1CDNA

Solution structure of (cd2+)1-calbindin d9k reveals details of the stepwise structural changes along the apo--> (ca2+)ii1--> (ca2+)i,ii2 binding pathway
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALBINDIN D9K
publication title Solution structure of (Cd2+)1-calbindin D9k reveals details of the stepwise structural changes along the Apo-->(Ca2+)II1-->(Ca2+)I,II2 binding pathway.
pubmed doi rcsb
source organism Bos taurus
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1995-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cdnA00
1BF5A 1NX1A 4BY5A 2L50A 3VGOA 2RGIA 5CSFA 4AQIA 3AAJA 3EVRA 3SIBA 1ZMZA 1XFYO 4ORCB 1UHJA 1C7VA 2BCAA 2NZ0A 2LHLA 5JOLA 1SCMB 1BT6A 3EK8A 2GGMA 2Y5IA 2NXQA 1V1GA 2KSPA 2KDHA 2CBLA 1CNPA 5AERA 4CFQA 2KYCA 1JFJA 2JZIA 1Q80A 2M8UA 2JOJA 4I5JA 5I2OA 1A75B 1B8CA 2WOSA 3OHMB 1YX7A 1QVIZ 2F3YA 5CPVA 1QIWA 1Y1XA 2JC2A 3A8RA 3DD4A 1B9AA 1QTXA 2LE9B 1A03A 1CFFA 1B7TY 3I5GB 1MHOA 2JTZA 3JTDB 2LCPA 2M29A 2LANA 3BUOB 5CSIA 1EH2A 1CFCA 1QX2A 1SMGA 1IQ3A 2OS8B 1GGZA 1TTXA 2CCMA 2WCBA 3RLZA 1JSAA 4Q04A 2COLB 5AANA 2F33A 1IJ6A 1SK6D 2HQWA 2K61A 1MR8A 3AKBA 3HCMA 5D69A 2I7AA 1NIWA 3PN7C 2VRGA 4F0ZB 4DS7A 1OQPA 4NDCA 1K96A 2LMVA 1XFZO 2ZNEA 4NDDA 1IKUA 1B47A 1CMGA 1DVIA 2KBMA 3D0YB 2CTNA 2ZNDA 2M1UA 4HSZA 1K9UA 3TDIA 5HYDA 4YGAA 1ALWA 1R6PA 4YBHB 5AXIA 2BECA 1A75A 5G08A 3FIAA 1WRLA 3TDZA 3OP0A 1NX2A 2L5XB 4PHMA 1OMDA 1QJTA 1QX7A 1B4CA 3EK7A 1WY9A 2I2RE 2PRUA 1NWDA 2BKHB 4ORAB 1H4BA 1BU3A 5DKQA 1YRUB 1OMVA 4WQ3A 3LK1A 2MBXA 3PATA 3SG2A 3JTDC 1J1EA 2KGBC 1UUSA 2BL0B 1DT7B 4GUKA 3TS5C 1RK9A 3BUNB 1UHNA 1WLMA 1L7ZA 2L4IA 3DVMA 3QRXA 1Y1AA 4L9MA 1S5GZ 4P2YB 2M3WA 3EKHA 3SG3A 1DTLA 4XJKA 5BPJA 3CTNA 3JVTC 3PSRA 5B8IB 1XYDA 1Y6WA 1C7WA 2ZN8A 1YRTB 3D0YA 2M7LA 2LC5A 4YGCB 2LUXA 4MRYA 2ZRSA 4C0JA 1PVBA 2K2FA 4CPVA 2JNXA 2HETA 3CR5X 4PHNA 2JT3A 1PSRA 2EGDA 3KPXA 1CMFA 1QXPA 4GGFA 4MSPA 1CTRA 1TN4A 4P5OE 5PALA 1JWDA 2ZN9A 4CIDA 1BJFA 1OZSA 1PVAA 2PSRA 2I18A 1YURA 1J55A 4USLA 4DRWA 2PASA 4MVFA 1JUOA 1AUIB 1IJ5A 1CDMA 2KAXA 1BR4B 2EHBA 3O2PA 1CFDA 1DJZA 3AKAA 1MUXA 2F2PA 1BR1B 2LLTA 1QATA 1OSAA 4R1EA 2ZRTA 4N1FA 2JXCA 1RFJA 4PALA 3DVEA 2I94A 1KK7Y 2BKIB 1FI5A 3PN7B 2E6WA 4TNCA 2K8MB 4M2OA 2MLFC 4YI8A 2LAPA 4JQ0D 1NP8A 4I5KA 2B1UA 1AJ5A 2H61C 1GGWA 3LK0A 4PE1A 2M9GA 2V53A 1NUBA 3IQQA 4OCIA 5DKNA 3BUXB 1TCOB 2Y4QA 1XFWO 1LA3A 1UP5A 2FJUB 2KHNA 5HKWA 4CFRA 1M46A 4WQ2A 3KF9A 3GK2A 1B1GA 3CS1A 3BOWB 3ZNIA 1EG4A 3NSKA 2MLEC 1SW8A 4PDZA 1M45A 4D1EA 3KHEA 4FQOA 2MJWB 1K95A 1RROA 3VRPA 4DUQA 4BY4A 2JULA 1SNLA 3OB1B 3PLFB 1UHKA 4QJ3B 2Y1MA 5ER5A 2LP3A 1V1FA 5DKRA 3TS5B 1JF2A 1S5GY 4MBEA 3WXAA 1YX8A 4GGNA 1YUSA 3TUYB 1GQMA 1SL8A 2K7CA 1D1OA 2KBIA 1SKTA 3SG7A 4JPZB 4OVNF 1S36A 2K2AA 3JVTB 4PCWA 1RJVA 2AAOA 3EK4A 3HX4A 1S1EA 2JTTA 4I5NB 3VROA 1Y0VH 1BG1A 1LKJA 4GPLB 1DGVA 2BBMA 1F71A 1SL7A 3A4UB 4MEWA 4PE4A 2FCDA 2JPTA 1CLBA 1CLMA 1SY9A 1JF0A 2BBNA 5AFPA 2KAYA 2JT0A 2JXLA 2KI6C 1EL4A 4I5LB 1IQ5A 3DF0B 1TOPA 1DJYA 1K9KA 1KWOB 1BODA 2MHHA 4AOMA 2CXJA 1J1DA 2F2OA 3I5FC 1LXFC 3FS7A 3F45A 2M7NA 2L4HA 4OV2A 1SBJA 2GGZA 1CDPA 3RM1A 5I2QA 1JC2A 1WDCB 1K8UA 3OB2B 4CLNA 1BMOA 1LINA 1NCYA 2WCFA 4A4BA 2M1KB 1U5IB 3PFVA 2KI4C 1KQMC 1NPQA 3TUYC 4QJ4B 1NX0A 1EJ3A 1KFUL 1UURA 2KQ6A 3WHUB 1L2OC 1M39A 1S3PA 3D10A 3LLEA 4HRHA 2JQ6A 3TZ1A 1TNWA 3VRNA 4E68A 1DF0B 2EC6C 4GBAA 2CT9A 1CDNA 2KGRA 1TNXA 2PMYA 2LP2A 1W7IB 4NQGA 1MXEA 2K0JA 2PALA 1YVLA 2BCBA 4JWQA 3SG6A 1QV1A 2ZFDA 3NSIA 5FYXA 3CWGA 1B7TZ 1XFUO 2R2IA 5D7FA 1AP4A 1TNQA 1DJGA 1TRFA 2QACA 1IG5A 2HPSA 1LVCD 4ZCVA 3BUMB 2GV5A 3KEVA 3OX5A 1B8RA 1S26D 4WRIA 5I8NA 1FF1A 1JBAA 3CR2A 1KWOC 1J7RA 1ODBA 1QVIY 1N2DA 1ZUZA 2JNFA 3EVVA 1F54A 1NCZA 2CNPA 3PALA 2K7OA 1WLZA 2M97A 2SCPA 2KI6D 4C0KA 3VRRA 1WDCC 5HKZA 2BCXA 1UHIA 1LA0A 3K21A 4YGEB 1DJWA 2HF5A 3TDUA 3BUWB 2WCEA 2DOQA 3MSEB 1XFVO 5GQQC 3E3RA 1RECA 2KOTA 1F8HA 1PULA 2JRFA 3M0WA 1KSMA 1TCFA 1DF0A 1YVHA 2LVIA 1UWOA 1WRZA 4UPGA 1KFXL 3CGAA 2LVJA 1G4YR 1QS7A 1IRJA 4HREE 1AJ4A 3BXKA 2AUCA 2MRDA 4OKHA 2NLNA 2F8PA 3LL8B 3CLNA 2WORA 3NSLA 2FOTA 4MRXA 5AEQA 2MA2A 4NDBA 3I5IC 5J3XA 2LMTA 1S6IA 1K9PA 3NXAA 4AQJA 2M49B 2K7BA 1XK4C 2L2EA 3AAKA 1FI6A 3EVUA 4MZJA 4N5XA 1PALA 4ORBB 2LHIA 5TNCA 2QPTA 3FWCA 3O78A 1YUUA 3I5FB 3IQOA 2OTGC 2O5GA 4FTGA 2JU0A 1CM4A 1F4QA 1HQVA 1A29A 4A4CA 2HQ8A 4DCKA 1ZACA 1DJIA 4DIRA 1XA5A 3DVKA 1KK8C 1A2XA 1NYAA 1FW4A 4MZKA 3ZWHA 2K7DA 2ISDA 3GOFA 5CSJA 1KFUS 1SPYA 1UHHA 1KQMB 2KI4B 2NCPA 3OX6A 4YRUA 1AHRA 3EKJA 1NSHA 4MLWA 1SRAA 1XFXO 3SIAA 2LLUA 1W7JB 2Q4UA 1L2OB 1ALVA 2ZKMX 2KAVA 4OR9B 4XYNA 1CM1A 2O60A 2EC6B 1AK8A 2OPOA 2Y1NA 2KFHA 2AMIA 2Q91A 2G2BA 3GK4X 1B8LA 1G33A 1YUTA 2A4JA 2F3ZA 4M2QA 3I5HC 2BE4A 3O4YA 2LUCA 1A4PA 1S6CA 2LM5A 1N65A 2PVBA 1DMOA 1CDLA 2H2KA 1WRKA 1SCVA 2LVVA 1OOJA 2G9BA 2LLSA 1J7PA 1CB1A 3BOWA 1DJXA 1QLSA 2JT8A 2IS9A 3BYAA 3ICBA 4U8DA 1QLKA 4ETOA 3C1VA 4XJKB 5KSZA 4PHKA 4MN0A 1BOCA 1KK7Z 1R2UA 1CFPA 5KU1A 3WNXB 5I2LA 1SCMC 1KCYA 4HRGA 2L51A 1TNPA 1IH0A 2KQYA 2KFFA 1DGUA 2JWWA 3LCPC 2FCEA 1E8AA 1MWNA 1J7QA 1YR5A 1HT9A 1OE9B 1OMRA 1XO5A 3GK1A 4PHJA 2M0RA 1S6JA 2SASA 1MQ1A 3PM8A 2D8NA 5HLVA 1KFXS 1YTZC 1PK0D 1VRKA 3SG4A 5K89A 4N1GA 1SR6B 3WHTB 1KSOA 2E30A 1F4OA 1C07A 1EG3A 3I5GC 2LVKA 2WNDA 1QX5B 3KO0A 3O6BA 1ZOTB 1K94A 2L0PA 1J7OA 4ZCUA 1OZOA 5F6TA 1NX3A 3NSOA 4GNKB 1XVJA 3CR4X 2OS8C 1K90D 1FPWA 3CZTX 3DF0A 1RTP1 3I5IB 5HLOA 4YI9A 1IWQA 1QV0A 4GAOA 2KYFA 2LNKA 2TN4A 2MAZA 4PE0A 3SJSA 1KQVA 1H8BA 1AVSA 5HKYA 1K93D 1Y1UA 1CKKA 1EXRA 1N0YA 2WC8A 1QIVA 2OTGB 3BQ3A 3DVJA 2P6BB 2KNEA 1SL9A 4MZLA 1FBVA 1U5IA 4GFTA 3SG5A 1F70A 1DJHA 4IL1A 1KK8B 1G8IA 1CLLA 2KFGA 1QASA 2LV7A 5ER4X 3H4SE 1PSBA 4GGFC 1NCXA 1SR6C 1K2HA 1M31A 3FWBA 1F55A 1SYMA 3IF7A 4YGDB 1JFKA 1RWYA 1MF8B 1M63B 4QJ5B 2BE6A 1IGVA 1X02A 4PE7A 5KTYA 2BL0C 1TIZA 2H61A 5IBWA 5JJGA 1BLQA 4M2PA 2NCOA 3I5HB 3VRQA 1ZFSA 5CSNA 4C0LA 1XK4A 1PRWA 2LMUA 1GJYA 4YGBB 4ICBA 1MXLC 2L98A
chains in the Genus database with same CATH superfamily
1BF5A 1NX1A 4BY5A 2L50A 3VGOA 2RGIA 5CSFA 4AQIA 2QEBA 3AAJA 3EVRA 3SIBA 1ZMZA 1XFYO 4ORCB 1UHJA 1C7VA 2BCAA 2NZ0A 2LHLA 3OBVA 5JOLA 1SCMB 1BT6A 3EK8A 2GGMA 2Y5IA 2QEOA 2NXQA 1V1GA 2KSPA 2KDHA 2CBLA 1CNPA 5AERA 4CFQA 2KYCA 1JFJA 2JZIA 1Q80A 4JKTA 2M8UA 2JOJA 4I5JA 5I2OA 1A75B 1B8CA 3NHIA 2WOSA 3OHMB 1YX7A 1QVIZ 3EG5B 2F3YA 5CPVA 1QIWA 1Y1XA 2JC2A 3A8RA 3DD4A 1B9AA 1QTXA 2LE9B 3S0FA 1CFFA 1B7TY 3I5GB 1MHOA 2JTZA 3JTDB 2LCPA 1OW4A 2M29A 2LANA 3BUOB 1SSEB 5CSIA 1CFCA 1EH2A 2WCKA 3S0AA 1QX2A 1SMGA 1IQ3A 2OS8B 3UNWA 1GGZA 1TTXA 2CCMA 2WCBA 3RLZA 1JSAA 4Q04A 2COLB 5AANA 2F33A 1IJ6A 1SK6D 2HQWA 2K61A 2BNXA 1MR8A 3D73A 3AKBA 3HCMA 5D69A 2I7AA 1NIWA 3PN7C 2VRGA 4F0ZB 4DS7A 1OQPA 4NDCA 1K96A 3R1VA 2LMVA 1XFZO 2ZNEA 4NDDA 3S0DA 1IKUA 1B47A 1CMGA 1DVIA 2KBMA 3D0YB 2CTNA 2ZNDA 2M1UA 4HSZA 1K9UA 3TDIA 5HYDA 4YGAA 1ALWA 1R6PA 4YBHB 4F7FA 5FI6A 5AXIA 2BECA 1A75A 3OGNA 5G08A 3FIAA 1OOFA 1WRLA 3TDZA 3OP0A 1NX2A 2L5XB 4PHMA 1OMDA 1QJTA 1QX7A 1GM0A 1B4CA 3EK7A 1WY9A 2I2RE 2PRUA 1NWDA 2BKHB 4ORAB 3S0EA 3SS4A 1H4BA 1BU3A 5DKQA 1YRUB 1OMVA 4WQ3A 3LK1A 1A03A 2MBXA 3PATA 3SG2A 3VRNA 3JTDC 1J1EA 2KGBC 1UUSA 2BL0B 5FI2A 1DT7B 4GUKA 3TS5C 1RK9A 3BUNB 1UHNA 1WLMA 1L7ZA 2L4IA 3DVMA 1IIOA 3QRXA 1Y1AA 4L9MA 1S5GZ 4P2YB 2M3WA 3EKHA 3SG3A 1DC1A 1DTLA 4PT1A 1DQEA 4XJKA 2P70A 3DYEA 5BPJA 3CTNA 3DZTA 3JVTC 3PSRA 2ERBA 5B8IB 1XYDA 1Y6WA 1C7WA 2ZN8A 3CABA 1YRTB 3D0YA 2M7LA 2LC5A 4YGCB 2JPOA 2LUXA 3FE6A 4MRYA 2ZRSA 4C0JA 1PVBA 3R1PA 2K2FA 3SS3A 4FQTA 4CPVA 2JNXA 2HETA 3CR5X 4PHNA 2JT3A 1PSRA 2EGDA 3KPXA 1CMFA 1QXPA 3UO9A 1LS8A 3Q8IA 4GGFA 4MSPA 1CTRA 1TN4A 4P5OE 5PALA 1JWDA 2WCHA 2ZN9A 4CIDA 1BJFA 1OZSA 1PVAA 2PSRA 4OZDA 2I18A 1YURA 1J55A 4USLA 4DRWA 2PASA 4MVFA 1JUOA 1AUIB 1IJ5A 1CDMA 2KAXA 1BR4B 2EHBA 3SG6A 3O2PA 1CFDA 1DJZA 2PQLA 1MUXA 2F2PA 3AKAA 1BR1B 2LLTA 1ORGA 1QATA 1OSAA 4R1EA 2ZRTA 1OOIX 4N1FA 2JXCA 1RFJA 4PALA 3DVEA 2GTEA 1KK7Y 2BKIB 2I94A 3PN7B 1FI5A 2E6WA 4TNCA 2K8MB 3IVTA 3BFBA 4M2OA 2MLFC 4YI8A 2LAPA 4JQ0D 3L4AA 1NP8A 2KLDA 2B1UA 1T14A 4I5KA 2P71A 1AJ5A 2H61C 1GGWA 3LK0A 3S0GA 4PE1A 2M9GA 2V53A 3BFHA 1NUBA 3IQQA 4OCIA 5DKNA 3BUXB 1TCOB 2Y4QA 1XFWO 1LA3A 1UP5A 2FJUB 2KHNA 2L5YA 5HKWA 4CFRA 1M46A 4WQ2A 3KF9A 3GK2A 3S0BA 1B1GA 3CS1A 3BOWB 3ZNIA 3O4XA 1W9ZA 1EG4A 3NSKA 2MLEC 1SW8A 4PDZA 1M45A 4D1EA 3KHEA 4FQOA 2MJWB 1K95A 1RROA 3VRPA 4DUQA 2FJYA 4BY4A 1TUZA 2JULA 5HL1A 2WC5A 1SNLA 3OB1B 3PLFB 1UHKA 4QJ3B 2Y1MA 5ER5A 2LP3A 1V1FA 5DKRA 3TS5B 1JF2A 1S5GY 4MBEA 3WXAA 1YX8A 4GGNA 1YUSA 3TUYB 1GQMA 1SL8A 2WCMA 1DEKA 2K7CA 1D1OA 2KBIA 1SKTA 3SG7A 4JPZB 4OVNF 1S36A 2K2AA 1DELA 3JVTB 4PCWA 1RJVA 2AAOA 3EK4A 3HX4A 1S1EA 2JTTA 4I5NB 3VROA 1Y0VH 1QWVA 1BG1A 1LKJA 4GPLB 2QEHA 1DGVA 2BBMA 3B87A 1SL7A 1F71A 1OOGA 3A4UB 4MEWA 4PE4A 2FCDA 2JPTA 3N7HA 1CLBA 1CLMA 1SY9A 1JF0A 2BBNA 5AFPA 2KAYA 3D78A 2JT0A 2JXLA 2KI6C 1EL4A 4I5LB 1IQ5A 3DF0B 1TOPA 1DJYA 1K9KA 1KWOB 1BODA 2MHHA 3B7AA 4AOMA 2CXJA 1J1DA 2F2OA 3I5FC 1LXFC 3FS7A 3PJIA 3F45A 3CZ1A 2M7NA 2L4HA 4JD9A 4OV2A 1SBJA 2GGZA 1CDPA 3RM1A 5I2QA 4INWA 1JC2A 1WDCB 1K8UA 3OB2B 4CLNA 1BMOA 1LINA 1NCYA 2WCFA 4A4BA 3CZ0A 2M1KB 1U5IB 3PFVA 2KI4C 1KQMC 1NPQA 3TUYC 4KYNA 4QJ4B 1NX0A 1EJ3A 1P28A 1KFUL 1UURA 2KQ6A 3WHUB 1L2OC 1M39A 1S3PA 3D10A 3L4LA 3LLEA 2JQ6A 4HRHA 1TNWA 3TZ1A 2PYQA 3CZ2A 1DF0B 2EC6C 3NGVA 4GBAA 2CT9A 1CDNA 2KGRA 1TNXA 2KPHA 2PMYA 2LP2A 1W7IB 4NQGA 1MXEA 2K0JA 2PALA 1YVLA 2BCBA 2YGUA 3BFAA 1QV1A 2ZFDA 3NSIA 4JWQA 3CWGA 1B7TZ 1XFUO 2R2IA 5D7FA 5FYXA 1TNQA 1DJGA 1TRFA 2QACA 1AP4A 1IG5A 2HPSA 1LVCD 4ZCVA 3BUMB 1Z4HA 2GV5A 3KEVA 3OX5A 5DICA 1B8RA 1S26D 4WRIA 5I8NA 3PM2A 3QMEA 5I94A 1FF1A 1JBAA 3CR2A 3K1EA 1KWOC 1J7RA 1ODBA 1QVIY 1N2DA 1ZUZA 2JNFA 3EVVA 1F54A 1NCZA 2CNPA 3PALA 2K7OA 1WLZA 2M97A 2SCPA 2KI6D 5FI7A 3V2LA 4C0KA 3VRRA 1WDCC 5HKZA 2BCXA 1UHIA 1LA0A 3K21A 4YGEB 1DJWA 2HF5A 3TDUA 3BUWB 2WCEA 2DOQA 3MSEB 1XFVO 4E68A 2BAPA 5GQQC 3E3RA 1RECA 2KOTA 1F8HA 2L2CA 1PULA 2JRFA 3M0WA 1KSMA 1TCFA 1DF0A 1YVHA 2LVIA 1UWOA 3VB1A 1WRZA 4UPGA 1KFXL 3CGAA 2LVJA 1G4YR 1QS7A 1IRJA 4HREE 1AJ4A 3BXKA 2AUCA 2MRDA 4OKHA 2NLNA 2F8PA 3LL8B 3CLNA 2WORA 3NSLA 2FOTA 4MRXA 2KLEA 5AEQA 2MA2A 4NDBA 3I5IC 3R72A 2LMTA 1S6IA 5J3XA 1K9PA 2QDIA 3D75A 3NXAA 3B86A 2M49B 2K7BA 4AQJA 1XK4C 2L2EA 3AAKA 1FI6A 3EVUA 5D3OA 4MZJA 4N5XA 1PALA 4ORBB 2LHIA 1TUJA 5TNCA 2QPTA 3FWCA 3O78A 1YUUA 3I5FB 3IQOA 2OTGC 2O5GA 4FTGA 2JU0A 1CM4A 1F4QA 1HQVA 1A29A 4A4CA 2HQ8A 4DCKA 1ZACA 1DJIA 4DIRA 1XA5A 3DVKA 1KK8C 1A2XA 1NYAA 1FW4A 4MZKA 3ZWHA 2K7DA 2ISDA 3GOFA 5CSJA 1KFUS 1SPYA 1UHHA 1KQMB 2KI4B 2NCPA 2WC6A 3OX6A 1AHRA 3EKJA 3SS5A 4YRUA 1NSHA 4MLWA 1SRAA 1XFXO 3SIAA 2LLUA 1W7JB 3NHTA 2Q4UA 1L2OB 1ALVA 2ZKMX 2KAVA 4OR9B 4XYNA 1CM1A 2O60A 3BJHA 2EC6B 1Z2CB 1AK8A 2OPOA 2Y1NA 2KFHA 2AMIA 2Q91A 2G2BA 3GK4X 1B8LA 1G33A 1YUTA 2A4JA 2F3ZA 4M2QA 3I5HC 2BE4A 3O4YA 2LUCA 1A4PA 1S6CA 2LM5A 1N65A 2PVBA 1DMOA 1CDLA 2H2KA 1WRKA 1SCVA 2LVVA 1OOJA 2G9BA 2LLSA 1J7PA 1CB1A 3BOWA 1DJXA 1QLSA 2JT8A 2IS9A 3BYAA 3ICBA 4U8DA 1QLKA 4ETOA 3C1VA 4XJKB 5KSZA 1C3ZA 4PHKA 4MN0A 1BOCA 1KK7Z 1R2UA 1CFPA 5KU1A 3WNXB 5I2LA 1SCMC 1KCYA 4HRGA 2L51A 1TNPA 1IH0A 2KQYA 2QEVA 2KFFA 1DGUA 2JWWA 3L47A 2FCEA 1E8AA 3LCPC 1MWNA 1J7QA 1YR5A 1HT9A 1OE9B 1OMRA 1XO5A 3RZSA 3GK1A 4PHJA 2M0RA 3D76A 1S6JA 2SASA 1MQ1A 3PM8A 2D8NA 5HLVA 1KFXS 1YTZC 1PK0D 1VRKA 3SG4A 5K89A 3FE8A 4N1GA 1SR6B 3WHTB 1KSOA 2E30A 1F4OA 1C07A 1TWOA 1EG3A 3I5GC 2LVKA 2WNDA 1QX5B 3KO0A 3O6BA 1ZOTB 3CDNA 3D74A 1K94A 2L0PA 1J7OA 4ZCUA 1OZOA 5F6TA 1NX3A 3NSOA 4GNKB 1XVJA 3CR4X 2OS8C 1K90D 3D77A 3CZTX 3DF0A 1FPWA 1RTP1 3I5IB 4INXA 5HLOA 4YI9A 1IWQA 1QV0A 1C3YA 4GAOA 2KYFA 2LNKA 2TN4A 2MAZA 4PE0A 3SJSA 1KQVA 1H8BA 1AVSA 5HKYA 1K93D 1Y1UA 1CKKA 1EXRA 3FE9A 1N0YA 2WC8A 1QIVA 2OTGB 3BQ3A 3DVJA 2P6BB 2KNEA 3B88A 3DY9A 1SL9A 4IJ7A 4MZLA 1FBVA 1U5IA 4GFTA 3SG5A 1F70A 1DJHA 4IL1A 1KK8B 2H8VA 1G8IA 3CYZA 1CLLA 2KFGA 1OOHA 3B6XA 1QASA 2LV7A 5ER4X 3H4SE 1PSBA 4GGFC 1NCXA 1SR6C 1K2HA 1M31A 3FWBA 5EL2A 1F55A 1SYMA 3IF7A 4YGDB 1JFKA 1RWYA 1MF8B 1M63B 3R1OA 2BE6A 1IGVA 1X02A 4PE7A 4QJ5B 5KTYA 2BL0C 1TIZA 2H61A 5IBWA 5JJGA 2WCLA 1BLQA 4M2PA 2WCJA 1XFRA 2NCOA 3I5HB 3VRQA 1ZFSA 5CSNA 4C0LA 1XK4A 1PRWA 3DXLA 2LMUA 1GJYA 2K60A 4YGBB 4ICBA 1MXLC 2L98A
chains in the Genus database with same CATH topology
1BF5A 1NX1A 4BY5A 2L50A 3VGOA 2RGIA 5CSFA 4AQIA 3AAJA 3EVRA 3SIBA 1ZMZA 1XFYO 4ORCB 1UHJA 1C7VA 2BCAA 2NZ0A 2LHLA 5JOLA 1SCMB 1BT6A 3EK8A 2GGMA 2Y5IA 2NXQA 1V1GA 2KSPA 2KDHA 2CBLA 1CNPA 5AERA 4CFQA 2KYCA 1JFJA 2JZIA 1Q80A 2M8UA 2JOJA 4I5JA 5I2OA 1A75B 1B8CA 2WOSA 3OHMB 1YX7A 1QVIZ 2F3YA 5CPVA 1QIWA 1Y1XA 2JC2A 3A8RA 3DD4A 1B9AA 1QTXA 2LE9B 1A03A 1CFFA 1B7TY 3I5GB 1MHOA 2JTZA 3JTDB 2LCPA 2M29A 2LANA 3BUOB 5CSIA 1EH2A 1CFCA 1QX2A 1SMGA 1IQ3A 2OS8B 1GGZA 1TTXA 2CCMA 2WCBA 3RLZA 1JSAA 4Q04A 2COLB 5AANA 2F33A 1IJ6A 1SK6D 2HQWA 2K61A 1MR8A 3AKBA 3HCMA 5D69A 2I7AA 1NIWA 3PN7C 2VRGA 4F0ZB 4DS7A 1OQPA 4NDCA 1K96A 2LMVA 1XFZO 2ZNEA 4NDDA 1IKUA 1B47A 1CMGA 1DVIA 2KBMA 3D0YB 2CTNA 2ZNDA 2M1UA 4HSZA 1K9UA 3TDIA 5HYDA 4YGAA 1ALWA 1R6PA 4YBHB 5AXIA 2BECA 1A75A 5G08A 3FIAA 1WRLA 3TDZA 3OP0A 1NX2A 2L5XB 4PHMA 1OMDA 1QJTA 1QX7A 1B4CA 3EK7A 1WY9A 2I2RE 2PRUA 1NWDA 2BKHB 4ORAB 1H4BA 1BU3A 5DKQA 1YRUB 1OMVA 4WQ3A 3LK1A 2MBXA 3PATA 3SG2A 3JTDC 1J1EA 2KGBC 1UUSA 2BL0B 1DT7B 4GUKA 3TS5C 1RK9A 3BUNB 1UHNA 1WLMA 1L7ZA 2L4IA 3DVMA 3QRXA 1Y1AA 4L9MA 1S5GZ 4P2YB 2M3WA 3EKHA 3SG3A 1DTLA 4XJKA 5BPJA 3CTNA 3JVTC 3PSRA 5B8IB 1XYDA 1Y6WA 1C7WA 2ZN8A 1YRTB 3D0YA 2M7LA 2LC5A 4YGCB 2LUXA 4MRYA 2ZRSA 4C0JA 1PVBA 2K2FA 4CPVA 2JNXA 2HETA 3CR5X 4PHNA 2JT3A 1PSRA 2EGDA 3KPXA 1CMFA 1QXPA 4GGFA 4MSPA 1CTRA 1TN4A 4P5OE 5PALA 1JWDA 2ZN9A 4CIDA 1BJFA 1OZSA 1PVAA 2PSRA 2I18A 1YURA 1J55A 4USLA 4DRWA 2PASA 4MVFA 1JUOA 1AUIB 1IJ5A 1CDMA 2KAXA 1BR4B 2EHBA 3O2PA 1CFDA 1DJZA 3AKAA 1MUXA 2F2PA 1BR1B 2LLTA 1QATA 1OSAA 4R1EA 2ZRTA 4N1FA 2JXCA 1RFJA 4PALA 3DVEA 2I94A 1KK7Y 2BKIB 1FI5A 3PN7B 2E6WA 4TNCA 2K8MB 4M2OA 2MLFC 4YI8A 2LAPA 4JQ0D 1NP8A 4I5KA 2B1UA 1AJ5A 2H61C 1GGWA 3LK0A 4PE1A 2M9GA 2V53A 1NUBA 3IQQA 4OCIA 5DKNA 3BUXB 1TCOB 2Y4QA 1XFWO 1LA3A 1UP5A 2FJUB 2KHNA 5HKWA 4CFRA 1M46A 4WQ2A 3KF9A 3GK2A 1B1GA 3CS1A 3BOWB 3ZNIA 1EG4A 3NSKA 2MLEC 1SW8A 4PDZA 1M45A 4D1EA 3KHEA 4FQOA 2MJWB 1K95A 1RROA 3VRPA 4DUQA 4BY4A 2JULA 1SNLA 3OB1B 3PLFB 1UHKA 4QJ3B 2Y1MA 5ER5A 2LP3A 1V1FA 5DKRA 3TS5B 1JF2A 1S5GY 4MBEA 3WXAA 1YX8A 4GGNA 1YUSA 3TUYB 1GQMA 1SL8A 2K7CA 1D1OA 2KBIA 1SKTA 3SG7A 4JPZB 4OVNF 1S36A 2K2AA 3JVTB 4PCWA 1RJVA 2AAOA 3EK4A 3HX4A 1S1EA 2JTTA 4I5NB 3VROA 1Y0VH 1BG1A 1LKJA 4GPLB 1DGVA 2BBMA 1F71A 1SL7A 3A4UB 4MEWA 4PE4A 2FCDA 2JPTA 1CLBA 1CLMA 1SY9A 1JF0A 2BBNA 5AFPA 2KAYA 2JT0A 2JXLA 2KI6C 1EL4A 4I5LB 1IQ5A 3DF0B 1TOPA 1DJYA 1K9KA 1KWOB 1BODA 2MHHA 4AOMA 2CXJA 1J1DA 2F2OA 3I5FC 1LXFC 3FS7A 3F45A 2M7NA 2L4HA 4OV2A 1SBJA 2GGZA 1CDPA 3RM1A 5I2QA 1JC2A 1WDCB 1K8UA 3OB2B 4CLNA 1BMOA 1LINA 1NCYA 2WCFA 4A4BA 2M1KB 1U5IB 3PFVA 2KI4C 1KQMC 1NPQA 3TUYC 4QJ4B 1NX0A 1EJ3A 1KFUL 1UURA 2KQ6A 3WHUB 1L2OC 1M39A 1S3PA 3D10A 3LLEA 4HRHA 2JQ6A 3TZ1A 1TNWA 3VRNA 4E68A 1DF0B 2EC6C 4GBAA 2CT9A 1CDNA 2KGRA 1TNXA 2PMYA 2LP2A 1W7IB 4NQGA 1MXEA 2K0JA 2PALA 1YVLA 2BCBA 4JWQA 3SG6A 1QV1A 2ZFDA 3NSIA 5FYXA 3CWGA 1B7TZ 1XFUO 2R2IA 5D7FA 1AP4A 1TNQA 1DJGA 1TRFA 2QACA 1IG5A 2HPSA 1LVCD 4ZCVA 3BUMB 2GV5A 3KEVA 3OX5A 1B8RA 1S26D 4WRIA 5I8NA 1FF1A 1JBAA 3CR2A 1KWOC 1J7RA 1ODBA 1QVIY 1N2DA 1ZUZA 2JNFA 3EVVA 1F54A 1NCZA 2CNPA 3PALA 2K7OA 1WLZA 2M97A 2SCPA 2KI6D 4C0KA 3VRRA 1WDCC 5HKZA 2BCXA 1UHIA 1LA0A 3K21A 4YGEB 1DJWA 2HF5A 3TDUA 3BUWB 2WCEA 2DOQA 3MSEB 1XFVO 5GQQC 3E3RA 1RECA 2KOTA 1F8HA 1PULA 2JRFA 3M0WA 1KSMA 1TCFA 1DF0A 1YVHA 2LVIA 1UWOA 1WRZA 4UPGA 1KFXL 3CGAA 2LVJA 1G4YR 1QS7A 1IRJA 4HREE 1AJ4A 3BXKA 2AUCA 2MRDA 4OKHA 2NLNA 2F8PA 3LL8B 3CLNA 2WORA 3NSLA 2FOTA 4MRXA 5AEQA 2MA2A 4NDBA 3I5IC 5J3XA 2LMTA 1S6IA 1K9PA 3NXAA 4AQJA 2M49B 2K7BA 1XK4C 2L2EA 3AAKA 1FI6A 3EVUA 4MZJA 4N5XA 1PALA 4ORBB 2LHIA 5TNCA 2QPTA 3FWCA 3O78A 1YUUA 3I5FB 3IQOA 2OTGC 2O5GA 4FTGA 2JU0A 1CM4A 1F4QA 1HQVA 1A29A 4A4CA 2HQ8A 4DCKA 1ZACA 1DJIA 4DIRA 1XA5A 3DVKA 1KK8C 1A2XA 1NYAA 1FW4A 4MZKA 3ZWHA 2K7DA 2ISDA 3GOFA 5CSJA 1KFUS 1SPYA 1UHHA 1KQMB 2KI4B 2NCPA 3OX6A 4YRUA 1AHRA 3EKJA 1NSHA 4MLWA 1SRAA 1XFXO 3SIAA 2LLUA 1W7JB 2Q4UA 1L2OB 1ALVA 2ZKMX 2KAVA 4OR9B 4XYNA 1CM1A 2O60A 2EC6B 1AK8A 2OPOA 2Y1NA 2KFHA 2AMIA 2Q91A 2G2BA 3GK4X 1B8LA 1G33A 1YUTA 2A4JA 2F3ZA 4M2QA 3I5HC 2BE4A 3O4YA 2LUCA 1A4PA 1S6CA 2LM5A 1N65A 2PVBA 1DMOA 1CDLA 2H2KA 1WRKA 1SCVA 2LVVA 1OOJA 2G9BA 2LLSA 1J7PA 1CB1A 3BOWA 1DJXA 1QLSA 2JT8A 2IS9A 3BYAA 3ICBA 4U8DA 1QLKA 4ETOA 3C1VA 4XJKB 5KSZA 4PHKA 4MN0A 1BOCA 1KK7Z 1R2UA 1CFPA 5KU1A 3WNXB 5I2LA 1SCMC 1KCYA 4HRGA 2L51A 1TNPA 1IH0A 2KQYA 2KFFA 1DGUA 2JWWA 3LCPC 2FCEA 1E8AA 1MWNA 1J7QA 1YR5A 1HT9A 1OE9B 1OMRA 1XO5A 3GK1A 4PHJA 2M0RA 1S6JA 2SASA 1MQ1A 3PM8A 2D8NA 5HLVA 1KFXS 1YTZC 1PK0D 1VRKA 3SG4A 5K89A 4N1GA 1SR6B 3WHTB 1KSOA 2E30A 1F4OA 1C07A 1EG3A 3I5GC 2LVKA 2WNDA 1QX5B 3KO0A 3O6BA 1ZOTB 1K94A 2L0PA 1J7OA 4ZCUA 1OZOA 5F6TA 1NX3A 3NSOA 4GNKB 1XVJA 3CR4X 2OS8C 1K90D 1FPWA 3CZTX 3DF0A 1RTP1 3I5IB 5HLOA 4YI9A 1IWQA 1QV0A 4GAOA 2KYFA 2LNKA 2TN4A 2MAZA 4PE0A 3SJSA 1KQVA 1H8BA 1AVSA 5HKYA 1K93D 1Y1UA 1CKKA 1EXRA 1N0YA 2WC8A 1QIVA 2OTGB 3BQ3A 3DVJA 2P6BB 2KNEA 1SL9A 4MZLA 1FBVA 1U5IA 4GFTA 3SG5A 1F70A 1DJHA 4IL1A 1KK8B 1G8IA 1CLLA 2KFGA 1QASA 2LV7A 5ER4X 3H4SE 1PSBA 4GGFC 1NCXA 1SR6C 1K2HA 1M31A 3FWBA 1F55A 1SYMA 3IF7A 4YGDB 1JFKA 1RWYA 1MF8B 1M63B 4QJ5B 2BE6A 1IGVA 1X02A 4PE7A 5KTYA 2BL0C 1TIZA 2H61A 5IBWA 5JJGA 1BLQA 4M2PA 2NCOA 3I5HB 3VRQA 1ZFSA 5CSNA 4C0LA 1XK4A 1PRWA 2LMUA 1GJYA 4YGBB 4ICBA 1MXLC 2L98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BF5 A;  1NX1 A;  4BY5 A;  2L50 A;  3VGO A;  2RGI A;  5CSF A;  4AQI A;  3AAJ A;  3EVR A;  3SIB A;  1ZMZ A;  1XFY O;  4ORC B;  1UHJ A;  1C7V A;  2BCA A;  2NZ0 A;  2LHL A;  5JOL A;  1SCM B;  1BT6 A;  3EK8 A;  2GGM A;  2Y5I A;  2NXQ A;  1V1G A;  2KSP A;  2KDH A;  2CBL A;  1CNP A;  5AER A;  4CFQ A;  2KYC A;  1JFJ A;  2JZI A;  1Q80 A;  2M8U A;  2JOJ A;  4I5J A;  5I2O A;  1A75 B;  1B8C A;  2WOS A;  3OHM B;  1YX7 A;  1QVI Z;  2F3Y A;  5CPV A;  1QIW A;  1Y1X A;  2JC2 A;  3A8R A;  3DD4 A;  1B9A A;  1QTX A;  2LE9 B;  1A03 A;  1CFF A;  1B7T Y;  3I5G B;  1MHO A;  2JTZ A;  3JTD B;  2LCP A;  2M29 A;  2LAN A;  3BUO B;  5CSI A;  1EH2 A;  1CFC A;  1QX2 A;  1SMG A;  1IQ3 A;  2OS8 B;  1GGZ A;  1TTX A;  2CCM A;  2WCB A;  3RLZ A;  1JSA A;  4Q04 A;  2COL B;  5AAN A;  2F33 A;  1IJ6 A;  1SK6 D;  2HQW A;  2K61 A;  1MR8 A;  3AKB A;  3HCM A;  5D69 A;  2I7A A;  1NIW A;  3PN7 C;  2VRG A;  4F0Z B;  4DS7 A;  1OQP A;  4NDC A;  1K96 A;  2LMV A;  1XFZ O;  2ZNE A;  4NDD A;  1IKU A;  1B47 A;  1CMG A;  1DVI A;  2KBM A;  3D0Y B;  2CTN A;  2ZND A;  2M1U A;  4HSZ A;  1K9U A;  3TDI A;  5HYD A;  4YGA A;  1ALW A;  1R6P A;  4YBH B;  5AXI A;  2BEC A;  1A75 A;  5G08 A;  3FIA A;  1WRL A;  3TDZ A;  3OP0 A;  1NX2 A;  2L5X B;  4PHM A;  1OMD A;  1QJT A;  1QX7 A;  1B4C A;  3EK7 A;  1WY9 A;  2I2R E;  2PRU A;  1NWD A;  2BKH B;  4ORA B;  1H4B A;  1BU3 A;  5DKQ A;  1YRU B;  1OMV A;  4WQ3 A;  3LK1 A;  2MBX A;  3PAT A;  3SG2 A;  3JTD C;  1J1E A;  2KGB C;  1UUS A;  2BL0 B;  1DT7 B;  4GUK A;  3TS5 C;  1RK9 A;  3BUN B;  1UHN A;  1WLM A;  1L7Z A;  2L4I A;  3DVM A;  3QRX A;  1Y1A A;  4L9M A;  1S5G Z;  4P2Y B;  2M3W A;  3EKH A;  3SG3 A;  1DTL A;  4XJK A;  5BPJ A;  3CTN A;  3JVT C;  3PSR A;  5B8I B;  1XYD A;  1Y6W A;  1C7W A;  2ZN8 A;  1YRT B;  3D0Y A;  2M7L A;  2LC5 A;  4YGC B;  2LUX A;  4MRY A;  2ZRS A;  4C0J A;  1PVB A;  2K2F A;  4CPV A;  2JNX A;  2HET A;  3CR5 X;  4PHN A;  2JT3 A;  1PSR A;  2EGD A;  3KPX A;  1CMF A;  1QXP A;  4GGF A;  4MSP A;  1CTR A;  1TN4 A;  4P5O E;  5PAL A;  1JWD A;  2ZN9 A;  4CID A;  1BJF A;  1OZS A;  1PVA A;  2PSR A;  2I18 A;  1YUR A;  1J55 A;  4USL A;  4DRW A;  2PAS A;  4MVF A;  1JUO A;  1AUI B;  1IJ5 A;  1CDM A;  2KAX A;  1BR4 B;  2EHB A;  3O2P A;  1CFD A;  1DJZ A;  3AKA A;  1MUX A;  2F2P A;  1BR1 B;  2LLT A;  1QAT A;  1OSA A;  4R1E A;  2ZRT A;  4N1F A;  2JXC A;  1RFJ A;  4PAL A;  3DVE A;  2I94 A;  1KK7 Y;  2BKI B;  1FI5 A;  3PN7 B;  2E6W A;  4TNC A;  2K8M B;  4M2O A;  2MLF C;  4YI8 A;  2LAP A;  4JQ0 D;  1NP8 A;  4I5K A;  2B1U A;  1AJ5 A;  2H61 C;  1GGW A;  3LK0 A;  4PE1 A;  2M9G A;  2V53 A;  1NUB A;  3IQQ A;  4OCI A;  5DKN A;  3BUX B;  1TCO B;  2Y4Q A;  1XFW O;  1LA3 A;  1UP5 A;  2FJU B;  2KHN A;  5HKW A;  4CFR A;  1M46 A;  4WQ2 A;  3KF9 A;  3GK2 A;  1B1G A;  3CS1 A;  3BOW B;  3ZNI A;  1EG4 A;  3NSK A;  2MLE C;  1SW8 A;  4PDZ A;  1M45 A;  4D1E A;  3KHE A;  4FQO A;  2MJW B;  1K95 A;  1RRO A;  3VRP A;  4DUQ A;  4BY4 A;  2JUL A;  1SNL A;  3OB1 B;  3PLF B;  1UHK A;  4QJ3 B;  2Y1M A;  5ER5 A;  2LP3 A;  1V1F A;  5DKR A;  3TS5 B;  1JF2 A;  1S5G Y;  4MBE A;  3WXA A;  1YX8 A;  4GGN A;  1YUS A;  3TUY B;  1GQM A;  1SL8 A;  2K7C A;  1D1O A;  2KBI A;  1SKT A;  3SG7 A;  4JPZ B;  4OVN F;  1S36 A;  2K2A A;  3JVT B;  4PCW A;  1RJV A;  2AAO A;  3EK4 A;  3HX4 A;  1S1E A;  2JTT A;  4I5N B;  3VRO A;  1Y0V H;  1BG1 A;  1LKJ A;  4GPL B;  1DGV A;  2BBM A;  1F71 A;  1SL7 A;  3A4U B;  4MEW A;  4PE4 A;  2FCD A;  2JPT A;  1CLB A;  1CLM A;  1SY9 A;  1JF0 A;  2BBN A;  5AFP A;  2KAY A;  2JT0 A;  2JXL A;  2KI6 C;  1EL4 A;  4I5L B;  1IQ5 A;  3DF0 B;  1TOP A;  1DJY A;  1K9K A;  1KWO B;  1BOD A;  2MHH A;  4AOM A;  2CXJ A;  1J1D A;  2F2O A;  3I5F C;  1LXF C;  3FS7 A;  3F45 A;  2M7N A;  2L4H A;  4OV2 A;  1SBJ A;  2GGZ A;  1CDP A;  3RM1 A;  5I2Q A;  1JC2 A;  1WDC B;  1K8U A;  3OB2 B;  4CLN A;  1BMO A;  1LIN A;  1NCY A;  2WCF A;  4A4B A;  2M1K B;  1U5I B;  3PFV A;  2KI4 C;  1KQM C;  1NPQ A;  3TUY C;  4QJ4 B;  1NX0 A;  1EJ3 A;  1KFU L;  1UUR A;  2KQ6 A;  3WHU B;  1L2O C;  1M39 A;  1S3P A;  3D10 A;  3LLE A;  4HRH A;  2JQ6 A;  3TZ1 A;  1TNW A;  3VRN A;  4E68 A;  1DF0 B;  2EC6 C;  4GBA A;  2CT9 A;  1CDN A;  2KGR A;  1TNX A;  2PMY A;  2LP2 A;  1W7I B;  4NQG A;  1MXE A;  2K0J A;  2PAL A;  1YVL A;  2BCB A;  4JWQ A;  3SG6 A;  1QV1 A;  2ZFD A;  3NSI A;  5FYX A;  3CWG A;  1B7T Z;  1XFU O;  2R2I A;  5D7F A;  1AP4 A;  1TNQ A;  1DJG A;  1TRF A;  2QAC A;  1IG5 A;  2HPS A;  1LVC D;  4ZCV A;  3BUM B;  2GV5 A;  3KEV A;  3OX5 A;  1B8R A;  1S26 D;  4WRI A;  5I8N A;  1FF1 A;  1JBA A;  3CR2 A;  1KWO C;  1J7R A;  1ODB A;  1QVI Y;  1N2D A;  1ZUZ A;  2JNF A;  3EVV A;  1F54 A;  1NCZ A;  2CNP A;  3PAL A;  2K7O A;  1WLZ A;  2M97 A;  2SCP A;  2KI6 D;  4C0K A;  3VRR A;  1WDC C;  5HKZ A;  2BCX A;  1UHI A;  1LA0 A;  3K21 A;  4YGE B;  1DJW A;  2HF5 A;  3TDU A;  3BUW B;  2WCE A;  2DOQ A;  3MSE B;  1XFV O;  5GQQ C;  3E3R A;  1REC A;  2KOT A;  1F8H A;  1PUL A;  2JRF A;  3M0W A;  1KSM A;  1TCF A;  1DF0 A;  1YVH A;  2LVI A;  1UWO A;  1WRZ A;  4UPG A;  1KFX L;  3CGA A;  2LVJ A;  1G4Y R;  1QS7 A;  1IRJ A;  4HRE E;  1AJ4 A;  3BXK A;  2AUC A;  2MRD A;  4OKH A;  2NLN A;  2F8P A;  3LL8 B;  3CLN A;  2WOR A;  3NSL A;  2FOT A;  4MRX A;  5AEQ A;  2MA2 A;  4NDB A;  3I5I C;  5J3X A;  2LMT A;  1S6I A;  1K9P A;  3NXA A;  4AQJ A;  2M49 B;  2K7B A;  1XK4 C;  2L2E A;  3AAK A;  1FI6 A;  3EVU A;  4MZJ A;  4N5X A;  1PAL A;  4ORB B;  2LHI A;  5TNC A;  2QPT A;  3FWC A;  3O78 A;  1YUU A;  3I5F B;  3IQO A;  2OTG C;  2O5G A;  4FTG A;  2JU0 A;  1CM4 A;  1F4Q A;  1HQV A;  1A29 A;  4A4C A;  2HQ8 A;  4DCK A;  1ZAC A;  1DJI A;  4DIR A;  1XA5 A;  3DVK A;  1KK8 C;  1A2X A;  1NYA A;  1FW4 A;  4MZK A;  3ZWH A;  2K7D A;  2ISD A;  3GOF A;  5CSJ A;  1KFU S;  1SPY A;  1UHH A;  1KQM B;  2KI4 B;  2NCP A;  3OX6 A;  4YRU A;  1AHR A;  3EKJ A;  1NSH A;  4MLW A;  1SRA A;  1XFX O;  3SIA A;  2LLU A;  1W7J B;  2Q4U A;  1L2O B;  1ALV A;  2ZKM X;  2KAV A;  4OR9 B;  4XYN A;  1CM1 A;  2O60 A;  2EC6 B;  1AK8 A;  2OPO A;  2Y1N A;  2KFH A;  2AMI A;  2Q91 A;  2G2B A;  3GK4 X;  1B8L A;  1G33 A;  1YUT A;  2A4J A;  2F3Z A;  4M2Q A;  3I5H C;  2BE4 A;  3O4Y A;  2LUC A;  1A4P A;  1S6C A;  2LM5 A;  1N65 A;  2PVB A;  1DMO A;  1CDL A;  2H2K A;  1WRK A;  1SCV A;  2LVV A;  1OOJ A;  2G9B A;  2LLS A;  1J7P A;  1CB1 A;  3BOW A;  1DJX A;  1QLS A;  2JT8 A;  2IS9 A;  3BYA A;  3ICB A;  4U8D A;  1QLK A;  4ETO A;  3C1V A;  4XJK B;  5KSZ A;  4PHK A;  4MN0 A;  1BOC A;  1KK7 Z;  1R2U A;  1CFP A;  5KU1 A;  3WNX B;  5I2L A;  1SCM C;  1KCY A;  4HRG A;  2L51 A;  1TNP A;  1IH0 A;  2KQY A;  2KFF A;  1DGU A;  2JWW A;  3LCP C;  2FCE A;  1E8A A;  1MWN A;  1J7Q A;  1YR5 A;  1HT9 A;  1OE9 B;  1OMR A;  1XO5 A;  3GK1 A;  4PHJ A;  2M0R A;  1S6J A;  2SAS A;  1MQ1 A;  3PM8 A;  2D8N A;  5HLV A;  1KFX S;  1YTZ C;  1PK0 D;  1VRK A;  3SG4 A;  5K89 A;  4N1G A;  1SR6 B;  3WHT B;  1KSO A;  2E30 A;  1F4O A;  1C07 A;  1EG3 A;  3I5G C;  2LVK A;  2WND A;  1QX5 B;  3KO0 A;  3O6B A;  1ZOT B;  1K94 A;  2L0P A;  1J7O A;  4ZCU A;  1OZO A;  5F6T A;  1NX3 A;  3NSO A;  4GNK B;  1XVJ A;  3CR4 X;  2OS8 C;  1K90 D;  1FPW A;  3CZT X;  3DF0 A;  1RTP 1;  3I5I B;  5HLO A;  4YI9 A;  1IWQ A;  1QV0 A;  4GAO A;  2KYF A;  2LNK A;  2TN4 A;  2MAZ A;  4PE0 A;  3SJS A;  1KQV A;  1H8B A;  1AVS A;  5HKY A;  1K93 D;  1Y1U A;  1CKK A;  1EXR A;  1N0Y A;  2WC8 A;  1QIV A;  2OTG B;  3BQ3 A;  3DVJ A;  2P6B B;  2KNE A;  1SL9 A;  4MZL A;  1FBV A;  1U5I A;  4GFT A;  3SG5 A;  1F70 A;  1DJH A;  4IL1 A;  1KK8 B;  1G8I A;  1CLL A;  2KFG A;  1QAS A;  2LV7 A;  5ER4 X;  3H4S E;  1PSB A;  4GGF C;  1NCX A;  1SR6 C;  1K2H A;  1M31 A;  3FWB A;  1F55 A;  1SYM A;  3IF7 A;  4YGD B;  1JFK A;  1RWY A;  1MF8 B;  1M63 B;  4QJ5 B;  2BE6 A;  1IGV A;  1X02 A;  4PE7 A;  5KTY A;  2BL0 C;  1TIZ A;  2H61 A;  5IBW A;  5JJG A;  1BLQ A;  4M2P A;  2NCO A;  3I5H B;  3VRQ A;  1ZFS A;  5CSN A;  4C0L A;  1XK4 A;  1PRW A;  2LMU A;  1GJY A;  4YGB B;  4ICB A;  1MXL C;  2L98 A; 
#chains in the Genus database with same CATH topology
 1BF5 A;  1NX1 A;  4BY5 A;  2L50 A;  3VGO A;  2RGI A;  5CSF A;  4AQI A;  2QEB A;  3AAJ A;  3EVR A;  3SIB A;  1ZMZ A;  1XFY O;  4ORC B;  1UHJ A;  1C7V A;  2BCA A;  2NZ0 A;  2LHL A;  3OBV A;  5JOL A;  1SCM B;  1BT6 A;  3EK8 A;  2GGM A;  2Y5I A;  2QEO A;  2NXQ A;  1V1G A;  2KSP A;  2KDH A;  2CBL A;  1CNP A;  5AER A;  4CFQ A;  2KYC A;  1JFJ A;  2JZI A;  1Q80 A;  4JKT A;  2M8U A;  2JOJ A;  4I5J A;  5I2O A;  1A75 B;  1B8C A;  3NHI A;  2WOS A;  3OHM B;  1YX7 A;  1QVI Z;  3EG5 B;  2F3Y A;  5CPV A;  1QIW A;  1Y1X A;  2JC2 A;  3A8R A;  3DD4 A;  1B9A A;  1QTX A;  2LE9 B;  3S0F A;  1CFF A;  1B7T Y;  3I5G B;  1MHO A;  2JTZ A;  3JTD B;  2LCP A;  1OW4 A;  2M29 A;  2LAN A;  3BUO B;  1SSE B;  5CSI A;  1CFC A;  1EH2 A;  2WCK A;  3S0A A;  1QX2 A;  1SMG A;  1IQ3 A;  2OS8 B;  3UNW A;  1GGZ A;  1TTX A;  2CCM A;  2WCB A;  3RLZ A;  1JSA A;  4Q04 A;  2COL B;  5AAN A;  2F33 A;  1IJ6 A;  1SK6 D;  2HQW A;  2K61 A;  2BNX A;  1MR8 A;  3D73 A;  3AKB A;  3HCM A;  5D69 A;  2I7A A;  1NIW A;  3PN7 C;  2VRG A;  4F0Z B;  4DS7 A;  1OQP A;  4NDC A;  1K96 A;  3R1V A;  2LMV A;  1XFZ O;  2ZNE A;  4NDD A;  3S0D A;  1IKU A;  1B47 A;  1CMG A;  1DVI A;  2KBM A;  3D0Y B;  2CTN A;  2ZND A;  2M1U A;  4HSZ A;  1K9U A;  3TDI A;  5HYD A;  4YGA A;  1ALW A;  1R6P A;  4YBH B;  4F7F A;  5FI6 A;  5AXI A;  2BEC A;  1A75 A;  3OGN A;  5G08 A;  3FIA A;  1OOF A;  1WRL A;  3TDZ A;  3OP0 A;  1NX2 A;  2L5X B;  4PHM A;  1OMD A;  1QJT A;  1QX7 A;  1GM0 A;  1B4C A;  3EK7 A;  1WY9 A;  2I2R E;  2PRU A;  1NWD A;  2BKH B;  4ORA B;  3S0E A;  3SS4 A;  1H4B A;  1BU3 A;  5DKQ A;  1YRU B;  1OMV A;  4WQ3 A;  3LK1 A;  1A03 A;  2MBX A;  3PAT A;  3SG2 A;  3VRN A;  3JTD C;  1J1E A;  2KGB C;  1UUS A;  2BL0 B;  5FI2 A;  1DT7 B;  4GUK A;  3TS5 C;  1RK9 A;  3BUN B;  1UHN A;  1WLM A;  1L7Z A;  2L4I A;  3DVM A;  1IIO A;  3QRX A;  1Y1A A;  4L9M A;  1S5G Z;  4P2Y B;  2M3W A;  3EKH A;  3SG3 A;  1DC1 A;  1DTL A;  4PT1 A;  1DQE A;  4XJK A;  2P70 A;  3DYE A;  5BPJ A;  3CTN A;  3DZT A;  3JVT C;  3PSR A;  2ERB A;  5B8I B;  1XYD A;  1Y6W A;  1C7W A;  2ZN8 A;  3CAB A;  1YRT B;  3D0Y A;  2M7L A;  2LC5 A;  4YGC B;  2JPO A;  2LUX A;  3FE6 A;  4MRY A;  2ZRS A;  4C0J A;  1PVB A;  3R1P A;  2K2F A;  3SS3 A;  4FQT A;  4CPV A;  2JNX A;  2HET A;  3CR5 X;  4PHN A;  2JT3 A;  1PSR A;  2EGD A;  3KPX A;  1CMF A;  1QXP A;  3UO9 A;  1LS8 A;  3Q8I A;  4GGF A;  4MSP A;  1CTR A;  1TN4 A;  4P5O E;  5PAL A;  1JWD A;  2WCH A;  2ZN9 A;  4CID A;  1BJF A;  1OZS A;  1PVA A;  2PSR A;  4OZD A;  2I18 A;  1YUR A;  1J55 A;  4USL A;  4DRW A;  2PAS A;  4MVF A;  1JUO A;  1AUI B;  1IJ5 A;  1CDM A;  2KAX A;  1BR4 B;  2EHB A;  3SG6 A;  3O2P A;  1CFD A;  1DJZ A;  2PQL A;  1MUX A;  2F2P A;  3AKA A;  1BR1 B;  2LLT A;  1ORG A;  1QAT A;  1OSA A;  4R1E A;  2ZRT A;  1OOI X;  4N1F A;  2JXC A;  1RFJ A;  4PAL A;  3DVE A;  2GTE A;  1KK7 Y;  2BKI B;  2I94 A;  3PN7 B;  1FI5 A;  2E6W A;  4TNC A;  2K8M B;  3IVT A;  3BFB A;  4M2O A;  2MLF C;  4YI8 A;  2LAP A;  4JQ0 D;  3L4A A;  1NP8 A;  2KLD A;  2B1U A;  1T14 A;  4I5K A;  2P71 A;  1AJ5 A;  2H61 C;  1GGW A;  3LK0 A;  3S0G A;  4PE1 A;  2M9G A;  2V53 A;  3BFH A;  1NUB A;  3IQQ A;  4OCI A;  5DKN A;  3BUX B;  1TCO B;  2Y4Q A;  1XFW O;  1LA3 A;  1UP5 A;  2FJU B;  2KHN A;  2L5Y A;  5HKW A;  4CFR A;  1M46 A;  4WQ2 A;  3KF9 A;  3GK2 A;  3S0B A;  1B1G A;  3CS1 A;  3BOW B;  3ZNI A;  3O4X A;  1W9Z A;  1EG4 A;  3NSK A;  2MLE C;  1SW8 A;  4PDZ A;  1M45 A;  4D1E A;  3KHE A;  4FQO A;  2MJW B;  1K95 A;  1RRO A;  3VRP A;  4DUQ A;  2FJY A;  4BY4 A;  1TUZ A;  2JUL A;  5HL1 A;  2WC5 A;  1SNL A;  3OB1 B;  3PLF B;  1UHK A;  4QJ3 B;  2Y1M A;  5ER5 A;  2LP3 A;  1V1F A;  5DKR A;  3TS5 B;  1JF2 A;  1S5G Y;  4MBE A;  3WXA A;  1YX8 A;  4GGN A;  1YUS A;  3TUY B;  1GQM A;  1SL8 A;  2WCM A;  1DEK A;  2K7C A;  1D1O A;  2KBI A;  1SKT A;  3SG7 A;  4JPZ B;  4OVN F;  1S36 A;  2K2A A;  1DEL A;  3JVT B;  4PCW A;  1RJV A;  2AAO A;  3EK4 A;  3HX4 A;  1S1E A;  2JTT A;  4I5N B;  3VRO A;  1Y0V H;  1QWV A;  1BG1 A;  1LKJ A;  4GPL B;  2QEH A;  1DGV A;  2BBM A;  3B87 A;  1SL7 A;  1F71 A;  1OOG A;  3A4U B;  4MEW A;  4PE4 A;  2FCD A;  2JPT A;  3N7H A;  1CLB A;  1CLM A;  1SY9 A;  1JF0 A;  2BBN A;  5AFP A;  2KAY A;  3D78 A;  2JT0 A;  2JXL A;  2KI6 C;  1EL4 A;  4I5L B;  1IQ5 A;  3DF0 B;  1TOP A;  1DJY A;  1K9K A;  1KWO B;  1BOD A;  2MHH A;  3B7A A;  4AOM A;  2CXJ A;  1J1D A;  2F2O A;  3I5F C;  1LXF C;  3FS7 A;  3PJI A;  3F45 A;  3CZ1 A;  2M7N A;  2L4H A;  4JD9 A;  4OV2 A;  1SBJ A;  2GGZ A;  1CDP A;  3RM1 A;  5I2Q A;  4INW A;  1JC2 A;  1WDC B;  1K8U A;  3OB2 B;  4CLN A;  1BMO A;  1LIN A;  1NCY A;  2WCF A;  4A4B A;  3CZ0 A;  2M1K B;  1U5I B;  3PFV A;  2KI4 C;  1KQM C;  1NPQ A;  3TUY C;  4KYN A;  4QJ4 B;  1NX0 A;  1EJ3 A;  1P28 A;  1KFU L;  1UUR A;  2KQ6 A;  3WHU B;  1L2O C;  1M39 A;  1S3P A;  3D10 A;  3L4L A;  3LLE A;  2JQ6 A;  4HRH A;  1TNW A;  3TZ1 A;  2PYQ A;  3CZ2 A;  1DF0 B;  2EC6 C;  3NGV A;  4GBA A;  2CT9 A;  1CDN A;  2KGR A;  1TNX A;  2KPH A;  2PMY A;  2LP2 A;  1W7I B;  4NQG A;  1MXE A;  2K0J A;  2PAL A;  1YVL A;  2BCB A;  2YGU A;  3BFA A;  1QV1 A;  2ZFD A;  3NSI A;  4JWQ A;  3CWG A;  1B7T Z;  1XFU O;  2R2I A;  5D7F A;  5FYX A;  1TNQ A;  1DJG A;  1TRF A;  2QAC A;  1AP4 A;  1IG5 A;  2HPS A;  1LVC D;  4ZCV A;  3BUM B;  1Z4H A;  2GV5 A;  3KEV A;  3OX5 A;  5DIC A;  1B8R A;  1S26 D;  4WRI A;  5I8N A;  3PM2 A;  3QME A;  5I94 A;  1FF1 A;  1JBA A;  3CR2 A;  3K1E A;  1KWO C;  1J7R A;  1ODB A;  1QVI Y;  1N2D A;  1ZUZ A;  2JNF A;  3EVV A;  1F54 A;  1NCZ A;  2CNP A;  3PAL A;  2K7O A;  1WLZ A;  2M97 A;  2SCP A;  2KI6 D;  5FI7 A;  3V2L A;  4C0K A;  3VRR A;  1WDC C;  5HKZ A;  2BCX A;  1UHI A;  1LA0 A;  3K21 A;  4YGE B;  1DJW A;  2HF5 A;  3TDU A;  3BUW B;  2WCE A;  2DOQ A;  3MSE B;  1XFV O;  4E68 A;  2BAP A;  5GQQ C;  3E3R A;  1REC A;  2KOT A;  1F8H A;  2L2C A;  1PUL A;  2JRF A;  3M0W A;  1KSM A;  1TCF A;  1DF0 A;  1YVH A;  2LVI A;  1UWO A;  3VB1 A;  1WRZ A;  4UPG A;  1KFX L;  3CGA A;  2LVJ A;  1G4Y R;  1QS7 A;  1IRJ A;  4HRE E;  1AJ4 A;  3BXK A;  2AUC A;  2MRD A;  4OKH A;  2NLN A;  2F8P A;  3LL8 B;  3CLN A;  2WOR A;  3NSL A;  2FOT A;  4MRX A;  2KLE A;  5AEQ A;  2MA2 A;  4NDB A;  3I5I C;  3R72 A;  2LMT A;  1S6I A;  5J3X A;  1K9P A;  2QDI A;  3D75 A;  3NXA A;  3B86 A;  2M49 B;  2K7B A;  4AQJ A;  1XK4 C;  2L2E A;  3AAK A;  1FI6 A;  3EVU A;  5D3O A;  4MZJ A;  4N5X A;  1PAL A;  4ORB B;  2LHI A;  1TUJ A;  5TNC A;  2QPT A;  3FWC A;  3O78 A;  1YUU A;  3I5F B;  3IQO A;  2OTG C;  2O5G A;  4FTG A;  2JU0 A;  1CM4 A;  1F4Q A;  1HQV A;  1A29 A;  4A4C A;  2HQ8 A;  4DCK A;  1ZAC A;  1DJI A;  4DIR A;  1XA5 A;  3DVK A;  1KK8 C;  1A2X A;  1NYA A;  1FW4 A;  4MZK A;  3ZWH A;  2K7D A;  2ISD A;  3GOF A;  5CSJ A;  1KFU S;  1SPY A;  1UHH A;  1KQM B;  2KI4 B;  2NCP A;  2WC6 A;  3OX6 A;  1AHR A;  3EKJ A;  3SS5 A;  4YRU A;  1NSH A;  4MLW A;  1SRA A;  1XFX O;  3SIA A;  2LLU A;  1W7J B;  3NHT A;  2Q4U A;  1L2O B;  1ALV A;  2ZKM X;  2KAV A;  4OR9 B;  4XYN A;  1CM1 A;  2O60 A;  3BJH A;  2EC6 B;  1Z2C B;  1AK8 A;  2OPO A;  2Y1N A;  2KFH A;  2AMI A;  2Q91 A;  2G2B A;  3GK4 X;  1B8L A;  1G33 A;  1YUT A;  2A4J A;  2F3Z A;  4M2Q A;  3I5H C;  2BE4 A;  3O4Y A;  2LUC A;  1A4P A;  1S6C A;  2LM5 A;  1N65 A;  2PVB A;  1DMO A;  1CDL A;  2H2K A;  1WRK A;  1SCV A;  2LVV A;  1OOJ A;  2G9B A;  2LLS A;  1J7P A;  1CB1 A;  3BOW A;  1DJX A;  1QLS A;  2JT8 A;  2IS9 A;  3BYA A;  3ICB A;  4U8D A;  1QLK A;  4ETO A;  3C1V A;  4XJK B;  5KSZ A;  1C3Z A;  4PHK A;  4MN0 A;  1BOC A;  1KK7 Z;  1R2U A;  1CFP A;  5KU1 A;  3WNX B;  5I2L A;  1SCM C;  1KCY A;  4HRG A;  2L51 A;  1TNP A;  1IH0 A;  2KQY A;  2QEV A;  2KFF A;  1DGU A;  2JWW A;  3L47 A;  2FCE A;  1E8A A;  3LCP C;  1MWN A;  1J7Q A;  1YR5 A;  1HT9 A;  1OE9 B;  1OMR A;  1XO5 A;  3RZS A;  3GK1 A;  4PHJ A;  2M0R A;  3D76 A;  1S6J A;  2SAS A;  1MQ1 A;  3PM8 A;  2D8N A;  5HLV A;  1KFX S;  1YTZ C;  1PK0 D;  1VRK A;  3SG4 A;  5K89 A;  3FE8 A;  4N1G A;  1SR6 B;  3WHT B;  1KSO A;  2E30 A;  1F4O A;  1C07 A;  1TWO A;  1EG3 A;  3I5G C;  2LVK A;  2WND A;  1QX5 B;  3KO0 A;  3O6B A;  1ZOT B;  3CDN A;  3D74 A;  1K94 A;  2L0P A;  1J7O A;  4ZCU A;  1OZO A;  5F6T A;  1NX3 A;  3NSO A;  4GNK B;  1XVJ A;  3CR4 X;  2OS8 C;  1K90 D;  3D77 A;  3CZT X;  3DF0 A;  1FPW A;  1RTP 1;  3I5I B;  4INX A;  5HLO A;  4YI9 A;  1IWQ A;  1QV0 A;  1C3Y A;  4GAO A;  2KYF A;  2LNK A;  2TN4 A;  2MAZ A;  4PE0 A;  3SJS A;  1KQV A;  1H8B A;  1AVS A;  5HKY A;  1K93 D;  1Y1U A;  1CKK A;  1EXR A;  3FE9 A;  1N0Y A;  2WC8 A;  1QIV A;  2OTG B;  3BQ3 A;  3DVJ A;  2P6B B;  2KNE A;  3B88 A;  3DY9 A;  1SL9 A;  4IJ7 A;  4MZL A;  1FBV A;  1U5I A;  4GFT A;  3SG5 A;  1F70 A;  1DJH A;  4IL1 A;  1KK8 B;  2H8V A;  1G8I A;  3CYZ A;  1CLL A;  2KFG A;  1OOH A;  3B6X A;  1QAS A;  2LV7 A;  5ER4 X;  3H4S E;  1PSB A;  4GGF C;  1NCX A;  1SR6 C;  1K2H A;  1M31 A;  3FWB A;  5EL2 A;  1F55 A;  1SYM A;  3IF7 A;  4YGD B;  1JFK A;  1RWY A;  1MF8 B;  1M63 B;  3R1O A;  2BE6 A;  1IGV A;  1X02 A;  4PE7 A;  4QJ5 B;  5KTY A;  2BL0 C;  1TIZ A;  2H61 A;  5IBW A;  5JJG A;  2WCL A;  1BLQ A;  4M2P A;  2WCJ A;  1XFR A;  2NCO A;  3I5H B;  3VRQ A;  1ZFS A;  5CSN A;  4C0L A;  1XK4 A;  1PRW A;  3DXL A;  2LMU A;  1GJY A;  2K60 A;  4YGB B;  4ICB A;  1MXL C;  2L98 A; 
#chains in the Genus database with same CATH homology
 1BF5 A;  1NX1 A;  4BY5 A;  2L50 A;  3VGO A;  2RGI A;  5CSF A;  4AQI A;  3AAJ A;  3EVR A;  3SIB A;  1ZMZ A;  1XFY O;  4ORC B;  1UHJ A;  1C7V A;  2BCA A;  2NZ0 A;  2LHL A;  5JOL A;  1SCM B;  1BT6 A;  3EK8 A;  2GGM A;  2Y5I A;  2NXQ A;  1V1G A;  2KSP A;  2KDH A;  2CBL A;  1CNP A;  5AER A;  4CFQ A;  2KYC A;  1JFJ A;  2JZI A;  1Q80 A;  2M8U A;  2JOJ A;  4I5J A;  5I2O A;  1A75 B;  1B8C A;  2WOS A;  3OHM B;  1YX7 A;  1QVI Z;  2F3Y A;  5CPV A;  1QIW A;  1Y1X A;  2JC2 A;  3A8R A;  3DD4 A;  1B9A A;  1QTX A;  2LE9 B;  1A03 A;  1CFF A;  1B7T Y;  3I5G B;  1MHO A;  2JTZ A;  3JTD B;  2LCP A;  2M29 A;  2LAN A;  3BUO B;  5CSI A;  1EH2 A;  1CFC A;  1QX2 A;  1SMG A;  1IQ3 A;  2OS8 B;  1GGZ A;  1TTX A;  2CCM A;  2WCB A;  3RLZ A;  1JSA A;  4Q04 A;  2COL B;  5AAN A;  2F33 A;  1IJ6 A;  1SK6 D;  2HQW A;  2K61 A;  1MR8 A;  3AKB A;  3HCM A;  5D69 A;  2I7A A;  1NIW A;  3PN7 C;  2VRG A;  4F0Z B;  4DS7 A;  1OQP A;  4NDC A;  1K96 A;  2LMV A;  1XFZ O;  2ZNE A;  4NDD A;  1IKU A;  1B47 A;  1CMG A;  1DVI A;  2KBM A;  3D0Y B;  2CTN A;  2ZND A;  2M1U A;  4HSZ A;  1K9U A;  3TDI A;  5HYD A;  4YGA A;  1ALW A;  1R6P A;  4YBH B;  5AXI A;  2BEC A;  1A75 A;  5G08 A;  3FIA A;  1WRL A;  3TDZ A;  3OP0 A;  1NX2 A;  2L5X B;  4PHM A;  1OMD A;  1QJT A;  1QX7 A;  1B4C A;  3EK7 A;  1WY9 A;  2I2R E;  2PRU A;  1NWD A;  2BKH B;  4ORA B;  1H4B A;  1BU3 A;  5DKQ A;  1YRU B;  1OMV A;  4WQ3 A;  3LK1 A;  2MBX A;  3PAT A;  3SG2 A;  3JTD C;  1J1E A;  2KGB C;  1UUS A;  2BL0 B;  1DT7 B;  4GUK A;  3TS5 C;  1RK9 A;  3BUN B;  1UHN A;  1WLM A;  1L7Z A;  2L4I A;  3DVM A;  3QRX A;  1Y1A A;  4L9M A;  1S5G Z;  4P2Y B;  2M3W A;  3EKH A;  3SG3 A;  1DTL A;  4XJK A;  5BPJ A;  3CTN A;  3JVT C;  3PSR A;  5B8I B;  1XYD A;  1Y6W A;  1C7W A;  2ZN8 A;  1YRT B;  3D0Y A;  2M7L A;  2LC5 A;  4YGC B;  2LUX A;  4MRY A;  2ZRS A;  4C0J A;  1PVB A;  2K2F A;  4CPV A;  2JNX A;  2HET A;  3CR5 X;  4PHN A;  2JT3 A;  1PSR A;  2EGD A;  3KPX A;  1CMF A;  1QXP A;  4GGF A;  4MSP A;  1CTR A;  1TN4 A;  4P5O E;  5PAL A;  1JWD A;  2ZN9 A;  4CID A;  1BJF A;  1OZS A;  1PVA A;  2PSR A;  2I18 A;  1YUR A;  1J55 A;  4USL A;  4DRW A;  2PAS A;  4MVF A;  1JUO A;  1AUI B;  1IJ5 A;  1CDM A;  2KAX A;  1BR4 B;  2EHB A;  3O2P A;  1CFD A;  1DJZ A;  3AKA A;  1MUX A;  2F2P A;  1BR1 B;  2LLT A;  1QAT A;  1OSA A;  4R1E A;  2ZRT A;  4N1F A;  2JXC A;  1RFJ A;  4PAL A;  3DVE A;  2I94 A;  1KK7 Y;  2BKI B;  1FI5 A;  3PN7 B;  2E6W A;  4TNC A;  2K8M B;  4M2O A;  2MLF C;  4YI8 A;  2LAP A;  4JQ0 D;  1NP8 A;  4I5K A;  2B1U A;  1AJ5 A;  2H61 C;  1GGW A;  3LK0 A;  4PE1 A;  2M9G A;  2V53 A;  1NUB A;  3IQQ A;  4OCI A;  5DKN A;  3BUX B;  1TCO B;  2Y4Q A;  1XFW O;  1LA3 A;  1UP5 A;  2FJU B;  2KHN A;  5HKW A;  4CFR A;  1M46 A;  4WQ2 A;  3KF9 A;  3GK2 A;  1B1G A;  3CS1 A;  3BOW B;  3ZNI A;  1EG4 A;  3NSK A;  2MLE C;  1SW8 A;  4PDZ A;  1M45 A;  4D1E A;  3KHE A;  4FQO A;  2MJW B;  1K95 A;  1RRO A;  3VRP A;  4DUQ A;  4BY4 A;  2JUL A;  1SNL A;  3OB1 B;  3PLF B;  1UHK A;  4QJ3 B;  2Y1M A;  5ER5 A;  2LP3 A;  1V1F A;  5DKR A;  3TS5 B;  1JF2 A;  1S5G Y;  4MBE A;  3WXA A;  1YX8 A;  4GGN A;  1YUS A;  3TUY B;  1GQM A;  1SL8 A;  2K7C A;  1D1O A;  2KBI A;  1SKT A;  3SG7 A;  4JPZ B;  4OVN F;  1S36 A;  2K2A A;  3JVT B;  4PCW A;  1RJV A;  2AAO A;  3EK4 A;  3HX4 A;  1S1E A;  2JTT A;  4I5N B;  3VRO A;  1Y0V H;  1BG1 A;  1LKJ A;  4GPL B;  1DGV A;  2BBM A;  1F71 A;  1SL7 A;  3A4U B;  4MEW A;  4PE4 A;  2FCD A;  2JPT A;  1CLB A;  1CLM A;  1SY9 A;  1JF0 A;  2BBN A;  5AFP A;  2KAY A;  2JT0 A;  2JXL A;  2KI6 C;  1EL4 A;  4I5L B;  1IQ5 A;  3DF0 B;  1TOP A;  1DJY A;  1K9K A;  1KWO B;  1BOD A;  2MHH A;  4AOM A;  2CXJ A;  1J1D A;  2F2O A;  3I5F C;  1LXF C;  3FS7 A;  3F45 A;  2M7N A;  2L4H A;  4OV2 A;  1SBJ A;  2GGZ A;  1CDP A;  3RM1 A;  5I2Q A;  1JC2 A;  1WDC B;  1K8U A;  3OB2 B;  4CLN A;  1BMO A;  1LIN A;  1NCY A;  2WCF A;  4A4B A;  2M1K B;  1U5I B;  3PFV A;  2KI4 C;  1KQM C;  1NPQ A;  3TUY C;  4QJ4 B;  1NX0 A;  1EJ3 A;  1KFU L;  1UUR A;  2KQ6 A;  3WHU B;  1L2O C;  1M39 A;  1S3P A;  3D10 A;  3LLE A;  4HRH A;  2JQ6 A;  3TZ1 A;  1TNW A;  3VRN A;  4E68 A;  1DF0 B;  2EC6 C;  4GBA A;  2CT9 A;  1CDN A;  2KGR A;  1TNX A;  2PMY A;  2LP2 A;  1W7I B;  4NQG A;  1MXE A;  2K0J A;  2PAL A;  1YVL A;  2BCB A;  4JWQ A;  3SG6 A;  1QV1 A;  2ZFD A;  3NSI A;  5FYX A;  3CWG A;  1B7T Z;  1XFU O;  2R2I A;  5D7F A;  1AP4 A;  1TNQ A;  1DJG A;  1TRF A;  2QAC A;  1IG5 A;  2HPS A;  1LVC D;  4ZCV A;  3BUM B;  2GV5 A;  3KEV A;  3OX5 A;  1B8R A;  1S26 D;  4WRI A;  5I8N A;  1FF1 A;  1JBA A;  3CR2 A;  1KWO C;  1J7R A;  1ODB A;  1QVI Y;  1N2D A;  1ZUZ A;  2JNF A;  3EVV A;  1F54 A;  1NCZ A;  2CNP A;  3PAL A;  2K7O A;  1WLZ A;  2M97 A;  2SCP A;  2KI6 D;  4C0K A;  3VRR A;  1WDC C;  5HKZ A;  2BCX A;  1UHI A;  1LA0 A;  3K21 A;  4YGE B;  1DJW A;  2HF5 A;  3TDU A;  3BUW B;  2WCE A;  2DOQ A;  3MSE B;  1XFV O;  5GQQ C;  3E3R A;  1REC A;  2KOT A;  1F8H A;  1PUL A;  2JRF A;  3M0W A;  1KSM A;  1TCF A;  1DF0 A;  1YVH A;  2LVI A;  1UWO A;  1WRZ A;  4UPG A;  1KFX L;  3CGA A;  2LVJ A;  1G4Y R;  1QS7 A;  1IRJ A;  4HRE E;  1AJ4 A;  3BXK A;  2AUC A;  2MRD A;  4OKH A;  2NLN A;  2F8P A;  3LL8 B;  3CLN A;  2WOR A;  3NSL A;  2FOT A;  4MRX A;  5AEQ A;  2MA2 A;  4NDB A;  3I5I C;  5J3X A;  2LMT A;  1S6I A;  1K9P A;  3NXA A;  4AQJ A;  2M49 B;  2K7B A;  1XK4 C;  2L2E A;  3AAK A;  1FI6 A;  3EVU A;  4MZJ A;  4N5X A;  1PAL A;  4ORB B;  2LHI A;  5TNC A;  2QPT A;  3FWC A;  3O78 A;  1YUU A;  3I5F B;  3IQO A;  2OTG C;  2O5G A;  4FTG A;  2JU0 A;  1CM4 A;  1F4Q A;  1HQV A;  1A29 A;  4A4C A;  2HQ8 A;  4DCK A;  1ZAC A;  1DJI A;  4DIR A;  1XA5 A;  3DVK A;  1KK8 C;  1A2X A;  1NYA A;  1FW4 A;  4MZK A;  3ZWH A;  2K7D A;  2ISD A;  3GOF A;  5CSJ A;  1KFU S;  1SPY A;  1UHH A;  1KQM B;  2KI4 B;  2NCP A;  3OX6 A;  4YRU A;  1AHR A;  3EKJ A;  1NSH A;  4MLW A;  1SRA A;  1XFX O;  3SIA A;  2LLU A;  1W7J B;  2Q4U A;  1L2O B;  1ALV A;  2ZKM X;  2KAV A;  4OR9 B;  4XYN A;  1CM1 A;  2O60 A;  2EC6 B;  1AK8 A;  2OPO A;  2Y1N A;  2KFH A;  2AMI A;  2Q91 A;  2G2B A;  3GK4 X;  1B8L A;  1G33 A;  1YUT A;  2A4J A;  2F3Z A;  4M2Q A;  3I5H C;  2BE4 A;  3O4Y A;  2LUC A;  1A4P A;  1S6C A;  2LM5 A;  1N65 A;  2PVB A;  1DMO A;  1CDL A;  2H2K A;  1WRK A;  1SCV A;  2LVV A;  1OOJ A;  2G9B A;  2LLS A;  1J7P A;  1CB1 A;  3BOW A;  1DJX A;  1QLS A;  2JT8 A;  2IS9 A;  3BYA A;  3ICB A;  4U8D A;  1QLK A;  4ETO A;  3C1V A;  4XJK B;  5KSZ A;  4PHK A;  4MN0 A;  1BOC A;  1KK7 Z;  1R2U A;  1CFP A;  5KU1 A;  3WNX B;  5I2L A;  1SCM C;  1KCY A;  4HRG A;  2L51 A;  1TNP A;  1IH0 A;  2KQY A;  2KFF A;  1DGU A;  2JWW A;  3LCP C;  2FCE A;  1E8A A;  1MWN A;  1J7Q A;  1YR5 A;  1HT9 A;  1OE9 B;  1OMR A;  1XO5 A;  3GK1 A;  4PHJ A;  2M0R A;  1S6J A;  2SAS A;  1MQ1 A;  3PM8 A;  2D8N A;  5HLV A;  1KFX S;  1YTZ C;  1PK0 D;  1VRK A;  3SG4 A;  5K89 A;  4N1G A;  1SR6 B;  3WHT B;  1KSO A;  2E30 A;  1F4O A;  1C07 A;  1EG3 A;  3I5G C;  2LVK A;  2WND A;  1QX5 B;  3KO0 A;  3O6B A;  1ZOT B;  1K94 A;  2L0P A;  1J7O A;  4ZCU A;  1OZO A;  5F6T A;  1NX3 A;  3NSO A;  4GNK B;  1XVJ A;  3CR4 X;  2OS8 C;  1K90 D;  1FPW A;  3CZT X;  3DF0 A;  1RTP 1;  3I5I B;  5HLO A;  4YI9 A;  1IWQ A;  1QV0 A;  4GAO A;  2KYF A;  2LNK A;  2TN4 A;  2MAZ A;  4PE0 A;  3SJS A;  1KQV A;  1H8B A;  1AVS A;  5HKY A;  1K93 D;  1Y1U A;  1CKK A;  1EXR A;  1N0Y A;  2WC8 A;  1QIV A;  2OTG B;  3BQ3 A;  3DVJ A;  2P6B B;  2KNE A;  1SL9 A;  4MZL A;  1FBV A;  1U5I A;  4GFT A;  3SG5 A;  1F70 A;  1DJH A;  4IL1 A;  1KK8 B;  1G8I A;  1CLL A;  2KFG A;  1QAS A;  2LV7 A;  5ER4 X;  3H4S E;  1PSB A;  4GGF C;  1NCX A;  1SR6 C;  1K2H A;  1M31 A;  3FWB A;  1F55 A;  1SYM A;  3IF7 A;  4YGD B;  1JFK A;  1RWY A;  1MF8 B;  1M63 B;  4QJ5 B;  2BE6 A;  1IGV A;  1X02 A;  4PE7 A;  5KTY A;  2BL0 C;  1TIZ A;  2H61 A;  5IBW A;  5JJG A;  1BLQ A;  4M2P A;  2NCO A;  3I5H B;  3VRQ A;  1ZFS A;  5CSN A;  4C0L A;  1XK4 A;  1PRW A;  2LMU A;  1GJY A;  4YGB B;  4ICB A;  1MXL C;  2L98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...