  2KSP A;  3SS3 A;  1R2U A;  1IIO A;  2E6W A;  3FIA A;  2LE9 B;  4PHN A;  4XJK A;  2JRF A;  1HT9 A;  1GQM A;  2JPT A;  3QRX A;  4A4B A;  1KFU S;  2OTG C;  1KFX S;  1W7J B;  1ORG A;  2FJY A;  3I5I B;  1SL7 A;  3BFA A;  4DRW A;  1N0Y A;  2F2O A;  4MZK A;  2WCF A;  1S1E A;  1TNX A;  1JFJ A;  1L7Z A;  4JKT A;  1RRO A;  1CFF A;  3D73 A;  4OV2 A;  2LCP A;  1EL4 A;  2KI6 C;  4JQ0 D;  1NX1 A;  3BFH A;  1CFC A;  2ZKM X;  1B7T Z;  3BUW B;  3IVT A;  1AUI B;  1IWQ A;  1YRT B;  4YBH B;  1FF1 A;  2WCJ A;  4GPL B;  5D7F A;  1CDP A;  1J1D A;  3DVE A;  2O5G A;  4ZCV A;  2LUC A;  3EVR A;  4GGF A;  2JC2 A;  3EK8 A;  4MSP A;  1A75 A;  1J7R A;  3FE9 A;  1F54 A;  2I18 A;  1EH2 A;  2LVV A;  2JNX A;  4DCK A;  4XYN A;  1ALW A;  4PT1 A;  2GGM A;  5ER5 A;  5AXI A;  2L2E A;  4M2O A;  2LVK A;  1K9U A;  1SPY A;  1IRJ A;  2KAY A;  3B87 A;  3Q8I A;  4M2P A;  2M9G A;  3DD4 A;  2OTG B;  2PAL A;  1CMF A;  2K61 A;  4PE0 A;  2KYC A;  1GGW A;  1NX3 A;  3GK4 X;  1MHO A;  2KFF A;  1XFU O;  2K7O A;  3JVT C;  4NDD A;  3EKJ A;  4FQT A;  2QEB A;  1IQ5 A;  4PDZ A;  5J3X A;  1XK4 A;  1RJV A;  3WXA A;  1IG5 A;  1WRK A;  1DJG A;  1X02 A;  1XK4 C;  2EHB A;  2GV5 A;  1UUS A;  1CMG A;  4YI8 A;  2OS8 C;  2H8V A;  2FJU B;  5FYX A;  4MZL A;  3DYE A;  3N7H A;  1S5G Z;  1PUL A;  1OQP A;  3OBV A;  4D1E A;  1U5I B;  4YGA A;  1BOD A;  1XFY O;  1JC2 A;  1B1G A;  5G08 A;  4F0Z B;  4WQ2 A;  1J7O A;  3KF9 A;  1DEL A;  3I5I C;  1A29 A;  2F3Z A;  1TTX A;  1XFW O;  1PRW A;  1XFR A;  2R2I A;  1QVI Z;  3BUX B;  4MEW A;  4BY4 A;  3KEV A;  2ZRS A;  1J1E A;  4NQG A;  4CFR A;  1U5I A;  1QVI Y;  2LLT A;  3D76 A;  1F8H A;  4QJ3 B;  3B6X A;  3S0D A;  3MSE B;  2BCX A;  2IS9 A;  1M63 B;  1NCZ A;  1V1F A;  1BR1 B;  3NHI A;  5D3O A;  2HET A;  1KFU L;  3D74 A;  1SCM B;  5JOL A;  1WLZ A;  1LIN A;  4MRX A;  3BJH A;  1TOP A;  5DKR A;  2SAS A;  3TDI A;  2F8P A;  3D0Y A;  5HYD A;  3OB1 B;  1S3P A;  1OZO A;  2BE6 A;  2WOS A;  1C7V A;  2BBM A;  1CLM A;  2F2P A;  2JNF A;  1IJ5 A;  1YX7 A;  1K9K A;  1K94 A;  1WDC B;  3D75 A;  4P2Y B;  1MXE A;  4N1F A;  4YGD B;  3S0B A;  4YGC B;  3LK1 A;  1WRL A;  5IBW A;  1A03 A;  3CZ2 A;  1KK8 C;  2BBN A;  2BNX A;  2G2B A;  2LNK A;  5KU1 A;  1TUJ A;  1RTP 1;  2H61 C;  2M1K B;  2P6B B;  2WND A;  2ZN8 A;  1BJF A;  3EG5 B;  5DIC A;  3R72 A;  3HX4 A;  2D8N A;  1G8I A;  1L2O B;  1Y1X A;  2QEV A;  1BU3 A;  3LL8 B;  1F70 A;  3I5H C;  4AQJ A;  1OE9 B;  3L4L A;  3TUY B;  1DJI A;  1CM4 A;  1PSB A;  2WCL A;  2ZNE A;  4F7F A;  4OVN F;  2LVI A;  1DT7 B;  3VRO A;  2WC8 A;  3H4S E;  1UHJ A;  1NPQ A;  1QAT A;  2BAP A;  2JPO A;  4GGN A;  1S36 A;  1BR4 B;  1Y0V H;  2CXJ A;  2BCA A;  2LP2 A;  3F45 A;  1YRU B;  2PSR A;  1HQV A;  4NDC A;  5AAN A;  4WQ3 A;  1LA0 A;  2KI4 C;  1CKK A;  1NCX A;  5CSI A;  2KBM A;  1S6C A;  2WCM A;  1K96 A;  1CLL A;  2H61 A;  2JTZ A;  3I5F B;  2M49 B;  1WLM A;  1K90 D;  1E8A A;  1GGZ A;  1NWD A;  4Q04 A;  1OOG A;  2RGI A;  1KCY A;  4CID A;  1RWY A;  4I5L B;  1CFP A;  4HSZ A;  5K89 A;  1V1G A;  4CFQ A;  1TNW A;  1GM0 A;  5PAL A;  1UHH A;  3PN7 B;  1DJW A;  3WHT B;  3AKB A;  3ZNI A;  1F55 A;  1MQ1 A;  1B4C A;  3BUO B;  1TCO B;  2QAC A;  3NSI A;  5CSF A;  2KAX A;  3D0Y B;  1AJ5 A;  2Y4Q A;  1PSR A;  2JOJ A;  4MLW A;  1DJH A;  1KK7 Y;  2A4J A;  3KPX A;  3RM1 A;  2K7D A;  5CPV A;  1BOC A;  2JT3 A;  4PE1 A;  2KLD A;  3UO9 A;  1JF0 A;  1DVI A;  1YUR A;  2CT9 A;  2K2A A;  4DUQ A;  2L5Y A;  1QXP A;  3L4A A;  2JTT A;  1OOH A;  2SCP A;  1OMR A;  1OOJ A;  4JPZ B;  5HKZ A;  4A4C A;  3BXK A;  3EVU A;  1JWD A;  3BQ3 A;  3CR2 A;  2BKI B;  4JD9 A;  1YUS A;  1LS8 A;  1SBJ A;  4ORA B;  1G33 A;  4USL A;  1F4Q A;  4L9M A;  3OGN A;  2KI4 B;  3IQO A;  1OZS A;  2PYQ A;  1AJ4 A;  3B7A A;  4IL1 A;  4PHM A;  2KFG A;  2BCB A;  5CSN A;  1YX8 A;  1PAL A;  3B86 A;  2MLF C;  2B1U A;  2LC5 A;  1H4B A;  3O6B A;  1B8R A;  4PE7 A;  1WDC C;  3CS1 A;  3FE6 A;  2F33 A;  1LA3 A;  1J7Q A;  2M0R A;  3NXA A;  2LMU A;  3OB2 B;  3BYA A;  3S0F A;  1CDN A;  2COL B;  1F71 A;  2YGU A;  2ZRT A;  2QDI A;  3DVM A;  1SW8 A;  1PK0 D;  2JZI A;  1PVB A;  1YR5 A;  1JF2 A;  2I7A A;  2Q4U A;  1KWO C;  1KQM B;  2KQY A;  3LK0 A;  4MRY A;  4UPG A;  4PHK A;  2JUL A;  2NCO A;  2M29 A;  2MHH A;  1DC1 A;  1M46 A;  1RFJ A;  4N1G A;  5ER4 X;  1OMD A;  1W9Z A;  5EL2 A;  1NSH A;  1JUO A;  3S0G A;  2QEO A;  1C3Z A;  1D1O A;  2MLE C;  3SG7 A;  4ETO A;  3I5G B;  4OKH A;  2AAO A;  4YI9 A;  2JQ6 A;  3R1O A;  4KYN A;  2WCE A;  2KLE A;  1JSA A;  1CM1 A;  2PMY A;  2JXL A;  3NSK A;  3CWG A;  2M7N A;  5I94 A;  3EKH A;  3ZWH A;  4C0J A;  2FOT A;  3BUM B;  2K8M B;  3BOW B;  2PRU A;  3LCP C;  2L98 A;  1S5G Y;  1B8C A;  2M1U A;  3IF7 A;  4OR9 B;  1UHK A;  4FTG A;  5DKQ A;  1IKU A;  1H8B A;  1DMO A;  3SIA A;  3GOF A;  3L47 A;  3BFB A;  3PJI A;  4MBE A;  4ORC B;  1XVJ A;  2LV7 A;  3FWC A;  3OX6 A;  1QX5 B;  2FCE A;  1AP4 A;  3PAL A;  1B9A A;  2GGZ A;  2QEH A;  3OX5 A;  3E3R A;  1JFK A;  1K9P A;  4GNK B;  1N65 A;  1JBA A;  2ZN9 A;  3DVK A;  2H2K A;  3S0A A;  4ZCU A;  1AHR A;  1R6P A;  3CYZ A;  2HPS A;  3EK4 A;  2I94 A;  2O60 A;  3VRR A;  1Z4H A;  3FWB A;  2K2F A;  2HQW A;  2JXC A;  3SJS A;  1EG3 A;  1KWO B; 
#chains in the Genus database with same CATH homology
 1QAS A;  1OSA A;  1KQM C;  2KNE A;  4R1E A;  1SR6 C;  4YRU A;  3SG5 A;  4WRI A;  4PE4 A;  1YVH A;  4AOM A;  1EXR A;  1M39 A;  2LLS A;  2Y1N A;  2ZND A;  2ZFD A;  5DKN A;  1SKT A;  2BL0 C;  2Q91 A;  4HRE E;  1KQV A;  1K95 A;  1N2D A;  3VRQ A;  4DS7 A;  1LXF C;  5I2O A;  4HRG A;  5I8N A;  1LKJ A;  1SCM C;  2CNP A;  3SG6 A;  1YUU A;  2KI6 D;  3AAK A;  2KGR A;  3VGO A;  3WHU B;  1M45 A;  1TCF A;  3OP0 A;  1SMG A;  2K7B A;  2QPT A;  4GFT A;  1BG1 A;  3C1V A;  1BLQ A;  2KDH A;  2BE4 A;  2NXQ A;  1DF0 A;  2KQ6 A;  5KSZ A;  3O4Y A;  1QLS A;  2CCM A;  2EC6 C;  3KO0 A;  4GGF C;  4U8D A;  2HF5 A;  3LLE A;  5AEQ A;  3CTN A;  2M7L A;  1WY9 A;  3TDU A;  3PM8 A;  3WNX B;  3O78 A;  2DOQ A;  1XO5 A;  1KK8 B;  1SK6 D;  4NDB A;  1K8U A;  1NX0 A;  1NCY A;  5F6T A;  2L50 A;  4C0L A;  1NX2 A;  4GAO A;  1DJZ A;  4CPV A;  1AVS A;  4ORB B;  1AK8 A;  2PVB A;  2CTN A;  2K0J A;  1KSM A;  3GK1 A;  1QIV A;  3GK2 A;  3TUY C;  1MWN A;  3RLZ A;  2LVJ A;  1BT6 A;  2JU0 A;  1C07 A;  1TNQ A;  1FI5 A;  2BKH B;  5GQQ C;  1QV1 A;  1M31 A;  5HKW A;  1MR8 A;  1DGU A;  1SY9 A;  1LVC D;  1B7T Y;  3NSL A;  3A8R A;  2EGD A;  2BL0 B;  3K21 A;  3TDZ A;  1TRF A;  4MVF A;  1A2X A;  1ALV A;  2VRG A;  4OCI A;  2I2R E;  2LMV A;  1ZMZ A;  2M3W A;  4DIR A;  1Y6W A;  2JWW A;  5TNC A;  3JVT B;  1S6I A;  5KTY A;  4QJ5 B;  2KGB C;  1Q80 A;  4PCW A;  3CR5 X;  2PAS A;  4GUK A;  2ISD A;  3VRN A;  2KAV A;  2Y1M A;  1SL8 A;  1KSO A;  1ODB A;  1YTZ C;  1UP5 A;  2LM5 A;  4MZJ A;  1XYD A;  2JT8 A;  2MAZ A;  1PVA A;  2F3Y A;  1QX7 A;  3HCM A;  2LMT A;  2Y5I A;  1FW4 A;  2K7C A;  2BEC A;  1IH0 A;  2HQ8 A;  1NYA A;  2JT0 A;  3PAT A;  1SCV A;  4I5J A;  1CLB A;  1TNP A;  1C7W A;  1FBV A;  1CDM A;  2KFH A;  3FS7 A;  3DVJ A;  2MRD A;  5BPJ A;  1SL9 A;  1MF8 B;  1SYM A;  3TS5 B;  2EC6 B;  3PFV A;  2LUX A;  1CTR A;  3SG4 A;  1XA5 A;  4P5O E;  2LAP A;  2KBI A;  5D69 A;  2AMI A;  2CBL A;  4GBA A;  1S26 D;  3KHE A;  1J55 A;  3BOW A;  1Y1U A;  1EJ3 A;  4CLN A;  5HKY A;  1K2H A;  1YUT A;  3A4U B;  1UHI A;  2KHN A;  3CLN A;  5AER A;  5HLV A;  1FPW A;  1DGV A;  2L0P A;  4QJ4 B;  4ICB A;  1GJY A;  1DJX A;  1UWO A;  2L5X B;  2KYF A;  5CSJ A;  4YGB B;  5I2L A;  2NZ0 A;  3CR4 X;  1VRK A;  4I5N B;  5B8I B;  1CFD A;  4E68 A;  1QLK A;  1K93 D;  1XFX O;  4TNC A;  4PHJ A;  5JJG A;  1B47 A;  1A75 B;  2NLN A;  1XFV O;  1IQ3 A;  3I5G C;  4JWQ A;  2LAN A;  3PLF B;  4MN0 A;  4N5X A;  1BMO A;  1KFX L;  1SNL A;  2G9B A;  4XJK B;  3OHM B;  1QIW A;  2KOT A;  2MA2 A;  2OPO A;  3JTD B;  3M0W A;  1A4P A;  3SG3 A;  4BY5 A;  1J7P A;  3AKA A;  3NSO A;  3CZT X;  1XFZ O;  3TS5 C;  2L4I A;  4AQI A;  2M97 A;  2NCP A;  3TZ1 A;  2MBX A;  1DF0 B;  1MXL C;  2TN4 A;  1NUB A;  1DTL A;  3CGA A;  2E30 A;  3ICB A;  1ZUZ A;  2FCD A;  2L4H A;  1UHN A;  4YGE B;  2WCB A;  2WOR A;  1FI6 A;  3SG2 A;  2MJW B;  1QTX A;  4PAL A;  4FQO A;  1YVL A;  1Y1A A;  2M8U A;  1TIZ A;  1RK9 A;  3I5H B;  3SIB A;  1QJT A;  1QS7 A;  1L2O C;  3DF0 A;  2LHI A;  1B8L A;  3PSR A;  1QX2 A;  1ZAC A;  1F4O A;  3PN7 C;  1EG4 A;  1OMV A;  1QV0 A;  1TN4 A;  1WRZ A;  4M2Q A;  4I5K A;  1NP8 A;  2L51 A;  1BF5 A;  3IQQ A;  3VRP A;  1MUX A;  2LHL A;  3BUN B;  1G4Y R;  1SRA A;  1IGV A;  5I2Q A;  1CB1 A;  1IJ6 A;  1UUR A;  3EVV A;  3JTD C;  2AUC A;  2V53 A;  5HLO A;  5AFP A;  1DJY A;  1ZOT B;  3I5F C;  4C0K A;  3EK7 A;  1S6J A;  2LLU A;  2OS8 B;  2LP3 A;  3D10 A;  1W7I B;  1KK7 Z;  4HRH A;  1NIW A;  1REC A;  3AAJ A;  1CDL A;  1SR6 B;  3DF0 B;  1CNP A;  3O2P A;  1ZFS A;  2KSP A;  1R2U A;  2E6W A;  3FIA A;  2LE9 B;  4PHN A;  4XJK A;  2JRF A;  1HT9 A;  1GQM A;  2JPT A;  3QRX A;  4A4B A;  1KFU S;  2OTG C;  1KFX S;  1W7J B;  3I5I B;  1SL7 A;  4DRW A;  1N0Y A;  2F2O A;  4MZK A;  2WCF A;  1S1E A;  1TNX A;  1JFJ A;  1L7Z A;  1RRO A;  1CFF A;  4OV2 A;  2LCP A;  1EL4 A;  2KI6 C;  4JQ0 D;  1NX1 A;  1CFC A;  2ZKM X;  1B7T Z;  3BUW B;  1AUI B;  1IWQ A;  1YRT B;  4YBH B;  1FF1 A;  4GPL B;  5D7F A;  1CDP A;  1J1D A;  3DVE A;  2O5G A;  4ZCV A;  2LUC A;  3EVR A;  4GGF A;  2JC2 A;  3EK8 A;  4MSP A;  1A75 A;  1J7R A;  1F54 A;  2I18 A;  1EH2 A;  2LVV A;  2JNX A;  4DCK A;  4XYN A;  1ALW A;  2GGM A;  5ER5 A;  5AXI A;  2L2E A;  4M2O A;  2LVK A;  1K9U A;  1SPY A;  1IRJ A;  2KAY A;  4M2P A;  2M9G A;  3DD4 A;  2OTG B;  2PAL A;  1CMF A;  2K61 A;  4PE0 A;  2KYC A;  1GGW A;  1NX3 A;  3GK4 X;  1MHO A;  2KFF A;  1XFU O;  2K7O A;  3JVT C;  4NDD A;  3EKJ A;  1IQ5 A;  4PDZ A;  5J3X A;  1XK4 A;  1RJV A;  3WXA A;  1IG5 A;  1WRK A;  1DJG A;  1X02 A;  1XK4 C;  2EHB A;  2GV5 A;  1UUS A;  1CMG A;  4YI8 A;  2OS8 C;  2FJU B;  5FYX A;  4MZL A;  1S5G Z;  1PUL A;  1OQP A;  4D1E A;  1U5I B;  4YGA A;  1BOD A;  1XFY O;  1JC2 A;  1B1G A;  5G08 A;  4F0Z B;  4WQ2 A;  1J7O A;  3KF9 A;  3I5I C;  1A29 A;  2F3Z A;  1TTX A;  1XFW O;  1PRW A;  2R2I A;  3BUX B;  1QVI Z;  4MEW A;  4BY4 A;  3KEV A;  2ZRS A;  1J1E A;  4NQG A;  4CFR A;  1U5I A;  1QVI Y;  2LLT A;  1F8H A;  4QJ3 B;  3MSE B;  2BCX A;  2IS9 A;  1M63 B;  1NCZ A;  1V1F A;  1BR1 B;  2HET A;  1KFU L;  1SCM B;  5JOL A;  1WLZ A;  1LIN A;  4MRX A;  1TOP A;  5DKR A;  2SAS A;  3TDI A;  2F8P A;  3D0Y A;  5HYD A;  3OB1 B;  1S3P A;  1OZO A;  2BE6 A;  2WOS A;  1C7V A;  2BBM A;  1CLM A;  2F2P A;  2JNF A;  1IJ5 A;  1YX7 A;  1K9K A;  1K94 A;  1WDC B;  4P2Y B;  1MXE A;  4N1F A;  4YGD B;  4YGC B;  3LK1 A;  1WRL A;  5IBW A;  1A03 A;  1KK8 C;  2BBN A;  2G2B A;  2LNK A;  5KU1 A;  1RTP 1;  2H61 C;  2M1K B;  2P6B B;  2WND A;  2ZN8 A;  1BJF A;  3HX4 A;  2D8N A;  1G8I A;  1L2O B;  1Y1X A;  1F70 A;  1BU3 A;  3LL8 B;  3I5H C;  4AQJ A;  1OE9 B;  3TUY B;  1DJI A;  1CM4 A;  1PSB A;  2ZNE A;  4OVN F;  2LVI A;  1DT7 B;  3VRO A;  2WC8 A;  3H4S E;  1UHJ A;  1NPQ A;  1QAT A;  4GGN A;  1S36 A;  1BR4 B;  1Y0V H;  2CXJ A;  2BCA A;  2LP2 A;  3F45 A;  1YRU B;  2PSR A;  1HQV A;  4NDC A;  5AAN A;  4WQ3 A;  1LA0 A;  2KI4 C;  1CKK A;  1NCX A;  5CSI A;  2KBM A;  1S6C A;  1K96 A;  1CLL A;  2H61 A;  2JTZ A;  3I5F B;  2M49 B;  1WLM A;  1K90 D;  1E8A A;  1GGZ A;  1NWD A;  4Q04 A;  2RGI A;  1KCY A;  4CID A;  1RWY A;  4I5L B;  1CFP A;  4HSZ A;  5K89 A;  1V1G A;  4CFQ A;  1TNW A;  5PAL A;  1UHH A;  3PN7 B;  1DJW A;  3WHT B;  3AKB A;  3ZNI A;  1F55 A;  1MQ1 A;  1B4C A;  3BUO B;  1TCO B;  2QAC A;  3NSI A;  5CSF A;  2KAX A;  3D0Y B;  1AJ5 A;  2Y4Q A;  1PSR A;  2JOJ A;  4MLW A;  1DJH A;  1KK7 Y;  2A4J A;  3KPX A;  3RM1 A;  2K7D A;  5CPV A;  1BOC A;  2JT3 A;  4PE1 A;  1JF0 A;  1DVI A;  1YUR A;  2CT9 A;  2K2A A;  4DUQ A;  1QXP A;  2JTT A;  2SCP A;  1OMR A;  1OOJ A;  4JPZ B;  5HKZ A;  4A4C A;  3BXK A;  3EVU A;  1JWD A;  3BQ3 A;  3CR2 A;  2BKI B;  1YUS A;  1SBJ A;  4ORA B;  1G33 A;  4USL A;  1F4Q A;  4L9M A;  2KI4 B;  3IQO A;  1OZS A;  4PHM A;  1AJ4 A;  4IL1 A;  2KFG A;  2BCB A;  5CSN A;  1YX8 A;  1PAL A;  2MLF C;  2B1U A;  2LC5 A;  1H4B A;  3O6B A;  1B8R A;  4PE7 A;  1WDC C;  3CS1 A;  2F33 A;  1LA3 A;  1J7Q A;  2M0R A;  3NXA A;  2LMU A;  3OB2 B;  3BYA A;  1CDN A;  2COL B;  1F71 A;  2ZRT A;  3DVM A;  1SW8 A;  1PK0 D;  2JZI A;  1PVB A;  1YR5 A;  1JF2 A;  2I7A A;  2Q4U A;  1KWO C;  1KQM B;  2KQY A;  3LK0 A;  4MRY A;  4UPG A;  4PHK A;  2JUL A;  2NCO A;  2M29 A;  2MHH A;  1M46 A;  1RFJ A;  4N1G A;  5ER4 X;  1OMD A;  1NSH A;  1JUO A;  1D1O A;  2MLE C;  3SG7 A;  4ETO A;  3I5G B;  4OKH A;  2AAO A;  4YI9 A;  2JQ6 A;  2WCE A;  1JSA A;  1CM1 A;  2PMY A;  2JXL A;  3NSK A;  3CWG A;  2M7N A;  3EKH A;  3ZWH A;  4C0J A;  2FOT A;  3BUM B;  2K8M B;  3BOW B;  2PRU A;  3LCP C;  2L98 A;  1S5G Y;  1B8C A;  2M1U A;  3IF7 A;  4OR9 B;  1UHK A;  4FTG A;  5DKQ A;  1IKU A;  1H8B A;  1DMO A;  3SIA A;  3GOF A;  4MBE A;  4ORC B;  1XVJ A;  2LV7 A;  3FWC A;  3OX6 A;  1QX5 B;  2FCE A;  1AP4 A;  3PAL A;  1B9A A;  2GGZ A;  3OX5 A;  3E3R A;  1JFK A;  1K9P A;  4GNK B;  1N65 A;  1JBA A;  2ZN9 A;  3DVK A;  2H2K A;  4ZCU A;  1AHR A;  1R6P A;  3EK4 A;  2HPS A;  2I94 A;  2O60 A;  3VRR A;  3FWB A;  2K2F A;  2HQW A;  2JXC A;  3SJS A;  1EG3 A;  1KWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...