4NDBA

X-ray structure of a mutant (t61d) of calexcitin - a neuronal calcium-signalling protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
187
structure length
187
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARADLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGTLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Calexcitin
publication title X-ray, spectroscopic and normal-mode dynamics of calexcitin: structure-function studies of a neuronal calcium-signalling protein.
pubmed doi rcsb
source organism Doryteuthis pealeii
total genus 80
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ndbA00
1M63B 1GGZA 4GGNA 5HKZA 1FBVA 4D1EA 1QX7A 1S1EA 1WDCC 4HRHA 1SBJA 4YI9A 1ZFSA 2M1UA 3HX4A 5HLVA 4E68A 1MF8B 1K90D 3TDIA 4OVNF 4C0LA 3WHUB 1DTLA 1XA5A 1OMRA 1GGWA 3GK1A 1KK7Z 1W7IB 3I5IC 3SG7A 2K7CA 2MJWB 3SG4A 1IH0A 1S5GY 1BJFA 2H61A 3GOFA 1B7TY 3AKBA 1CLBA 1AVSA 1CLMA 1N0YA 1OMVA 3CGAA 4GFTA 4OCIA 3E3RA 1XFWO 2LP2A 1NIWA 3TS5B 1PVBA 1M45A 1YR5A 1BLQA 5I2QA 4ETOA 5HYDA 1RWYA 1TIZA 2EC6C 2M97A 2KGBC 1D1OA 3EVRA 3JVTC 2M49B 3BXKA 4MN0A 1L2OC 4GUKA 4NDDA 1MXLC 4OKHA 2LVKA 2JTTA 1QV1A 3ICBA 2L98A 2JOJA 1YUTA 3I5HB 4Q04A 4DIRA 1SYMA 2HQWA 1A75B 2O5GA 2KQ6A 1S36A 1TNWA 3BUWB 2WOSA 3VRNA 1SR6B 1BU3A 5KTYA 1PRWA 3I5FC 5DKQA 1NX1A 2KQYA 2KBMA 2LMVA 1AK8A 2ZRTA 1M39A 4WQ3A 1CDLA 2O60A 4YGBB 4UPGA 4MLWA 3NSIA 1A29A 1TCFA 4MSPA 4YBHB 1NX3A 1SL7A 2CXJA 4GGFA 1J7OA 5AEQA 3BOWB 2LANA 2BE6A 4PDZA 1DGVA 2QPTA 4MZLA 3NSLA 1IJ6A 2A4JA 5ER4X 3FS7A 1MR8A 1G4YR 1Y0VH 5CSJA 1F54A 1QIVA 1F4OA 2HF5A 3LL8B 2JULA 1MXEA 5AXIA 1C7VA 2I18A 5AANA 1K96A 4YRUA 1EJ3A 1DVIA 1E8AA 2WC8A 2I94A 4P2YB 3GK2A 1IGVA 2OS8B 2I2RE 5JOLA 3CTNA 1QLKA 1HT9A 1J7RA 5D7FA 2M9GA 5KSZA 1XYDA 4ZCVA 4DUQA 4PE0A 4ZCUA 3EVVA 1UHIA 5HKYA 2GGZA 4NQGA 2EHBA 1MQ1A 4BY5A 5JJGA 3PN7C 2Q4UA 1PSBA 5KU1A 4MVFA 1MUXA 3O78A 4MZKA 1JUOA 1YRTB 1XFVO 3AAKA 3KO0A 3O6BA 1V1GA 2BE4A 1ZMZA 2G2BA 3OX6A 4WRIA 5B8IB 1IG5A 2F8PA 1J55A 2L2EA 3VRQA 2WCFA 5CPVA 2P6BB 4QJ5B 1RECA 1YX8A 4HREE 1F8HA 2I7AA 2OTGC 1DMOA 2L5XB 1JBAA 1UHKA 2G9BA 3ZNIA 4C0JA 2H61C 2LE9B 2SCPA 3WXAA 3I5IB 1DGUA 4PHJA 5G08A 5PALA 2BL0B 1OZSA 3CZTX 2M8UA 1G33A 1Q80A 3JTDB 4I5LB 2V53A 1J7PA 3OX5A 4DCKA 3HCMA 5HLOA 1FPWA 3SIBA 2LLUA 3FWCA 1JFKA 2PVBA 5TNCA 4OR9B 1S5GZ 1B7TZ 3PALA 1Y1XA 3SG2A 1AJ5A 1S6CA 4HRGA 1C7WA 1NYAA 1NCYA 1ZOTB 2JTZA 1RK9A 2LC5A 2LV7A 1SY9A 1Y1AA 1IRJA 2CT9A 3LCPC 1YURA 3BUOB 2M7LA 1KFXL 1SL9A 2BBNA 3JVTB 3TDZA 1L2OB 1JC2A 2KFGA 1NUBA 1UP5A 3I5GC 3DVMA 3KEVA 4PE4A 1CNPA 4PALA 3AKAA 3DVKA 2MLEC 2Y1MA 1OQPA 1KQVA 1A75A 2KYCA 3RM1A 1CTRA 2F2OA 3NSKA 4IL1A 3VRRA 1CFFA 5DKRA 3I5FB 1R2UA 3CLNA 1QX2A 4GGFC 5HKWA 2LHLA 1QXPA 1S3PA 2KHNA 1IQ3A 1XK4A 1KK8B 2LMUA 1CMGA 3O4YA 1ZUZA 2KAYA 4MRYA 4M2QA 3IF7A 1LVCD 1RJVA 1SCMC 1ALWA 2WCEA 2HPSA 2CCMA 4PHNA 1QV0A 2LUCA 1CFCA 3BOWA 3SG5A 2NXQA 1JFJA 2M1KB 1JSAA 2JU0A 2MA2A 1S6JA 3TUYC 3D0YB 2ISDA 4MEWA 4A4CA 1F4QA 2JZIA 4CFQA 3LK0A 1B9AA 2FCEA 1A4PA 2KI4C 2H2KA 2M3WA 4L9MA 5K89A 2ZN9A 4U8DA 3EK4A 1S26D 2LVIA 1PK0D 5D69A 2KFFA 1Y1UA 2KGRA 1AHRA 2PSRA 2VRGA 4MRXA 3PLFB 1QATA 2K0JA 2M0RA 3O2PA 1QIWA 2PALA 3WNXB 1QVIY 2ZNEA 3NXAA 2JRFA 4NDBA 3CWGA 4WQ2A 1K8UA 1WRKA 2JT8A 4C0KA 1CDNA 4ORAB 2MHHA 1CFPA 2SASA 1DJZA 1KFUS 2NCOA 2K7DA 2BECA 2LM5A 2HETA 2LAPA 1F71A 3VGOA 1A2XA 1LA3A 1OZOA 1ALVA 1KK7Y 1OMDA 2K7OA 4TNCA 2L4IA 1QJTA 1U5IB 1SK6D 2B1UA 5BPJA 1EH2A 1IKUA 1SKTA 2NLNA 4CPVA 2K61A 1NSHA 1NX2A 2BKHB 2K8MB 1RROA 2LNKA 3D10A 3KHEA 4JPZB 1C07A 2OTGB 1OOJA 5IBWA 4FTGA 3C1VA 4M2OA 1TNPA 3PATA 1KWOC 1B47A 3QRXA 3DVEA 4PCWA 1SL8A 2F33A 1R6PA 3SJSA 1DF0B 1PSRA 1KFUL 1MWNA 4N1FA 5I2OA 1YX7A 1L7ZA 2Y4QA 4P5OE 1K9PA 4BY4A 2KDHA 3PFVA 1B8RA 1TTXA 1KQMC 1QS7A 1FI5A 1MHOA 4DRWA 1N65A 1UURA 4I5NB 2CBLA 2L51A 4DS7A 4FQOA 2L50A 4YGEB 3I5HC 1CMFA 2KYFA 4YGDB 2WORA 1BODA 2JQ6A 3DF0B 1JF0A 1DJHA 2ZNDA 1OE9B 3I5GB 1SR6C 3LK1A 4ICBA 1YRUB 1WDCB 1EXRA 1BMOA 1YTZC 4MBEA 4A4BA 2CTNA 1BR4B 1XK4C 2LP3A 2KBIA 3CR5X 5I8NA 2CNPA 3WHTB 1QX5B 4XJKB 2AUCA 1LINA 2WCBA 2IS9A 2F3YA 2JT3A 3DD4A 1AP4A 4QJ3B 1RFJA 1QTXA 3SG6A 1CKKA 2LVJA 1CDPA 3CR4X 4JWQA 1H8BA 2L0PA 4GNKB 5DKNA 1B1GA 2KI6C 1JWDA 2EC6B 1K93D 1CM4A 2K2AA 1XFZO 2NCPA 3VROA 1M31A 3FIAA 2ZFDA 1CB1A 1YUUA 2OS8C 2ZKMX 3D0YA 2KI4B 1LA0A 2L4HA 1DJGA 1DJWA 2LLSA 1TNXA 1UHHA 3LLEA 1SCVA 1XFXO 1WY9A 4YGAA 1K94A 2KI6D 2LCPA 2E6WA 2F3ZA 5AFPA 1EG4A 1GJYA 3AAJA 2MRDA 5CSFA 4N5XA 1UUSA 2BCBA 1PULA 3TZ1A 1K95A 4M2PA 1WRZA 3TDUA 1YVHA 4ORCB 4I5KA 1B8LA 1CDMA 1NCXA 2K7BA 2LVVA 1YUSA 3OB1B 1B8CA 1UHJA 3MSEB 3CR2A 1BG1A 2KOTA 2KNEA 1U5IA 1CFDA 2JXCA 1EG3A 2BL0C 1JF2A 4I5JA 3JTDC 3M0WA 1DJYA 1B4CA 3SG3A 2RGIA 1S6IA 2KFHA 1DT7B 1FF1A 3EKHA 1TN4A 1KWOB 1TNQA 1XFYO 4AQJA 1TCOB 2D8NA 2JXLA 4MZJA 1NCZA 2MBXA 2EGDA 4QJ4B 1G8IA 5J3XA 3K21A 1QLSA 1DF0A 4USLA 2M7NA 4F0ZB 1IWQA 1CLLA 1SRAA 4XYNA 1FW4A 2JNXA 2Y1NA 1SW8A 1J7QA 1KQMB 1WLZA 2Y5IA 1XVJA 3ZWHA 2JPTA 3BQ3A 3PN7B 3F45A 2F2PA 4AOMA 1WRLA 3IQOA 1PVAA 1EL4A 2JT0A 1F70A 1VRKA 2LUXA 3DF0A 4YGCB 2JC2A 1RTP1 1QASA 5F6TA 1IJ5A 3DVJA 3SIAA 2R2IA 1KK8C 2WNDA 4GAOA 4CLNA 2OPOA 3EK8A 1KSOA 1BR1B 1K9UA 1AJ4A 4YI8A 4OV2A 3H4SE 2BKIB 4XJKA 1M46A 5ER5A 3BUMB 3FWBA 3TS5C 1PALA 4GPLB 2BCAA 1NPQA 2K2FA 3PM8A 3GK4X 1F55A 3A8RA 1BF5A 1TOPA 1FI6A 2COLB 2HQ8A 1ODBA 1J1DA 1UWOA 4AQIA 1LXFC 2KSPA 2NZ0A 2PMYA 4CIDA 1XO5A 1XFUO 4PHMA 2KAVA 3RLZA 1LKJA 2ZN8A 3CS1A 2GGMA 3KF9A 1W7JB 2KAXA 4HSZA 2LMTA 1H4BA 2MLFC 2FOTA 4N1GA 1A03A 1CM1A 2E30A 2PASA 3OP0A 2AMIA 3EKJA 1NWDA 1N2DA 3EK7A 2BCXA 1BOCA 1J1EA 1KCYA 2BBMA 2LHIA 2JWWA 1IQ5A 2AAOA 1AUIB 3OHMB 1WLMA 1K9KA 1TRFA 1Y6WA 3BUXB 5CSIA 5I2LA 1KSMA 1SCMB 4PHKA 2FCDA 1KFXS 1DJIA 1OSAA 4GBAA 4CFRA 2ZRSA 3VRPA 2FJUB 3EVUA 2DOQA 2PRUA 1BT6A 5CSNA 3OB2B 1UHNA 3TUYB 5FYXA 1ZACA 1HQVA 1SNLA 4ORBB 2GV5A 1K2HA 3IQQA 5AERA 2MAZA 1SMGA 1YVLA 2TN4A 2M29A 3BYAA 1DJXA 3NSOA 1GQMA 1X02A 1SPYA 3KPXA 2Q91A 3BUNB 3A4UB 4NDCA 4R1EA 1NP8A 1NX0A 4PE1A 2JNFA 5GQQC 1V1FA 1QVIZ 4PE7A 4JQ0D 3PSRA 2QACA 2LLTA
chains in the Genus database with same CATH superfamily
1M63B 1GGZA 4GGNA 5HKZA 1FBVA 4D1EA 1QX7A 1S1EA 1WDCC 4HRHA 1SBJA 4YI9A 1ZFSA 2WC6A 2M1UA 3HX4A 5HLVA 4E68A 1MF8B 3D76A 1K90D 3TDIA 4OVNF 3UO9A 3WHUB 1DTLA 1XA5A 1OMRA 4C0LA 1GGWA 3GK1A 1KK7Z 1W7IB 3V2LA 3I5IC 3SG7A 2K7CA 2MJWB 3SG4A 1IH0A 1S5GY 1BJFA 2H61A 3GOFA 2WC5A 1B7TY 3AKBA 1CLBA 1AVSA 1CLMA 1N0YA 1OMVA 3CGAA 4GFTA 4INWA 3E3RA 4OCIA 1XFWO 2LP2A 1NIWA 3TS5B 1PVBA 1M45A 1YR5A 3CZ1A 1BLQA 5I2QA 4ETOA 5HYDA 1RWYA 1TIZA 3OBVA 2EC6C 1Z2CB 2M97A 2KGBC 1D1OA 3EVRA 3JVTC 2M49B 3BXKA 4MN0A 1L2OC 2L2CA 4GUKA 1MXLC 4NDDA 2LVKA 4OKHA 2JTTA 3SS4A 1QV1A 3ICBA 2L98A 2JOJA 1YUTA 3I5HB 3CYZA 4Q04A 4DIRA 3S0GA 1SYMA 2HQWA 1A75B 2O5GA 2KQ6A 1S36A 1TNWA 3BUWB 2WOSA 3VRNA 1SR6B 1BU3A 5KTYA 1PRWA 3I5FC 2QDIA 5DKQA 2QEBA 1NX1A 2KQYA 2KBMA 3D77A 2LMVA 1AK8A 2ZRTA 1M39A 4WQ3A 1CDLA 2O60A 3FE8A 4YGBB 4UPGA 4MLWA 1ORGA 1A29A 1TCFA 3NSIA 4MSPA 4YBHB 1NX3A 1SL7A 2CXJA 4GGFA 1J7OA 5AEQA 3BOWB 2LANA 2BE6A 4PDZA 1DGVA 2ERBA 2QPTA 4MZLA 3NSLA 1IJ6A 2A4JA 5ER4X 3R1OA 3FS7A 1MR8A 1G4YR 1Y0VH 5CSJA 1F54A 1QIVA 1F4OA 2HF5A 3LL8B 2JULA 2P71A 3B88A 1MXEA 3O4XA 5AXIA 1C7VA 2I18A 5AANA 1K96A 4YRUA 1EJ3A 1DVIA 1E8AA 2WC8A 2I94A 4P2YB 3GK2A 1IGVA 2OS8B 2I2RE 2KLEA 5JOLA 3CTNA 1QLKA 1HT9A 1J7RA 5D7FA 2M9GA 5KSZA 3CABA 3S0AA 1XYDA 4ZCVA 4DUQA 4PE0A 4ZCUA 3EVVA 1UHIA 5HKYA 2GGZA 4NQGA 2EHBA 1MQ1A 4BY5A 1CFCA 5JJGA 3PN7C 4INXA 3S0EA 2Q4UA 1PSBA 5KU1A 1C3YA 4MVFA 1MUXA 3O78A 4FQTA 4MZKA 1JUOA 1YRTB 1XFVO 3AAKA 3KO0A 3O6BA 1V1GA 2BE4A 1ZMZA 2G2BA 3OX6A 3QMEA 4WRIA 5B8IB 1IG5A 2F8PA 1J55A 2L2EA 3VRQA 2WCFA 5CPVA 2P6BB 4QJ5B 1RECA 1YX8A 4HREE 4IJ7A 2I7AA 1F8HA 2OTGC 1DMOA 2L5XB 1JBAA 1UHKA 2G9BA 3ZNIA 4C0JA 2H61C 2LE9B 2SCPA 5DICA 4KYNA 3I5IB 1DGUA 4PHJA 5G08A 5PALA 2BL0B 3WXAA 1OZSA 3CZTX 1QWVA 1G33A 1Q80A 2M8UA 3JTDB 4I5LB 2V53A 1J7PA 3OX5A 4DCKA 3HCMA 5HLOA 1FPWA 3SIBA 2LLUA 3FWCA 1JFKA 1Z4HA 2PVBA 5TNCA 4OR9B 3UNWA 1S5GZ 1B7TZ 3PALA 1Y1XA 2WCJA 1AJ5A 1S6CA 4HRGA 3SG2A 1C7WA 1NYAA 1NCYA 1ZOTB 2JTZA 1RK9A 2LC5A 2LV7A 1SY9A 1Y1AA 1IRJA 2CT9A 3LCPC 1YURA 3BUOB 2M7LA 1KFXL 1SL9A 2BBNA 3JVTB 3TDZA 3VB1A 1L2OB 3NHTA 1JC2A 2KFGA 1NUBA 4JPZB 1UP5A 3I5GC 3DVMA 3KEVA 1OOIX 4PE4A 3B86A 1CNPA 4PALA 3AKAA 3DVKA 2MLEC 2Y1MA 1OQPA 2WCHA 1KQVA 1A75A 2KYCA 3RM1A 1CTRA 2F2OA 3NSKA 4IL1A 3VRRA 1CFFA 5DKRA 3I5FB 3Q8IA 1R2UA 3S0BA 3CLNA 1QX2A 4GGFC 5HKWA 2LHLA 1QXPA 1S3PA 2KHNA 1IQ3A 3NGVA 1XK4A 1KK8B 2LMUA 1CMGA 3O4YA 1ZUZA 2KAYA 4MRYA 4M2QA 3IF7A 1LVCD 1RJVA 1SCMC 1ALWA 2WCEA 2HPSA 2CCMA 3R1PA 1QV0A 2LUCA 2P70A 3BOWA 4PHNA 2NXQA 3SG5A 3SS3A 1JFJA 2M1KB 1T14A 3PM2A 1JSAA 2JU0A 2MA2A 1S6JA 3TUYC 3D0YB 3BFAA 4MEWA 2ISDA 3S0DA 1F4QA 4A4CA 2JZIA 4CFQA 3LK0A 1B9AA 2FCEA 1A4PA 2KI4C 2H2KA 2M3WA 4L9MA 5K89A 2ZN9A 4U8DA 3EK4A 1S26D 2LVIA 1PK0D 5D69A 2KFFA 1Y1UA 2KGRA 1AHRA 2PSRA 2VRGA 4MRXA 3PLFB 1QATA 2K0JA 2M0RA 3O2PA 4PT1A 1QIWA 2PALA 3WNXB 1QVIY 2ZNEA 3NXAA 1XFRA 2JRFA 4NDBA 3CWGA 1DEKA 1K8UA 1WRKA 4WQ2A 2JT8A 4C0KA 1CDNA 4ORAB 2MHHA 1CFPA 2SASA 1DJZA 1KFUS 2NCOA 2K7DA 2BECA 2LM5A 2HETA 2LAPA 1F71A 3VGOA 1A2XA 1LA3A 1OZOA 3R1VA 1ALVA 1KK7Y 1OMDA 2K7OA 3B87A 2L4IA 1QJTA 1U5IB 1SK6D 2B1UA 2KPHA 4TNCA 5BPJA 1IKUA 1EH2A 1SKTA 2NLNA 4CPVA 3L47A 2L5YA 2K61A 1NSHA 1NX2A 2BKHB 2K8MB 1RROA 2LNKA 3D10A 3DYEA 3KHEA 4F7FA 2OTGB 1C07A 1OOJA 3B7AA 5IBWA 2PQLA 4FTGA 1TWOA 3C1VA 4M2OA 1TNPA 2BNXA 3PATA 1KWOC 1B47A 3QRXA 3DVEA 4PCWA 1SL8A 2F33A 1R6PA 3SJSA 1DF0B 1PSRA 1KFUL 1W9ZA 3R72A 1MWNA 4N1FA 5I2OA 1YX7A 1L7ZA 2Y4QA 4P5OE 1K9PA 4BY4A 2KDHA 3PFVA 1B8RA 1TTXA 1KQMC 1QS7A 2K60A 1FI5A 1MHOA 4DRWA 1N65A 1UURA 4I5NB 2CBLA 2L51A 4DS7A 4FQOA 2L50A 3D73A 3I5HC 4YGEB 2KYFA 1C3ZA 1CMFA 4YGDB 2FJYA 2WORA 1BODA 2JQ6A 3DF0B 3S0FA 1JF0A 1OOGA 1DJHA 2ZNDA 1OE9B 3I5GB 1SR6C 3LK1A 2GTEA 2KLDA 4ICBA 1YRUB 1P28A 1DELA 1WDCB 1EXRA 1BMOA 1YTZC 4JD9A 4MBEA 4A4BA 2CTNA 1BR4B 1XK4C 2LP3A 2KBIA 3CR5X 5I8NA 3DXLA 2CNPA 3WHTB 1LS8A 1QX5B 4XJKB 2AUCA 1LINA 1OOHA 2WCBA 2IS9A 3EG5B 3BJHA 2F3YA 2JT3A 3DD4A 1AP4A 4QJ3B 1RFJA 1QTXA 3SG6A 1CKKA 3K1EA 2LVJA 1CDPA 3CR4X 4JWQA 1H8BA 2L0PA 1IIOA 4GNKB 4OZDA 3CZ2A 3D75A 5DKNA 1B1GA 3DZTA 2KI6C 1JWDA 1TUJA 2EC6B 1K93D 1CM4A 2K2AA 1XFZO 2NCPA 3VROA 1M31A 3FIAA 2ZFDA 1CB1A 1YUUA 2OS8C 2ZKMX 3D0YA 2KI4B 1LA0A 2L4HA 4JKTA 1DJGA 1DJWA 2LLSA 1OW4A 3NHIA 1TNXA 1UHHA 3LLEA 1SCVA 1XFXO 1WY9A 3FE6A 4YGAA 1K94A 2KI6D 2LCPA 2E6WA 2F3ZA 5AFPA 1EG4A 1GJYA 3AAJA 2MRDA 5CSFA 5EL2A 4N5XA 1UUSA 2BCBA 1PULA 2WCKA 3B6XA 3TZ1A 1K95A 3OGNA 4M2PA 1WRZA 3TDUA 1YVHA 3BFBA 4ORCB 3D78A 4I5KA 1SSEB 1B8LA 1CDMA 1OOFA 1NCXA 2K7BA 2LVVA 1YUSA 3OB1B 1B8CA 1UHJA 3MSEB 3CR2A 1BG1A 2KOTA 2KNEA 1U5IA 3L4AA 1CFDA 2JXCA 1EG3A 2BL0C 1JF2A 4I5JA 3JTDC 3M0WA 1DJYA 1B4CA 3SG3A 2RGIA 1S6IA 2KFHA 1DT7B 1FF1A 3EKHA 1TN4A 1KWOB 1TNQA 1XFYO 3FE9A 4AQJA 1TCOB 2D8NA 2JXLA 4MZJA 1NCZA 2MBXA 2EGDA 4QJ4B 1G8IA 3IVTA 5J3XA 3K21A 3PJIA 1QLSA 1DF0A 4USLA 2M7NA 4F0ZB 1IWQA 1CLLA 1TUZA 1SRAA 4XYNA 1FW4A 2JNXA 2Y1NA 1SW8A 1J7QA 1DQEA 1KQMB 1WLZA 5FI7A 2Y5IA 1XVJA 1DC1A 3ZWHA 2JPTA 3BQ3A 3PN7B 3F45A 2F2PA 4AOMA 1WRLA 3IQOA 1PVAA 1EL4A 2JT0A 1F70A 1VRKA 2LUXA 3DF0A 2QEOA 3N7HA 4YGCB 2JC2A 1RTP1 1QASA 5F6TA 1IJ5A 3DVJA 3SIAA 2R2IA 2QEVA 1KK8C 2WNDA 2PYQA 4GAOA 4CLNA 2OPOA 3EK8A 1KSOA 1BR1B 1K9UA 1AJ4A 3L4LA 4YI8A 4OV2A 3H4SE 2BKIB 4XJKA 1M46A 5FI6A 5ER5A 3BUMB 3FWBA 3TS5C 1PALA 3SS5A 4GPLB 2BCAA 1NPQA 2K2FA 3PM8A 3GK4X 1F55A 3A8RA 1BF5A 1TOPA 1FI6A 5D3OA 2COLB 2HQ8A 2JPOA 1ODBA 3BFHA 1J1DA 1UWOA 4AQIA 1LXFC 2KSPA 3CZ0A 2NZ0A 2PMYA 4CIDA 1XO5A 1XFUO 4PHMA 2WCMA 2KAVA 3RLZA 1LKJA 2ZN8A 3CS1A 2GGMA 3KF9A 1W7JB 2KAXA 4HSZA 2LMTA 1H4BA 3D74A 2MLFC 2FOTA 4N1GA 1A03A 1CM1A 2E30A 2PASA 3OP0A 2AMIA 3EKJA 1NWDA 1N2DA 5FI2A 3EK7A 2BCXA 1BOCA 1J1EA 1KCYA 2BBMA 2LHIA 2JWWA 1IQ5A 2AAOA 3DY9A 1AUIB 2H8VA 3OHMB 1WLMA 1K9KA 1TRFA 1Y6WA 3BUXB 5CSIA 5I2LA 3RZSA 1KSMA 1SCMB 4PHKA 2FCDA 1KFXS 1DJIA 1OSAA 4GBAA 4CFRA 2ZRSA 3VRPA 2FJUB 3EVUA 2DOQA 2PRUA 3CDNA 1BT6A 5CSNA 3OB2B 1UHNA 3TUYB 5FYXA 1ZACA 1HQVA 1SNLA 4ORBB 2GV5A 1K2HA 3IQQA 1GM0A 5AERA 2MAZA 1SMGA 2WCLA 1YVLA 2TN4A 2M29A 3BYAA 1DJXA 3NSOA 1GQMA 1X02A 1SPYA 3KPXA 2Q91A 3BUNB 2BAPA 3A4UB 5HL1A 4NDCA 4R1EA 1NP8A 1NX0A 2QEHA 4PE1A 2JNFA 2YGUA 5GQQC 1V1FA 1QVIZ 4PE7A 4JQ0D 3PSRA 2QACA 2LLTA 5I94A
chains in the Genus database with same CATH topology
1M63B 1GGZA 4GGNA 5HKZA 1FBVA 4D1EA 1QX7A 1S1EA 1WDCC 4HRHA 1SBJA 4YI9A 1ZFSA 2M1UA 3HX4A 5HLVA 4E68A 1MF8B 1K90D 3TDIA 4OVNF 4C0LA 3WHUB 1DTLA 1XA5A 1OMRA 1GGWA 3GK1A 1KK7Z 1W7IB 3I5IC 3SG7A 2K7CA 2MJWB 3SG4A 1IH0A 1S5GY 1BJFA 2H61A 3GOFA 1B7TY 3AKBA 1CLBA 1AVSA 1CLMA 1N0YA 1OMVA 3CGAA 4GFTA 4OCIA 3E3RA 1XFWO 2LP2A 1NIWA 3TS5B 1PVBA 1M45A 1YR5A 1BLQA 5I2QA 4ETOA 5HYDA 1RWYA 1TIZA 2EC6C 2M97A 2KGBC 1D1OA 3EVRA 3JVTC 2M49B 3BXKA 4MN0A 1L2OC 4GUKA 4NDDA 1MXLC 4OKHA 2LVKA 2JTTA 1QV1A 3ICBA 2L98A 2JOJA 1YUTA 3I5HB 4Q04A 4DIRA 1SYMA 2HQWA 1A75B 2O5GA 2KQ6A 1S36A 1TNWA 3BUWB 2WOSA 3VRNA 1SR6B 1BU3A 5KTYA 1PRWA 3I5FC 5DKQA 1NX1A 2KQYA 2KBMA 2LMVA 1AK8A 2ZRTA 1M39A 4WQ3A 1CDLA 2O60A 4YGBB 4UPGA 4MLWA 3NSIA 1A29A 1TCFA 4MSPA 4YBHB 1NX3A 1SL7A 2CXJA 4GGFA 1J7OA 5AEQA 3BOWB 2LANA 2BE6A 4PDZA 1DGVA 2QPTA 4MZLA 3NSLA 1IJ6A 2A4JA 5ER4X 3FS7A 1MR8A 1G4YR 1Y0VH 5CSJA 1F54A 1QIVA 1F4OA 2HF5A 3LL8B 2JULA 1MXEA 5AXIA 1C7VA 2I18A 5AANA 1K96A 4YRUA 1EJ3A 1DVIA 1E8AA 2WC8A 2I94A 4P2YB 3GK2A 1IGVA 2OS8B 2I2RE 5JOLA 3CTNA 1QLKA 1HT9A 1J7RA 5D7FA 2M9GA 5KSZA 1XYDA 4ZCVA 4DUQA 4PE0A 4ZCUA 3EVVA 1UHIA 5HKYA 2GGZA 4NQGA 2EHBA 1MQ1A 4BY5A 5JJGA 3PN7C 2Q4UA 1PSBA 5KU1A 4MVFA 1MUXA 3O78A 4MZKA 1JUOA 1YRTB 1XFVO 3AAKA 3KO0A 3O6BA 1V1GA 2BE4A 1ZMZA 2G2BA 3OX6A 4WRIA 5B8IB 1IG5A 2F8PA 1J55A 2L2EA 3VRQA 2WCFA 5CPVA 2P6BB 4QJ5B 1RECA 1YX8A 4HREE 1F8HA 2I7AA 2OTGC 1DMOA 2L5XB 1JBAA 1UHKA 2G9BA 3ZNIA 4C0JA 2H61C 2LE9B 2SCPA 3WXAA 3I5IB 1DGUA 4PHJA 5G08A 5PALA 2BL0B 1OZSA 3CZTX 2M8UA 1G33A 1Q80A 3JTDB 4I5LB 2V53A 1J7PA 3OX5A 4DCKA 3HCMA 5HLOA 1FPWA 3SIBA 2LLUA 3FWCA 1JFKA 2PVBA 5TNCA 4OR9B 1S5GZ 1B7TZ 3PALA 1Y1XA 3SG2A 1AJ5A 1S6CA 4HRGA 1C7WA 1NYAA 1NCYA 1ZOTB 2JTZA 1RK9A 2LC5A 2LV7A 1SY9A 1Y1AA 1IRJA 2CT9A 3LCPC 1YURA 3BUOB 2M7LA 1KFXL 1SL9A 2BBNA 3JVTB 3TDZA 1L2OB 1JC2A 2KFGA 1NUBA 1UP5A 3I5GC 3DVMA 3KEVA 4PE4A 1CNPA 4PALA 3AKAA 3DVKA 2MLEC 2Y1MA 1OQPA 1KQVA 1A75A 2KYCA 3RM1A 1CTRA 2F2OA 3NSKA 4IL1A 3VRRA 1CFFA 5DKRA 3I5FB 1R2UA 3CLNA 1QX2A 4GGFC 5HKWA 2LHLA 1QXPA 1S3PA 2KHNA 1IQ3A 1XK4A 1KK8B 2LMUA 1CMGA 3O4YA 1ZUZA 2KAYA 4MRYA 4M2QA 3IF7A 1LVCD 1RJVA 1SCMC 1ALWA 2WCEA 2HPSA 2CCMA 4PHNA 1QV0A 2LUCA 1CFCA 3BOWA 3SG5A 2NXQA 1JFJA 2M1KB 1JSAA 2JU0A 2MA2A 1S6JA 3TUYC 3D0YB 2ISDA 4MEWA 4A4CA 1F4QA 2JZIA 4CFQA 3LK0A 1B9AA 2FCEA 1A4PA 2KI4C 2H2KA 2M3WA 4L9MA 5K89A 2ZN9A 4U8DA 3EK4A 1S26D 2LVIA 1PK0D 5D69A 2KFFA 1Y1UA 2KGRA 1AHRA 2PSRA 2VRGA 4MRXA 3PLFB 1QATA 2K0JA 2M0RA 3O2PA 1QIWA 2PALA 3WNXB 1QVIY 2ZNEA 3NXAA 2JRFA 4NDBA 3CWGA 4WQ2A 1K8UA 1WRKA 2JT8A 4C0KA 1CDNA 4ORAB 2MHHA 1CFPA 2SASA 1DJZA 1KFUS 2NCOA 2K7DA 2BECA 2LM5A 2HETA 2LAPA 1F71A 3VGOA 1A2XA 1LA3A 1OZOA 1ALVA 1KK7Y 1OMDA 2K7OA 4TNCA 2L4IA 1QJTA 1U5IB 1SK6D 2B1UA 5BPJA 1EH2A 1IKUA 1SKTA 2NLNA 4CPVA 2K61A 1NSHA 1NX2A 2BKHB 2K8MB 1RROA 2LNKA 3D10A 3KHEA 4JPZB 1C07A 2OTGB 1OOJA 5IBWA 4FTGA 3C1VA 4M2OA 1TNPA 3PATA 1KWOC 1B47A 3QRXA 3DVEA 4PCWA 1SL8A 2F33A 1R6PA 3SJSA 1DF0B 1PSRA 1KFUL 1MWNA 4N1FA 5I2OA 1YX7A 1L7ZA 2Y4QA 4P5OE 1K9PA 4BY4A 2KDHA 3PFVA 1B8RA 1TTXA 1KQMC 1QS7A 1FI5A 1MHOA 4DRWA 1N65A 1UURA 4I5NB 2CBLA 2L51A 4DS7A 4FQOA 2L50A 4YGEB 3I5HC 1CMFA 2KYFA 4YGDB 2WORA 1BODA 2JQ6A 3DF0B 1JF0A 1DJHA 2ZNDA 1OE9B 3I5GB 1SR6C 3LK1A 4ICBA 1YRUB 1WDCB 1EXRA 1BMOA 1YTZC 4MBEA 4A4BA 2CTNA 1BR4B 1XK4C 2LP3A 2KBIA 3CR5X 5I8NA 2CNPA 3WHTB 1QX5B 4XJKB 2AUCA 1LINA 2WCBA 2IS9A 2F3YA 2JT3A 3DD4A 1AP4A 4QJ3B 1RFJA 1QTXA 3SG6A 1CKKA 2LVJA 1CDPA 3CR4X 4JWQA 1H8BA 2L0PA 4GNKB 5DKNA 1B1GA 2KI6C 1JWDA 2EC6B 1K93D 1CM4A 2K2AA 1XFZO 2NCPA 3VROA 1M31A 3FIAA 2ZFDA 1CB1A 1YUUA 2OS8C 2ZKMX 3D0YA 2KI4B 1LA0A 2L4HA 1DJGA 1DJWA 2LLSA 1TNXA 1UHHA 3LLEA 1SCVA 1XFXO 1WY9A 4YGAA 1K94A 2KI6D 2LCPA 2E6WA 2F3ZA 5AFPA 1EG4A 1GJYA 3AAJA 2MRDA 5CSFA 4N5XA 1UUSA 2BCBA 1PULA 3TZ1A 1K95A 4M2PA 1WRZA 3TDUA 1YVHA 4ORCB 4I5KA 1B8LA 1CDMA 1NCXA 2K7BA 2LVVA 1YUSA 3OB1B 1B8CA 1UHJA 3MSEB 3CR2A 1BG1A 2KOTA 2KNEA 1U5IA 1CFDA 2JXCA 1EG3A 2BL0C 1JF2A 4I5JA 3JTDC 3M0WA 1DJYA 1B4CA 3SG3A 2RGIA 1S6IA 2KFHA 1DT7B 1FF1A 3EKHA 1TN4A 1KWOB 1TNQA 1XFYO 4AQJA 1TCOB 2D8NA 2JXLA 4MZJA 1NCZA 2MBXA 2EGDA 4QJ4B 1G8IA 5J3XA 3K21A 1QLSA 1DF0A 4USLA 2M7NA 4F0ZB 1IWQA 1CLLA 1SRAA 4XYNA 1FW4A 2JNXA 2Y1NA 1SW8A 1J7QA 1KQMB 1WLZA 2Y5IA 1XVJA 3ZWHA 2JPTA 3BQ3A 3PN7B 3F45A 2F2PA 4AOMA 1WRLA 3IQOA 1PVAA 1EL4A 2JT0A 1F70A 1VRKA 2LUXA 3DF0A 4YGCB 2JC2A 1RTP1 1QASA 5F6TA 1IJ5A 3DVJA 3SIAA 2R2IA 1KK8C 2WNDA 4GAOA 4CLNA 2OPOA 3EK8A 1KSOA 1BR1B 1K9UA 1AJ4A 4YI8A 4OV2A 3H4SE 2BKIB 4XJKA 1M46A 5ER5A 3BUMB 3FWBA 3TS5C 1PALA 4GPLB 2BCAA 1NPQA 2K2FA 3PM8A 3GK4X 1F55A 3A8RA 1BF5A 1TOPA 1FI6A 2COLB 2HQ8A 1ODBA 1J1DA 1UWOA 4AQIA 1LXFC 2KSPA 2NZ0A 2PMYA 4CIDA 1XO5A 1XFUO 4PHMA 2KAVA 3RLZA 1LKJA 2ZN8A 3CS1A 2GGMA 3KF9A 1W7JB 2KAXA 4HSZA 2LMTA 1H4BA 2MLFC 2FOTA 4N1GA 1A03A 1CM1A 2E30A 2PASA 3OP0A 2AMIA 3EKJA 1NWDA 1N2DA 3EK7A 2BCXA 1BOCA 1J1EA 1KCYA 2BBMA 2LHIA 2JWWA 1IQ5A 2AAOA 1AUIB 3OHMB 1WLMA 1K9KA 1TRFA 1Y6WA 3BUXB 5CSIA 5I2LA 1KSMA 1SCMB 4PHKA 2FCDA 1KFXS 1DJIA 1OSAA 4GBAA 4CFRA 2ZRSA 3VRPA 2FJUB 3EVUA 2DOQA 2PRUA 1BT6A 5CSNA 3OB2B 1UHNA 3TUYB 5FYXA 1ZACA 1HQVA 1SNLA 4ORBB 2GV5A 1K2HA 3IQQA 5AERA 2MAZA 1SMGA 1YVLA 2TN4A 2M29A 3BYAA 1DJXA 3NSOA 1GQMA 1X02A 1SPYA 3KPXA 2Q91A 3BUNB 3A4UB 4NDCA 4R1EA 1NP8A 1NX0A 4PE1A 2JNFA 5GQQC 1V1FA 1QVIZ 4PE7A 4JQ0D 3PSRA 2QACA 2LLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M63 B;  1GGZ A;  4GGN A;  5HKZ A;  1FBV A;  4D1E A;  1QX7 A;  1S1E A;  1WDC C;  4HRH A;  1SBJ A;  4YI9 A;  1ZFS A;  2M1U A;  3HX4 A;  5HLV A;  4E68 A;  1MF8 B;  1K90 D;  3TDI A;  4OVN F;  4C0L A;  3WHU B;  1DTL A;  1XA5 A;  1OMR A;  1GGW A;  3GK1 A;  1KK7 Z;  1W7I B;  3I5I C;  3SG7 A;  2K7C A;  2MJW B;  3SG4 A;  1IH0 A;  1S5G Y;  1BJF A;  2H61 A;  3GOF A;  1B7T Y;  3AKB A;  1CLB A;  1AVS A;  1CLM A;  1N0Y A;  1OMV A;  3CGA A;  4GFT A;  4OCI A;  3E3R A;  1XFW O;  2LP2 A;  1NIW A;  3TS5 B;  1PVB A;  1M45 A;  1YR5 A;  1BLQ A;  5I2Q A;  4ETO A;  5HYD A;  1RWY A;  1TIZ A;  2EC6 C;  2M97 A;  2KGB C;  1D1O A;  3EVR A;  3JVT C;  2M49 B;  3BXK A;  4MN0 A;  1L2O C;  4GUK A;  4NDD A;  1MXL C;  4OKH A;  2LVK A;  2JTT A;  1QV1 A;  3ICB A;  2L98 A;  2JOJ A;  1YUT A;  3I5H B;  4Q04 A;  4DIR A;  1SYM A;  2HQW A;  1A75 B;  2O5G A;  2KQ6 A;  1S36 A;  1TNW A;  3BUW B;  2WOS A;  3VRN A;  1SR6 B;  1BU3 A;  5KTY A;  1PRW A;  3I5F C;  5DKQ A;  1NX1 A;  2KQY A;  2KBM A;  2LMV A;  1AK8 A;  2ZRT A;  1M39 A;  4WQ3 A;  1CDL A;  2O60 A;  4YGB B;  4UPG A;  4MLW A;  3NSI A;  1A29 A;  1TCF A;  4MSP A;  4YBH B;  1NX3 A;  1SL7 A;  2CXJ A;  4GGF A;  1J7O A;  5AEQ A;  3BOW B;  2LAN A;  2BE6 A;  4PDZ A;  1DGV A;  2QPT A;  4MZL A;  3NSL A;  1IJ6 A;  2A4J A;  5ER4 X;  3FS7 A;  1MR8 A;  1G4Y R;  1Y0V H;  5CSJ A;  1F54 A;  1QIV A;  1F4O A;  2HF5 A;  3LL8 B;  2JUL A;  1MXE A;  5AXI A;  1C7V A;  2I18 A;  5AAN A;  1K96 A;  4YRU A;  1EJ3 A;  1DVI A;  1E8A A;  2WC8 A;  2I94 A;  4P2Y B;  3GK2 A;  1IGV A;  2OS8 B;  2I2R E;  5JOL A;  3CTN A;  1QLK A;  1HT9 A;  1J7R A;  5D7F A;  2M9G A;  5KSZ A;  1XYD A;  4ZCV A;  4DUQ A;  4PE0 A;  4ZCU A;  3EVV A;  1UHI A;  5HKY A;  2GGZ A;  4NQG A;  2EHB A;  1MQ1 A;  4BY5 A;  5JJG A;  3PN7 C;  2Q4U A;  1PSB A;  5KU1 A;  4MVF A;  1MUX A;  3O78 A;  4MZK A;  1JUO A;  1YRT B;  1XFV O;  3AAK A;  3KO0 A;  3O6B A;  1V1G A;  2BE4 A;  1ZMZ A;  2G2B A;  3OX6 A;  4WRI A;  5B8I B;  1IG5 A;  2F8P A;  1J55 A;  2L2E A;  3VRQ A;  2WCF A;  5CPV A;  2P6B B;  4QJ5 B;  1REC A;  1YX8 A;  4HRE E;  1F8H A;  2I7A A;  2OTG C;  1DMO A;  2L5X B;  1JBA A;  1UHK A;  2G9B A;  3ZNI A;  4C0J A;  2H61 C;  2LE9 B;  2SCP A;  3WXA A;  3I5I B;  1DGU A;  4PHJ A;  5G08 A;  5PAL A;  2BL0 B;  1OZS A;  3CZT X;  2M8U A;  1G33 A;  1Q80 A;  3JTD B;  4I5L B;  2V53 A;  1J7P A;  3OX5 A;  4DCK A;  3HCM A;  5HLO A;  1FPW A;  3SIB A;  2LLU A;  3FWC A;  1JFK A;  2PVB A;  5TNC A;  4OR9 B;  1S5G Z;  1B7T Z;  3PAL A;  1Y1X A;  3SG2 A;  1AJ5 A;  1S6C A;  4HRG A;  1C7W A;  1NYA A;  1NCY A;  1ZOT B;  2JTZ A;  1RK9 A;  2LC5 A;  2LV7 A;  1SY9 A;  1Y1A A;  1IRJ A;  2CT9 A;  3LCP C;  1YUR A;  3BUO B;  2M7L A;  1KFX L;  1SL9 A;  2BBN A;  3JVT B;  3TDZ A;  1L2O B;  1JC2 A;  2KFG A;  1NUB A;  1UP5 A;  3I5G C;  3DVM A;  3KEV A;  4PE4 A;  1CNP A;  4PAL A;  3AKA A;  3DVK A;  2MLE C;  2Y1M A;  1OQP A;  1KQV A;  1A75 A;  2KYC A;  3RM1 A;  1CTR A;  2F2O A;  3NSK A;  4IL1 A;  3VRR A;  1CFF A;  5DKR A;  3I5F B;  1R2U A;  3CLN A;  1QX2 A;  4GGF C;  5HKW A;  2LHL A;  1QXP A;  1S3P A;  2KHN A;  1IQ3 A;  1XK4 A;  1KK8 B;  2LMU A;  1CMG A;  3O4Y A;  1ZUZ A;  2KAY A;  4MRY A;  4M2Q A;  3IF7 A;  1LVC D;  1RJV A;  1SCM C;  1ALW A;  2WCE A;  2HPS A;  2CCM A;  4PHN A;  1QV0 A;  2LUC A;  1CFC A;  3BOW A;  3SG5 A;  2NXQ A;  1JFJ A;  2M1K B;  1JSA A;  2JU0 A;  2MA2 A;  1S6J A;  3TUY C;  3D0Y B;  2ISD A;  4MEW A;  4A4C A;  1F4Q A;  2JZI A;  4CFQ A;  3LK0 A;  1B9A A;  2FCE A;  1A4P A;  2KI4 C;  2H2K A;  2M3W A;  4L9M A;  5K89 A;  2ZN9 A;  4U8D A;  3EK4 A;  1S26 D;  2LVI A;  1PK0 D;  5D69 A;  2KFF A;  1Y1U A;  2KGR A;  1AHR A;  2PSR A;  2VRG A;  4MRX A;  3PLF B;  1QAT A;  2K0J A;  2M0R A;  3O2P A;  1QIW A;  2PAL A;  3WNX B;  1QVI Y;  2ZNE A;  3NXA A;  2JRF A;  4NDB A;  3CWG A;  4WQ2 A;  1K8U A;  1WRK A;  2JT8 A;  4C0K A;  1CDN A;  4ORA B;  2MHH A;  1CFP A;  2SAS A;  1DJZ A;  1KFU S;  2NCO A;  2K7D A;  2BEC A;  2LM5 A;  2HET A;  2LAP A;  1F71 A;  3VGO A;  1A2X A;  1LA3 A;  1OZO A;  1ALV A;  1KK7 Y;  1OMD A;  2K7O A;  4TNC A;  2L4I A;  1QJT A;  1U5I B;  1SK6 D;  2B1U A;  5BPJ A;  1EH2 A;  1IKU A;  1SKT A;  2NLN A;  4CPV A;  2K61 A;  1NSH A;  1NX2 A;  2BKH B;  2K8M B;  1RRO A;  2LNK A;  3D10 A;  3KHE A;  4JPZ B;  1C07 A;  2OTG B;  1OOJ A;  5IBW A;  4FTG A;  3C1V A;  4M2O A;  1TNP A;  3PAT A;  1KWO C;  1B47 A;  3QRX A;  3DVE A;  4PCW A;  1SL8 A;  2F33 A;  1R6P A;  3SJS A;  1DF0 B;  1PSR A;  1KFU L;  1MWN A;  4N1F A;  5I2O A;  1YX7 A;  1L7Z A;  2Y4Q A;  4P5O E;  1K9P A;  4BY4 A;  2KDH A;  3PFV A;  1B8R A;  1TTX A;  1KQM C;  1QS7 A;  1FI5 A;  1MHO A;  4DRW A;  1N65 A;  1UUR A;  4I5N B;  2CBL A;  2L51 A;  4DS7 A;  4FQO A;  2L50 A;  4YGE B;  3I5H C;  1CMF A;  2KYF A;  4YGD B;  2WOR A;  1BOD A;  2JQ6 A;  3DF0 B;  1JF0 A;  1DJH A;  2ZND A;  1OE9 B;  3I5G B;  1SR6 C;  3LK1 A;  4ICB A;  1YRU B;  1WDC B;  1EXR A;  1BMO A;  1YTZ C;  4MBE A;  4A4B A;  2CTN A;  1BR4 B;  1XK4 C;  2LP3 A;  2KBI A;  3CR5 X;  5I8N A;  2CNP A;  3WHT B;  1QX5 B;  4XJK B;  2AUC A;  1LIN A;  2WCB A;  2IS9 A;  2F3Y A;  2JT3 A;  3DD4 A;  1AP4 A;  4QJ3 B;  1RFJ A;  1QTX A;  3SG6 A;  1CKK A;  2LVJ A;  1CDP A;  3CR4 X;  4JWQ A;  1H8B A;  2L0P A;  4GNK B;  5DKN A;  1B1G A;  2KI6 C;  1JWD A;  2EC6 B;  1K93 D;  1CM4 A;  2K2A A;  1XFZ O;  2NCP A;  3VRO A;  1M31 A;  3FIA A;  2ZFD A;  1CB1 A;  1YUU A;  2OS8 C;  2ZKM X;  3D0Y A;  2KI4 B;  1LA0 A;  2L4H A;  1DJG A;  1DJW A;  2LLS A;  1TNX A;  1UHH A;  3LLE A;  1SCV A;  1XFX O;  1WY9 A;  4YGA A;  1K94 A;  2KI6 D;  2LCP A;  2E6W A;  2F3Z A;  5AFP A;  1EG4 A;  1GJY A;  3AAJ A;  2MRD A;  5CSF A;  4N5X A;  1UUS A;  2BCB A;  1PUL A;  3TZ1 A;  1K95 A;  4M2P A;  1WRZ A;  3TDU A;  1YVH A;  4ORC B;  4I5K A;  1B8L A;  1CDM A;  1NCX A;  2K7B A;  2LVV A;  1YUS A;  3OB1 B;  1B8C A;  1UHJ A;  3MSE B;  3CR2 A;  1BG1 A;  2KOT A;  2KNE A;  1U5I A;  1CFD A;  2JXC A;  1EG3 A;  2BL0 C;  1JF2 A;  4I5J A;  3JTD C;  3M0W A;  1DJY A;  1B4C A;  3SG3 A;  2RGI A;  1S6I A;  2KFH A;  1DT7 B;  1FF1 A;  3EKH A;  1TN4 A;  1KWO B;  1TNQ A;  1XFY O;  4AQJ A;  1TCO B;  2D8N A;  2JXL A;  4MZJ A;  1NCZ A;  2MBX A;  2EGD A;  4QJ4 B;  1G8I A;  5J3X A;  3K21 A;  1QLS A;  1DF0 A;  4USL A;  2M7N A;  4F0Z B;  1IWQ A;  1CLL A;  1SRA A;  4XYN A;  1FW4 A;  2JNX A;  2Y1N A;  1SW8 A;  1J7Q A;  1KQM B;  1WLZ A;  2Y5I A;  1XVJ A;  3ZWH A;  2JPT A;  3BQ3 A;  3PN7 B;  3F45 A;  2F2P A;  4AOM A;  1WRL A;  3IQO A;  1PVA A;  1EL4 A;  2JT0 A;  1F70 A;  1VRK A;  2LUX A;  3DF0 A;  4YGC B;  2JC2 A;  1RTP 1;  1QAS A;  5F6T A;  1IJ5 A;  3DVJ A;  3SIA A;  2R2I A;  1KK8 C;  2WND A;  4GAO A;  4CLN A;  2OPO A;  3EK8 A;  1KSO A;  1BR1 B;  1K9U A;  1AJ4 A;  4YI8 A;  4OV2 A;  3H4S E;  2BKI B;  4XJK A;  1M46 A;  5ER5 A;  3BUM B;  3FWB A;  3TS5 C;  1PAL A;  4GPL B;  2BCA A;  1NPQ A;  2K2F A;  3PM8 A;  3GK4 X;  1F55 A;  3A8R A;  1BF5 A;  1TOP A;  1FI6 A;  2COL B;  2HQ8 A;  1ODB A;  1J1D A;  1UWO A;  4AQI A;  1LXF C;  2KSP A;  2NZ0 A;  2PMY A;  4CID A;  1XO5 A;  1XFU O;  4PHM A;  2KAV A;  3RLZ A;  1LKJ A;  2ZN8 A;  3CS1 A;  2GGM A;  3KF9 A;  1W7J B;  2KAX A;  4HSZ A;  2LMT A;  1H4B A;  2MLF C;  2FOT A;  4N1G A;  1A03 A;  1CM1 A;  2E30 A;  2PAS A;  3OP0 A;  2AMI A;  3EKJ A;  1NWD A;  1N2D A;  3EK7 A;  2BCX A;  1BOC A;  1J1E A;  1KCY A;  2BBM A;  2LHI A;  2JWW A;  1IQ5 A;  2AAO A;  1AUI B;  3OHM B;  1WLM A;  1K9K A;  1TRF A;  1Y6W A;  3BUX B;  5CSI A;  5I2L A;  1KSM A;  1SCM B;  4PHK A;  2FCD A;  1KFX S;  1DJI A;  1OSA A;  4GBA A;  4CFR A;  2ZRS A;  3VRP A;  2FJU B;  3EVU A;  2DOQ A;  2PRU A;  1BT6 A;  5CSN A;  3OB2 B;  1UHN A;  3TUY B;  5FYX A;  1ZAC A;  1HQV A;  1SNL A;  4ORB B;  2GV5 A;  1K2H A;  3IQQ A;  5AER A;  2MAZ A;  1SMG A;  1YVL A;  2TN4 A;  2M29 A;  3BYA A;  1DJX A;  3NSO A;  1GQM A;  1X02 A;  1SPY A;  3KPX A;  2Q91 A;  3BUN B;  3A4U B;  4NDC A;  4R1E A;  1NP8 A;  1NX0 A;  4PE1 A;  2JNF A;  5GQQ C;  1V1F A;  1QVI Z;  4PE7 A;  4JQ0 D;  3PSR A;  2QAC A;  2LLT A; 
#chains in the Genus database with same CATH topology
 1M63 B;  1GGZ A;  4GGN A;  5HKZ A;  1FBV A;  4D1E A;  1QX7 A;  1S1E A;  1WDC C;  4HRH A;  1SBJ A;  4YI9 A;  1ZFS A;  2WC6 A;  2M1U A;  3HX4 A;  5HLV A;  4E68 A;  1MF8 B;  3D76 A;  1K90 D;  3TDI A;  4OVN F;  3UO9 A;  3WHU B;  1DTL A;  1XA5 A;  1OMR A;  4C0L A;  1GGW A;  3GK1 A;  1KK7 Z;  1W7I B;  3V2L A;  3I5I C;  3SG7 A;  2K7C A;  2MJW B;  3SG4 A;  1IH0 A;  1S5G Y;  1BJF A;  2H61 A;  3GOF A;  2WC5 A;  1B7T Y;  3AKB A;  1CLB A;  1AVS A;  1CLM A;  1N0Y A;  1OMV A;  3CGA A;  4GFT A;  4INW A;  3E3R A;  4OCI A;  1XFW O;  2LP2 A;  1NIW A;  3TS5 B;  1PVB A;  1M45 A;  1YR5 A;  3CZ1 A;  1BLQ A;  5I2Q A;  4ETO A;  5HYD A;  1RWY A;  1TIZ A;  3OBV A;  2EC6 C;  1Z2C B;  2M97 A;  2KGB C;  1D1O A;  3EVR A;  3JVT C;  2M49 B;  3BXK A;  4MN0 A;  1L2O C;  2L2C A;  4GUK A;  1MXL C;  4NDD A;  2LVK A;  4OKH A;  2JTT A;  3SS4 A;  1QV1 A;  3ICB A;  2L98 A;  2JOJ A;  1YUT A;  3I5H B;  3CYZ A;  4Q04 A;  4DIR A;  3S0G A;  1SYM A;  2HQW A;  1A75 B;  2O5G A;  2KQ6 A;  1S36 A;  1TNW A;  3BUW B;  2WOS A;  3VRN A;  1SR6 B;  1BU3 A;  5KTY A;  1PRW A;  3I5F C;  2QDI A;  5DKQ A;  2QEB A;  1NX1 A;  2KQY A;  2KBM A;  3D77 A;  2LMV A;  1AK8 A;  2ZRT A;  1M39 A;  4WQ3 A;  1CDL A;  2O60 A;  3FE8 A;  4YGB B;  4UPG A;  4MLW A;  1ORG A;  1A29 A;  1TCF A;  3NSI A;  4MSP A;  4YBH B;  1NX3 A;  1SL7 A;  2CXJ A;  4GGF A;  1J7O A;  5AEQ A;  3BOW B;  2LAN A;  2BE6 A;  4PDZ A;  1DGV A;  2ERB A;  2QPT A;  4MZL A;  3NSL A;  1IJ6 A;  2A4J A;  5ER4 X;  3R1O A;  3FS7 A;  1MR8 A;  1G4Y R;  1Y0V H;  5CSJ A;  1F54 A;  1QIV A;  1F4O A;  2HF5 A;  3LL8 B;  2JUL A;  2P71 A;  3B88 A;  1MXE A;  3O4X A;  5AXI A;  1C7V A;  2I18 A;  5AAN A;  1K96 A;  4YRU A;  1EJ3 A;  1DVI A;  1E8A A;  2WC8 A;  2I94 A;  4P2Y B;  3GK2 A;  1IGV A;  2OS8 B;  2I2R E;  2KLE A;  5JOL A;  3CTN A;  1QLK A;  1HT9 A;  1J7R A;  5D7F A;  2M9G A;  5KSZ A;  3CAB A;  3S0A A;  1XYD A;  4ZCV A;  4DUQ A;  4PE0 A;  4ZCU A;  3EVV A;  1UHI A;  5HKY A;  2GGZ A;  4NQG A;  2EHB A;  1MQ1 A;  4BY5 A;  1CFC A;  5JJG A;  3PN7 C;  4INX A;  3S0E A;  2Q4U A;  1PSB A;  5KU1 A;  1C3Y A;  4MVF A;  1MUX A;  3O78 A;  4FQT A;  4MZK A;  1JUO A;  1YRT B;  1XFV O;  3AAK A;  3KO0 A;  3O6B A;  1V1G A;  2BE4 A;  1ZMZ A;  2G2B A;  3OX6 A;  3QME A;  4WRI A;  5B8I B;  1IG5 A;  2F8P A;  1J55 A;  2L2E A;  3VRQ A;  2WCF A;  5CPV A;  2P6B B;  4QJ5 B;  1REC A;  1YX8 A;  4HRE E;  4IJ7 A;  2I7A A;  1F8H A;  2OTG C;  1DMO A;  2L5X B;  1JBA A;  1UHK A;  2G9B A;  3ZNI A;  4C0J A;  2H61 C;  2LE9 B;  2SCP A;  5DIC A;  4KYN A;  3I5I B;  1DGU A;  4PHJ A;  5G08 A;  5PAL A;  2BL0 B;  3WXA A;  1OZS A;  3CZT X;  1QWV A;  1G33 A;  1Q80 A;  2M8U A;  3JTD B;  4I5L B;  2V53 A;  1J7P A;  3OX5 A;  4DCK A;  3HCM A;  5HLO A;  1FPW A;  3SIB A;  2LLU A;  3FWC A;  1JFK A;  1Z4H A;  2PVB A;  5TNC A;  4OR9 B;  3UNW A;  1S5G Z;  1B7T Z;  3PAL A;  1Y1X A;  2WCJ A;  1AJ5 A;  1S6C A;  4HRG A;  3SG2 A;  1C7W A;  1NYA A;  1NCY A;  1ZOT B;  2JTZ A;  1RK9 A;  2LC5 A;  2LV7 A;  1SY9 A;  1Y1A A;  1IRJ A;  2CT9 A;  3LCP C;  1YUR A;  3BUO B;  2M7L A;  1KFX L;  1SL9 A;  2BBN A;  3JVT B;  3TDZ A;  3VB1 A;  1L2O B;  3NHT A;  1JC2 A;  2KFG A;  1NUB A;  4JPZ B;  1UP5 A;  3I5G C;  3DVM A;  3KEV A;  1OOI X;  4PE4 A;  3B86 A;  1CNP A;  4PAL A;  3AKA A;  3DVK A;  2MLE C;  2Y1M A;  1OQP A;  2WCH A;  1KQV A;  1A75 A;  2KYC A;  3RM1 A;  1CTR A;  2F2O A;  3NSK A;  4IL1 A;  3VRR A;  1CFF A;  5DKR A;  3I5F B;  3Q8I A;  1R2U A;  3S0B A;  3CLN A;  1QX2 A;  4GGF C;  5HKW A;  2LHL A;  1QXP A;  1S3P A;  2KHN A;  1IQ3 A;  3NGV A;  1XK4 A;  1KK8 B;  2LMU A;  1CMG A;  3O4Y A;  1ZUZ A;  2KAY A;  4MRY A;  4M2Q A;  3IF7 A;  1LVC D;  1RJV A;  1SCM C;  1ALW A;  2WCE A;  2HPS A;  2CCM A;  3R1P A;  1QV0 A;  2LUC A;  2P70 A;  3BOW A;  4PHN A;  2NXQ A;  3SG5 A;  3SS3 A;  1JFJ A;  2M1K B;  1T14 A;  3PM2 A;  1JSA A;  2JU0 A;  2MA2 A;  1S6J A;  3TUY C;  3D0Y B;  3BFA A;  4MEW A;  2ISD A;  3S0D A;  1F4Q A;  4A4C A;  2JZI A;  4CFQ A;  3LK0 A;  1B9A A;  2FCE A;  1A4P A;  2KI4 C;  2H2K A;  2M3W A;  4L9M A;  5K89 A;  2ZN9 A;  4U8D A;  3EK4 A;  1S26 D;  2LVI A;  1PK0 D;  5D69 A;  2KFF A;  1Y1U A;  2KGR A;  1AHR A;  2PSR A;  2VRG A;  4MRX A;  3PLF B;  1QAT A;  2K0J A;  2M0R A;  3O2P A;  4PT1 A;  1QIW A;  2PAL A;  3WNX B;  1QVI Y;  2ZNE A;  3NXA A;  1XFR A;  2JRF A;  4NDB A;  3CWG A;  1DEK A;  1K8U A;  1WRK A;  4WQ2 A;  2JT8 A;  4C0K A;  1CDN A;  4ORA B;  2MHH A;  1CFP A;  2SAS A;  1DJZ A;  1KFU S;  2NCO A;  2K7D A;  2BEC A;  2LM5 A;  2HET A;  2LAP A;  1F71 A;  3VGO A;  1A2X A;  1LA3 A;  1OZO A;  3R1V A;  1ALV A;  1KK7 Y;  1OMD A;  2K7O A;  3B87 A;  2L4I A;  1QJT A;  1U5I B;  1SK6 D;  2B1U A;  2KPH A;  4TNC A;  5BPJ A;  1IKU A;  1EH2 A;  1SKT A;  2NLN A;  4CPV A;  3L47 A;  2L5Y A;  2K61 A;  1NSH A;  1NX2 A;  2BKH B;  2K8M B;  1RRO A;  2LNK A;  3D10 A;  3DYE A;  3KHE A;  4F7F A;  2OTG B;  1C07 A;  1OOJ A;  3B7A A;  5IBW A;  2PQL A;  4FTG A;  1TWO A;  3C1V A;  4M2O A;  1TNP A;  2BNX A;  3PAT A;  1KWO C;  1B47 A;  3QRX A;  3DVE A;  4PCW A;  1SL8 A;  2F33 A;  1R6P A;  3SJS A;  1DF0 B;  1PSR A;  1KFU L;  1W9Z A;  3R72 A;  1MWN A;  4N1F A;  5I2O A;  1YX7 A;  1L7Z A;  2Y4Q A;  4P5O E;  1K9P A;  4BY4 A;  2KDH A;  3PFV A;  1B8R A;  1TTX A;  1KQM C;  1QS7 A;  2K60 A;  1FI5 A;  1MHO A;  4DRW A;  1N65 A;  1UUR A;  4I5N B;  2CBL A;  2L51 A;  4DS7 A;  4FQO A;  2L50 A;  3D73 A;  3I5H C;  4YGE B;  2KYF A;  1C3Z A;  1CMF A;  4YGD B;  2FJY A;  2WOR A;  1BOD A;  2JQ6 A;  3DF0 B;  3S0F A;  1JF0 A;  1OOG A;  1DJH A;  2ZND A;  1OE9 B;  3I5G B;  1SR6 C;  3LK1 A;  2GTE A;  2KLD A;  4ICB A;  1YRU B;  1P28 A;  1DEL A;  1WDC B;  1EXR A;  1BMO A;  1YTZ C;  4JD9 A;  4MBE A;  4A4B A;  2CTN A;  1BR4 B;  1XK4 C;  2LP3 A;  2KBI A;  3CR5 X;  5I8N A;  3DXL A;  2CNP A;  3WHT B;  1LS8 A;  1QX5 B;  4XJK B;  2AUC A;  1LIN A;  1OOH A;  2WCB A;  2IS9 A;  3EG5 B;  3BJH A;  2F3Y A;  2JT3 A;  3DD4 A;  1AP4 A;  4QJ3 B;  1RFJ A;  1QTX A;  3SG6 A;  1CKK A;  3K1E A;  2LVJ A;  1CDP A;  3CR4 X;  4JWQ A;  1H8B A;  2L0P A;  1IIO A;  4GNK B;  4OZD A;  3CZ2 A;  3D75 A;  5DKN A;  1B1G A;  3DZT A;  2KI6 C;  1JWD A;  1TUJ A;  2EC6 B;  1K93 D;  1CM4 A;  2K2A A;  1XFZ O;  2NCP A;  3VRO A;  1M31 A;  3FIA A;  2ZFD A;  1CB1 A;  1YUU A;  2OS8 C;  2ZKM X;  3D0Y A;  2KI4 B;  1LA0 A;  2L4H A;  4JKT A;  1DJG A;  1DJW A;  2LLS A;  1OW4 A;  3NHI A;  1TNX A;  1UHH A;  3LLE A;  1SCV A;  1XFX O;  1WY9 A;  3FE6 A;  4YGA A;  1K94 A;  2KI6 D;  2LCP A;  2E6W A;  2F3Z A;  5AFP A;  1EG4 A;  1GJY A;  3AAJ A;  2MRD A;  5CSF A;  5EL2 A;  4N5X A;  1UUS A;  2BCB A;  1PUL A;  2WCK A;  3B6X A;  3TZ1 A;  1K95 A;  3OGN A;  4M2P A;  1WRZ A;  3TDU A;  1YVH A;  3BFB A;  4ORC B;  3D78 A;  4I5K A;  1SSE B;  1B8L A;  1CDM A;  1OOF A;  1NCX A;  2K7B A;  2LVV A;  1YUS A;  3OB1 B;  1B8C A;  1UHJ A;  3MSE B;  3CR2 A;  1BG1 A;  2KOT A;  2KNE A;  1U5I A;  3L4A A;  1CFD A;  2JXC A;  1EG3 A;  2BL0 C;  1JF2 A;  4I5J A;  3JTD C;  3M0W A;  1DJY A;  1B4C A;  3SG3 A;  2RGI A;  1S6I A;  2KFH A;  1DT7 B;  1FF1 A;  3EKH A;  1TN4 A;  1KWO B;  1TNQ A;  1XFY O;  3FE9 A;  4AQJ A;  1TCO B;  2D8N A;  2JXL A;  4MZJ A;  1NCZ A;  2MBX A;  2EGD A;  4QJ4 B;  1G8I A;  3IVT A;  5J3X A;  3K21 A;  3PJI A;  1QLS A;  1DF0 A;  4USL A;  2M7N A;  4F0Z B;  1IWQ A;  1CLL A;  1TUZ A;  1SRA A;  4XYN A;  1FW4 A;  2JNX A;  2Y1N A;  1SW8 A;  1J7Q A;  1DQE A;  1KQM B;  1WLZ A;  5FI7 A;  2Y5I A;  1XVJ A;  1DC1 A;  3ZWH A;  2JPT A;  3BQ3 A;  3PN7 B;  3F45 A;  2F2P A;  4AOM A;  1WRL A;  3IQO A;  1PVA A;  1EL4 A;  2JT0 A;  1F70 A;  1VRK A;  2LUX A;  3DF0 A;  2QEO A;  3N7H A;  4YGC B;  2JC2 A;  1RTP 1;  1QAS A;  5F6T A;  1IJ5 A;  3DVJ A;  3SIA A;  2R2I A;  2QEV A;  1KK8 C;  2WND A;  2PYQ A;  4GAO A;  4CLN A;  2OPO A;  3EK8 A;  1KSO A;  1BR1 B;  1K9U A;  1AJ4 A;  3L4L A;  4YI8 A;  4OV2 A;  3H4S E;  2BKI B;  4XJK A;  1M46 A;  5FI6 A;  5ER5 A;  3BUM B;  3FWB A;  3TS5 C;  1PAL A;  3SS5 A;  4GPL B;  2BCA A;  1NPQ A;  2K2F A;  3PM8 A;  3GK4 X;  1F55 A;  3A8R A;  1BF5 A;  1TOP A;  1FI6 A;  5D3O A;  2COL B;  2HQ8 A;  2JPO A;  1ODB A;  3BFH A;  1J1D A;  1UWO A;  4AQI A;  1LXF C;  2KSP A;  3CZ0 A;  2NZ0 A;  2PMY A;  4CID A;  1XO5 A;  1XFU O;  4PHM A;  2WCM A;  2KAV A;  3RLZ A;  1LKJ A;  2ZN8 A;  3CS1 A;  2GGM A;  3KF9 A;  1W7J B;  2KAX A;  4HSZ A;  2LMT A;  1H4B A;  3D74 A;  2MLF C;  2FOT A;  4N1G A;  1A03 A;  1CM1 A;  2E30 A;  2PAS A;  3OP0 A;  2AMI A;  3EKJ A;  1NWD A;  1N2D A;  5FI2 A;  3EK7 A;  2BCX A;  1BOC A;  1J1E A;  1KCY A;  2BBM A;  2LHI A;  2JWW A;  1IQ5 A;  2AAO A;  3DY9 A;  1AUI B;  2H8V A;  3OHM B;  1WLM A;  1K9K A;  1TRF A;  1Y6W A;  3BUX B;  5CSI A;  5I2L A;  3RZS A;  1KSM A;  1SCM B;  4PHK A;  2FCD A;  1KFX S;  1DJI A;  1OSA A;  4GBA A;  4CFR A;  2ZRS A;  3VRP A;  2FJU B;  3EVU A;  2DOQ A;  2PRU A;  3CDN A;  1BT6 A;  5CSN A;  3OB2 B;  1UHN A;  3TUY B;  5FYX A;  1ZAC A;  1HQV A;  1SNL A;  4ORB B;  2GV5 A;  1K2H A;  3IQQ A;  1GM0 A;  5AER A;  2MAZ A;  1SMG A;  2WCL A;  1YVL A;  2TN4 A;  2M29 A;  3BYA A;  1DJX A;  3NSO A;  1GQM A;  1X02 A;  1SPY A;  3KPX A;  2Q91 A;  3BUN B;  2BAP A;  3A4U B;  5HL1 A;  4NDC A;  4R1E A;  1NP8 A;  1NX0 A;  2QEH A;  4PE1 A;  2JNF A;  2YGU A;  5GQQ C;  1V1F A;  1QVI Z;  4PE7 A;  4JQ0 D;  3PSR A;  2QAC A;  2LLT A;  5I94 A; 
#chains in the Genus database with same CATH homology
 1M63 B;  1GGZ A;  4GGN A;  5HKZ A;  1FBV A;  4D1E A;  1QX7 A;  1S1E A;  1WDC C;  4HRH A;  1SBJ A;  4YI9 A;  1ZFS A;  2M1U A;  3HX4 A;  5HLV A;  4E68 A;  1MF8 B;  1K90 D;  3TDI A;  4OVN F;  4C0L A;  3WHU B;  1DTL A;  1XA5 A;  1OMR A;  1GGW A;  3GK1 A;  1KK7 Z;  1W7I B;  3I5I C;  3SG7 A;  2K7C A;  2MJW B;  3SG4 A;  1IH0 A;  1S5G Y;  1BJF A;  2H61 A;  3GOF A;  1B7T Y;  3AKB A;  1CLB A;  1AVS A;  1CLM A;  1N0Y A;  1OMV A;  3CGA A;  4GFT A;  4OCI A;  3E3R A;  1XFW O;  2LP2 A;  1NIW A;  3TS5 B;  1PVB A;  1M45 A;  1YR5 A;  1BLQ A;  5I2Q A;  4ETO A;  5HYD A;  1RWY A;  1TIZ A;  2EC6 C;  2M97 A;  2KGB C;  1D1O A;  3EVR A;  3JVT C;  2M49 B;  3BXK A;  4MN0 A;  1L2O C;  4GUK A;  4NDD A;  1MXL C;  4OKH A;  2LVK A;  2JTT A;  1QV1 A;  3ICB A;  2L98 A;  2JOJ A;  1YUT A;  3I5H B;  4Q04 A;  4DIR A;  1SYM A;  2HQW A;  1A75 B;  2O5G A;  2KQ6 A;  1S36 A;  1TNW A;  3BUW B;  2WOS A;  3VRN A;  1SR6 B;  1BU3 A;  5KTY A;  1PRW A;  3I5F C;  5DKQ A;  1NX1 A;  2KQY A;  2KBM A;  2LMV A;  1AK8 A;  2ZRT A;  1M39 A;  4WQ3 A;  1CDL A;  2O60 A;  4YGB B;  4UPG A;  4MLW A;  3NSI A;  1A29 A;  1TCF A;  4MSP A;  4YBH B;  1NX3 A;  1SL7 A;  2CXJ A;  4GGF A;  1J7O A;  5AEQ A;  3BOW B;  2LAN A;  2BE6 A;  4PDZ A;  1DGV A;  2QPT A;  4MZL A;  3NSL A;  1IJ6 A;  2A4J A;  5ER4 X;  3FS7 A;  1MR8 A;  1G4Y R;  1Y0V H;  5CSJ A;  1F54 A;  1QIV A;  1F4O A;  2HF5 A;  3LL8 B;  2JUL A;  1MXE A;  5AXI A;  1C7V A;  2I18 A;  5AAN A;  1K96 A;  4YRU A;  1EJ3 A;  1DVI A;  1E8A A;  2WC8 A;  2I94 A;  4P2Y B;  3GK2 A;  1IGV A;  2OS8 B;  2I2R E;  5JOL A;  3CTN A;  1QLK A;  1HT9 A;  1J7R A;  5D7F A;  2M9G A;  5KSZ A;  1XYD A;  4ZCV A;  4DUQ A;  4PE0 A;  4ZCU A;  3EVV A;  1UHI A;  5HKY A;  2GGZ A;  4NQG A;  2EHB A;  1MQ1 A;  4BY5 A;  5JJG A;  3PN7 C;  2Q4U A;  1PSB A;  5KU1 A;  4MVF A;  1MUX A;  3O78 A;  4MZK A;  1JUO A;  1YRT B;  1XFV O;  3AAK A;  3KO0 A;  3O6B A;  1V1G A;  2BE4 A;  1ZMZ A;  2G2B A;  3OX6 A;  4WRI A;  5B8I B;  1IG5 A;  2F8P A;  1J55 A;  2L2E A;  3VRQ A;  2WCF A;  5CPV A;  2P6B B;  4QJ5 B;  1REC A;  1YX8 A;  4HRE E;  1F8H A;  2I7A A;  2OTG C;  1DMO A;  2L5X B;  1JBA A;  1UHK A;  2G9B A;  3ZNI A;  4C0J A;  2H61 C;  2LE9 B;  2SCP A;  3WXA A;  3I5I B;  1DGU A;  4PHJ A;  5G08 A;  5PAL A;  2BL0 B;  1OZS A;  3CZT X;  2M8U A;  1G33 A;  1Q80 A;  3JTD B;  4I5L B;  2V53 A;  1J7P A;  3OX5 A;  4DCK A;  3HCM A;  5HLO A;  1FPW A;  3SIB A;  2LLU A;  3FWC A;  1JFK A;  2PVB A;  5TNC A;  4OR9 B;  1S5G Z;  1B7T Z;  3PAL A;  1Y1X A;  3SG2 A;  1AJ5 A;  1S6C A;  4HRG A;  1C7W A;  1NYA A;  1NCY A;  1ZOT B;  2JTZ A;  1RK9 A;  2LC5 A;  2LV7 A;  1SY9 A;  1Y1A A;  1IRJ A;  2CT9 A;  3LCP C;  1YUR A;  3BUO B;  2M7L A;  1KFX L;  1SL9 A;  2BBN A;  3JVT B;  3TDZ A;  1L2O B;  1JC2 A;  2KFG A;  1NUB A;  1UP5 A;  3I5G C;  3DVM A;  3KEV A;  4PE4 A;  1CNP A;  4PAL A;  3AKA A;  3DVK A;  2MLE C;  2Y1M A;  1OQP A;  1KQV A;  1A75 A;  2KYC A;  3RM1 A;  1CTR A;  2F2O A;  3NSK A;  4IL1 A;  3VRR A;  1CFF A;  5DKR A;  3I5F B;  1R2U A;  3CLN A;  1QX2 A;  4GGF C;  5HKW A;  2LHL A;  1QXP A;  1S3P A;  2KHN A;  1IQ3 A;  1XK4 A;  1KK8 B;  2LMU A;  1CMG A;  3O4Y A;  1ZUZ A;  2KAY A;  4MRY A;  4M2Q A;  3IF7 A;  1LVC D;  1RJV A;  1SCM C;  1ALW A;  2WCE A;  2HPS A;  2CCM A;  4PHN A;  1QV0 A;  2LUC A;  1CFC A;  3BOW A;  3SG5 A;  2NXQ A;  1JFJ A;  2M1K B;  1JSA A;  2JU0 A;  2MA2 A;  1S6J A;  3TUY C;  3D0Y B;  2ISD A;  4MEW A;  4A4C A;  1F4Q A;  2JZI A;  4CFQ A;  3LK0 A;  1B9A A;  2FCE A;  1A4P A;  2KI4 C;  2H2K A;  2M3W A;  4L9M A;  5K89 A;  2ZN9 A;  4U8D A;  3EK4 A;  1S26 D;  2LVI A;  1PK0 D;  5D69 A;  2KFF A;  1Y1U A;  2KGR A;  1AHR A;  2PSR A;  2VRG A;  4MRX A;  3PLF B;  1QAT A;  2K0J A;  2M0R A;  3O2P A;  1QIW A;  2PAL A;  3WNX B;  1QVI Y;  2ZNE A;  3NXA A;  2JRF A;  4NDB A;  3CWG A;  4WQ2 A;  1K8U A;  1WRK A;  2JT8 A;  4C0K A;  1CDN A;  4ORA B;  2MHH A;  1CFP A;  2SAS A;  1DJZ A;  1KFU S;  2NCO A;  2K7D A;  2BEC A;  2LM5 A;  2HET A;  2LAP A;  1F71 A;  3VGO A;  1A2X A;  1LA3 A;  1OZO A;  1ALV A;  1KK7 Y;  1OMD A;  2K7O A;  4TNC A;  2L4I A;  1QJT A;  1U5I B;  1SK6 D;  2B1U A;  5BPJ A;  1EH2 A;  1IKU A;  1SKT A;  2NLN A;  4CPV A;  2K61 A;  1NSH A;  1NX2 A;  2BKH B;  2K8M B;  1RRO A;  2LNK A;  3D10 A;  3KHE A;  4JPZ B;  1C07 A;  2OTG B;  1OOJ A;  5IBW A;  4FTG A;  3C1V A;  4M2O A;  1TNP A;  3PAT A;  1KWO C;  1B47 A;  3QRX A;  3DVE A;  4PCW A;  1SL8 A;  2F33 A;  1R6P A;  3SJS A;  1DF0 B;  1PSR A;  1KFU L;  1MWN A;  4N1F A;  5I2O A;  1YX7 A;  1L7Z A;  2Y4Q A;  4P5O E;  1K9P A;  4BY4 A;  2KDH A;  3PFV A;  1B8R A;  1TTX A;  1KQM C;  1QS7 A;  1FI5 A;  1MHO A;  4DRW A;  1N65 A;  1UUR A;  4I5N B;  2CBL A;  2L51 A;  4DS7 A;  4FQO A;  2L50 A;  4YGE B;  3I5H C;  1CMF A;  2KYF A;  4YGD B;  2WOR A;  1BOD A;  2JQ6 A;  3DF0 B;  1JF0 A;  1DJH A;  2ZND A;  1OE9 B;  3I5G B;  1SR6 C;  3LK1 A;  4ICB A;  1YRU B;  1WDC B;  1EXR A;  1BMO A;  1YTZ C;  4MBE A;  4A4B A;  2CTN A;  1BR4 B;  1XK4 C;  2LP3 A;  2KBI A;  3CR5 X;  5I8N A;  2CNP A;  3WHT B;  1QX5 B;  4XJK B;  2AUC A;  1LIN A;  2WCB A;  2IS9 A;  2F3Y A;  2JT3 A;  3DD4 A;  1AP4 A;  4QJ3 B;  1RFJ A;  1QTX A;  3SG6 A;  1CKK A;  2LVJ A;  1CDP A;  3CR4 X;  4JWQ A;  1H8B A;  2L0P A;  4GNK B;  5DKN A;  1B1G A;  2KI6 C;  1JWD A;  2EC6 B;  1K93 D;  1CM4 A;  2K2A A;  1XFZ O;  2NCP A;  3VRO A;  1M31 A;  3FIA A;  2ZFD A;  1CB1 A;  1YUU A;  2OS8 C;  2ZKM X;  3D0Y A;  2KI4 B;  1LA0 A;  2L4H A;  1DJG A;  1DJW A;  2LLS A;  1TNX A;  1UHH A;  3LLE A;  1SCV A;  1XFX O;  1WY9 A;  4YGA A;  1K94 A;  2KI6 D;  2LCP A;  2E6W A;  2F3Z A;  5AFP A;  1EG4 A;  1GJY A;  3AAJ A;  2MRD A;  5CSF A;  4N5X A;  1UUS A;  2BCB A;  1PUL A;  3TZ1 A;  1K95 A;  4M2P A;  1WRZ A;  3TDU A;  1YVH A;  4ORC B;  4I5K A;  1B8L A;  1CDM A;  1NCX A;  2K7B A;  2LVV A;  1YUS A;  3OB1 B;  1B8C A;  1UHJ A;  3MSE B;  3CR2 A;  1BG1 A;  2KOT A;  2KNE A;  1U5I A;  1CFD A;  2JXC A;  1EG3 A;  2BL0 C;  1JF2 A;  4I5J A;  3JTD C;  3M0W A;  1DJY A;  1B4C A;  3SG3 A;  2RGI A;  1S6I A;  2KFH A;  1DT7 B;  1FF1 A;  3EKH A;  1TN4 A;  1KWO B;  1TNQ A;  1XFY O;  4AQJ A;  1TCO B;  2D8N A;  2JXL A;  4MZJ A;  1NCZ A;  2MBX A;  2EGD A;  4QJ4 B;  1G8I A;  5J3X A;  3K21 A;  1QLS A;  1DF0 A;  4USL A;  2M7N A;  4F0Z B;  1IWQ A;  1CLL A;  1SRA A;  4XYN A;  1FW4 A;  2JNX A;  2Y1N A;  1SW8 A;  1J7Q A;  1KQM B;  1WLZ A;  2Y5I A;  1XVJ A;  3ZWH A;  2JPT A;  3BQ3 A;  3PN7 B;  3F45 A;  2F2P A;  4AOM A;  1WRL A;  3IQO A;  1PVA A;  1EL4 A;  2JT0 A;  1F70 A;  1VRK A;  2LUX A;  3DF0 A;  4YGC B;  2JC2 A;  1RTP 1;  1QAS A;  5F6T A;  1IJ5 A;  3DVJ A;  3SIA A;  2R2I A;  1KK8 C;  2WND A;  4GAO A;  4CLN A;  2OPO A;  3EK8 A;  1KSO A;  1BR1 B;  1K9U A;  1AJ4 A;  4YI8 A;  4OV2 A;  3H4S E;  2BKI B;  4XJK A;  1M46 A;  5ER5 A;  3BUM B;  3FWB A;  3TS5 C;  1PAL A;  4GPL B;  2BCA A;  1NPQ A;  2K2F A;  3PM8 A;  3GK4 X;  1F55 A;  3A8R A;  1BF5 A;  1TOP A;  1FI6 A;  2COL B;  2HQ8 A;  1ODB A;  1J1D A;  1UWO A;  4AQI A;  1LXF C;  2KSP A;  2NZ0 A;  2PMY A;  4CID A;  1XO5 A;  1XFU O;  4PHM A;  2KAV A;  3RLZ A;  1LKJ A;  2ZN8 A;  3CS1 A;  2GGM A;  3KF9 A;  1W7J B;  2KAX A;  4HSZ A;  2LMT A;  1H4B A;  2MLF C;  2FOT A;  4N1G A;  1A03 A;  1CM1 A;  2E30 A;  2PAS A;  3OP0 A;  2AMI A;  3EKJ A;  1NWD A;  1N2D A;  3EK7 A;  2BCX A;  1BOC A;  1J1E A;  1KCY A;  2BBM A;  2LHI A;  2JWW A;  1IQ5 A;  2AAO A;  1AUI B;  3OHM B;  1WLM A;  1K9K A;  1TRF A;  1Y6W A;  3BUX B;  5CSI A;  5I2L A;  1KSM A;  1SCM B;  4PHK A;  2FCD A;  1KFX S;  1DJI A;  1OSA A;  4GBA A;  4CFR A;  2ZRS A;  3VRP A;  2FJU B;  3EVU A;  2DOQ A;  2PRU A;  1BT6 A;  5CSN A;  3OB2 B;  1UHN A;  3TUY B;  5FYX A;  1ZAC A;  1HQV A;  1SNL A;  4ORB B;  2GV5 A;  1K2H A;  3IQQ A;  5AER A;  2MAZ A;  1SMG A;  1YVL A;  2TN4 A;  2M29 A;  3BYA A;  1DJX A;  3NSO A;  1GQM A;  1X02 A;  1SPY A;  3KPX A;  2Q91 A;  3BUN B;  3A4U B;  4NDC A;  4R1E A;  1NP8 A;  1NX0 A;  4PE1 A;  2JNF A;  5GQQ C;  1V1F A;  1QVI Z;  4PE7 A;  4JQ0 D;  3PSR A;  2QAC A;  2LLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...