1CDNA

Solution structure of (cd2+)1-calbindin d9k reveals details of the stepwise structural changes along the apo--> (ca2+)ii1--> (ca2+)i,ii2 binding pathway
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Solution structure of (Cd2+)1-calbindin D9k reveals details of the stepwise structural changes along the Apo-->(Ca2+)II1-->(Ca2+)I,II2 binding pathway.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1995-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cdnA00
3I5HC 2TN4A 2LVIA 1UHHA 5AXIA 4PE4A 2CNPA 2LP2A 2KFFA 2WCFA 1F54A 1XO5A 1CDNA 2K2AA 5HKWA 1WRKA 2OTGC 2ZN9A 2LVKA 4GAOA 1TNWA 1J1EA 4MZLA 4DIRA 2LMTA 2LVJA 1IQ5A 1CNPA 1AUIB 2JNXA 3PLFB 1B7TY 3NXAA 4JQ0D 1YUSA 4WQ2A 1OSAA 1CDMA 1MWNA 1M46A 2CBLA 3E3RA 2LLUA 4N5XA 5CSJA 3HCMA 3KO0A 4YGEB 1FI6A 1SW8A 2KGRA 5FYXA 1KK7Z 2BCXA 1DJZA 2JOJA 3BQ3A 3GK1A 1KQMB 4HSZA 1BMOA 1M63B 1KK7Y 1DJIA 2JRFA 5J3XA 1AK8A 1KSMA 4XYNA 1AVSA 2A4JA 1K94A 1KWOC 2H61C 2FJUB 2HQ8A 3KHEA 2JZIA 3PATA 1ZMZA 1U5IB 1Y1UA 2I7AA 2L5XB 3OB1B 2ZFDA 2LMVA 2F8PA 3JVTC 2QPTA 1G8IA 2KI4B 1YX7A 4OR9B 4WQ3A 1W7IB 1BG1A 4ORCB 2OS8B 1YUUA 2L51A 1B4CA 1PVBA 1FI5A 1NCZA 3NSLA 1S3PA 3CTNA 3WHUB 1GQMA 1GGZA 2K7DA 1PRWA 1U5IA 3KEVA 3PALA 1N65A 1YX8A 3FIAA 1KK8B 1UHKA 1NWDA 1WDCB 2EC6C 1UHJA 1SRAA 1CLMA 1ODBA 3EKJA 5ER5A 2MJWB 2PRUA 3I5GC 1WY9A 2JNFA 1YR5A 2KYCA 1F70A 5HLOA 3CR4X 1R6PA 3JTDC 2Y4QA 1DTLA 3NSKA 3FWCA 2MRDA 1IWQA 3FS7A 2WNDA 1TN4A 1F4OA 1RTP1 2LUCA 2KI6D 3CGAA 1QLSA 2KI6C 3HX4A 5CSNA 1CKKA 4D1EA 1FF1A 1Q80A 2NLNA 1SR6B 4MLWA 5IBWA 2JU0A 5TNCA 2WORA 1JC2A 4GNKB 4TNCA 3OB2B 2ZKMX 3TS5B 2M1UA 1V1FA 2F2PA 2LLSA 1C7VA 2O5GA 1BLQA 1J7OA 2MBXA 1KFUL 2JULA 1F71A 1DJHA 1IG5A 1C7WA 1B8LA 4YGAA 5AANA 2K2FA 1SKTA 2BE6A 1TRFA 2OPOA 2WCBA 1K2HA 2MLEC 4P2YB 1V1GA 2LUXA 1BU3A 2BKIB 1J7RA 3DVEA 1JBAA 2KDHA 2JC2A 1RK9A 1OMVA 5CSFA 4CFQA 4ZCVA 4I5NB 2BCAA 1AP4A 4PDZA 2WOSA 4YGCB 2FCDA 1XK4A 1WRZA 4CFRA 2KI4C 3PM8A 1X02A 4HRHA 1D1OA 2M49B 3OHMB 1K90D 4YI9A 2GGZA 1SL9A 2QACA 3EVUA 5HLVA 1FW4A 1PSBA 2KYFA 5AEQA 1TNQA 4DS7A 1DF0B 1WDCC 1CM1A 2CTNA 1IJ6A 4GGFC 4N1GA 1MXEA 2FCEA 1JUOA 2K7BA 3O2PA 1A75B 1KCYA 1BT6A 1EJ3A 2JT0A 2JWWA 2M7LA 3VRQA 4A4BA 1SBJA 3CWGA 1ALVA 2ISDA 2JT8A 4DRWA 2LC5A 1KFUS 2AUCA 4USLA 1QX2A 4MZKA 4UPGA 1SCMB 1B7TZ 3LLEA 3OP0A 1DF0A 3DVKA 2VRGA 3PN7B 3DVMA 4PE1A 4CIDA 4P5OE 1E8AA 1K8UA 4DCKA 2E6WA 2Y1MA 4I5JA 1A75A 3VROA 5HYDA 1KQVA 2F33A 1IGVA 5DKRA 2WC8A 3TS5C 1MHOA 1CDPA 1JF2A 1QXPA 1ZUZA 2CT9A 3LL8B 4I5KA 1YURA 1K95A 1QVIZ 3GK2A 3KF9A 1F8HA 1K96A 1XA5A 2H2KA 1SCVA 3BUXB 1XK4C 1QATA 4A4CA 2M29A 2JT3A 1QVIY 2KSPA 2L50A 2Q4UA 1Y6WA 2Q91A 3BUWB 4GFTA 3SG6A 1MR8A 1SMGA 2B1UA 1A4PA 1EL4A 3ZNIA 1FPWA 5GQQC 1NX1A 3WHTB 2COLB 2KAXA 1QLKA 1UUSA 3SG2A 1IH0A 3AKAA 3BOWB 1S26D 1OE9B 1YUTA 2SCPA 4WRIA 4CLNA 2G9BA 4PHMA 2K0JA 2DOQA 3AAJA 5K89A 2GGMA 1DT7B 1J7PA 1DJXA 4MN0A 1BODA 1TNXA 1EH2A 1YVLA 5JJGA 2KQYA 2KNEA 3IQOA 1XFYO 5CPVA 1GJYA 1UWOA 1UHIA 3CLNA 3CR5X 2AAOA 4PE0A 1RECA 2F3ZA 1SNLA 3BXKA 2I2RE 3BOWA 5I8NA 1TIZA 3OX6A 1LKJA 4GPLB 1BJFA 3EK8A 3TUYB 3F45A 1M39A 2NXQA 2LNKA 2ZNEA 1AHRA 2BKHB 1PSRA 3EVRA 3WXAA 1QIVA 2L4HA 1CM4A 3I5IB 1YVHA 2K8MB 1K93D 3CS1A 1NIWA 1F55A 1G4YR 1Y1XA 3TDZA 1UURA 1XVJA 1DJYA 1QIWA 1ALWA 2ZN8A 3VRPA 3BUMB 2LMUA 1VRKA 1NX2A 2PSRA 5DKQA 1CMGA 1W7JB 2JXLA 1QTXA 1DJGA 1FBVA 1A03A 1QV1A 1QV0A 5F6TA 3I5HB 2BE4A 3DF0B 5KTYA 2HQWA 2M3WA 4U8DA 1CFDA 2EHBA 1S1EA 4F0ZB 2NCPA 2PALA 1XFXO 3MSEB 1K9PA 2MAZA 1BR1B 1KQMC 2JQ6A 2KFHA 3SIAA 4DUQA 2FOTA 2OTGB 4AOMA 1IKUA 3EVVA 1LINA 4GUKA 1AJ4A 4M2OA 1BF5A 2KBMA 1GGWA 2KGBC 2E30A 1DGUA 3LK0A 1M31A 4YI8A 4PHJA 2JPTA 3AKBA 4YGDB 1KFXL 1YTZC 1NSHA 2JTTA 1SPYA 4QJ3B 1LA3A 1SK6D 3DD4A 3TZ1A 1B8CA 2OS8C 2P6BB 4ETOA 2L4IA 4ORBB 2RGIA 1WRLA 3SG5A 2M8UA 1DJWA 2LCPA 4NQGA 4OKHA 2KOTA 1QX5B 2BL0B 5D7FA 1R2UA 2NCOA 3I5FB 1KWOB 1B1GA 3OX5A 1KK8C 1CLLA 1MUXA 2IS9A 2I94A 4HRGA 3TUYC 5I2LA 1LXFC 5KSZA 3VRNA 4IL1A 3O4YA 4E68A 1WLMA 2KBIA 1N2DA 5JOLA 2K7CA 2JTZA 2CXJA 2LANA 2G2BA 1UP5A 1OZSA 1SL8A 2LHLA 1SY9A 4YBHB 4BY4A 1YRUB 1HT9A 2H61A 4I5LB 3RM1A 3BYAA 3EKHA 4NDBA 4QJ4B 1L2OB 1DGVA 1JFKA 2KQ6A 1HQVA 5ER4X 3NSIA 1JWDA 2K7OA 2L2EA 2PVBA 1A2XA 4L9MA 1SR6C 1BOCA 2PMYA 1CB1A 1DVIA 2F3YA 3IF7A 4JWQA 2L0PA 3C1VA 3I5GB 1KFXS 2HPSA 4XJKB 3O78A 1CDLA 4PHNA 1WLZA 2LVVA 1EXRA 3JTDB 3VGOA 3K21A 2Y5IA 2LHIA 4JPZB 1JFJA 1MQ1A 1SL7A 1SYMA 1ZACA 1MXLC 1QJTA 4GGNA 2LV7A 5I2QA 1NCYA 2CCMA 4C0KA 4YRUA 1NX0A 2Y1NA 1B9AA 1C07A 2ZNDA 4XJKA 4MBEA 1PK0D 3ZWHA 2R2IA 1EG3A 4GBAA 2SASA 4MZJA 4NDDA 3TDIA 3WNXB 1DMOA 2BECA 1QS7A 2KHNA 1PULA 1RFJA 3LCPC 4N1FA 1QASA 4HREE 3RLZA 3ICBA 1NYAA 4PALA 4PHKA 5D69A 1CLBA 3SJSA 1LVCD 1XFZO 2KAYA 3FWBA 1G33A 1NUBA 3TDUA 1XYDA 5AERA 4QJ5B 4ICBA 4OCIA 1QX7A 2BBMA 4FQOA 2ZRSA 3D10A 2BL0C 2KAVA 1EG4A 1CFPA 2NZ0A 1K9KA 3I5FC 1Y1AA 1TCOB 3KPXA 4C0LA 3VRRA 1XFWO 4CPVA 2LM5A 1S6IA 1KSOA 3A4UB 3GOFA 1TTXA 5G08A 1S6CA 1IJ5A 1J55A 2M0RA 1J7QA 2PASA 2M1KB 1NCXA 2M97A 2AMIA 3O6BA 1SCMC 2M9GA 5BPJA 1CMFA 1IQ3A 2MA2A 3PN7C 1AJ5A 1L2OC 2L98A 3NSOA 1JSAA 1JF0A 3BUOB 5AFPA 1A29A 5DKNA 2WCEA 2BCBA 3A8RA 3BUNB 1BR4B 1NPQA 2LE9B 1XFVO 2MHHA 1M45A 4PE7A 1K9UA 4Q04A 1MF8B 1S36A 5CSIA 2O60A 1TCFA 1UHNA 3CR2A 3IQQA 1OOJA 1F4QA 1TNPA 1OZOA 1LA0A 4YGBB 3PFVA 5I2OA 2V53A 1RROA 3QRXA 4GGFA 4NDCA 3GK4X 4M2PA 1RJVA 3SG3A 1TOPA 4ZCUA 3DF0A 4FTGA 4MRYA 4MVFA 3CZTX 1ZFSA 5HKYA 3AAKA 4C0JA 1OMRA 2BBNA 3DVJA 3LK1A 4PCWA 1RWYA 3EK7A 1H4BA 1H8BA 4MSPA 1N0YA 1S6JA 2M7NA 3D0YB 4OVNF 2HF5A 3M0WA 4MRXA 3SG7A 2F2OA 2LP3A 1CFFA 4MEWA 4ORAB 1ZOTB 1XFUO 1J1DA 2MLFC 3SG4A 2LAPA 4R1EA 4AQJA 1IRJA 2JXCA 5B8IB 5KU1A 1B8RA 1PALA 3JVTB 2D8NA 2ZRTA 1CFCA 3PSRA 1PVAA 3D0YA 1CTRA 4M2QA 3I5IC 4AQIA 1OQPA 1Y0VH 5HKZA 3EK4A 2EGDA 2HETA 3SIBA 1NP8A 1L7ZA 1OMDA 1S5GZ 5PALA 4OV2A 1NX3A 2I18A 1B47A 2EC6B 3H4SE 2K61A 1YRTB 2GV5A 2KFGA 1S5GY 2LLTA 4BY5A
chains in the Genus database with same CATH superfamily
3I5HC 2TN4A 2LVIA 1UHHA 5AXIA 4PE4A 2CNPA 2LP2A 2KFFA 2WCFA 1F54A 1XO5A 1CDNA 2K2AA 2WC5A 5HKWA 1WRKA 1QWVA 1ORGA 2OTGC 2ZN9A 2LVKA 4GAOA 1TNWA 1J1EA 4MZLA 4DIRA 2LMTA 2LVJA 1IQ5A 1CNPA 1AUIB 2JNXA 3PLFB 1B7TY 3NXAA 4JQ0D 1YUSA 4WQ2A 1OOHA 1OSAA 1CDMA 1MWNA 1M46A 2CBLA 3D73A 3E3RA 2LLUA 4JKTA 4N5XA 5CSJA 3HCMA 3KO0A 4YGEB 1FI6A 1SW8A 2KGRA 5FYXA 1KK7Z 1T14A 2BCXA 1DJZA 2JOJA 3BQ3A 3GK1A 1KQMB 3R1VA 4HSZA 1BMOA 1M63B 3D74A 5EL2A 1KK7Y 1DJIA 2JRFA 4JD9A 5J3XA 1AK8A 1KSMA 4XYNA 1AVSA 2A4JA 1K94A 1KWOC 2H61C 3B6XA 3Q8IA 2FJUB 2HQ8A 3KHEA 2JZIA 5I94A 4KYNA 3PATA 1ZMZA 1U5IB 1Y1UA 2I7AA 2L5XB 3O4XA 2ZFDA 3OB1B 2LMVA 2F8PA 1OOFA 3JVTC 2QPTA 1G8IA 2KI4B 1YX7A 4FQTA 4OR9B 1W7IB 4WQ3A 3S0BA 1BG1A 4ORCB 2OS8B 1YUUA 2L51A 1B4CA 1PVBA 1FI5A 1NCZA 3NSLA 1S3PA 3CTNA 3WHUB 2BNXA 1GQMA 1DC1A 1GGZA 2K7DA 1PRWA 1U5IA 3KEVA 3PALA 1N65A 1YX8A 3FIAA 1KK8B 1UHKA 1NWDA 1WDCB 2EC6C 1UHJA 1SRAA 1CLMA 1ODBA 3EKJA 5ER5A 2MJWB 2PRUA 3I5GC 3OGNA 3R1PA 1WY9A 2JNFA 1YR5A 2KYCA 1F70A 5HLOA 3CR4X 1R6PA 3JTDC 2Y4QA 3CZ1A 1DTLA 3NSKA 3SS5A 3FWCA 2MRDA 1IWQA 3FS7A 2WNDA 1TN4A 1F4OA 1W9ZA 1RTP1 2LUCA 2KI6D 3CGAA 1QLSA 2KI6C 3HX4A 5CSNA 1CKKA 4D1EA 1FF1A 1Q80A 2NLNA 1SR6B 4MLWA 5IBWA 2JU0A 5TNCA 2WORA 1JC2A 4GNKB 4TNCA 2QEBA 3IVTA 3OB2B 3S0AA 2ZKMX 3TS5B 2M1UA 1V1FA 2F2PA 1GM0A 2LLSA 3QMEA 1C7VA 2O5GA 1BLQA 1J7OA 2MBXA 1KFUL 2JULA 1F71A 1DJHA 1IG5A 1C7WA 3SS4A 1B8LA 2QEVA 4YGAA 5AANA 2K2FA 1SKTA 2BE6A 1TRFA 2OPOA 2WCBA 1K2HA 2MLEC 4P2YB 3PM2A 1V1GA 3CABA 2LUXA 1BU3A 1J7RA 2BKIB 3DVEA 1JBAA 2KDHA 2JC2A 1RK9A 1OMVA 5CSFA 1TWOA 4ZCVA 4CFQA 4I5NB 2BCAA 1AP4A 4PDZA 2WOSA 4YGCB 2FCDA 1XK4A 1WRZA 4CFRA 2KI4C 3PM8A 3CZ2A 1Z4HA 1X02A 2GTEA 2WCLA 3S0GA 4HRHA 1D1OA 2M49B 3OHMB 1K90D 3FE8A 3UNWA 4YI9A 2GGZA 1SL9A 2QACA 3EVUA 5HLVA 1FW4A 1PSBA 2KYFA 3S0DA 3SS3A 3D76A 1TNQA 5AEQA 1DF0B 1WDCC 3L47A 4DS7A 1CM1A 2CTNA 1OW4A 1IJ6A 4GGFC 4N1GA 1MXEA 2FCEA 2WCHA 1JUOA 3CZ0A 2K7BA 3O2PA 1A75B 4PT1A 1KCYA 3CDNA 1BT6A 1EJ3A 2JT0A 2JWWA 3EG5B 3OBVA 2M7LA 3VRQA 5DICA 4A4BA 1SBJA 3CWGA 1ALVA 2ISDA 2JT8A 4DRWA 2LC5A 1KFUS 2AUCA 4USLA 1QX2A 4MZKA 4UPGA 1SCMB 1B7TZ 3LLEA 3OP0A 1DF0A 3DVKA 2PQLA 2VRGA 3DVMA 3PN7B 4PE1A 2KLDA 4P5OE 4CIDA 1E8AA 1K8UA 3B86A 3L4AA 4DCKA 2E6WA 2Y1MA 4I5JA 1A75A 3VROA 5HYDA 1KQVA 2F33A 1IGVA 5DKRA 2WC8A 3TS5C 1MHOA 1CDPA 1JF2A 1QXPA 1ZUZA 2CT9A 3LL8B 4I5KA 1YURA 1K95A 1QVIZ 3GK2A 3KF9A 1F8HA 1K96A 1XA5A 2H2KA 1IIOA 1SCVA 3BUXB 1XK4C 1QATA 4A4CA 2M29A 2JT3A 1QVIY 2KSPA 2L50A 2Q4UA 1Y6WA 2Q91A 3BUWB 4GFTA 3K1EA 1MR8A 3SG6A 1SMGA 2B1UA 1A4PA 1EL4A 3ZNIA 1FPWA 5GQQC 1NX1A 3WHTB 2COLB 2KAXA 1QLKA 1UUSA 3SG2A 1IH0A 3AKAA 3BOWB 1S26D 1OE9B 1YUTA 2SCPA 4WRIA 1C3YA 4CLNA 2G9BA 4PHMA 2K0JA 2DOQA 3AAJA 1OOGA 2GGMA 5K89A 1DT7B 1DJXA 4MN0A 1J7PA 1BODA 1TNXA 1EH2A 1YVLA 5JJGA 2KQYA 2KNEA 3IQOA 1XFYO 5CPVA 1GJYA 1UWOA 1UHIA 3CLNA 3DY9A 3CR5X 2AAOA 4PE0A 1RECA 2F3ZA 1SNLA 2ERBA 2I2RE 3BXKA 3BOWA 5I8NA 1TIZA 3OX6A 1LKJA 4GPLB 1BJFA 3EK8A 3TUYB 3F45A 1M39A 2NXQA 2LNKA 2ZNEA 1AHRA 2BKHB 1PSRA 3BFAA 3EVRA 2L5YA 3WXAA 4INXA 1QIVA 2L4HA 1CM4A 3I5IB 1YVHA 2K8MB 1K93D 3CS1A 1NIWA 1F55A 1G4YR 1Y1XA 3TDZA 1DEKA 1UURA 1TUJA 1XVJA 1DJYA 1QIWA 1ALWA 2ZN8A 3VRPA 3BUMB 2LMUA 1VRKA 1NX2A 2PSRA 5DKQA 1CMGA 1W7JB 2JXLA 1QTXA 1DJGA 1FBVA 1A03A 1QV1A 1QV0A 5F6TA 3I5HB 2BE4A 3DF0B 3B7AA 5KTYA 2HQWA 2M3WA 4U8DA 3NHTA 1CFDA 2EHBA 1S1EA 4F0ZB 2NCPA 2PALA 1XFXO 3RZSA 3MSEB 1K9PA 2MAZA 4OZDA 1BR1B 1KQMC 2JQ6A 2KFHA 3SIAA 4DUQA 2FOTA 2OTGB 1Z2CB 2P71A 3EVVA 4AOMA 1LINA 4GUKA 1IKUA 1AJ4A 4M2OA 1BF5A 2KBMA 1GGWA 2KGBC 2E30A 1DGUA 3LK0A 5FI6A 1M31A 4YI8A 3R72A 4PHJA 2JPTA 3AKBA 4YGDB 1KFXL 1YTZC 1NSHA 2JTTA 1SPYA 4QJ3B 2H8VA 1LA3A 1SK6D 1XFRA 5FI7A 3DD4A 3TZ1A 1B8CA 2OS8C 2P6BB 4ETOA 2L4IA 3S0EA 4ORBB 5D3OA 2RGIA 1WRLA 3SG5A 2BAPA 1OOIX 2M8UA 3NGVA 1DJWA 2LCPA 4NQGA 4OKHA 2KOTA 1QX5B 2BL0B 5D7FA 1R2UA 2NCOA 3I5FB 1KWOB 1B1GA 3OX5A 2QEOA 1KK8C 1CLLA 1MUXA 2IS9A 2I94A 4HRGA 3TUYC 5I2LA 1LXFC 5KSZA 3VRNA 1P28A 3O4YA 4IL1A 4E68A 1WLMA 2KBIA 1N2DA 5JOLA 2K7CA 3CYZA 2JTZA 2CXJA 2LANA 2G2BA 1UP5A 1OZSA 1SL8A 2LHLA 1SY9A 4YBHB 4BY4A 1YRUB 1HT9A 2H61A 4I5LB 3RM1A 3BYAA 3EKHA 1LS8A 4NDBA 1L2OB 1DGVA 1JFKA 2KQ6A 1HQVA 5ER4X 4QJ4B 3DZTA 3NSIA 2K7OA 2L2EA 1JWDA 2PVBA 1A2XA 4L9MA 3UO9A 1SR6C 1BOCA 2PMYA 2L2CA 1CB1A 1DVIA 3BJHA 2F3YA 3IF7A 4JWQA 2L0PA 3C1VA 4IJ7A 3I5GB 1KFXS 2HPSA 4XJKB 3O78A 1CDLA 4PHNA 1WLZA 2LVVA 2KLEA 1EXRA 3JTDB 3VGOA 3K21A 2Y5IA 2LHIA 4JPZB 1JFJA 1MQ1A 1SL7A 1SYMA 1ZACA 1MXLC 1QJTA 4GGNA 5HL1A 3S0FA 2LV7A 5I2QA 3R1OA 1NCYA 2CCMA 4C0KA 4YRUA 1NX0A 2Y1NA 3PJIA 1B9AA 3L4LA 1C07A 2ZNDA 4XJKA 4MBEA 1PK0D 3ZWHA 2R2IA 1EG3A 2JPOA 2SASA 4GBAA 4MZJA 4NDDA 3TDIA 3WNXB 1DMOA 2BECA 1QS7A 2KHNA 1PULA 2QDIA 1RFJA 3LCPC 4N1FA 1QASA 4HREE 3RLZA 3ICBA 1NYAA 4PALA 4PHKA 5D69A 1CLBA 3SJSA 1LVCD 1SSEB 1XFZO 2KAYA 3FWBA 1G33A 1NUBA 3TDUA 1XYDA 5AERA 4QJ5B 4ICBA 4OCIA 1QX7A 2BBMA 4FQOA 2ZRSA 2K60A 3D10A 2BL0C 2KAVA 1EG4A 1CFPA 2NZ0A 1K9KA 3I5FC 3B87A 1Y1AA 2WC6A 1TCOB 3KPXA 3VB1A 3VRRA 4C0LA 2PYQA 1XFWO 4CPVA 1C3ZA 2LM5A 1S6IA 1KSOA 2WCJA 2KPHA 3A4UB 3D75A 3GOFA 1TTXA 4INWA 1S6CA 1IJ5A 1J55A 2M0RA 2WCMA 5G08A 1J7QA 2PASA 2M1KB 1NCXA 2M97A 2AMIA 3D78A 3O6BA 1SCMC 2M9GA 5BPJA 1CMFA 1IQ3A 2MA2A 3PN7C 1AJ5A 1L2OC 2L98A 3NSOA 2FJYA 1JSAA 1JF0A 3BUOB 5AFPA 1A29A 5DKNA 2WCEA 2BCBA 3A8RA 3BUNB 3N7HA 1BR4B 1NPQA 2LE9B 3V2LA 1XFVO 2MHHA 1M45A 4PE7A 1K9UA 3NHIA 4Q04A 3FE6A 1MF8B 1S36A 5CSIA 2O60A 1TCFA 1UHNA 3CR2A 3IQQA 1OOJA 1F4QA 1TNPA 1OZOA 1LA0A 2P70A 4YGBB 2WCKA 3BFBA 3DYEA 3PFVA 5I2OA 1TUZA 2YGUA 2V53A 1DELA 1RROA 3QRXA 2QEHA 4GGFA 4NDCA 3GK4X 4M2PA 1RJVA 3SG3A 1TOPA 4ZCUA 3DF0A 4FTGA 4MRYA 4MVFA 3DXLA 3CZTX 1DQEA 1ZFSA 5HKYA 3AAKA 4C0JA 1OMRA 2BBNA 3DVJA 3LK1A 4PCWA 1RWYA 3EK7A 1H4BA 1H8BA 4MSPA 1N0YA 1S6JA 2M7NA 3D0YB 4OVNF 2HF5A 3M0WA 4MRXA 3SG7A 3FE9A 2F2OA 2LP3A 1CFFA 4MEWA 4ORAB 1ZOTB 1XFUO 1J1DA 2MLFC 3SG4A 2LAPA 4R1EA 4AQJA 1IRJA 2JXCA 5B8IB 5KU1A 1B8RA 5FI2A 1PALA 3JVTB 2D8NA 2ZRTA 3BFHA 1CFCA 3PSRA 1PVAA 3D0YA 1CTRA 4M2QA 3I5IC 4AQIA 3D77A 1OQPA 1Y0VH 5HKZA 3EK4A 2EGDA 2HETA 3SIBA 1NP8A 1L7ZA 1OMDA 1S5GZ 5PALA 3B88A 4OV2A 1NX3A 2I18A 1B47A 2EC6B 3H4SE 2K61A 1YRTB 2GV5A 2KFGA 4F7FA 1S5GY 2LLTA 4BY5A
chains in the Genus database with same CATH topology
3I5HC 2TN4A 2LVIA 1UHHA 5AXIA 4PE4A 2CNPA 2LP2A 2KFFA 2WCFA 1F54A 1XO5A 1CDNA 2K2AA 5HKWA 1WRKA 2OTGC 2ZN9A 2LVKA 4GAOA 1TNWA 1J1EA 4MZLA 4DIRA 2LMTA 2LVJA 1IQ5A 1CNPA 1AUIB 2JNXA 3PLFB 1B7TY 3NXAA 4JQ0D 1YUSA 4WQ2A 1OSAA 1CDMA 1MWNA 1M46A 2CBLA 3E3RA 2LLUA 4N5XA 5CSJA 3HCMA 3KO0A 4YGEB 1FI6A 1SW8A 2KGRA 5FYXA 1KK7Z 2BCXA 1DJZA 2JOJA 3BQ3A 3GK1A 1KQMB 4HSZA 1BMOA 1M63B 1KK7Y 1DJIA 2JRFA 5J3XA 1AK8A 1KSMA 4XYNA 1AVSA 2A4JA 1K94A 1KWOC 2H61C 2FJUB 2HQ8A 3KHEA 2JZIA 3PATA 1ZMZA 1U5IB 1Y1UA 2I7AA 2L5XB 3OB1B 2ZFDA 2LMVA 2F8PA 3JVTC 2QPTA 1G8IA 2KI4B 1YX7A 4OR9B 4WQ3A 1W7IB 1BG1A 4ORCB 2OS8B 1YUUA 2L51A 1B4CA 1PVBA 1FI5A 1NCZA 3NSLA 1S3PA 3CTNA 3WHUB 1GQMA 1GGZA 2K7DA 1PRWA 1U5IA 3KEVA 3PALA 1N65A 1YX8A 3FIAA 1KK8B 1UHKA 1NWDA 1WDCB 2EC6C 1UHJA 1SRAA 1CLMA 1ODBA 3EKJA 5ER5A 2MJWB 2PRUA 3I5GC 1WY9A 2JNFA 1YR5A 2KYCA 1F70A 5HLOA 3CR4X 1R6PA 3JTDC 2Y4QA 1DTLA 3NSKA 3FWCA 2MRDA 1IWQA 3FS7A 2WNDA 1TN4A 1F4OA 1RTP1 2LUCA 2KI6D 3CGAA 1QLSA 2KI6C 3HX4A 5CSNA 1CKKA 4D1EA 1FF1A 1Q80A 2NLNA 1SR6B 4MLWA 5IBWA 2JU0A 5TNCA 2WORA 1JC2A 4GNKB 4TNCA 3OB2B 2ZKMX 3TS5B 2M1UA 1V1FA 2F2PA 2LLSA 1C7VA 2O5GA 1BLQA 1J7OA 2MBXA 1KFUL 2JULA 1F71A 1DJHA 1IG5A 1C7WA 1B8LA 4YGAA 5AANA 2K2FA 1SKTA 2BE6A 1TRFA 2OPOA 2WCBA 1K2HA 2MLEC 4P2YB 1V1GA 2LUXA 1BU3A 2BKIB 1J7RA 3DVEA 1JBAA 2KDHA 2JC2A 1RK9A 1OMVA 5CSFA 4CFQA 4ZCVA 4I5NB 2BCAA 1AP4A 4PDZA 2WOSA 4YGCB 2FCDA 1XK4A 1WRZA 4CFRA 2KI4C 3PM8A 1X02A 4HRHA 1D1OA 2M49B 3OHMB 1K90D 4YI9A 2GGZA 1SL9A 2QACA 3EVUA 5HLVA 1FW4A 1PSBA 2KYFA 5AEQA 1TNQA 4DS7A 1DF0B 1WDCC 1CM1A 2CTNA 1IJ6A 4GGFC 4N1GA 1MXEA 2FCEA 1JUOA 2K7BA 3O2PA 1A75B 1KCYA 1BT6A 1EJ3A 2JT0A 2JWWA 2M7LA 3VRQA 4A4BA 1SBJA 3CWGA 1ALVA 2ISDA 2JT8A 4DRWA 2LC5A 1KFUS 2AUCA 4USLA 1QX2A 4MZKA 4UPGA 1SCMB 1B7TZ 3LLEA 3OP0A 1DF0A 3DVKA 2VRGA 3PN7B 3DVMA 4PE1A 4CIDA 4P5OE 1E8AA 1K8UA 4DCKA 2E6WA 2Y1MA 4I5JA 1A75A 3VROA 5HYDA 1KQVA 2F33A 1IGVA 5DKRA 2WC8A 3TS5C 1MHOA 1CDPA 1JF2A 1QXPA 1ZUZA 2CT9A 3LL8B 4I5KA 1YURA 1K95A 1QVIZ 3GK2A 3KF9A 1F8HA 1K96A 1XA5A 2H2KA 1SCVA 3BUXB 1XK4C 1QATA 4A4CA 2M29A 2JT3A 1QVIY 2KSPA 2L50A 2Q4UA 1Y6WA 2Q91A 3BUWB 4GFTA 3SG6A 1MR8A 1SMGA 2B1UA 1A4PA 1EL4A 3ZNIA 1FPWA 5GQQC 1NX1A 3WHTB 2COLB 2KAXA 1QLKA 1UUSA 3SG2A 1IH0A 3AKAA 3BOWB 1S26D 1OE9B 1YUTA 2SCPA 4WRIA 4CLNA 2G9BA 4PHMA 2K0JA 2DOQA 3AAJA 5K89A 2GGMA 1DT7B 1J7PA 1DJXA 4MN0A 1BODA 1TNXA 1EH2A 1YVLA 5JJGA 2KQYA 2KNEA 3IQOA 1XFYO 5CPVA 1GJYA 1UWOA 1UHIA 3CLNA 3CR5X 2AAOA 4PE0A 1RECA 2F3ZA 1SNLA 3BXKA 2I2RE 3BOWA 5I8NA 1TIZA 3OX6A 1LKJA 4GPLB 1BJFA 3EK8A 3TUYB 3F45A 1M39A 2NXQA 2LNKA 2ZNEA 1AHRA 2BKHB 1PSRA 3EVRA 3WXAA 1QIVA 2L4HA 1CM4A 3I5IB 1YVHA 2K8MB 1K93D 3CS1A 1NIWA 1F55A 1G4YR 1Y1XA 3TDZA 1UURA 1XVJA 1DJYA 1QIWA 1ALWA 2ZN8A 3VRPA 3BUMB 2LMUA 1VRKA 1NX2A 2PSRA 5DKQA 1CMGA 1W7JB 2JXLA 1QTXA 1DJGA 1FBVA 1A03A 1QV1A 1QV0A 5F6TA 3I5HB 2BE4A 3DF0B 5KTYA 2HQWA 2M3WA 4U8DA 1CFDA 2EHBA 1S1EA 4F0ZB 2NCPA 2PALA 1XFXO 3MSEB 1K9PA 2MAZA 1BR1B 1KQMC 2JQ6A 2KFHA 3SIAA 4DUQA 2FOTA 2OTGB 4AOMA 1IKUA 3EVVA 1LINA 4GUKA 1AJ4A 4M2OA 1BF5A 2KBMA 1GGWA 2KGBC 2E30A 1DGUA 3LK0A 1M31A 4YI8A 4PHJA 2JPTA 3AKBA 4YGDB 1KFXL 1YTZC 1NSHA 2JTTA 1SPYA 4QJ3B 1LA3A 1SK6D 3DD4A 3TZ1A 1B8CA 2OS8C 2P6BB 4ETOA 2L4IA 4ORBB 2RGIA 1WRLA 3SG5A 2M8UA 1DJWA 2LCPA 4NQGA 4OKHA 2KOTA 1QX5B 2BL0B 5D7FA 1R2UA 2NCOA 3I5FB 1KWOB 1B1GA 3OX5A 1KK8C 1CLLA 1MUXA 2IS9A 2I94A 4HRGA 3TUYC 5I2LA 1LXFC 5KSZA 3VRNA 4IL1A 3O4YA 4E68A 1WLMA 2KBIA 1N2DA 5JOLA 2K7CA 2JTZA 2CXJA 2LANA 2G2BA 1UP5A 1OZSA 1SL8A 2LHLA 1SY9A 4YBHB 4BY4A 1YRUB 1HT9A 2H61A 4I5LB 3RM1A 3BYAA 3EKHA 4NDBA 4QJ4B 1L2OB 1DGVA 1JFKA 2KQ6A 1HQVA 5ER4X 3NSIA 1JWDA 2K7OA 2L2EA 2PVBA 1A2XA 4L9MA 1SR6C 1BOCA 2PMYA 1CB1A 1DVIA 2F3YA 3IF7A 4JWQA 2L0PA 3C1VA 3I5GB 1KFXS 2HPSA 4XJKB 3O78A 1CDLA 4PHNA 1WLZA 2LVVA 1EXRA 3JTDB 3VGOA 3K21A 2Y5IA 2LHIA 4JPZB 1JFJA 1MQ1A 1SL7A 1SYMA 1ZACA 1MXLC 1QJTA 4GGNA 2LV7A 5I2QA 1NCYA 2CCMA 4C0KA 4YRUA 1NX0A 2Y1NA 1B9AA 1C07A 2ZNDA 4XJKA 4MBEA 1PK0D 3ZWHA 2R2IA 1EG3A 4GBAA 2SASA 4MZJA 4NDDA 3TDIA 3WNXB 1DMOA 2BECA 1QS7A 2KHNA 1PULA 1RFJA 3LCPC 4N1FA 1QASA 4HREE 3RLZA 3ICBA 1NYAA 4PALA 4PHKA 5D69A 1CLBA 3SJSA 1LVCD 1XFZO 2KAYA 3FWBA 1G33A 1NUBA 3TDUA 1XYDA 5AERA 4QJ5B 4ICBA 4OCIA 1QX7A 2BBMA 4FQOA 2ZRSA 3D10A 2BL0C 2KAVA 1EG4A 1CFPA 2NZ0A 1K9KA 3I5FC 1Y1AA 1TCOB 3KPXA 4C0LA 3VRRA 1XFWO 4CPVA 2LM5A 1S6IA 1KSOA 3A4UB 3GOFA 1TTXA 5G08A 1S6CA 1IJ5A 1J55A 2M0RA 1J7QA 2PASA 2M1KB 1NCXA 2M97A 2AMIA 3O6BA 1SCMC 2M9GA 5BPJA 1CMFA 1IQ3A 2MA2A 3PN7C 1AJ5A 1L2OC 2L98A 3NSOA 1JSAA 1JF0A 3BUOB 5AFPA 1A29A 5DKNA 2WCEA 2BCBA 3A8RA 3BUNB 1BR4B 1NPQA 2LE9B 1XFVO 2MHHA 1M45A 4PE7A 1K9UA 4Q04A 1MF8B 1S36A 5CSIA 2O60A 1TCFA 1UHNA 3CR2A 3IQQA 1OOJA 1F4QA 1TNPA 1OZOA 1LA0A 4YGBB 3PFVA 5I2OA 2V53A 1RROA 3QRXA 4GGFA 4NDCA 3GK4X 4M2PA 1RJVA 3SG3A 1TOPA 4ZCUA 3DF0A 4FTGA 4MRYA 4MVFA 3CZTX 1ZFSA 5HKYA 3AAKA 4C0JA 1OMRA 2BBNA 3DVJA 3LK1A 4PCWA 1RWYA 3EK7A 1H4BA 1H8BA 4MSPA 1N0YA 1S6JA 2M7NA 3D0YB 4OVNF 2HF5A 3M0WA 4MRXA 3SG7A 2F2OA 2LP3A 1CFFA 4MEWA 4ORAB 1ZOTB 1XFUO 1J1DA 2MLFC 3SG4A 2LAPA 4R1EA 4AQJA 1IRJA 2JXCA 5B8IB 5KU1A 1B8RA 1PALA 3JVTB 2D8NA 2ZRTA 1CFCA 3PSRA 1PVAA 3D0YA 1CTRA 4M2QA 3I5IC 4AQIA 1OQPA 1Y0VH 5HKZA 3EK4A 2EGDA 2HETA 3SIBA 1NP8A 1L7ZA 1OMDA 1S5GZ 5PALA 4OV2A 1NX3A 2I18A 1B47A 2EC6B 3H4SE 2K61A 1YRTB 2GV5A 2KFGA 1S5GY 2LLTA 4BY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5H C;  2TN4 A;  2LVI A;  1UHH A;  5AXI A;  4PE4 A;  2CNP A;  2LP2 A;  2KFF A;  2WCF A;  1F54 A;  1XO5 A;  1CDN A;  2K2A A;  5HKW A;  1WRK A;  2OTG C;  2ZN9 A;  2LVK A;  4GAO A;  1TNW A;  1J1E A;  4MZL A;  4DIR A;  2LMT A;  2LVJ A;  1IQ5 A;  1CNP A;  1AUI B;  2JNX A;  3PLF B;  1B7T Y;  3NXA A;  4JQ0 D;  1YUS A;  4WQ2 A;  1OSA A;  1CDM A;  1MWN A;  1M46 A;  2CBL A;  3E3R A;  2LLU A;  4N5X A;  5CSJ A;  3HCM A;  3KO0 A;  4YGE B;  1FI6 A;  1SW8 A;  2KGR A;  5FYX A;  1KK7 Z;  2BCX A;  1DJZ A;  2JOJ A;  3BQ3 A;  3GK1 A;  1KQM B;  4HSZ A;  1BMO A;  1M63 B;  1KK7 Y;  1DJI A;  2JRF A;  5J3X A;  1AK8 A;  1KSM A;  4XYN A;  1AVS A;  2A4J A;  1K94 A;  1KWO C;  2H61 C;  2FJU B;  2HQ8 A;  3KHE A;  2JZI A;  3PAT A;  1ZMZ A;  1U5I B;  1Y1U A;  2I7A A;  2L5X B;  3OB1 B;  2ZFD A;  2LMV A;  2F8P A;  3JVT C;  2QPT A;  1G8I A;  2KI4 B;  1YX7 A;  4OR9 B;  4WQ3 A;  1W7I B;  1BG1 A;  4ORC B;  2OS8 B;  1YUU A;  2L51 A;  1B4C A;  1PVB A;  1FI5 A;  1NCZ A;  3NSL A;  1S3P A;  3CTN A;  3WHU B;  1GQM A;  1GGZ A;  2K7D A;  1PRW A;  1U5I A;  3KEV A;  3PAL A;  1N65 A;  1YX8 A;  3FIA A;  1KK8 B;  1UHK A;  1NWD A;  1WDC B;  2EC6 C;  1UHJ A;  1SRA A;  1CLM A;  1ODB A;  3EKJ A;  5ER5 A;  2MJW B;  2PRU A;  3I5G C;  1WY9 A;  2JNF A;  1YR5 A;  2KYC A;  1F70 A;  5HLO A;  3CR4 X;  1R6P A;  3JTD C;  2Y4Q A;  1DTL A;  3NSK A;  3FWC A;  2MRD A;  1IWQ A;  3FS7 A;  2WND A;  1TN4 A;  1F4O A;  1RTP 1;  2LUC A;  2KI6 D;  3CGA A;  1QLS A;  2KI6 C;  3HX4 A;  5CSN A;  1CKK A;  4D1E A;  1FF1 A;  1Q80 A;  2NLN A;  1SR6 B;  4MLW A;  5IBW A;  2JU0 A;  5TNC A;  2WOR A;  1JC2 A;  4GNK B;  4TNC A;  3OB2 B;  2ZKM X;  3TS5 B;  2M1U A;  1V1F A;  2F2P A;  2LLS A;  1C7V A;  2O5G A;  1BLQ A;  1J7O A;  2MBX A;  1KFU L;  2JUL A;  1F71 A;  1DJH A;  1IG5 A;  1C7W A;  1B8L A;  4YGA A;  5AAN A;  2K2F A;  1SKT A;  2BE6 A;  1TRF A;  2OPO A;  2WCB A;  1K2H A;  2MLE C;  4P2Y B;  1V1G A;  2LUX A;  1BU3 A;  2BKI B;  1J7R A;  3DVE A;  1JBA A;  2KDH A;  2JC2 A;  1RK9 A;  1OMV A;  5CSF A;  4CFQ A;  4ZCV A;  4I5N B;  2BCA A;  1AP4 A;  4PDZ A;  2WOS A;  4YGC B;  2FCD A;  1XK4 A;  1WRZ A;  4CFR A;  2KI4 C;  3PM8 A;  1X02 A;  4HRH A;  1D1O A;  2M49 B;  3OHM B;  1K90 D;  4YI9 A;  2GGZ A;  1SL9 A;  2QAC A;  3EVU A;  5HLV A;  1FW4 A;  1PSB A;  2KYF A;  5AEQ A;  1TNQ A;  4DS7 A;  1DF0 B;  1WDC C;  1CM1 A;  2CTN A;  1IJ6 A;  4GGF C;  4N1G A;  1MXE A;  2FCE A;  1JUO A;  2K7B A;  3O2P A;  1A75 B;  1KCY A;  1BT6 A;  1EJ3 A;  2JT0 A;  2JWW A;  2M7L A;  3VRQ A;  4A4B A;  1SBJ A;  3CWG A;  1ALV A;  2ISD A;  2JT8 A;  4DRW A;  2LC5 A;  1KFU S;  2AUC A;  4USL A;  1QX2 A;  4MZK A;  4UPG A;  1SCM B;  1B7T Z;  3LLE A;  3OP0 A;  1DF0 A;  3DVK A;  2VRG A;  3PN7 B;  3DVM A;  4PE1 A;  4CID A;  4P5O E;  1E8A A;  1K8U A;  4DCK A;  2E6W A;  2Y1M A;  4I5J A;  1A75 A;  3VRO A;  5HYD A;  1KQV A;  2F33 A;  1IGV A;  5DKR A;  2WC8 A;  3TS5 C;  1MHO A;  1CDP A;  1JF2 A;  1QXP A;  1ZUZ A;  2CT9 A;  3LL8 B;  4I5K A;  1YUR A;  1K95 A;  1QVI Z;  3GK2 A;  3KF9 A;  1F8H A;  1K96 A;  1XA5 A;  2H2K A;  1SCV A;  3BUX B;  1XK4 C;  1QAT A;  4A4C A;  2M29 A;  2JT3 A;  1QVI Y;  2KSP A;  2L50 A;  2Q4U A;  1Y6W A;  2Q91 A;  3BUW B;  4GFT A;  3SG6 A;  1MR8 A;  1SMG A;  2B1U A;  1A4P A;  1EL4 A;  3ZNI A;  1FPW A;  5GQQ C;  1NX1 A;  3WHT B;  2COL B;  2KAX A;  1QLK A;  1UUS A;  3SG2 A;  1IH0 A;  3AKA A;  3BOW B;  1S26 D;  1OE9 B;  1YUT A;  2SCP A;  4WRI A;  4CLN A;  2G9B A;  4PHM A;  2K0J A;  2DOQ A;  3AAJ A;  5K89 A;  2GGM A;  1DT7 B;  1J7P A;  1DJX A;  4MN0 A;  1BOD A;  1TNX A;  1EH2 A;  1YVL A;  5JJG A;  2KQY A;  2KNE A;  3IQO A;  1XFY O;  5CPV A;  1GJY A;  1UWO A;  1UHI A;  3CLN A;  3CR5 X;  2AAO A;  4PE0 A;  1REC A;  2F3Z A;  1SNL A;  3BXK A;  2I2R E;  3BOW A;  5I8N A;  1TIZ A;  3OX6 A;  1LKJ A;  4GPL B;  1BJF A;  3EK8 A;  3TUY B;  3F45 A;  1M39 A;  2NXQ A;  2LNK A;  2ZNE A;  1AHR A;  2BKH B;  1PSR A;  3EVR A;  3WXA A;  1QIV A;  2L4H A;  1CM4 A;  3I5I B;  1YVH A;  2K8M B;  1K93 D;  3CS1 A;  1NIW A;  1F55 A;  1G4Y R;  1Y1X A;  3TDZ A;  1UUR A;  1XVJ A;  1DJY A;  1QIW A;  1ALW A;  2ZN8 A;  3VRP A;  3BUM B;  2LMU A;  1VRK A;  1NX2 A;  2PSR A;  5DKQ A;  1CMG A;  1W7J B;  2JXL A;  1QTX A;  1DJG A;  1FBV A;  1A03 A;  1QV1 A;  1QV0 A;  5F6T A;  3I5H B;  2BE4 A;  3DF0 B;  5KTY A;  2HQW A;  2M3W A;  4U8D A;  1CFD A;  2EHB A;  1S1E A;  4F0Z B;  2NCP A;  2PAL A;  1XFX O;  3MSE B;  1K9P A;  2MAZ A;  1BR1 B;  1KQM C;  2JQ6 A;  2KFH A;  3SIA A;  4DUQ A;  2FOT A;  2OTG B;  4AOM A;  1IKU A;  3EVV A;  1LIN A;  4GUK A;  1AJ4 A;  4M2O A;  1BF5 A;  2KBM A;  1GGW A;  2KGB C;  2E30 A;  1DGU A;  3LK0 A;  1M31 A;  4YI8 A;  4PHJ A;  2JPT A;  3AKB A;  4YGD B;  1KFX L;  1YTZ C;  1NSH A;  2JTT A;  1SPY A;  4QJ3 B;  1LA3 A;  1SK6 D;  3DD4 A;  3TZ1 A;  1B8C A;  2OS8 C;  2P6B B;  4ETO A;  2L4I A;  4ORB B;  2RGI A;  1WRL A;  3SG5 A;  2M8U A;  1DJW A;  2LCP A;  4NQG A;  4OKH A;  2KOT A;  1QX5 B;  2BL0 B;  5D7F A;  1R2U A;  2NCO A;  3I5F B;  1KWO B;  1B1G A;  3OX5 A;  1KK8 C;  1CLL A;  1MUX A;  2IS9 A;  2I94 A;  4HRG A;  3TUY C;  5I2L A;  1LXF C;  5KSZ A;  3VRN A;  4IL1 A;  3O4Y A;  4E68 A;  1WLM A;  2KBI A;  1N2D A;  5JOL A;  2K7C A;  2JTZ A;  2CXJ A;  2LAN A;  2G2B A;  1UP5 A;  1OZS A;  1SL8 A;  2LHL A;  1SY9 A;  4YBH B;  4BY4 A;  1YRU B;  1HT9 A;  2H61 A;  4I5L B;  3RM1 A;  3BYA A;  3EKH A;  4NDB A;  4QJ4 B;  1L2O B;  1DGV A;  1JFK A;  2KQ6 A;  1HQV A;  5ER4 X;  3NSI A;  1JWD A;  2K7O A;  2L2E A;  2PVB A;  1A2X A;  4L9M A;  1SR6 C;  1BOC A;  2PMY A;  1CB1 A;  1DVI A;  2F3Y A;  3IF7 A;  4JWQ A;  2L0P A;  3C1V A;  3I5G B;  1KFX S;  2HPS A;  4XJK B;  3O78 A;  1CDL A;  4PHN A;  1WLZ A;  2LVV A;  1EXR A;  3JTD B;  3VGO A;  3K21 A;  2Y5I A;  2LHI A;  4JPZ B;  1JFJ A;  1MQ1 A;  1SL7 A;  1SYM A;  1ZAC A;  1MXL C;  1QJT A;  4GGN A;  2LV7 A;  5I2Q A;  1NCY A;  2CCM A;  4C0K A;  4YRU A;  1NX0 A;  2Y1N A;  1B9A A;  1C07 A;  2ZND A;  4XJK A;  4MBE A;  1PK0 D;  3ZWH A;  2R2I A;  1EG3 A;  4GBA A;  2SAS A;  4MZJ A;  4NDD A;  3TDI A;  3WNX B;  1DMO A;  2BEC A;  1QS7 A;  2KHN A;  1PUL A;  1RFJ A;  3LCP C;  4N1F A;  1QAS A;  4HRE E;  3RLZ A;  3ICB A;  1NYA A;  4PAL A;  4PHK A;  5D69 A;  1CLB A;  3SJS A;  1LVC D;  1XFZ O;  2KAY A;  3FWB A;  1G33 A;  1NUB A;  3TDU A;  1XYD A;  5AER A;  4QJ5 B;  4ICB A;  4OCI A;  1QX7 A;  2BBM A;  4FQO A;  2ZRS A;  3D10 A;  2BL0 C;  2KAV A;  1EG4 A;  1CFP A;  2NZ0 A;  1K9K A;  3I5F C;  1Y1A A;  1TCO B;  3KPX A;  4C0L A;  3VRR A;  1XFW O;  4CPV A;  2LM5 A;  1S6I A;  1KSO A;  3A4U B;  3GOF A;  1TTX A;  5G08 A;  1S6C A;  1IJ5 A;  1J55 A;  2M0R A;  1J7Q A;  2PAS A;  2M1K B;  1NCX A;  2M97 A;  2AMI A;  3O6B A;  1SCM C;  2M9G A;  5BPJ A;  1CMF A;  1IQ3 A;  2MA2 A;  3PN7 C;  1AJ5 A;  1L2O C;  2L98 A;  3NSO A;  1JSA A;  1JF0 A;  3BUO B;  5AFP A;  1A29 A;  5DKN A;  2WCE A;  2BCB A;  3A8R A;  3BUN B;  1BR4 B;  1NPQ A;  2LE9 B;  1XFV O;  2MHH A;  1M45 A;  4PE7 A;  1K9U A;  4Q04 A;  1MF8 B;  1S36 A;  5CSI A;  2O60 A;  1TCF A;  1UHN A;  3CR2 A;  3IQQ A;  1OOJ A;  1F4Q A;  1TNP A;  1OZO A;  1LA0 A;  4YGB B;  3PFV A;  5I2O A;  2V53 A;  1RRO A;  3QRX A;  4GGF A;  4NDC A;  3GK4 X;  4M2P A;  1RJV A;  3SG3 A;  1TOP A;  4ZCU A;  3DF0 A;  4FTG A;  4MRY A;  4MVF A;  3CZT X;  1ZFS A;  5HKY A;  3AAK A;  4C0J A;  1OMR A;  2BBN A;  3DVJ A;  3LK1 A;  4PCW A;  1RWY A;  3EK7 A;  1H4B A;  1H8B A;  4MSP A;  1N0Y A;  1S6J A;  2M7N A;  3D0Y B;  4OVN F;  2HF5 A;  3M0W A;  4MRX A;  3SG7 A;  2F2O A;  2LP3 A;  1CFF A;  4MEW A;  4ORA B;  1ZOT B;  1XFU O;  1J1D A;  2MLF C;  3SG4 A;  2LAP A;  4R1E A;  4AQJ A;  1IRJ A;  2JXC A;  5B8I B;  5KU1 A;  1B8R A;  1PAL A;  3JVT B;  2D8N A;  2ZRT A;  1CFC A;  3PSR A;  1PVA A;  3D0Y A;  1CTR A;  4M2Q A;  3I5I C;  4AQI A;  1OQP A;  1Y0V H;  5HKZ A;  3EK4 A;  2EGD A;  2HET A;  3SIB A;  1NP8 A;  1L7Z A;  1OMD A;  1S5G Z;  5PAL A;  4OV2 A;  1NX3 A;  2I18 A;  1B47 A;  2EC6 B;  3H4S E;  2K61 A;  1YRT B;  2GV5 A;  2KFG A;  1S5G Y;  2LLT A;  4BY5 A; 
#chains in the Genus database with same CATH topology
 3I5H C;  2TN4 A;  2LVI A;  1UHH A;  5AXI A;  4PE4 A;  2CNP A;  2LP2 A;  2KFF A;  2WCF A;  1F54 A;  1XO5 A;  1CDN A;  2K2A A;  2WC5 A;  5HKW A;  1WRK A;  1QWV A;  1ORG A;  2OTG C;  2ZN9 A;  2LVK A;  4GAO A;  1TNW A;  1J1E A;  4MZL A;  4DIR A;  2LMT A;  2LVJ A;  1IQ5 A;  1CNP A;  1AUI B;  2JNX A;  3PLF B;  1B7T Y;  3NXA A;  4JQ0 D;  1YUS A;  4WQ2 A;  1OOH A;  1OSA A;  1CDM A;  1MWN A;  1M46 A;  2CBL A;  3D73 A;  3E3R A;  2LLU A;  4JKT A;  4N5X A;  5CSJ A;  3HCM A;  3KO0 A;  4YGE B;  1FI6 A;  1SW8 A;  2KGR A;  5FYX A;  1KK7 Z;  1T14 A;  2BCX A;  1DJZ A;  2JOJ A;  3BQ3 A;  3GK1 A;  1KQM B;  3R1V A;  4HSZ A;  1BMO A;  1M63 B;  3D74 A;  5EL2 A;  1KK7 Y;  1DJI A;  2JRF A;  4JD9 A;  5J3X A;  1AK8 A;  1KSM A;  4XYN A;  1AVS A;  2A4J A;  1K94 A;  1KWO C;  2H61 C;  3B6X A;  3Q8I A;  2FJU B;  2HQ8 A;  3KHE A;  2JZI A;  5I94 A;  4KYN A;  3PAT A;  1ZMZ A;  1U5I B;  1Y1U A;  2I7A A;  2L5X B;  3O4X A;  2ZFD A;  3OB1 B;  2LMV A;  2F8P A;  1OOF A;  3JVT C;  2QPT A;  1G8I A;  2KI4 B;  1YX7 A;  4FQT A;  4OR9 B;  1W7I B;  4WQ3 A;  3S0B A;  1BG1 A;  4ORC B;  2OS8 B;  1YUU A;  2L51 A;  1B4C A;  1PVB A;  1FI5 A;  1NCZ A;  3NSL A;  1S3P A;  3CTN A;  3WHU B;  2BNX A;  1GQM A;  1DC1 A;  1GGZ A;  2K7D A;  1PRW A;  1U5I A;  3KEV A;  3PAL A;  1N65 A;  1YX8 A;  3FIA A;  1KK8 B;  1UHK A;  1NWD A;  1WDC B;  2EC6 C;  1UHJ A;  1SRA A;  1CLM A;  1ODB A;  3EKJ A;  5ER5 A;  2MJW B;  2PRU A;  3I5G C;  3OGN A;  3R1P A;  1WY9 A;  2JNF A;  1YR5 A;  2KYC A;  1F70 A;  5HLO A;  3CR4 X;  1R6P A;  3JTD C;  2Y4Q A;  3CZ1 A;  1DTL A;  3NSK A;  3SS5 A;  3FWC A;  2MRD A;  1IWQ A;  3FS7 A;  2WND A;  1TN4 A;  1F4O A;  1W9Z A;  1RTP 1;  2LUC A;  2KI6 D;  3CGA A;  1QLS A;  2KI6 C;  3HX4 A;  5CSN A;  1CKK A;  4D1E A;  1FF1 A;  1Q80 A;  2NLN A;  1SR6 B;  4MLW A;  5IBW A;  2JU0 A;  5TNC A;  2WOR A;  1JC2 A;  4GNK B;  4TNC A;  2QEB A;  3IVT A;  3OB2 B;  3S0A A;  2ZKM X;  3TS5 B;  2M1U A;  1V1F A;  2F2P A;  1GM0 A;  2LLS A;  3QME A;  1C7V A;  2O5G A;  1BLQ A;  1J7O A;  2MBX A;  1KFU L;  2JUL A;  1F71 A;  1DJH A;  1IG5 A;  1C7W A;  3SS4 A;  1B8L A;  2QEV A;  4YGA A;  5AAN A;  2K2F A;  1SKT A;  2BE6 A;  1TRF A;  2OPO A;  2WCB A;  1K2H A;  2MLE C;  4P2Y B;  3PM2 A;  1V1G A;  3CAB A;  2LUX A;  1BU3 A;  1J7R A;  2BKI B;  3DVE A;  1JBA A;  2KDH A;  2JC2 A;  1RK9 A;  1OMV A;  5CSF A;  1TWO A;  4ZCV A;  4CFQ A;  4I5N B;  2BCA A;  1AP4 A;  4PDZ A;  2WOS A;  4YGC B;  2FCD A;  1XK4 A;  1WRZ A;  4CFR A;  2KI4 C;  3PM8 A;  3CZ2 A;  1Z4H A;  1X02 A;  2GTE A;  2WCL A;  3S0G A;  4HRH A;  1D1O A;  2M49 B;  3OHM B;  1K90 D;  3FE8 A;  3UNW A;  4YI9 A;  2GGZ A;  1SL9 A;  2QAC A;  3EVU A;  5HLV A;  1FW4 A;  1PSB A;  2KYF A;  3S0D A;  3SS3 A;  3D76 A;  1TNQ A;  5AEQ A;  1DF0 B;  1WDC C;  3L47 A;  4DS7 A;  1CM1 A;  2CTN A;  1OW4 A;  1IJ6 A;  4GGF C;  4N1G A;  1MXE A;  2FCE A;  2WCH A;  1JUO A;  3CZ0 A;  2K7B A;  3O2P A;  1A75 B;  4PT1 A;  1KCY A;  3CDN A;  1BT6 A;  1EJ3 A;  2JT0 A;  2JWW A;  3EG5 B;  3OBV A;  2M7L A;  3VRQ A;  5DIC A;  4A4B A;  1SBJ A;  3CWG A;  1ALV A;  2ISD A;  2JT8 A;  4DRW A;  2LC5 A;  1KFU S;  2AUC A;  4USL A;  1QX2 A;  4MZK A;  4UPG A;  1SCM B;  1B7T Z;  3LLE A;  3OP0 A;  1DF0 A;  3DVK A;  2PQL A;  2VRG A;  3DVM A;  3PN7 B;  4PE1 A;  2KLD A;  4P5O E;  4CID A;  1E8A A;  1K8U A;  3B86 A;  3L4A A;  4DCK A;  2E6W A;  2Y1M A;  4I5J A;  1A75 A;  3VRO A;  5HYD A;  1KQV A;  2F33 A;  1IGV A;  5DKR A;  2WC8 A;  3TS5 C;  1MHO A;  1CDP A;  1JF2 A;  1QXP A;  1ZUZ A;  2CT9 A;  3LL8 B;  4I5K A;  1YUR A;  1K95 A;  1QVI Z;  3GK2 A;  3KF9 A;  1F8H A;  1K96 A;  1XA5 A;  2H2K A;  1IIO A;  1SCV A;  3BUX B;  1XK4 C;  1QAT A;  4A4C A;  2M29 A;  2JT3 A;  1QVI Y;  2KSP A;  2L50 A;  2Q4U A;  1Y6W A;  2Q91 A;  3BUW B;  4GFT A;  3K1E A;  1MR8 A;  3SG6 A;  1SMG A;  2B1U A;  1A4P A;  1EL4 A;  3ZNI A;  1FPW A;  5GQQ C;  1NX1 A;  3WHT B;  2COL B;  2KAX A;  1QLK A;  1UUS A;  3SG2 A;  1IH0 A;  3AKA A;  3BOW B;  1S26 D;  1OE9 B;  1YUT A;  2SCP A;  4WRI A;  1C3Y A;  4CLN A;  2G9B A;  4PHM A;  2K0J A;  2DOQ A;  3AAJ A;  1OOG A;  2GGM A;  5K89 A;  1DT7 B;  1DJX A;  4MN0 A;  1J7P A;  1BOD A;  1TNX A;  1EH2 A;  1YVL A;  5JJG A;  2KQY A;  2KNE A;  3IQO A;  1XFY O;  5CPV A;  1GJY A;  1UWO A;  1UHI A;  3CLN A;  3DY9 A;  3CR5 X;  2AAO A;  4PE0 A;  1REC A;  2F3Z A;  1SNL A;  2ERB A;  2I2R E;  3BXK A;  3BOW A;  5I8N A;  1TIZ A;  3OX6 A;  1LKJ A;  4GPL B;  1BJF A;  3EK8 A;  3TUY B;  3F45 A;  1M39 A;  2NXQ A;  2LNK A;  2ZNE A;  1AHR A;  2BKH B;  1PSR A;  3BFA A;  3EVR A;  2L5Y A;  3WXA A;  4INX A;  1QIV A;  2L4H A;  1CM4 A;  3I5I B;  1YVH A;  2K8M B;  1K93 D;  3CS1 A;  1NIW A;  1F55 A;  1G4Y R;  1Y1X A;  3TDZ A;  1DEK A;  1UUR A;  1TUJ A;  1XVJ A;  1DJY A;  1QIW A;  1ALW A;  2ZN8 A;  3VRP A;  3BUM B;  2LMU A;  1VRK A;  1NX2 A;  2PSR A;  5DKQ A;  1CMG A;  1W7J B;  2JXL A;  1QTX A;  1DJG A;  1FBV A;  1A03 A;  1QV1 A;  1QV0 A;  5F6T A;  3I5H B;  2BE4 A;  3DF0 B;  3B7A A;  5KTY A;  2HQW A;  2M3W A;  4U8D A;  3NHT A;  1CFD A;  2EHB A;  1S1E A;  4F0Z B;  2NCP A;  2PAL A;  1XFX O;  3RZS A;  3MSE B;  1K9P A;  2MAZ A;  4OZD A;  1BR1 B;  1KQM C;  2JQ6 A;  2KFH A;  3SIA A;  4DUQ A;  2FOT A;  2OTG B;  1Z2C B;  2P71 A;  3EVV A;  4AOM A;  1LIN A;  4GUK A;  1IKU A;  1AJ4 A;  4M2O A;  1BF5 A;  2KBM A;  1GGW A;  2KGB C;  2E30 A;  1DGU A;  3LK0 A;  5FI6 A;  1M31 A;  4YI8 A;  3R72 A;  4PHJ A;  2JPT A;  3AKB A;  4YGD B;  1KFX L;  1YTZ C;  1NSH A;  2JTT A;  1SPY A;  4QJ3 B;  2H8V A;  1LA3 A;  1SK6 D;  1XFR A;  5FI7 A;  3DD4 A;  3TZ1 A;  1B8C A;  2OS8 C;  2P6B B;  4ETO A;  2L4I A;  3S0E A;  4ORB B;  5D3O A;  2RGI A;  1WRL A;  3SG5 A;  2BAP A;  1OOI X;  2M8U A;  3NGV A;  1DJW A;  2LCP A;  4NQG A;  4OKH A;  2KOT A;  1QX5 B;  2BL0 B;  5D7F A;  1R2U A;  2NCO A;  3I5F B;  1KWO B;  1B1G A;  3OX5 A;  2QEO A;  1KK8 C;  1CLL A;  1MUX A;  2IS9 A;  2I94 A;  4HRG A;  3TUY C;  5I2L A;  1LXF C;  5KSZ A;  3VRN A;  1P28 A;  3O4Y A;  4IL1 A;  4E68 A;  1WLM A;  2KBI A;  1N2D A;  5JOL A;  2K7C A;  3CYZ A;  2JTZ A;  2CXJ A;  2LAN A;  2G2B A;  1UP5 A;  1OZS A;  1SL8 A;  2LHL A;  1SY9 A;  4YBH B;  4BY4 A;  1YRU B;  1HT9 A;  2H61 A;  4I5L B;  3RM1 A;  3BYA A;  3EKH A;  1LS8 A;  4NDB A;  1L2O B;  1DGV A;  1JFK A;  2KQ6 A;  1HQV A;  5ER4 X;  4QJ4 B;  3DZT A;  3NSI A;  2K7O A;  2L2E A;  1JWD A;  2PVB A;  1A2X A;  4L9M A;  3UO9 A;  1SR6 C;  1BOC A;  2PMY A;  2L2C A;  1CB1 A;  1DVI A;  3BJH A;  2F3Y A;  3IF7 A;  4JWQ A;  2L0P A;  3C1V A;  4IJ7 A;  3I5G B;  1KFX S;  2HPS A;  4XJK B;  3O78 A;  1CDL A;  4PHN A;  1WLZ A;  2LVV A;  2KLE A;  1EXR A;  3JTD B;  3VGO A;  3K21 A;  2Y5I A;  2LHI A;  4JPZ B;  1JFJ A;  1MQ1 A;  1SL7 A;  1SYM A;  1ZAC A;  1MXL C;  1QJT A;  4GGN A;  5HL1 A;  3S0F A;  2LV7 A;  5I2Q A;  3R1O A;  1NCY A;  2CCM A;  4C0K A;  4YRU A;  1NX0 A;  2Y1N A;  3PJI A;  1B9A A;  3L4L A;  1C07 A;  2ZND A;  4XJK A;  4MBE A;  1PK0 D;  3ZWH A;  2R2I A;  1EG3 A;  2JPO A;  2SAS A;  4GBA A;  4MZJ A;  4NDD A;  3TDI A;  3WNX B;  1DMO A;  2BEC A;  1QS7 A;  2KHN A;  1PUL A;  2QDI A;  1RFJ A;  3LCP C;  4N1F A;  1QAS A;  4HRE E;  3RLZ A;  3ICB A;  1NYA A;  4PAL A;  4PHK A;  5D69 A;  1CLB A;  3SJS A;  1LVC D;  1SSE B;  1XFZ O;  2KAY A;  3FWB A;  1G33 A;  1NUB A;  3TDU A;  1XYD A;  5AER A;  4QJ5 B;  4ICB A;  4OCI A;  1QX7 A;  2BBM A;  4FQO A;  2ZRS A;  2K60 A;  3D10 A;  2BL0 C;  2KAV A;  1EG4 A;  1CFP A;  2NZ0 A;  1K9K A;  3I5F C;  3B87 A;  1Y1A A;  2WC6 A;  1TCO B;  3KPX A;  3VB1 A;  3VRR A;  4C0L A;  2PYQ A;  1XFW O;  4CPV A;  1C3Z A;  2LM5 A;  1S6I A;  1KSO A;  2WCJ A;  2KPH A;  3A4U B;  3D75 A;  3GOF A;  1TTX A;  4INW A;  1S6C A;  1IJ5 A;  1J55 A;  2M0R A;  2WCM A;  5G08 A;  1J7Q A;  2PAS A;  2M1K B;  1NCX A;  2M97 A;  2AMI A;  3D78 A;  3O6B A;  1SCM C;  2M9G A;  5BPJ A;  1CMF A;  1IQ3 A;  2MA2 A;  3PN7 C;  1AJ5 A;  1L2O C;  2L98 A;  3NSO A;  2FJY A;  1JSA A;  1JF0 A;  3BUO B;  5AFP A;  1A29 A;  5DKN A;  2WCE A;  2BCB A;  3A8R A;  3BUN B;  3N7H A;  1BR4 B;  1NPQ A;  2LE9 B;  3V2L A;  1XFV O;  2MHH A;  1M45 A;  4PE7 A;  1K9U A;  3NHI A;  4Q04 A;  3FE6 A;  1MF8 B;  1S36 A;  5CSI A;  2O60 A;  1TCF A;  1UHN A;  3CR2 A;  3IQQ A;  1OOJ A;  1F4Q A;  1TNP A;  1OZO A;  1LA0 A;  2P70 A;  4YGB B;  2WCK A;  3BFB A;  3DYE A;  3PFV A;  5I2O A;  1TUZ A;  2YGU A;  2V53 A;  1DEL A;  1RRO A;  3QRX A;  2QEH A;  4GGF A;  4NDC A;  3GK4 X;  4M2P A;  1RJV A;  3SG3 A;  1TOP A;  4ZCU A;  3DF0 A;  4FTG A;  4MRY A;  4MVF A;  3DXL A;  3CZT X;  1DQE A;  1ZFS A;  5HKY A;  3AAK A;  4C0J A;  1OMR A;  2BBN A;  3DVJ A;  3LK1 A;  4PCW A;  1RWY A;  3EK7 A;  1H4B A;  1H8B A;  4MSP A;  1N0Y A;  1S6J A;  2M7N A;  3D0Y B;  4OVN F;  2HF5 A;  3M0W A;  4MRX A;  3SG7 A;  3FE9 A;  2F2O A;  2LP3 A;  1CFF A;  4MEW A;  4ORA B;  1ZOT B;  1XFU O;  1J1D A;  2MLF C;  3SG4 A;  2LAP A;  4R1E A;  4AQJ A;  1IRJ A;  2JXC A;  5B8I B;  5KU1 A;  1B8R A;  5FI2 A;  1PAL A;  3JVT B;  2D8N A;  2ZRT A;  3BFH A;  1CFC A;  3PSR A;  1PVA A;  3D0Y A;  1CTR A;  4M2Q A;  3I5I C;  4AQI A;  3D77 A;  1OQP A;  1Y0V H;  5HKZ A;  3EK4 A;  2EGD A;  2HET A;  3SIB A;  1NP8 A;  1L7Z A;  1OMD A;  1S5G Z;  5PAL A;  3B88 A;  4OV2 A;  1NX3 A;  2I18 A;  1B47 A;  2EC6 B;  3H4S E;  2K61 A;  1YRT B;  2GV5 A;  2KFG A;  4F7F A;  1S5G Y;  2LLT A;  4BY5 A; 
#chains in the Genus database with same CATH homology
 3I5H C;  2TN4 A;  2LVI A;  1UHH A;  5AXI A;  4PE4 A;  2CNP A;  2LP2 A;  2KFF A;  2WCF A;  1F54 A;  1XO5 A;  1CDN A;  2K2A A;  5HKW A;  1WRK A;  2OTG C;  2ZN9 A;  2LVK A;  4GAO A;  1TNW A;  1J1E A;  4MZL A;  4DIR A;  2LMT A;  2LVJ A;  1IQ5 A;  1CNP A;  1AUI B;  2JNX A;  3PLF B;  1B7T Y;  3NXA A;  4JQ0 D;  1YUS A;  4WQ2 A;  1OSA A;  1CDM A;  1MWN A;  1M46 A;  2CBL A;  3E3R A;  2LLU A;  4N5X A;  5CSJ A;  3HCM A;  3KO0 A;  4YGE B;  1FI6 A;  1SW8 A;  2KGR A;  5FYX A;  1KK7 Z;  2BCX A;  1DJZ A;  2JOJ A;  3BQ3 A;  3GK1 A;  1KQM B;  4HSZ A;  1BMO A;  1M63 B;  1KK7 Y;  1DJI A;  2JRF A;  5J3X A;  1AK8 A;  1KSM A;  4XYN A;  1AVS A;  2A4J A;  1K94 A;  1KWO C;  2H61 C;  2FJU B;  2HQ8 A;  3KHE A;  2JZI A;  3PAT A;  1ZMZ A;  1U5I B;  1Y1U A;  2I7A A;  2L5X B;  3OB1 B;  2ZFD A;  2LMV A;  2F8P A;  3JVT C;  2QPT A;  1G8I A;  2KI4 B;  1YX7 A;  4OR9 B;  4WQ3 A;  1W7I B;  1BG1 A;  4ORC B;  2OS8 B;  1YUU A;  2L51 A;  1B4C A;  1PVB A;  1FI5 A;  1NCZ A;  3NSL A;  1S3P A;  3CTN A;  3WHU B;  1GQM A;  1GGZ A;  2K7D A;  1PRW A;  1U5I A;  3KEV A;  3PAL A;  1N65 A;  1YX8 A;  3FIA A;  1KK8 B;  1UHK A;  1NWD A;  1WDC B;  2EC6 C;  1UHJ A;  1SRA A;  1CLM A;  1ODB A;  3EKJ A;  5ER5 A;  2MJW B;  2PRU A;  3I5G C;  1WY9 A;  2JNF A;  1YR5 A;  2KYC A;  1F70 A;  5HLO A;  3CR4 X;  1R6P A;  3JTD C;  2Y4Q A;  1DTL A;  3NSK A;  3FWC A;  2MRD A;  1IWQ A;  3FS7 A;  2WND A;  1TN4 A;  1F4O A;  1RTP 1;  2LUC A;  2KI6 D;  3CGA A;  1QLS A;  2KI6 C;  3HX4 A;  5CSN A;  1CKK A;  4D1E A;  1FF1 A;  1Q80 A;  2NLN A;  1SR6 B;  4MLW A;  5IBW A;  2JU0 A;  5TNC A;  2WOR A;  1JC2 A;  4GNK B;  4TNC A;  3OB2 B;  2ZKM X;  3TS5 B;  2M1U A;  1V1F A;  2F2P A;  2LLS A;  1C7V A;  2O5G A;  1BLQ A;  1J7O A;  2MBX A;  1KFU L;  2JUL A;  1F71 A;  1DJH A;  1IG5 A;  1C7W A;  1B8L A;  4YGA A;  5AAN A;  2K2F A;  1SKT A;  2BE6 A;  1TRF A;  2OPO A;  2WCB A;  1K2H A;  2MLE C;  4P2Y B;  1V1G A;  2LUX A;  1BU3 A;  2BKI B;  1J7R A;  3DVE A;  1JBA A;  2KDH A;  2JC2 A;  1RK9 A;  1OMV A;  5CSF A;  4CFQ A;  4ZCV A;  4I5N B;  2BCA A;  1AP4 A;  4PDZ A;  2WOS A;  4YGC B;  2FCD A;  1XK4 A;  1WRZ A;  4CFR A;  2KI4 C;  3PM8 A;  1X02 A;  4HRH A;  1D1O A;  2M49 B;  3OHM B;  1K90 D;  4YI9 A;  2GGZ A;  1SL9 A;  2QAC A;  3EVU A;  5HLV A;  1FW4 A;  1PSB A;  2KYF A;  5AEQ A;  1TNQ A;  4DS7 A;  1DF0 B;  1WDC C;  1CM1 A;  2CTN A;  1IJ6 A;  4GGF C;  4N1G A;  1MXE A;  2FCE A;  1JUO A;  2K7B A;  3O2P A;  1A75 B;  1KCY A;  1BT6 A;  1EJ3 A;  2JT0 A;  2JWW A;  2M7L A;  3VRQ A;  4A4B A;  1SBJ A;  3CWG A;  1ALV A;  2ISD A;  2JT8 A;  4DRW A;  2LC5 A;  1KFU S;  2AUC A;  4USL A;  1QX2 A;  4MZK A;  4UPG A;  1SCM B;  1B7T Z;  3LLE A;  3OP0 A;  1DF0 A;  3DVK A;  2VRG A;  3PN7 B;  3DVM A;  4PE1 A;  4CID A;  4P5O E;  1E8A A;  1K8U A;  4DCK A;  2E6W A;  2Y1M A;  4I5J A;  1A75 A;  3VRO A;  5HYD A;  1KQV A;  2F33 A;  1IGV A;  5DKR A;  2WC8 A;  3TS5 C;  1MHO A;  1CDP A;  1JF2 A;  1QXP A;  1ZUZ A;  2CT9 A;  3LL8 B;  4I5K A;  1YUR A;  1K95 A;  1QVI Z;  3GK2 A;  3KF9 A;  1F8H A;  1K96 A;  1XA5 A;  2H2K A;  1SCV A;  3BUX B;  1XK4 C;  1QAT A;  4A4C A;  2M29 A;  2JT3 A;  1QVI Y;  2KSP A;  2L50 A;  2Q4U A;  1Y6W A;  2Q91 A;  3BUW B;  4GFT A;  3SG6 A;  1MR8 A;  1SMG A;  2B1U A;  1A4P A;  1EL4 A;  3ZNI A;  1FPW A;  5GQQ C;  1NX1 A;  3WHT B;  2COL B;  2KAX A;  1QLK A;  1UUS A;  3SG2 A;  1IH0 A;  3AKA A;  3BOW B;  1S26 D;  1OE9 B;  1YUT A;  2SCP A;  4WRI A;  4CLN A;  2G9B A;  4PHM A;  2K0J A;  2DOQ A;  3AAJ A;  5K89 A;  2GGM A;  1DT7 B;  1J7P A;  1DJX A;  4MN0 A;  1BOD A;  1TNX A;  1EH2 A;  1YVL A;  5JJG A;  2KQY A;  2KNE A;  3IQO A;  1XFY O;  5CPV A;  1GJY A;  1UWO A;  1UHI A;  3CLN A;  3CR5 X;  2AAO A;  4PE0 A;  1REC A;  2F3Z A;  1SNL A;  3BXK A;  2I2R E;  3BOW A;  5I8N A;  1TIZ A;  3OX6 A;  1LKJ A;  4GPL B;  1BJF A;  3EK8 A;  3TUY B;  3F45 A;  1M39 A;  2NXQ A;  2LNK A;  2ZNE A;  1AHR A;  2BKH B;  1PSR A;  3EVR A;  3WXA A;  1QIV A;  2L4H A;  1CM4 A;  3I5I B;  1YVH A;  2K8M B;  1K93 D;  3CS1 A;  1NIW A;  1F55 A;  1G4Y R;  1Y1X A;  3TDZ A;  1UUR A;  1XVJ A;  1DJY A;  1QIW A;  1ALW A;  2ZN8 A;  3VRP A;  3BUM B;  2LMU A;  1VRK A;  1NX2 A;  2PSR A;  5DKQ A;  1CMG A;  1W7J B;  2JXL A;  1QTX A;  1DJG A;  1FBV A;  1A03 A;  1QV1 A;  1QV0 A;  5F6T A;  3I5H B;  2BE4 A;  3DF0 B;  5KTY A;  2HQW A;  2M3W A;  4U8D A;  1CFD A;  2EHB A;  1S1E A;  4F0Z B;  2NCP A;  2PAL A;  1XFX O;  3MSE B;  1K9P A;  2MAZ A;  1BR1 B;  1KQM C;  2JQ6 A;  2KFH A;  3SIA A;  4DUQ A;  2FOT A;  2OTG B;  4AOM A;  1IKU A;  3EVV A;  1LIN A;  4GUK A;  1AJ4 A;  4M2O A;  1BF5 A;  2KBM A;  1GGW A;  2KGB C;  2E30 A;  1DGU A;  3LK0 A;  1M31 A;  4YI8 A;  4PHJ A;  2JPT A;  3AKB A;  4YGD B;  1KFX L;  1YTZ C;  1NSH A;  2JTT A;  1SPY A;  4QJ3 B;  1LA3 A;  1SK6 D;  3DD4 A;  3TZ1 A;  1B8C A;  2OS8 C;  2P6B B;  4ETO A;  2L4I A;  4ORB B;  2RGI A;  1WRL A;  3SG5 A;  2M8U A;  1DJW A;  2LCP A;  4NQG A;  4OKH A;  2KOT A;  1QX5 B;  2BL0 B;  5D7F A;  1R2U A;  2NCO A;  3I5F B;  1KWO B;  1B1G A;  3OX5 A;  1KK8 C;  1CLL A;  1MUX A;  2IS9 A;  2I94 A;  4HRG A;  3TUY C;  5I2L A;  1LXF C;  5KSZ A;  3VRN A;  4IL1 A;  3O4Y A;  4E68 A;  1WLM A;  2KBI A;  1N2D A;  5JOL A;  2K7C A;  2JTZ A;  2CXJ A;  2LAN A;  2G2B A;  1UP5 A;  1OZS A;  1SL8 A;  2LHL A;  1SY9 A;  4YBH B;  4BY4 A;  1YRU B;  1HT9 A;  2H61 A;  4I5L B;  3RM1 A;  3BYA A;  3EKH A;  4NDB A;  4QJ4 B;  1L2O B;  1DGV A;  1JFK A;  2KQ6 A;  1HQV A;  5ER4 X;  3NSI A;  1JWD A;  2K7O A;  2L2E A;  2PVB A;  1A2X A;  4L9M A;  1SR6 C;  1BOC A;  2PMY A;  1CB1 A;  1DVI A;  2F3Y A;  3IF7 A;  4JWQ A;  2L0P A;  3C1V A;  3I5G B;  1KFX S;  2HPS A;  4XJK B;  3O78 A;  1CDL A;  4PHN A;  1WLZ A;  2LVV A;  1EXR A;  3JTD B;  3VGO A;  3K21 A;  2Y5I A;  2LHI A;  4JPZ B;  1JFJ A;  1MQ1 A;  1SL7 A;  1SYM A;  1ZAC A;  1MXL C;  1QJT A;  4GGN A;  2LV7 A;  5I2Q A;  1NCY A;  2CCM A;  4C0K A;  4YRU A;  1NX0 A;  2Y1N A;  1B9A A;  1C07 A;  2ZND A;  4XJK A;  4MBE A;  1PK0 D;  3ZWH A;  2R2I A;  1EG3 A;  4GBA A;  2SAS A;  4MZJ A;  4NDD A;  3TDI A;  3WNX B;  1DMO A;  2BEC A;  1QS7 A;  2KHN A;  1PUL A;  1RFJ A;  3LCP C;  4N1F A;  1QAS A;  4HRE E;  3RLZ A;  3ICB A;  1NYA A;  4PAL A;  4PHK A;  5D69 A;  1CLB A;  3SJS A;  1LVC D;  1XFZ O;  2KAY A;  3FWB A;  1G33 A;  1NUB A;  3TDU A;  1XYD A;  5AER A;  4QJ5 B;  4ICB A;  4OCI A;  1QX7 A;  2BBM A;  4FQO A;  2ZRS A;  3D10 A;  2BL0 C;  2KAV A;  1EG4 A;  1CFP A;  2NZ0 A;  1K9K A;  3I5F C;  1Y1A A;  1TCO B;  3KPX A;  4C0L A;  3VRR A;  1XFW O;  4CPV A;  2LM5 A;  1S6I A;  1KSO A;  3A4U B;  3GOF A;  1TTX A;  5G08 A;  1S6C A;  1IJ5 A;  1J55 A;  2M0R A;  1J7Q A;  2PAS A;  2M1K B;  1NCX A;  2M97 A;  2AMI A;  3O6B A;  1SCM C;  2M9G A;  5BPJ A;  1CMF A;  1IQ3 A;  2MA2 A;  3PN7 C;  1AJ5 A;  1L2O C;  2L98 A;  3NSO A;  1JSA A;  1JF0 A;  3BUO B;  5AFP A;  1A29 A;  5DKN A;  2WCE A;  2BCB A;  3A8R A;  3BUN B;  1BR4 B;  1NPQ A;  2LE9 B;  1XFV O;  2MHH A;  1M45 A;  4PE7 A;  1K9U A;  4Q04 A;  1MF8 B;  1S36 A;  5CSI A;  2O60 A;  1TCF A;  1UHN A;  3CR2 A;  3IQQ A;  1OOJ A;  1F4Q A;  1TNP A;  1OZO A;  1LA0 A;  4YGB B;  3PFV A;  5I2O A;  2V53 A;  1RRO A;  3QRX A;  4GGF A;  4NDC A;  3GK4 X;  4M2P A;  1RJV A;  3SG3 A;  1TOP A;  4ZCU A;  3DF0 A;  4FTG A;  4MRY A;  4MVF A;  3CZT X;  1ZFS A;  5HKY A;  3AAK A;  4C0J A;  1OMR A;  2BBN A;  3DVJ A;  3LK1 A;  4PCW A;  1RWY A;  3EK7 A;  1H4B A;  1H8B A;  4MSP A;  1N0Y A;  1S6J A;  2M7N A;  3D0Y B;  4OVN F;  2HF5 A;  3M0W A;  4MRX A;  3SG7 A;  2F2O A;  2LP3 A;  1CFF A;  4MEW A;  4ORA B;  1ZOT B;  1XFU O;  1J1D A;  2MLF C;  3SG4 A;  2LAP A;  4R1E A;  4AQJ A;  1IRJ A;  2JXC A;  5B8I B;  5KU1 A;  1B8R A;  1PAL A;  3JVT B;  2D8N A;  2ZRT A;  1CFC A;  3PSR A;  1PVA A;  3D0Y A;  1CTR A;  4M2Q A;  3I5I C;  4AQI A;  1OQP A;  1Y0V H;  5HKZ A;  3EK4 A;  2EGD A;  2HET A;  3SIB A;  1NP8 A;  1L7Z A;  1OMD A;  1S5G Z;  5PAL A;  4OV2 A;  1NX3 A;  2I18 A;  1B47 A;  2EC6 B;  3H4S E;  2K61 A;  1YRT B;  2GV5 A;  2KFG A;  1S5G Y;  2LLT A;  4BY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...