4NDBA

X-ray structure of a mutant (t61d) of calexcitin - a neuronal calcium-signalling protein
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
187
structure length
187
Chain Sequence
QLSDFQRNKILRVFNTFYDCNHDGVIEWDDFELAIKKICNLHSWPTDGKKHNEARADLKLIWDGLRKYADENEDEQVTKEEWLKMWAECVKSVEKGESLPEWLTKYMNFMFDVNDTSGDNIIDKHEYSTVYMSYGIPKSDCDAAFDTLSDGGKTMVTREIFARLWTEYFVSNDRGAKGNHLFGTLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calexcitin
publication title X-ray, spectroscopic and normal-mode dynamics of calexcitin: structure-function studies of a neuronal calcium-signalling protein.
pubmed doi rcsb
source organism Doryteuthis pealeii
molecule tags Signaling protein
total genus 80
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4ndbA00
5ER4X 1XFZO 1OQPA 5JJGA 2FCDA 1J55A 4PALA 3NSIA 1B8CA 1NCYA 2JT3A 2K7CA 2TN4A 1B4CA 1W7IB 1FBVA 1NP8A 3JTDC 2MLEC 1LA3A 2WNDA 1XA5A 2DOQA 2H61A 2I2RE 5HYDA 1XVJA 2O5GA 3BUMB 1BR4B 2LC5A 4GBAA 1KWOC 1SL9A 5TNCA 4D1EA 1TOPA 2L0PA 1SMGA 1BT6A 1SCMC 3AAKA 4JWQA 2BE6A 3PALA 2G9BA 1CDLA 1QLKA 4I5JA 4USLA 2KAVA 1K90D 4HREE 1B7TZ 1MWNA 2KI6C 1JBAA 1Y1UA 1V1GA 1WY9A 4WRIA 1XFXO 2HF5A 1JC2A 1PVAA 1JSAA 3OX6A 1HQVA 2M7LA 2WC8A 1YUSA 1M31A 3MSEB 4DIRA 4ETOA 5AEQA 1L2OC 2LMUA 2LM5A 3KPXA 3OP0A 4WQ3A 1KFUS 1BF5A 1KK8C 2KNEA 3DVKA 4NQGA 2WCBA 1SCVA 2JU0A 3I5FC 1KSMA 4YGAA 1R6PA 2JWWA 1B47A 3QRXA 2KFHA 2ZNDA 1KFXL 1SRAA 1FW4A 2LVJA 3GK4X 4ZCUA 2GGZA 1PSRA 3O6BA 1UHIA 1F70A 1ALWA 1BODA 3BOWB 3CR2A 2PSRA 1D1OA 2ISDA 2LAPA 1IJ6A 2K61A 2L2EA 4YGCB 1DJYA 1KK7Z 1G4YR 4GGNA 1F71A 3TS5B 4CLNA 3EKJA 1JFJA 1VRKA 1QVIZ 2NZ0A 2PRUA 1A4PA 5KSZA 3VRNA 5GQQC 1TN4A 4TNCA 2ZNEA 4M2OA 1MHOA 1S36A 3PN7C 1J7PA 4R1EA 4M2QA 2JPTA 4F0ZB 3LL8B 2K0JA 3NSKA 4GGFC 4FQOA 1S5GZ 2M7NA 2EC6B 2BL0B 5CSFA 1KSOA 3JVTB 4OKHA 1OSAA 1MR8A 2KQ6A 1F54A 5AXIA 1HT9A 1CFPA 1AVSA 1N0YA 1K95A 3DD4A 3I5GB 2CBLA 3K21A 1H8BA 1LA0A 2PVBA 1WRKA 3BQ3A 1PALA 2JNFA 4MRXA 2JC2A 3ICBA 1K9KA 5D7FA 5HLOA 2BBNA 1Y6WA 2KDHA 2Y1MA 2RGIA 4DUQA 2Q91A 2MLFC 2M8UA 4PDZA 2F3ZA 1NX3A 1OE9B 4MEWA 4PHJA 1CLLA 1CDPA 2L5XB 4IL1A 1GGWA 2OS8C 1QV1A 1B8RA 1DJXA 4A4BA 2K2AA 1LXFC 1XO5A 2LP3A 1RTP1 2CNPA 2CXJA 2M1UA 4YRUA 5I8NA 1XYDA 3BUXB 4U8DA 4L9MA 2LCPA 4N1GA 4P5OE 1BMOA 2E6WA 3LLEA 4PCWA 1IQ3A 1DT7B 1CMFA 4OVNF 1WDCB 5HKWA 4CIDA 1AP4A 2K2FA 3RLZA 2WCFA 2L51A 2KFFA 1JF2A 2JTTA 1TNXA 3PM8A 1J7RA 1S1EA 1UURA 1J7OA 1ODBA 2LHIA 2KGBC 4QJ5B 3KF9A 3I5IC 1BOCA 5JOLA 2JT8A 3TUYC 1Y0VH 1MXEA 2LVVA 3PFVA 2CT9A 4MN0A 2E30A 5AFPA 5I2OA 1SY9A 1CKKA 2O60A 3FWBA 1Q80A 1NX1A 1EG4A 3OB2B 3CGAA 2A4JA 1ZFSA 1BG1A 3ZNIA 2KSPA 4ZCVA 2VRGA 3GK2A 2KGRA 2JT0A 2ZRSA 1IJ5A 5I2QA 1JWDA 2KAXA 2MA2A 1TCOB 1DTLA 1A2XA 1MQ1A 1W7JB 4OV2A 5HLVA 1CM4A 1A75A 2CTNA 1GGZA 4JPZB 2MAZA 4XJKA 4I5LB 1QJTA 2I18A 5IBWA 2HPSA 1XK4C 3LK0A 1GQMA 1OOJA 2COLB 3DVMA 3RM1A 1IH0A 3KEVA 5I2LA 1SCMB 1OMRA 4JQ0D 1CLMA 1QIVA 1B1GA 3BUWB 3TDZA 3VROA 1IRJA 2PALA 2WOSA 3WHTB 1M46A 2MHHA 1SL7A 4I5NB 1SPYA 2JXCA 1V1FA 2FJUB 1DJZA 5G08A 4AQIA 1QATA 1QX5B 1XFWO 2L50A 2BCBA 3OX5A 2ZFDA 4BY5A 3HCMA 3VRQA 4YGDB 1KFXS 5HKYA 2KQYA 1KFUL 3AAJA 2B1UA 1ALVA 3SG7A 1KK7Y 2OPOA 1CTRA 2LLUA 1NPQA 3CTNA 4UPGA 1QVIY 4QJ4B 1CDMA 1M45A 1YRTB 2SASA 3TS5C 1RECA 1YX7A 4DS7A 1YTZC 4FTGA 2F2PA 2KYCA 1UHHA 1FF1A 1FI6A 1TCFA 2LLSA 3BUNB 1J7QA 2FOTA 1QX2A 1S5GY 2MJWB 4GNKB 1NWDA 2NLNA 1ZOTB 1QXPA 3O4YA 4P2YB 5D69A 3M0WA 2MBXA 4DCKA 5BPJA 2FCEA 2WCEA 2EC6C 2BL0C 2BKHB 3JVTC 1DJGA 2V53A 5DKQA 3O2PA 1QLSA 1A75B 1XFYO 3PN7B 3AKBA 3OB1B 1K96A 3A8RA 4HSZA 3WNXB 2NCPA 4XJKB 5B8IB 2MRDA 2K7DA 4MZKA 4PE0A 1CB1A 2M49B 2AMIA 3IQQA 3VRPA 4PE7A 2GV5A 1SKTA 1YR5A 3CLNA 1NUBA 3GK1A 1AK8A 2F33A 1SYMA 5KU1A 1AUIB 4MLWA 2JNXA 3PSRA 2M1KB 2K7OA 1PRWA 1S6JA 2HETA 2JTZA 1BR1B 1KQVA 3D0YA 5CSNA 1PK0D 3FWCA 3EVUA 4C0LA 2LUCA 2KI4C 1NCXA 3CR5X 3VRRA 2CCMA 2JXLA 2BBMA 5F6TA 2G2BA 3IF7A 2K7BA 1KQMB 1UUSA 1WDCC 1UHJA 1XK4A 3I5HB 1LINA 5DKNA 1S3PA 1G33A 1WLZA 1WRZA 2KFGA 2OS8B 3CWGA 4PE1A 1G8IA 4MSPA 2F3YA 3SIBA 4AQJA 4PHMA 2Y1NA 4AOMA 3WHUB 2OTGB 1TNQA 2M29A 5CPVA 1IWQA 1S26D 1AJ5A 1S6IA 3CR4X 3DF0A 3KHEA 4ICBA 2QACA 1F55A 3BYAA 1OMDA 1TNWA 1DGUA 2HQWA 3SIAA 1K93D 2JRFA 2L4HA 3PATA 4MVFA 4BY4A 1CM1A 4MZJA 1Y1XA 1YX8A 2KBMA 3TDIA 2LANA 1DVIA 2KI6D 4YI8A 3EK4A 1RROA 1SR6B 1F4QA 4YBHB 1TIZA 3I5IB 5DKRA 2KOTA 1WLMA 1AHRA 4YI9A 3NSLA 3F45A 3E3RA 4PHKA 3TUYB 5CSIA 1IKUA 3EVVA 1ZACA 4GUKA 2LNKA 1C7VA 1F4OA 3WXAA 2EGDA 1J1EA 1B7TY 2BCAA 1C7WA 1QIWA 2P6BB 5AANA 1QASA 4PE4A 3JTDB 3SG2A 1FPWA 1DGVA 1DMOA 1SBJA 3BXKA 4C0KA 1DJHA 4Q04A 2K8MB 4GGFA 1S6CA 1MXLC 3GOFA 4CPVA 1TNPA 1CNPA 1TTXA 1KWOB 1K8UA 2IS9A 1UHNA 4GPLB 2GGMA 2BECA 1SW8A 2H2KA 4NDDA 1X02A 2KBIA 2Y5IA 3SG4A 3D0YB 1NIWA 1FI5A 4N5XA 1YURA 3O78A 1QV0A 2LV7A 4CFRA 1IGVA 3NSOA 1CFDA 1K94A 2PMYA 1M63B 4CFQA 1MUXA 1EG3A 1GJYA 4E68A 1RK9A 1QS7A 2LMVA 3KO0A 3LCPC 1Y1AA 2KYFA 1L2OB 2I7AA 2Q4UA 2BE4A 1UP5A 1OZSA 3SG5A 3TDUA 1EH2A 1KK8B 1A29A 5ER5A 1EL4A 2ZKMX 3I5FB 3DF0B 3CS1A 2R2IA 3ZWHA 1QTXA 3NXAA 4OR9B 2LVIA 2PASA 1UHKA 1DF0A 2M9GA 1KCYA 2LHLA 1BU3A 1AJ4A 3OHMB 1JF0A 5K89A 4YGEB 2KHNA 1CLBA 3SG6A 1UWOA 1RFJA 2LMTA 2JULA 1NX0A 2H61C 1QX7A 1K2HA 4ORBB 1U5IA 2F2OA 2F8PA 2JZIA 2ZRTA 5FYXA 3EK8A 5HKZA 5AERA 1XFVO 2HQ8A 3AKAA 5J3XA 1J1DA 1N2DA 1YUTA 2ZN9A 2I94A 3I5GC 3IQOA 3BUOB 2M97A 3DVJA 1PSBA 1WRLA 2KAYA 3H4SE 1YVHA 2BCXA 1H4BA 2EHBA 2WORA 3LK1A 4MZLA 4I5KA 3FIAA 3A4UB 2Y4QA 1DJIA 4DRWA 4NDBA 1F8HA 1IQ5A 1MF8B 1NX2A 4NDCA 4N1FA 1JUOA 1DJWA 3PLFB 4WQ2A 3SG3A 4ORAB 1M39A 1OZOA 2L98A 4A4CA 1EXRA 1YVLA 2D8NA 1CMGA 1BJFA 4M2PA 5PALA 2AUCA 2QPTA 1ZMZA 1K9UA 1PVBA 1EJ3A 1B9AA 1TRFA 3C1VA 4QJ3B 1YUUA 3VGOA 2LE9B 1LVCD 1CDNA 3EVRA 1YRUB 4PHNA 2SCPA 3FS7A 4HRGA 1KQMC 2LLTA 3I5HC 4GAOA 1L7ZA 3D10A 1RJVA 1SNLA 4GFTA 3HX4A 1CFFA 1DF0B 1B8LA 2M0RA 1SL8A 2KI4B 2BKIB 2OTGC 1NCZA 3CZTX 3EK7A 4HRHA 4ORCB 1R2UA 3SJSA 2LP2A 2NXQA 2ZN8A 1BLQA 1JFKA 1IG5A 5CSJA 1OMVA 2LVKA 4OCIA 1NSHA 1K9PA 4MBEA 1CFCA 4C0JA 4MRYA 4XYNA 1U5IB 1PULA 2LUXA 1LKJA 3TZ1A 3BOWA 1RWYA 2JOJA 1SR6C 1XFUO 5KTYA 1ZUZA 2AAOA 2M3WA 1N65A 2L4IA 2NCOA 1A03A 3EKHA 1E8AA 4YGBB 2JQ6A 1SK6D 3DVEA 1C07A 1NYAA
chains in the Genus database with same CATH superfamily
5ER4X 1XFZO 3B7AA 1OQPA 5JJGA 2FCDA 1J55A 4PALA 3NSIA 1B8CA 1NCYA 2JT3A 2K7CA 2TN4A 3K1EA 1W7IB 1B4CA 1FBVA 1NP8A 3JTDC 2MLEC 1LA3A 2WNDA 1XA5A 2DOQA 2H61A 2I2RE 5HYDA 1XVJA 2O5GA 3S0BA 3BUMB 1BR4B 2LC5A 4GBAA 1KWOC 1SL9A 5TNCA 4D1EA 1TOPA 2L0PA 1SMGA 1BT6A 3S0FA 1SCMC 3D78A 3AAKA 5DICA 4JWQA 2BE6A 2KLEA 3PALA 3SS3A 2G9BA 1CDLA 1QLKA 4I5JA 4USLA 2KAVA 1K90D 4HREE 1B7TZ 1MWNA 2KI6C 1JBAA 3Q8IA 1Y1UA 1V1GA 1WY9A 3NHTA 4WRIA 1XFXO 2HF5A 1JC2A 1PVAA 1JSAA 3B6XA 3OX6A 1HQVA 3DYEA 2WC8A 2M7LA 1YUSA 1M31A 3CDNA 3MSEB 4DIRA 4ETOA 4INXA 5AEQA 1L2OC 2LMUA 2LM5A 2K60A 3KPXA 3OP0A 4WQ3A 3DY9A 1KFUS 1BF5A 1KK8C 2KNEA 3B88A 3DVKA 2WCBA 1SCVA 2JU0A 3R1OA 3I5FC 4NQGA 5FI6A 1DC1A 1KSMA 3R1VA 4YGAA 1R6PA 1C3YA 2JWWA 1B47A 3QRXA 2KFHA 2ZNDA 1KFXL 1SRAA 1FW4A 2LVJA 2PQLA 3GK4X 4ZCUA 2GGZA 1PSRA 3O6BA 1UHIA 1F70A 1ALWA 1BODA 3BOWB 3CR2A 3SS5A 2PSRA 1D1OA 2ISDA 2LAPA 1IJ6A 2K61A 2L2EA 4YGCB 1DJYA 1KK7Z 1G4YR 4GGNA 1F71A 3TS5B 4CLNA 3EKJA 1TWOA 1JFJA 1VRKA 1QVIZ 2NZ0A 2PRUA 1A4PA 5KSZA 3VRNA 5GQQC 1TN4A 4TNCA 2ZNEA 4FQTA 1MHOA 1S36A 2WCLA 3PN7C 4M2OA 1J7PA 4R1EA 4M2QA 2JPTA 5I94A 4F0ZB 3DXLA 3LL8B 2K0JA 3NSKA 4GGFC 4FQOA 1S5GZ 2M7NA 2EC6B 2BL0B 5CSFA 1KSOA 2QEVA 3JVTB 4OKHA 1OSAA 1MR8A 2BAPA 2KQ6A 1F54A 5AXIA 1HT9A 3BFHA 1AVSA 1N0YA 1CFPA 1K95A 3DD4A 3I5GB 2CBLA 3K21A 2PYQA 1H8BA 1LA0A 2PVBA 1WRKA 3BQ3A 1PALA 2JNFA 4MRXA 2WCMA 2JC2A 3ICBA 1K9KA 5D7FA 5HLOA 2BBNA 1Y6WA 3O4XA 2KDHA 2Y1MA 2RGIA 4DUQA 2Q91A 2MLFC 2WCKA 2M8UA 4PDZA 2F3ZA 1NX3A 1OE9B 4MEWA 4PHJA 1CLLA 1CDPA 2L5XB 4IL1A 1GGWA 2OS8C 1QV1A 1B8RA 1DJXA 4A4BA 2K2AA 1Z2CB 1LXFC 1XO5A 2LP3A 1RTP1 2CNPA 2CXJA 2M1UA 3IVTA 4YRUA 5I8NA 1XYDA 3BUXB 4U8DA 4L9MA 2LCPA 4N1GA 4P5OE 1BMOA 2E6WA 3LLEA 4PCWA 1IQ3A 1DT7B 1CMFA 4OVNF 1WDCB 5HKWA 4CIDA 1AP4A 2K2FA 3RLZA 1SSEB 2WCFA 2L51A 2KFFA 1JF2A 2JTTA 1TNXA 3PM8A 4JD9A 1J7RA 1S1EA 1UURA 1J7OA 1ODBA 2LHIA 5D3OA 2KGBC 4QJ5B 3KF9A 3BJHA 3I5IC 1BOCA 5JOLA 3EG5B 3VB1A 2JT8A 3TUYC 1Y0VH 3NHIA 1MXEA 2LVVA 3PFVA 3R1PA 1T14A 2CT9A 2E30A 4MN0A 5AFPA 1SY9A 5I2OA 1CKKA 2O60A 3FWBA 1Q80A 1NX1A 2JPOA 4IJ7A 1EG4A 3OB2B 3CGAA 2A4JA 1DQEA 1ZFSA 2QEBA 4F7FA 1BG1A 3ZNIA 2KSPA 4ZCVA 3RZSA 2VRGA 1OOGA 3GK2A 2KGRA 2JT0A 2ZRSA 1IJ5A 5I2QA 1JWDA 2KAXA 2MA2A 1TCOB 1DTLA 1A2XA 1MQ1A 1W7JB 3D73A 4OV2A 5HLVA 1CM4A 1A75A 3S0GA 2CTNA 1GGZA 4JPZB 2MAZA 4XJKA 4I5LB 3OBVA 1QJTA 2I18A 5IBWA 2HPSA 1XK4C 3LK0A 1GQMA 1OOJA 2COLB 3DVMA 3RM1A 1IH0A 3KEVA 5I2LA 1SCMB 1OMRA 4JQ0D 1CLMA 1QIVA 3L47A 1B1GA 3BUWB 3TDZA 3VROA 1IRJA 2PALA 2WOSA 3UO9A 3WHTB 1M46A 2MHHA 1SL7A 3UNWA 4I5NB 1SPYA 2JXCA 1V1FA 2FJUB 3S0DA 1DJZA 5G08A 4AQIA 1Z4HA 1QATA 1QX5B 1XFWO 2L50A 2BCBA 2WC6A 3OX5A 2ZFDA 4BY5A 3HCMA 3VRQA 4YGDB 1KFXS 3PJIA 5HKYA 2KQYA 1KFUL 3AAJA 2B1UA 2BNXA 1ALVA 3SG7A 2KPHA 1KK7Y 2OPOA 1CTRA 2LLUA 1NPQA 3CTNA 4UPGA 1QVIY 4QJ4B 1CDMA 1M45A 1YRTB 2SASA 3TS5C 1RECA 1YX7A 4DS7A 1YTZC 4FTGA 1W9ZA 2F2PA 2KYCA 1UHHA 2WC5A 1FF1A 1ORGA 1FI6A 3D76A 3BFBA 1TCFA 2LLSA 3BUNB 1J7QA 2FOTA 1QX2A 1S5GY 2MJWB 4GNKB 1NWDA 3BFAA 2NLNA 1ZOTB 1QXPA 3O4YA 4P2YB 5D69A 3M0WA 2MBXA 4DCKA 5BPJA 2FCEA 2WCEA 4JKTA 2EC6C 2BL0C 2BKHB 3JVTC 1DJGA 3CZ2A 2V53A 5DKQA 3O2PA 1QLSA 1A75B 1XFYO 3PN7B 3QMEA 3AKBA 3OB1B 1K96A 2P71A 1DELA 3A8RA 4HSZA 2KLDA 2NCPA 4XJKB 3WNXB 2MRDA 5B8IB 2K7DA 4MZKA 4PE0A 1CB1A 2M49B 2AMIA 3IQQA 3VRPA 4PE7A 2GV5A 1SKTA 1YR5A 3CLNA 1NUBA 3GK1A 1AK8A 2F33A 1C3ZA 1SYMA 5KU1A 1AUIB 4MLWA 2JNXA 3PSRA 2M1KB 2K7OA 1PRWA 1S6JA 2HETA 2JTZA 1BR1B 1KQVA 5EL2A 1QWVA 3D0YA 3L4LA 5CSNA 2ERBA 1PK0D 3FWCA 3EVUA 4C0LA 2LUCA 2KI4C 1NCXA 3CR5X 1XFRA 3VRRA 2CCMA 2JXLA 2L5YA 5FI7A 2BBMA 5F6TA 2G2BA 3IF7A 2K7BA 1KQMB 1UUSA 1WDCC 1UHJA 1XK4A 3DZTA 1LINA 3I5HB 1S3PA 1G33A 1WLZA 1WRZA 2KFGA 2OS8B 3CWGA 4PE1A 1G8IA 4MSPA 2F3YA 3NGVA 3SIBA 4AQJA 5DKNA 3R72A 4PHMA 2Y1NA 2P70A 4AOMA 3WHUB 2OTGB 1TNQA 2M29A 5CPVA 1IWQA 1S26D 1AJ5A 1S6IA 3CR4X 2H8VA 3D75A 3DF0A 2QACA 3KHEA 3BYAA 4ICBA 2QEHA 1F55A 1OMDA 1TNWA 1DGUA 2HQWA 3SIAA 1K93D 2JRFA 2L4HA 3PATA 4MVFA 4BY4A 5HL1A 1CM1A 4MZJA 1Y1XA 1YX8A 2KBMA 3TDIA 2LANA 1DVIA 2KI6D 4YI8A 3EK4A 1RROA 1SR6B 2FJYA 1F4QA 4YBHB 1TIZA 3I5IB 5DKRA 2KOTA 3FE8A 1WLMA 1AHRA 4YI9A 3NSLA 3F45A 3E3RA 4PHKA 3TUYB 5CSIA 1IKUA 3EVVA 1ZACA 4GUKA 2LNKA 1C7VA 1OOFA 1F4OA 4PT1A 3WXAA 2EGDA 1J1EA 1B7TY 2BCAA 1C7WA 1QIWA 1OW4A 2P6BB 5AANA 1QASA 4PE4A 3JTDB 4INWA 3SG2A 1FPWA 1DGVA 1DMOA 1SBJA 3BXKA 4C0KA 1DJHA 4Q04A 2K8MB 4GGFA 1S6CA 1DEKA 1MXLC 3GOFA 1TNPA 4CPVA 1TTXA 1KWOB 1CNPA 1K8UA 2IS9A 1UHNA 4GPLB 2GGMA 2BECA 1SW8A 2H2KA 4NDDA 1X02A 2KBIA 2Y5IA 3PM2A 3SG4A 3D0YB 1NIWA 1FI5A 4N5XA 3CABA 1YURA 3O78A 1QV0A 2LV7A 5FI2A 4CFRA 1IGVA 1TUJA 3NSOA 1CFDA 1K94A 2PMYA 1M63B 4CFQA 1MUXA 1EG3A 1GJYA 4E68A 1RK9A 1QS7A 2LMVA 3KO0A 3LCPC 2YGUA 2GTEA 1Y1AA 2KYFA 1L2OB 2I7AA 2Q4UA 2BE4A 1UP5A 1OZSA 3SG5A 3TDUA 1EH2A 1KK8B 1A29A 5ER5A 3OGNA 1EL4A 2ZKMX 3I5FB 3DF0B 3CS1A 2R2IA 3ZWHA 3FE9A 1QTXA 3NXAA 4OR9B 2LVIA 2PASA 1UHKA 1DF0A 2M9GA 2WCHA 2WCJA 1KCYA 2LHLA 1BU3A 4ORCB 1AJ4A 3OHMB 1IIOA 1JF0A 3V2LA 5K89A 4YGEB 2KHNA 1CLBA 3SG6A 3CZ0A 1UWOA 1RFJA 2QEOA 2LMTA 2JULA 1NX0A 2H61C 1QX7A 1K2HA 4ORBB 1U5IA 2F2OA 2F8PA 2JZIA 2ZRTA 5FYXA 3EK8A 5HKZA 5AERA 1XFVO 2HQ8A 3AKAA 5J3XA 1J1DA 1N2DA 1YUTA 2ZN9A 2I94A 3I5GC 3IQOA 3BUOB 1OOIX 2M97A 3DVJA 1PSBA 1WRLA 2KAYA 1GM0A 3H4SE 1YVHA 2BCXA 1H4BA 2EHBA 2WORA 3LK1A 3N7HA 4MZLA 4I5KA 3FIAA 3A4UB 2Y4QA 3CYZA 4KYNA 1DJIA 4DRWA 4OZDA 4NDBA 1F8HA 1OOHA 1IQ5A 1MF8B 1NX2A 4NDCA 1TUZA 4N1FA 1JUOA 1DJWA 3PLFB 4WQ2A 3SG3A 4ORAB 1M39A 1OZOA 2L98A 4A4CA 1EXRA 1YVLA 2D8NA 1CMGA 1BJFA 4M2PA 5PALA 2AUCA 2L2CA 2QPTA 3S0AA 1ZMZA 1K9UA 1PVBA 1EJ3A 1B9AA 1TRFA 3C1VA 3D74A 4QJ3B 1YUUA 3VGOA 2LE9B 1LVCD 1CDNA 3EVRA 1YRUB 4PHNA 2SCPA 3FS7A 3B86A 3D77A 4HRGA 1KQMC 2LLTA 3I5HC 4GAOA 1L7ZA 3D10A 3S0EA 3CZ1A 1RJVA 1SNLA 4GFTA 3HX4A 3B87A 1CFFA 1DF0B 1B8LA 2M0RA 1SL8A 2KI4B 1LS8A 2BKIB 1NCZA 2OTGC 3CZTX 3EK7A 4HRHA 1R2UA 2QDIA 2LP2A 2NXQA 2ZN8A 1BLQA 1JFKA 1IG5A 5CSJA 1OMVA 2LVKA 4OCIA 3SJSA 1NSHA 1K9PA 3L4AA 4MBEA 1P28A 1CFCA 4C0JA 4MRYA 4XYNA 1U5IB 1PULA 2LUXA 1LKJA 3TZ1A 3BOWA 1RWYA 2JOJA 1SR6C 1XFUO 5KTYA 1ZUZA 2AAOA 2M3WA 1N65A 2L4IA 3FE6A 2NCOA 3SS4A 1A03A 3EKHA 1E8AA 4YGBB 2JQ6A 1SK6D 3DVEA 1C07A 1NYAA
chains in the Genus database with same CATH topology
5ER4X 1XFZO 1OQPA 5JJGA 2FCDA 1J55A 4PALA 3NSIA 1B8CA 1NCYA 2JT3A 2K7CA 2TN4A 1B4CA 1W7IB 1FBVA 1NP8A 3JTDC 2MLEC 1LA3A 2WNDA 1XA5A 2DOQA 2H61A 2I2RE 5HYDA 1XVJA 2O5GA 3BUMB 1BR4B 2LC5A 4GBAA 1KWOC 1SL9A 5TNCA 4D1EA 1TOPA 2L0PA 1SMGA 1BT6A 1SCMC 3AAKA 4JWQA 2BE6A 3PALA 2G9BA 1CDLA 1QLKA 4I5JA 4USLA 2KAVA 1K90D 4HREE 1B7TZ 1MWNA 2KI6C 1JBAA 1Y1UA 1V1GA 1WY9A 4WRIA 1XFXO 2HF5A 1JC2A 1PVAA 1JSAA 3OX6A 1HQVA 2M7LA 2WC8A 1YUSA 1M31A 3MSEB 4DIRA 4ETOA 5AEQA 1L2OC 2LMUA 2LM5A 3KPXA 3OP0A 4WQ3A 1KFUS 1BF5A 1KK8C 2KNEA 3DVKA 4NQGA 2WCBA 1SCVA 2JU0A 3I5FC 1KSMA 4YGAA 1R6PA 2JWWA 1B47A 3QRXA 2KFHA 2ZNDA 1KFXL 1SRAA 1FW4A 2LVJA 3GK4X 4ZCUA 2GGZA 1PSRA 3O6BA 1UHIA 1F70A 1ALWA 1BODA 3BOWB 3CR2A 2PSRA 1D1OA 2ISDA 2LAPA 1IJ6A 2K61A 2L2EA 4YGCB 1DJYA 1KK7Z 1G4YR 4GGNA 1F71A 3TS5B 4CLNA 3EKJA 1JFJA 1VRKA 1QVIZ 2NZ0A 2PRUA 1A4PA 5KSZA 3VRNA 5GQQC 1TN4A 4TNCA 2ZNEA 4M2OA 1MHOA 1S36A 3PN7C 1J7PA 4R1EA 4M2QA 2JPTA 4F0ZB 3LL8B 2K0JA 3NSKA 4GGFC 4FQOA 1S5GZ 2M7NA 2EC6B 2BL0B 5CSFA 1KSOA 3JVTB 4OKHA 1OSAA 1MR8A 2KQ6A 1F54A 5AXIA 1HT9A 1CFPA 1AVSA 1N0YA 1K95A 3DD4A 3I5GB 2CBLA 3K21A 1H8BA 1LA0A 2PVBA 1WRKA 3BQ3A 1PALA 2JNFA 4MRXA 2JC2A 3ICBA 1K9KA 5D7FA 5HLOA 2BBNA 1Y6WA 2KDHA 2Y1MA 2RGIA 4DUQA 2Q91A 2MLFC 2M8UA 4PDZA 2F3ZA 1NX3A 1OE9B 4MEWA 4PHJA 1CLLA 1CDPA 2L5XB 4IL1A 1GGWA 2OS8C 1QV1A 1B8RA 1DJXA 4A4BA 2K2AA 1LXFC 1XO5A 2LP3A 1RTP1 2CNPA 2CXJA 2M1UA 4YRUA 5I8NA 1XYDA 3BUXB 4U8DA 4L9MA 2LCPA 4N1GA 4P5OE 1BMOA 2E6WA 3LLEA 4PCWA 1IQ3A 1DT7B 1CMFA 4OVNF 1WDCB 5HKWA 4CIDA 1AP4A 2K2FA 3RLZA 2WCFA 2L51A 2KFFA 1JF2A 2JTTA 1TNXA 3PM8A 1J7RA 1S1EA 1UURA 1J7OA 1ODBA 2LHIA 2KGBC 4QJ5B 3KF9A 3I5IC 1BOCA 5JOLA 2JT8A 3TUYC 1Y0VH 1MXEA 2LVVA 3PFVA 2CT9A 4MN0A 2E30A 5AFPA 5I2OA 1SY9A 1CKKA 2O60A 3FWBA 1Q80A 1NX1A 1EG4A 3OB2B 3CGAA 2A4JA 1ZFSA 1BG1A 3ZNIA 2KSPA 4ZCVA 2VRGA 3GK2A 2KGRA 2JT0A 2ZRSA 1IJ5A 5I2QA 1JWDA 2KAXA 2MA2A 1TCOB 1DTLA 1A2XA 1MQ1A 1W7JB 4OV2A 5HLVA 1CM4A 1A75A 2CTNA 1GGZA 4JPZB 2MAZA 4XJKA 4I5LB 1QJTA 2I18A 5IBWA 2HPSA 1XK4C 3LK0A 1GQMA 1OOJA 2COLB 3DVMA 3RM1A 1IH0A 3KEVA 5I2LA 1SCMB 1OMRA 4JQ0D 1CLMA 1QIVA 1B1GA 3BUWB 3TDZA 3VROA 1IRJA 2PALA 2WOSA 3WHTB 1M46A 2MHHA 1SL7A 4I5NB 1SPYA 2JXCA 1V1FA 2FJUB 1DJZA 5G08A 4AQIA 1QATA 1QX5B 1XFWO 2L50A 2BCBA 3OX5A 2ZFDA 4BY5A 3HCMA 3VRQA 4YGDB 1KFXS 5HKYA 2KQYA 1KFUL 3AAJA 2B1UA 1ALVA 3SG7A 1KK7Y 2OPOA 1CTRA 2LLUA 1NPQA 3CTNA 4UPGA 1QVIY 4QJ4B 1CDMA 1M45A 1YRTB 2SASA 3TS5C 1RECA 1YX7A 4DS7A 1YTZC 4FTGA 2F2PA 2KYCA 1UHHA 1FF1A 1FI6A 1TCFA 2LLSA 3BUNB 1J7QA 2FOTA 1QX2A 1S5GY 2MJWB 4GNKB 1NWDA 2NLNA 1ZOTB 1QXPA 3O4YA 4P2YB 5D69A 3M0WA 2MBXA 4DCKA 5BPJA 2FCEA 2WCEA 2EC6C 2BL0C 2BKHB 3JVTC 1DJGA 2V53A 5DKQA 3O2PA 1QLSA 1A75B 1XFYO 3PN7B 3AKBA 3OB1B 1K96A 3A8RA 4HSZA 3WNXB 2NCPA 4XJKB 5B8IB 2MRDA 2K7DA 4MZKA 4PE0A 1CB1A 2M49B 2AMIA 3IQQA 3VRPA 4PE7A 2GV5A 1SKTA 1YR5A 3CLNA 1NUBA 3GK1A 1AK8A 2F33A 1SYMA 5KU1A 1AUIB 4MLWA 2JNXA 3PSRA 2M1KB 2K7OA 1PRWA 1S6JA 2HETA 2JTZA 1BR1B 1KQVA 3D0YA 5CSNA 1PK0D 3FWCA 3EVUA 4C0LA 2LUCA 2KI4C 1NCXA 3CR5X 3VRRA 2CCMA 2JXLA 2BBMA 5F6TA 2G2BA 3IF7A 2K7BA 1KQMB 1UUSA 1WDCC 1UHJA 1XK4A 3I5HB 1LINA 5DKNA 1S3PA 1G33A 1WLZA 1WRZA 2KFGA 2OS8B 3CWGA 4PE1A 1G8IA 4MSPA 2F3YA 3SIBA 4AQJA 4PHMA 2Y1NA 4AOMA 3WHUB 2OTGB 1TNQA 2M29A 5CPVA 1IWQA 1S26D 1AJ5A 1S6IA 3CR4X 3DF0A 3KHEA 4ICBA 2QACA 1F55A 3BYAA 1OMDA 1TNWA 1DGUA 2HQWA 3SIAA 1K93D 2JRFA 2L4HA 3PATA 4MVFA 4BY4A 1CM1A 4MZJA 1Y1XA 1YX8A 2KBMA 3TDIA 2LANA 1DVIA 2KI6D 4YI8A 3EK4A 1RROA 1SR6B 1F4QA 4YBHB 1TIZA 3I5IB 5DKRA 2KOTA 1WLMA 1AHRA 4YI9A 3NSLA 3F45A 3E3RA 4PHKA 3TUYB 5CSIA 1IKUA 3EVVA 1ZACA 4GUKA 2LNKA 1C7VA 1F4OA 3WXAA 2EGDA 1J1EA 1B7TY 2BCAA 1C7WA 1QIWA 2P6BB 5AANA 1QASA 4PE4A 3JTDB 3SG2A 1FPWA 1DGVA 1DMOA 1SBJA 3BXKA 4C0KA 1DJHA 4Q04A 2K8MB 4GGFA 1S6CA 1MXLC 3GOFA 4CPVA 1TNPA 1CNPA 1TTXA 1KWOB 1K8UA 2IS9A 1UHNA 4GPLB 2GGMA 2BECA 1SW8A 2H2KA 4NDDA 1X02A 2KBIA 2Y5IA 3SG4A 3D0YB 1NIWA 1FI5A 4N5XA 1YURA 3O78A 1QV0A 2LV7A 4CFRA 1IGVA 3NSOA 1CFDA 1K94A 2PMYA 1M63B 4CFQA 1MUXA 1EG3A 1GJYA 4E68A 1RK9A 1QS7A 2LMVA 3KO0A 3LCPC 1Y1AA 2KYFA 1L2OB 2I7AA 2Q4UA 2BE4A 1UP5A 1OZSA 3SG5A 3TDUA 1EH2A 1KK8B 1A29A 5ER5A 1EL4A 2ZKMX 3I5FB 3DF0B 3CS1A 2R2IA 3ZWHA 1QTXA 3NXAA 4OR9B 2LVIA 2PASA 1UHKA 1DF0A 2M9GA 1KCYA 2LHLA 1BU3A 1AJ4A 3OHMB 1JF0A 5K89A 4YGEB 2KHNA 1CLBA 3SG6A 1UWOA 1RFJA 2LMTA 2JULA 1NX0A 2H61C 1QX7A 1K2HA 4ORBB 1U5IA 2F2OA 2F8PA 2JZIA 2ZRTA 5FYXA 3EK8A 5HKZA 5AERA 1XFVO 2HQ8A 3AKAA 5J3XA 1J1DA 1N2DA 1YUTA 2ZN9A 2I94A 3I5GC 3IQOA 3BUOB 2M97A 3DVJA 1PSBA 1WRLA 2KAYA 3H4SE 1YVHA 2BCXA 1H4BA 2EHBA 2WORA 3LK1A 4MZLA 4I5KA 3FIAA 3A4UB 2Y4QA 1DJIA 4DRWA 4NDBA 1F8HA 1IQ5A 1MF8B 1NX2A 4NDCA 4N1FA 1JUOA 1DJWA 3PLFB 4WQ2A 3SG3A 4ORAB 1M39A 1OZOA 2L98A 4A4CA 1EXRA 1YVLA 2D8NA 1CMGA 1BJFA 4M2PA 5PALA 2AUCA 2QPTA 1ZMZA 1K9UA 1PVBA 1EJ3A 1B9AA 1TRFA 3C1VA 4QJ3B 1YUUA 3VGOA 2LE9B 1LVCD 1CDNA 3EVRA 1YRUB 4PHNA 2SCPA 3FS7A 4HRGA 1KQMC 2LLTA 3I5HC 4GAOA 1L7ZA 3D10A 1RJVA 1SNLA 4GFTA 3HX4A 1CFFA 1DF0B 1B8LA 2M0RA 1SL8A 2KI4B 2BKIB 2OTGC 1NCZA 3CZTX 3EK7A 4HRHA 4ORCB 1R2UA 3SJSA 2LP2A 2NXQA 2ZN8A 1BLQA 1JFKA 1IG5A 5CSJA 1OMVA 2LVKA 4OCIA 1NSHA 1K9PA 4MBEA 1CFCA 4C0JA 4MRYA 4XYNA 1U5IB 1PULA 2LUXA 1LKJA 3TZ1A 3BOWA 1RWYA 2JOJA 1SR6C 1XFUO 5KTYA 1ZUZA 2AAOA 2M3WA 1N65A 2L4IA 2NCOA 1A03A 3EKHA 1E8AA 4YGBB 2JQ6A 1SK6D 3DVEA 1C07A 1NYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ER4 X;  1XFZ O;  1OQP A;  5JJG A;  2FCD A;  1J55 A;  4PAL A;  3NSI A;  1B8C A;  1NCY A;  2JT3 A;  2K7C A;  2TN4 A;  1B4C A;  1W7I B;  1FBV A;  1NP8 A;  3JTD C;  2MLE C;  1LA3 A;  2WND A;  1XA5 A;  2DOQ A;  2H61 A;  2I2R E;  5HYD A;  1XVJ A;  2O5G A;  3BUM B;  1BR4 B;  2LC5 A;  4GBA A;  1KWO C;  1SL9 A;  5TNC A;  4D1E A;  1TOP A;  2L0P A;  1SMG A;  1BT6 A;  1SCM C;  3AAK A;  4JWQ A;  2BE6 A;  3PAL A;  2G9B A;  1CDL A;  1QLK A;  4I5J A;  4USL A;  2KAV A;  1K90 D;  4HRE E;  1B7T Z;  1MWN A;  2KI6 C;  1JBA A;  1Y1U A;  1V1G A;  1WY9 A;  4WRI A;  1XFX O;  2HF5 A;  1JC2 A;  1PVA A;  1JSA A;  3OX6 A;  1HQV A;  2M7L A;  2WC8 A;  1YUS A;  1M31 A;  3MSE B;  4DIR A;  4ETO A;  5AEQ A;  1L2O C;  2LMU A;  2LM5 A;  3KPX A;  3OP0 A;  4WQ3 A;  1KFU S;  1BF5 A;  1KK8 C;  2KNE A;  3DVK A;  4NQG A;  2WCB A;  1SCV A;  2JU0 A;  3I5F C;  1KSM A;  4YGA A;  1R6P A;  2JWW A;  1B47 A;  3QRX A;  2KFH A;  2ZND A;  1KFX L;  1SRA A;  1FW4 A;  2LVJ A;  3GK4 X;  4ZCU A;  2GGZ A;  1PSR A;  3O6B A;  1UHI A;  1F70 A;  1ALW A;  1BOD A;  3BOW B;  3CR2 A;  2PSR A;  1D1O A;  2ISD A;  2LAP A;  1IJ6 A;  2K61 A;  2L2E A;  4YGC B;  1DJY A;  1KK7 Z;  1G4Y R;  4GGN A;  1F71 A;  3TS5 B;  4CLN A;  3EKJ A;  1JFJ A;  1VRK A;  1QVI Z;  2NZ0 A;  2PRU A;  1A4P A;  5KSZ A;  3VRN A;  5GQQ C;  1TN4 A;  4TNC A;  2ZNE A;  4M2O A;  1MHO A;  1S36 A;  3PN7 C;  1J7P A;  4R1E A;  4M2Q A;  2JPT A;  4F0Z B;  3LL8 B;  2K0J A;  3NSK A;  4GGF C;  4FQO A;  1S5G Z;  2M7N A;  2EC6 B;  2BL0 B;  5CSF A;  1KSO A;  3JVT B;  4OKH A;  1OSA A;  1MR8 A;  2KQ6 A;  1F54 A;  5AXI A;  1HT9 A;  1CFP A;  1AVS A;  1N0Y A;  1K95 A;  3DD4 A;  3I5G B;  2CBL A;  3K21 A;  1H8B A;  1LA0 A;  2PVB A;  1WRK A;  3BQ3 A;  1PAL A;  2JNF A;  4MRX A;  2JC2 A;  3ICB A;  1K9K A;  5D7F A;  5HLO A;  2BBN A;  1Y6W A;  2KDH A;  2Y1M A;  2RGI A;  4DUQ A;  2Q91 A;  2MLF C;  2M8U A;  4PDZ A;  2F3Z A;  1NX3 A;  1OE9 B;  4MEW A;  4PHJ A;  1CLL A;  1CDP A;  2L5X B;  4IL1 A;  1GGW A;  2OS8 C;  1QV1 A;  1B8R A;  1DJX A;  4A4B A;  2K2A A;  1LXF C;  1XO5 A;  2LP3 A;  1RTP 1;  2CNP A;  2CXJ A;  2M1U A;  4YRU A;  5I8N A;  1XYD A;  3BUX B;  4U8D A;  4L9M A;  2LCP A;  4N1G A;  4P5O E;  1BMO A;  2E6W A;  3LLE A;  4PCW A;  1IQ3 A;  1DT7 B;  1CMF A;  4OVN F;  1WDC B;  5HKW A;  4CID A;  1AP4 A;  2K2F A;  3RLZ A;  2WCF A;  2L51 A;  2KFF A;  1JF2 A;  2JTT A;  1TNX A;  3PM8 A;  1J7R A;  1S1E A;  1UUR A;  1J7O A;  1ODB A;  2LHI A;  2KGB C;  4QJ5 B;  3KF9 A;  3I5I C;  1BOC A;  5JOL A;  2JT8 A;  3TUY C;  1Y0V H;  1MXE A;  2LVV A;  3PFV A;  2CT9 A;  4MN0 A;  2E30 A;  5AFP A;  5I2O A;  1SY9 A;  1CKK A;  2O60 A;  3FWB A;  1Q80 A;  1NX1 A;  1EG4 A;  3OB2 B;  3CGA A;  2A4J A;  1ZFS A;  1BG1 A;  3ZNI A;  2KSP A;  4ZCV A;  2VRG A;  3GK2 A;  2KGR A;  2JT0 A;  2ZRS A;  1IJ5 A;  5I2Q A;  1JWD A;  2KAX A;  2MA2 A;  1TCO B;  1DTL A;  1A2X A;  1MQ1 A;  1W7J B;  4OV2 A;  5HLV A;  1CM4 A;  1A75 A;  2CTN A;  1GGZ A;  4JPZ B;  2MAZ A;  4XJK A;  4I5L B;  1QJT A;  2I18 A;  5IBW A;  2HPS A;  1XK4 C;  3LK0 A;  1GQM A;  1OOJ A;  2COL B;  3DVM A;  3RM1 A;  1IH0 A;  3KEV A;  5I2L A;  1SCM B;  1OMR A;  4JQ0 D;  1CLM A;  1QIV A;  1B1G A;  3BUW B;  3TDZ A;  3VRO A;  1IRJ A;  2PAL A;  2WOS A;  3WHT B;  1M46 A;  2MHH A;  1SL7 A;  4I5N B;  1SPY A;  2JXC A;  1V1F A;  2FJU B;  1DJZ A;  5G08 A;  4AQI A;  1QAT A;  1QX5 B;  1XFW O;  2L50 A;  2BCB A;  3OX5 A;  2ZFD A;  4BY5 A;  3HCM A;  3VRQ A;  4YGD B;  1KFX S;  5HKY A;  2KQY A;  1KFU L;  3AAJ A;  2B1U A;  1ALV A;  3SG7 A;  1KK7 Y;  2OPO A;  1CTR A;  2LLU A;  1NPQ A;  3CTN A;  4UPG A;  1QVI Y;  4QJ4 B;  1CDM A;  1M45 A;  1YRT B;  2SAS A;  3TS5 C;  1REC A;  1YX7 A;  4DS7 A;  1YTZ C;  4FTG A;  2F2P A;  2KYC A;  1UHH A;  1FF1 A;  1FI6 A;  1TCF A;  2LLS A;  3BUN B;  1J7Q A;  2FOT A;  1QX2 A;  1S5G Y;  2MJW B;  4GNK B;  1NWD A;  2NLN A;  1ZOT B;  1QXP A;  3O4Y A;  4P2Y B;  5D69 A;  3M0W A;  2MBX A;  4DCK A;  5BPJ A;  2FCE A;  2WCE A;  2EC6 C;  2BL0 C;  2BKH B;  3JVT C;  1DJG A;  2V53 A;  5DKQ A;  3O2P A;  1QLS A;  1A75 B;  1XFY O;  3PN7 B;  3AKB A;  3OB1 B;  1K96 A;  3A8R A;  4HSZ A;  3WNX B;  2NCP A;  4XJK B;  5B8I B;  2MRD A;  2K7D A;  4MZK A;  4PE0 A;  1CB1 A;  2M49 B;  2AMI A;  3IQQ A;  3VRP A;  4PE7 A;  2GV5 A;  1SKT A;  1YR5 A;  3CLN A;  1NUB A;  3GK1 A;  1AK8 A;  2F33 A;  1SYM A;  5KU1 A;  1AUI B;  4MLW A;  2JNX A;  3PSR A;  2M1K B;  2K7O A;  1PRW A;  1S6J A;  2HET A;  2JTZ A;  1BR1 B;  1KQV A;  3D0Y A;  5CSN A;  1PK0 D;  3FWC A;  3EVU A;  4C0L A;  2LUC A;  2KI4 C;  1NCX A;  3CR5 X;  3VRR A;  2CCM A;  2JXL A;  2BBM A;  5F6T A;  2G2B A;  3IF7 A;  2K7B A;  1KQM B;  1UUS A;  1WDC C;  1UHJ A;  1XK4 A;  3I5H B;  1LIN A;  5DKN A;  1S3P A;  1G33 A;  1WLZ A;  1WRZ A;  2KFG A;  2OS8 B;  3CWG A;  4PE1 A;  1G8I A;  4MSP A;  2F3Y A;  3SIB A;  4AQJ A;  4PHM A;  2Y1N A;  4AOM A;  3WHU B;  2OTG B;  1TNQ A;  2M29 A;  5CPV A;  1IWQ A;  1S26 D;  1AJ5 A;  1S6I A;  3CR4 X;  3DF0 A;  3KHE A;  4ICB A;  2QAC A;  1F55 A;  3BYA A;  1OMD A;  1TNW A;  1DGU A;  2HQW A;  3SIA A;  1K93 D;  2JRF A;  2L4H A;  3PAT A;  4MVF A;  4BY4 A;  1CM1 A;  4MZJ A;  1Y1X A;  1YX8 A;  2KBM A;  3TDI A;  2LAN A;  1DVI A;  2KI6 D;  4YI8 A;  3EK4 A;  1RRO A;  1SR6 B;  1F4Q A;  4YBH B;  1TIZ A;  3I5I B;  5DKR A;  2KOT A;  1WLM A;  1AHR A;  4YI9 A;  3NSL A;  3F45 A;  3E3R A;  4PHK A;  3TUY B;  5CSI A;  1IKU A;  3EVV A;  1ZAC A;  4GUK A;  2LNK A;  1C7V A;  1F4O A;  3WXA A;  2EGD A;  1J1E A;  1B7T Y;  2BCA A;  1C7W A;  1QIW A;  2P6B B;  5AAN A;  1QAS A;  4PE4 A;  3JTD B;  3SG2 A;  1FPW A;  1DGV A;  1DMO A;  1SBJ A;  3BXK A;  4C0K A;  1DJH A;  4Q04 A;  2K8M B;  4GGF A;  1S6C A;  1MXL C;  3GOF A;  4CPV A;  1TNP A;  1CNP A;  1TTX A;  1KWO B;  1K8U A;  2IS9 A;  1UHN A;  4GPL B;  2GGM A;  2BEC A;  1SW8 A;  2H2K A;  4NDD A;  1X02 A;  2KBI A;  2Y5I A;  3SG4 A;  3D0Y B;  1NIW A;  1FI5 A;  4N5X A;  1YUR A;  3O78 A;  1QV0 A;  2LV7 A;  4CFR A;  1IGV A;  3NSO A;  1CFD A;  1K94 A;  2PMY A;  1M63 B;  4CFQ A;  1MUX A;  1EG3 A;  1GJY A;  4E68 A;  1RK9 A;  1QS7 A;  2LMV A;  3KO0 A;  3LCP C;  1Y1A A;  2KYF A;  1L2O B;  2I7A A;  2Q4U A;  2BE4 A;  1UP5 A;  1OZS A;  3SG5 A;  3TDU A;  1EH2 A;  1KK8 B;  1A29 A;  5ER5 A;  1EL4 A;  2ZKM X;  3I5F B;  3DF0 B;  3CS1 A;  2R2I A;  3ZWH A;  1QTX A;  3NXA A;  4OR9 B;  2LVI A;  2PAS A;  1UHK A;  1DF0 A;  2M9G A;  1KCY A;  2LHL A;  1BU3 A;  1AJ4 A;  3OHM B;  1JF0 A;  5K89 A;  4YGE B;  2KHN A;  1CLB A;  3SG6 A;  1UWO A;  1RFJ A;  2LMT A;  2JUL A;  1NX0 A;  2H61 C;  1QX7 A;  1K2H A;  4ORB B;  1U5I A;  2F2O A;  2F8P A;  2JZI A;  2ZRT A;  5FYX A;  3EK8 A;  5HKZ A;  5AER A;  1XFV O;  2HQ8 A;  3AKA A;  5J3X A;  1J1D A;  1N2D A;  1YUT A;  2ZN9 A;  2I94 A;  3I5G C;  3IQO A;  3BUO B;  2M97 A;  3DVJ A;  1PSB A;  1WRL A;  2KAY A;  3H4S E;  1YVH A;  2BCX A;  1H4B A;  2EHB A;  2WOR A;  3LK1 A;  4MZL A;  4I5K A;  3FIA A;  3A4U B;  2Y4Q A;  1DJI A;  4DRW A;  4NDB A;  1F8H A;  1IQ5 A;  1MF8 B;  1NX2 A;  4NDC A;  4N1F A;  1JUO A;  1DJW A;  3PLF B;  4WQ2 A;  3SG3 A;  4ORA B;  1M39 A;  1OZO A;  2L98 A;  4A4C A;  1EXR A;  1YVL A;  2D8N A;  1CMG A;  1BJF A;  4M2P A;  5PAL A;  2AUC A;  2QPT A;  1ZMZ A;  1K9U A;  1PVB A;  1EJ3 A;  1B9A A;  1TRF A;  3C1V A;  4QJ3 B;  1YUU A;  3VGO A;  2LE9 B;  1LVC D;  1CDN A;  3EVR A;  1YRU B;  4PHN A;  2SCP A;  3FS7 A;  4HRG A;  1KQM C;  2LLT A;  3I5H C;  4GAO A;  1L7Z A;  3D10 A;  1RJV A;  1SNL A;  4GFT A;  3HX4 A;  1CFF A;  1DF0 B;  1B8L A;  2M0R A;  1SL8 A;  2KI4 B;  2BKI B;  2OTG C;  1NCZ A;  3CZT X;  3EK7 A;  4HRH A;  4ORC B;  1R2U A;  3SJS A;  2LP2 A;  2NXQ A;  2ZN8 A;  1BLQ A;  1JFK A;  1IG5 A;  5CSJ A;  1OMV A;  2LVK A;  4OCI A;  1NSH A;  1K9P A;  4MBE A;  1CFC A;  4C0J A;  4MRY A;  4XYN A;  1U5I B;  1PUL A;  2LUX A;  1LKJ A;  3TZ1 A;  3BOW A;  1RWY A;  2JOJ A;  1SR6 C;  1XFU O;  5KTY A;  1ZUZ A;  2AAO A;  2M3W A;  1N65 A;  2L4I A;  2NCO A;  1A03 A;  3EKH A;  1E8A A;  4YGB B;  2JQ6 A;  1SK6 D;  3DVE A;  1C07 A;  1NYA A; 
#chains in the Genus database with same CATH topology
 5ER4 X;  1XFZ O;  3B7A A;  1OQP A;  5JJG A;  2FCD A;  1J55 A;  4PAL A;  3NSI A;  1B8C A;  1NCY A;  2JT3 A;  2K7C A;  2TN4 A;  3K1E A;  1W7I B;  1B4C A;  1FBV A;  1NP8 A;  3JTD C;  2MLE C;  1LA3 A;  2WND A;  1XA5 A;  2DOQ A;  2H61 A;  2I2R E;  5HYD A;  1XVJ A;  2O5G A;  3S0B A;  3BUM B;  1BR4 B;  2LC5 A;  4GBA A;  1KWO C;  1SL9 A;  5TNC A;  4D1E A;  1TOP A;  2L0P A;  1SMG A;  1BT6 A;  3S0F A;  1SCM C;  3D78 A;  3AAK A;  5DIC A;  4JWQ A;  2BE6 A;  2KLE A;  3PAL A;  3SS3 A;  2G9B A;  1CDL A;  1QLK A;  4I5J A;  4USL A;  2KAV A;  1K90 D;  4HRE E;  1B7T Z;  1MWN A;  2KI6 C;  1JBA A;  3Q8I A;  1Y1U A;  1V1G A;  1WY9 A;  3NHT A;  4WRI A;  1XFX O;  2HF5 A;  1JC2 A;  1PVA A;  1JSA A;  3B6X A;  3OX6 A;  1HQV A;  3DYE A;  2WC8 A;  2M7L A;  1YUS A;  1M31 A;  3CDN A;  3MSE B;  4DIR A;  4ETO A;  4INX A;  5AEQ A;  1L2O C;  2LMU A;  2LM5 A;  2K60 A;  3KPX A;  3OP0 A;  4WQ3 A;  3DY9 A;  1KFU S;  1BF5 A;  1KK8 C;  2KNE A;  3B88 A;  3DVK A;  2WCB A;  1SCV A;  2JU0 A;  3R1O A;  3I5F C;  4NQG A;  5FI6 A;  1DC1 A;  1KSM A;  3R1V A;  4YGA A;  1R6P A;  1C3Y A;  2JWW A;  1B47 A;  3QRX A;  2KFH A;  2ZND A;  1KFX L;  1SRA A;  1FW4 A;  2LVJ A;  2PQL A;  3GK4 X;  4ZCU A;  2GGZ A;  1PSR A;  3O6B A;  1UHI A;  1F70 A;  1ALW A;  1BOD A;  3BOW B;  3CR2 A;  3SS5 A;  2PSR A;  1D1O A;  2ISD A;  2LAP A;  1IJ6 A;  2K61 A;  2L2E A;  4YGC B;  1DJY A;  1KK7 Z;  1G4Y R;  4GGN A;  1F71 A;  3TS5 B;  4CLN A;  3EKJ A;  1TWO A;  1JFJ A;  1VRK A;  1QVI Z;  2NZ0 A;  2PRU A;  1A4P A;  5KSZ A;  3VRN A;  5GQQ C;  1TN4 A;  4TNC A;  2ZNE A;  4FQT A;  1MHO A;  1S36 A;  2WCL A;  3PN7 C;  4M2O A;  1J7P A;  4R1E A;  4M2Q A;  2JPT A;  5I94 A;  4F0Z B;  3DXL A;  3LL8 B;  2K0J A;  3NSK A;  4GGF C;  4FQO A;  1S5G Z;  2M7N A;  2EC6 B;  2BL0 B;  5CSF A;  1KSO A;  2QEV A;  3JVT B;  4OKH A;  1OSA A;  1MR8 A;  2BAP A;  2KQ6 A;  1F54 A;  5AXI A;  1HT9 A;  3BFH A;  1AVS A;  1N0Y A;  1CFP A;  1K95 A;  3DD4 A;  3I5G B;  2CBL A;  3K21 A;  2PYQ A;  1H8B A;  1LA0 A;  2PVB A;  1WRK A;  3BQ3 A;  1PAL A;  2JNF A;  4MRX A;  2WCM A;  2JC2 A;  3ICB A;  1K9K A;  5D7F A;  5HLO A;  2BBN A;  1Y6W A;  3O4X A;  2KDH A;  2Y1M A;  2RGI A;  4DUQ A;  2Q91 A;  2MLF C;  2WCK A;  2M8U A;  4PDZ A;  2F3Z A;  1NX3 A;  1OE9 B;  4MEW A;  4PHJ A;  1CLL A;  1CDP A;  2L5X B;  4IL1 A;  1GGW A;  2OS8 C;  1QV1 A;  1B8R A;  1DJX A;  4A4B A;  2K2A A;  1Z2C B;  1LXF C;  1XO5 A;  2LP3 A;  1RTP 1;  2CNP A;  2CXJ A;  2M1U A;  3IVT A;  4YRU A;  5I8N A;  1XYD A;  3BUX B;  4U8D A;  4L9M A;  2LCP A;  4N1G A;  4P5O E;  1BMO A;  2E6W A;  3LLE A;  4PCW A;  1IQ3 A;  1DT7 B;  1CMF A;  4OVN F;  1WDC B;  5HKW A;  4CID A;  1AP4 A;  2K2F A;  3RLZ A;  1SSE B;  2WCF A;  2L51 A;  2KFF A;  1JF2 A;  2JTT A;  1TNX A;  3PM8 A;  4JD9 A;  1J7R A;  1S1E A;  1UUR A;  1J7O A;  1ODB A;  2LHI A;  5D3O A;  2KGB C;  4QJ5 B;  3KF9 A;  3BJH A;  3I5I C;  1BOC A;  5JOL A;  3EG5 B;  3VB1 A;  2JT8 A;  3TUY C;  1Y0V H;  3NHI A;  1MXE A;  2LVV A;  3PFV A;  3R1P A;  1T14 A;  2CT9 A;  2E30 A;  4MN0 A;  5AFP A;  1SY9 A;  5I2O A;  1CKK A;  2O60 A;  3FWB A;  1Q80 A;  1NX1 A;  2JPO A;  4IJ7 A;  1EG4 A;  3OB2 B;  3CGA A;  2A4J A;  1DQE A;  1ZFS A;  2QEB A;  4F7F A;  1BG1 A;  3ZNI A;  2KSP A;  4ZCV A;  3RZS A;  2VRG A;  1OOG A;  3GK2 A;  2KGR A;  2JT0 A;  2ZRS A;  1IJ5 A;  5I2Q A;  1JWD A;  2KAX A;  2MA2 A;  1TCO B;  1DTL A;  1A2X A;  1MQ1 A;  1W7J B;  3D73 A;  4OV2 A;  5HLV A;  1CM4 A;  1A75 A;  3S0G A;  2CTN A;  1GGZ A;  4JPZ B;  2MAZ A;  4XJK A;  4I5L B;  3OBV A;  1QJT A;  2I18 A;  5IBW A;  2HPS A;  1XK4 C;  3LK0 A;  1GQM A;  1OOJ A;  2COL B;  3DVM A;  3RM1 A;  1IH0 A;  3KEV A;  5I2L A;  1SCM B;  1OMR A;  4JQ0 D;  1CLM A;  1QIV A;  3L47 A;  1B1G A;  3BUW B;  3TDZ A;  3VRO A;  1IRJ A;  2PAL A;  2WOS A;  3UO9 A;  3WHT B;  1M46 A;  2MHH A;  1SL7 A;  3UNW A;  4I5N B;  1SPY A;  2JXC A;  1V1F A;  2FJU B;  3S0D A;  1DJZ A;  5G08 A;  4AQI A;  1Z4H A;  1QAT A;  1QX5 B;  1XFW O;  2L50 A;  2BCB A;  2WC6 A;  3OX5 A;  2ZFD A;  4BY5 A;  3HCM A;  3VRQ A;  4YGD B;  1KFX S;  3PJI A;  5HKY A;  2KQY A;  1KFU L;  3AAJ A;  2B1U A;  2BNX A;  1ALV A;  3SG7 A;  2KPH A;  1KK7 Y;  2OPO A;  1CTR A;  2LLU A;  1NPQ A;  3CTN A;  4UPG A;  1QVI Y;  4QJ4 B;  1CDM A;  1M45 A;  1YRT B;  2SAS A;  3TS5 C;  1REC A;  1YX7 A;  4DS7 A;  1YTZ C;  4FTG A;  1W9Z A;  2F2P A;  2KYC A;  1UHH A;  2WC5 A;  1FF1 A;  1ORG A;  1FI6 A;  3D76 A;  3BFB A;  1TCF A;  2LLS A;  3BUN B;  1J7Q A;  2FOT A;  1QX2 A;  1S5G Y;  2MJW B;  4GNK B;  1NWD A;  3BFA A;  2NLN A;  1ZOT B;  1QXP A;  3O4Y A;  4P2Y B;  5D69 A;  3M0W A;  2MBX A;  4DCK A;  5BPJ A;  2FCE A;  2WCE A;  4JKT A;  2EC6 C;  2BL0 C;  2BKH B;  3JVT C;  1DJG A;  3CZ2 A;  2V53 A;  5DKQ A;  3O2P A;  1QLS A;  1A75 B;  1XFY O;  3PN7 B;  3QME A;  3AKB A;  3OB1 B;  1K96 A;  2P71 A;  1DEL A;  3A8R A;  4HSZ A;  2KLD A;  2NCP A;  4XJK B;  3WNX B;  2MRD A;  5B8I B;  2K7D A;  4MZK A;  4PE0 A;  1CB1 A;  2M49 B;  2AMI A;  3IQQ A;  3VRP A;  4PE7 A;  2GV5 A;  1SKT A;  1YR5 A;  3CLN A;  1NUB A;  3GK1 A;  1AK8 A;  2F33 A;  1C3Z A;  1SYM A;  5KU1 A;  1AUI B;  4MLW A;  2JNX A;  3PSR A;  2M1K B;  2K7O A;  1PRW A;  1S6J A;  2HET A;  2JTZ A;  1BR1 B;  1KQV A;  5EL2 A;  1QWV A;  3D0Y A;  3L4L A;  5CSN A;  2ERB A;  1PK0 D;  3FWC A;  3EVU A;  4C0L A;  2LUC A;  2KI4 C;  1NCX A;  3CR5 X;  1XFR A;  3VRR A;  2CCM A;  2JXL A;  2L5Y A;  5FI7 A;  2BBM A;  5F6T A;  2G2B A;  3IF7 A;  2K7B A;  1KQM B;  1UUS A;  1WDC C;  1UHJ A;  1XK4 A;  3DZT A;  1LIN A;  3I5H B;  1S3P A;  1G33 A;  1WLZ A;  1WRZ A;  2KFG A;  2OS8 B;  3CWG A;  4PE1 A;  1G8I A;  4MSP A;  2F3Y A;  3NGV A;  3SIB A;  4AQJ A;  5DKN A;  3R72 A;  4PHM A;  2Y1N A;  2P70 A;  4AOM A;  3WHU B;  2OTG B;  1TNQ A;  2M29 A;  5CPV A;  1IWQ A;  1S26 D;  1AJ5 A;  1S6I A;  3CR4 X;  2H8V A;  3D75 A;  3DF0 A;  2QAC A;  3KHE A;  3BYA A;  4ICB A;  2QEH A;  1F55 A;  1OMD A;  1TNW A;  1DGU A;  2HQW A;  3SIA A;  1K93 D;  2JRF A;  2L4H A;  3PAT A;  4MVF A;  4BY4 A;  5HL1 A;  1CM1 A;  4MZJ A;  1Y1X A;  1YX8 A;  2KBM A;  3TDI A;  2LAN A;  1DVI A;  2KI6 D;  4YI8 A;  3EK4 A;  1RRO A;  1SR6 B;  2FJY A;  1F4Q A;  4YBH B;  1TIZ A;  3I5I B;  5DKR A;  2KOT A;  3FE8 A;  1WLM A;  1AHR A;  4YI9 A;  3NSL A;  3F45 A;  3E3R A;  4PHK A;  3TUY B;  5CSI A;  1IKU A;  3EVV A;  1ZAC A;  4GUK A;  2LNK A;  1C7V A;  1OOF A;  1F4O A;  4PT1 A;  3WXA A;  2EGD A;  1J1E A;  1B7T Y;  2BCA A;  1C7W A;  1QIW A;  1OW4 A;  2P6B B;  5AAN A;  1QAS A;  4PE4 A;  3JTD B;  4INW A;  3SG2 A;  1FPW A;  1DGV A;  1DMO A;  1SBJ A;  3BXK A;  4C0K A;  1DJH A;  4Q04 A;  2K8M B;  4GGF A;  1S6C A;  1DEK A;  1MXL C;  3GOF A;  1TNP A;  4CPV A;  1TTX A;  1KWO B;  1CNP A;  1K8U A;  2IS9 A;  1UHN A;  4GPL B;  2GGM A;  2BEC A;  1SW8 A;  2H2K A;  4NDD A;  1X02 A;  2KBI A;  2Y5I A;  3PM2 A;  3SG4 A;  3D0Y B;  1NIW A;  1FI5 A;  4N5X A;  3CAB A;  1YUR A;  3O78 A;  1QV0 A;  2LV7 A;  5FI2 A;  4CFR A;  1IGV A;  1TUJ A;  3NSO A;  1CFD A;  1K94 A;  2PMY A;  1M63 B;  4CFQ A;  1MUX A;  1EG3 A;  1GJY A;  4E68 A;  1RK9 A;  1QS7 A;  2LMV A;  3KO0 A;  3LCP C;  2YGU A;  2GTE A;  1Y1A A;  2KYF A;  1L2O B;  2I7A A;  2Q4U A;  2BE4 A;  1UP5 A;  1OZS A;  3SG5 A;  3TDU A;  1EH2 A;  1KK8 B;  1A29 A;  5ER5 A;  3OGN A;  1EL4 A;  2ZKM X;  3I5F B;  3DF0 B;  3CS1 A;  2R2I A;  3ZWH A;  3FE9 A;  1QTX A;  3NXA A;  4OR9 B;  2LVI A;  2PAS A;  1UHK A;  1DF0 A;  2M9G A;  2WCH A;  2WCJ A;  1KCY A;  2LHL A;  1BU3 A;  4ORC B;  1AJ4 A;  3OHM B;  1IIO A;  1JF0 A;  3V2L A;  5K89 A;  4YGE B;  2KHN A;  1CLB A;  3SG6 A;  3CZ0 A;  1UWO A;  1RFJ A;  2QEO A;  2LMT A;  2JUL A;  1NX0 A;  2H61 C;  1QX7 A;  1K2H A;  4ORB B;  1U5I A;  2F2O A;  2F8P A;  2JZI A;  2ZRT A;  5FYX A;  3EK8 A;  5HKZ A;  5AER A;  1XFV O;  2HQ8 A;  3AKA A;  5J3X A;  1J1D A;  1N2D A;  1YUT A;  2ZN9 A;  2I94 A;  3I5G C;  3IQO A;  3BUO B;  1OOI X;  2M97 A;  3DVJ A;  1PSB A;  1WRL A;  2KAY A;  1GM0 A;  3H4S E;  1YVH A;  2BCX A;  1H4B A;  2EHB A;  2WOR A;  3LK1 A;  3N7H A;  4MZL A;  4I5K A;  3FIA A;  3A4U B;  2Y4Q A;  3CYZ A;  4KYN A;  1DJI A;  4DRW A;  4OZD A;  4NDB A;  1F8H A;  1OOH A;  1IQ5 A;  1MF8 B;  1NX2 A;  4NDC A;  1TUZ A;  4N1F A;  1JUO A;  1DJW A;  3PLF B;  4WQ2 A;  3SG3 A;  4ORA B;  1M39 A;  1OZO A;  2L98 A;  4A4C A;  1EXR A;  1YVL A;  2D8N A;  1CMG A;  1BJF A;  4M2P A;  5PAL A;  2AUC A;  2L2C A;  2QPT A;  3S0A A;  1ZMZ A;  1K9U A;  1PVB A;  1EJ3 A;  1B9A A;  1TRF A;  3C1V A;  3D74 A;  4QJ3 B;  1YUU A;  3VGO A;  2LE9 B;  1LVC D;  1CDN A;  3EVR A;  1YRU B;  4PHN A;  2SCP A;  3FS7 A;  3B86 A;  3D77 A;  4HRG A;  1KQM C;  2LLT A;  3I5H C;  4GAO A;  1L7Z A;  3D10 A;  3S0E A;  3CZ1 A;  1RJV A;  1SNL A;  4GFT A;  3HX4 A;  3B87 A;  1CFF A;  1DF0 B;  1B8L A;  2M0R A;  1SL8 A;  2KI4 B;  1LS8 A;  2BKI B;  1NCZ A;  2OTG C;  3CZT X;  3EK7 A;  4HRH A;  1R2U A;  2QDI A;  2LP2 A;  2NXQ A;  2ZN8 A;  1BLQ A;  1JFK A;  1IG5 A;  5CSJ A;  1OMV A;  2LVK A;  4OCI A;  3SJS A;  1NSH A;  1K9P A;  3L4A A;  4MBE A;  1P28 A;  1CFC A;  4C0J A;  4MRY A;  4XYN A;  1U5I B;  1PUL A;  2LUX A;  1LKJ A;  3TZ1 A;  3BOW A;  1RWY A;  2JOJ A;  1SR6 C;  1XFU O;  5KTY A;  1ZUZ A;  2AAO A;  2M3W A;  1N65 A;  2L4I A;  3FE6 A;  2NCO A;  3SS4 A;  1A03 A;  3EKH A;  1E8A A;  4YGB B;  2JQ6 A;  1SK6 D;  3DVE A;  1C07 A;  1NYA A; 
#chains in the Genus database with same CATH homology
 5ER4 X;  1XFZ O;  1OQP A;  5JJG A;  2FCD A;  1J55 A;  4PAL A;  3NSI A;  1B8C A;  1NCY A;  2JT3 A;  2K7C A;  2TN4 A;  1B4C A;  1W7I B;  1FBV A;  1NP8 A;  3JTD C;  2MLE C;  1LA3 A;  2WND A;  1XA5 A;  2DOQ A;  2H61 A;  2I2R E;  5HYD A;  1XVJ A;  2O5G A;  3BUM B;  1BR4 B;  2LC5 A;  4GBA A;  1KWO C;  1SL9 A;  5TNC A;  4D1E A;  1TOP A;  2L0P A;  1SMG A;  1BT6 A;  1SCM C;  3AAK A;  4JWQ A;  2BE6 A;  3PAL A;  2G9B A;  1CDL A;  1QLK A;  4I5J A;  4USL A;  2KAV A;  1K90 D;  4HRE E;  1B7T Z;  1MWN A;  2KI6 C;  1JBA A;  1Y1U A;  1V1G A;  1WY9 A;  4WRI A;  1XFX O;  2HF5 A;  1JC2 A;  1PVA A;  1JSA A;  3OX6 A;  1HQV A;  2M7L A;  2WC8 A;  1YUS A;  1M31 A;  3MSE B;  4DIR A;  4ETO A;  5AEQ A;  1L2O C;  2LMU A;  2LM5 A;  3KPX A;  3OP0 A;  4WQ3 A;  1KFU S;  1BF5 A;  1KK8 C;  2KNE A;  3DVK A;  4NQG A;  2WCB A;  1SCV A;  2JU0 A;  3I5F C;  1KSM A;  4YGA A;  1R6P A;  2JWW A;  1B47 A;  3QRX A;  2KFH A;  2ZND A;  1KFX L;  1SRA A;  1FW4 A;  2LVJ A;  3GK4 X;  4ZCU A;  2GGZ A;  1PSR A;  3O6B A;  1UHI A;  1F70 A;  1ALW A;  1BOD A;  3BOW B;  3CR2 A;  2PSR A;  1D1O A;  2ISD A;  2LAP A;  1IJ6 A;  2K61 A;  2L2E A;  4YGC B;  1DJY A;  1KK7 Z;  1G4Y R;  4GGN A;  1F71 A;  3TS5 B;  4CLN A;  3EKJ A;  1JFJ A;  1VRK A;  1QVI Z;  2NZ0 A;  2PRU A;  1A4P A;  5KSZ A;  3VRN A;  5GQQ C;  1TN4 A;  4TNC A;  2ZNE A;  4M2O A;  1MHO A;  1S36 A;  3PN7 C;  1J7P A;  4R1E A;  4M2Q A;  2JPT A;  4F0Z B;  3LL8 B;  2K0J A;  3NSK A;  4GGF C;  4FQO A;  1S5G Z;  2M7N A;  2EC6 B;  2BL0 B;  5CSF A;  1KSO A;  3JVT B;  4OKH A;  1OSA A;  1MR8 A;  2KQ6 A;  1F54 A;  5AXI A;  1HT9 A;  1CFP A;  1AVS A;  1N0Y A;  1K95 A;  3DD4 A;  3I5G B;  2CBL A;  3K21 A;  1H8B A;  1LA0 A;  2PVB A;  1WRK A;  3BQ3 A;  1PAL A;  2JNF A;  4MRX A;  2JC2 A;  3ICB A;  1K9K A;  5D7F A;  5HLO A;  2BBN A;  1Y6W A;  2KDH A;  2Y1M A;  2RGI A;  4DUQ A;  2Q91 A;  2MLF C;  2M8U A;  4PDZ A;  2F3Z A;  1NX3 A;  1OE9 B;  4MEW A;  4PHJ A;  1CLL A;  1CDP A;  2L5X B;  4IL1 A;  1GGW A;  2OS8 C;  1QV1 A;  1B8R A;  1DJX A;  4A4B A;  2K2A A;  1LXF C;  1XO5 A;  2LP3 A;  1RTP 1;  2CNP A;  2CXJ A;  2M1U A;  4YRU A;  5I8N A;  1XYD A;  3BUX B;  4U8D A;  4L9M A;  2LCP A;  4N1G A;  4P5O E;  1BMO A;  2E6W A;  3LLE A;  4PCW A;  1IQ3 A;  1DT7 B;  1CMF A;  4OVN F;  1WDC B;  5HKW A;  4CID A;  1AP4 A;  2K2F A;  3RLZ A;  2WCF A;  2L51 A;  2KFF A;  1JF2 A;  2JTT A;  1TNX A;  3PM8 A;  1J7R A;  1S1E A;  1UUR A;  1J7O A;  1ODB A;  2LHI A;  2KGB C;  4QJ5 B;  3KF9 A;  3I5I C;  1BOC A;  5JOL A;  2JT8 A;  3TUY C;  1Y0V H;  1MXE A;  2LVV A;  3PFV A;  2CT9 A;  4MN0 A;  2E30 A;  5AFP A;  5I2O A;  1SY9 A;  1CKK A;  2O60 A;  3FWB A;  1Q80 A;  1NX1 A;  1EG4 A;  3OB2 B;  3CGA A;  2A4J A;  1ZFS A;  1BG1 A;  3ZNI A;  2KSP A;  4ZCV A;  2VRG A;  3GK2 A;  2KGR A;  2JT0 A;  2ZRS A;  1IJ5 A;  5I2Q A;  1JWD A;  2KAX A;  2MA2 A;  1TCO B;  1DTL A;  1A2X A;  1MQ1 A;  1W7J B;  4OV2 A;  5HLV A;  1CM4 A;  1A75 A;  2CTN A;  1GGZ A;  4JPZ B;  2MAZ A;  4XJK A;  4I5L B;  1QJT A;  2I18 A;  5IBW A;  2HPS A;  1XK4 C;  3LK0 A;  1GQM A;  1OOJ A;  2COL B;  3DVM A;  3RM1 A;  1IH0 A;  3KEV A;  5I2L A;  1SCM B;  1OMR A;  4JQ0 D;  1CLM A;  1QIV A;  1B1G A;  3BUW B;  3TDZ A;  3VRO A;  1IRJ A;  2PAL A;  2WOS A;  3WHT B;  1M46 A;  2MHH A;  1SL7 A;  4I5N B;  1SPY A;  2JXC A;  1V1F A;  2FJU B;  1DJZ A;  5G08 A;  4AQI A;  1QAT A;  1QX5 B;  1XFW O;  2L50 A;  2BCB A;  3OX5 A;  2ZFD A;  4BY5 A;  3HCM A;  3VRQ A;  4YGD B;  1KFX S;  5HKY A;  2KQY A;  1KFU L;  3AAJ A;  2B1U A;  1ALV A;  3SG7 A;  1KK7 Y;  2OPO A;  1CTR A;  2LLU A;  1NPQ A;  3CTN A;  4UPG A;  1QVI Y;  4QJ4 B;  1CDM A;  1M45 A;  1YRT B;  2SAS A;  3TS5 C;  1REC A;  1YX7 A;  4DS7 A;  1YTZ C;  4FTG A;  2F2P A;  2KYC A;  1UHH A;  1FF1 A;  1FI6 A;  1TCF A;  2LLS A;  3BUN B;  1J7Q A;  2FOT A;  1QX2 A;  1S5G Y;  2MJW B;  4GNK B;  1NWD A;  2NLN A;  1ZOT B;  1QXP A;  3O4Y A;  4P2Y B;  5D69 A;  3M0W A;  2MBX A;  4DCK A;  5BPJ A;  2FCE A;  2WCE A;  2EC6 C;  2BL0 C;  2BKH B;  3JVT C;  1DJG A;  2V53 A;  5DKQ A;  3O2P A;  1QLS A;  1A75 B;  1XFY O;  3PN7 B;  3AKB A;  3OB1 B;  1K96 A;  3A8R A;  4HSZ A;  3WNX B;  2NCP A;  4XJK B;  5B8I B;  2MRD A;  2K7D A;  4MZK A;  4PE0 A;  1CB1 A;  2M49 B;  2AMI A;  3IQQ A;  3VRP A;  4PE7 A;  2GV5 A;  1SKT A;  1YR5 A;  3CLN A;  1NUB A;  3GK1 A;  1AK8 A;  2F33 A;  1SYM A;  5KU1 A;  1AUI B;  4MLW A;  2JNX A;  3PSR A;  2M1K B;  2K7O A;  1PRW A;  1S6J A;  2HET A;  2JTZ A;  1BR1 B;  1KQV A;  3D0Y A;  5CSN A;  1PK0 D;  3FWC A;  3EVU A;  4C0L A;  2LUC A;  2KI4 C;  1NCX A;  3CR5 X;  3VRR A;  2CCM A;  2JXL A;  2BBM A;  5F6T A;  2G2B A;  3IF7 A;  2K7B A;  1KQM B;  1UUS A;  1WDC C;  1UHJ A;  1XK4 A;  3I5H B;  1LIN A;  5DKN A;  1S3P A;  1G33 A;  1WLZ A;  1WRZ A;  2KFG A;  2OS8 B;  3CWG A;  4PE1 A;  1G8I A;  4MSP A;  2F3Y A;  3SIB A;  4AQJ A;  4PHM A;  2Y1N A;  4AOM A;  3WHU B;  2OTG B;  1TNQ A;  2M29 A;  5CPV A;  1IWQ A;  1S26 D;  1AJ5 A;  1S6I A;  3CR4 X;  3DF0 A;  3KHE A;  4ICB A;  2QAC A;  1F55 A;  3BYA A;  1OMD A;  1TNW A;  1DGU A;  2HQW A;  3SIA A;  1K93 D;  2JRF A;  2L4H A;  3PAT A;  4MVF A;  4BY4 A;  1CM1 A;  4MZJ A;  1Y1X A;  1YX8 A;  2KBM A;  3TDI A;  2LAN A;  1DVI A;  2KI6 D;  4YI8 A;  3EK4 A;  1RRO A;  1SR6 B;  1F4Q A;  4YBH B;  1TIZ A;  3I5I B;  5DKR A;  2KOT A;  1WLM A;  1AHR A;  4YI9 A;  3NSL A;  3F45 A;  3E3R A;  4PHK A;  3TUY B;  5CSI A;  1IKU A;  3EVV A;  1ZAC A;  4GUK A;  2LNK A;  1C7V A;  1F4O A;  3WXA A;  2EGD A;  1J1E A;  1B7T Y;  2BCA A;  1C7W A;  1QIW A;  2P6B B;  5AAN A;  1QAS A;  4PE4 A;  3JTD B;  3SG2 A;  1FPW A;  1DGV A;  1DMO A;  1SBJ A;  3BXK A;  4C0K A;  1DJH A;  4Q04 A;  2K8M B;  4GGF A;  1S6C A;  1MXL C;  3GOF A;  4CPV A;  1TNP A;  1CNP A;  1TTX A;  1KWO B;  1K8U A;  2IS9 A;  1UHN A;  4GPL B;  2GGM A;  2BEC A;  1SW8 A;  2H2K A;  4NDD A;  1X02 A;  2KBI A;  2Y5I A;  3SG4 A;  3D0Y B;  1NIW A;  1FI5 A;  4N5X A;  1YUR A;  3O78 A;  1QV0 A;  2LV7 A;  4CFR A;  1IGV A;  3NSO A;  1CFD A;  1K94 A;  2PMY A;  1M63 B;  4CFQ A;  1MUX A;  1EG3 A;  1GJY A;  4E68 A;  1RK9 A;  1QS7 A;  2LMV A;  3KO0 A;  3LCP C;  1Y1A A;  2KYF A;  1L2O B;  2I7A A;  2Q4U A;  2BE4 A;  1UP5 A;  1OZS A;  3SG5 A;  3TDU A;  1EH2 A;  1KK8 B;  1A29 A;  5ER5 A;  1EL4 A;  2ZKM X;  3I5F B;  3DF0 B;  3CS1 A;  2R2I A;  3ZWH A;  1QTX A;  3NXA A;  4OR9 B;  2LVI A;  2PAS A;  1UHK A;  1DF0 A;  2M9G A;  1KCY A;  2LHL A;  1BU3 A;  1AJ4 A;  3OHM B;  1JF0 A;  5K89 A;  4YGE B;  2KHN A;  1CLB A;  3SG6 A;  1UWO A;  1RFJ A;  2LMT A;  2JUL A;  1NX0 A;  2H61 C;  1QX7 A;  1K2H A;  4ORB B;  1U5I A;  2F2O A;  2F8P A;  2JZI A;  2ZRT A;  5FYX A;  3EK8 A;  5HKZ A;  5AER A;  1XFV O;  2HQ8 A;  3AKA A;  5J3X A;  1J1D A;  1N2D A;  1YUT A;  2ZN9 A;  2I94 A;  3I5G C;  3IQO A;  3BUO B;  2M97 A;  3DVJ A;  1PSB A;  1WRL A;  2KAY A;  3H4S E;  1YVH A;  2BCX A;  1H4B A;  2EHB A;  2WOR A;  3LK1 A;  4MZL A;  4I5K A;  3FIA A;  3A4U B;  2Y4Q A;  1DJI A;  4DRW A;  4NDB A;  1F8H A;  1IQ5 A;  1MF8 B;  1NX2 A;  4NDC A;  4N1F A;  1JUO A;  1DJW A;  3PLF B;  4WQ2 A;  3SG3 A;  4ORA B;  1M39 A;  1OZO A;  2L98 A;  4A4C A;  1EXR A;  1YVL A;  2D8N A;  1CMG A;  1BJF A;  4M2P A;  5PAL A;  2AUC A;  2QPT A;  1ZMZ A;  1K9U A;  1PVB A;  1EJ3 A;  1B9A A;  1TRF A;  3C1V A;  4QJ3 B;  1YUU A;  3VGO A;  2LE9 B;  1LVC D;  1CDN A;  3EVR A;  1YRU B;  4PHN A;  2SCP A;  3FS7 A;  4HRG A;  1KQM C;  2LLT A;  3I5H C;  4GAO A;  1L7Z A;  3D10 A;  1RJV A;  1SNL A;  4GFT A;  3HX4 A;  1CFF A;  1DF0 B;  1B8L A;  2M0R A;  1SL8 A;  2KI4 B;  2BKI B;  2OTG C;  1NCZ A;  3CZT X;  3EK7 A;  4HRH A;  4ORC B;  1R2U A;  3SJS A;  2LP2 A;  2NXQ A;  2ZN8 A;  1BLQ A;  1JFK A;  1IG5 A;  5CSJ A;  1OMV A;  2LVK A;  4OCI A;  1NSH A;  1K9P A;  4MBE A;  1CFC A;  4C0J A;  4MRY A;  4XYN A;  1U5I B;  1PUL A;  2LUX A;  1LKJ A;  3TZ1 A;  3BOW A;  1RWY A;  2JOJ A;  1SR6 C;  1XFU O;  5KTY A;  1ZUZ A;  2AAO A;  2M3W A;  1N65 A;  2L4I A;  2NCO A;  1A03 A;  3EKH A;  1E8A A;  4YGB B;  2JQ6 A;  1SK6 D;  3DVE A;  1C07 A;  1NYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...