1CDNA

Solution structure of (cd2+)1-calbindin d9k reveals details of the stepwise structural changes along the apo--> (ca2+)ii1--> (ca2+)i,ii2 binding pathway
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALBINDIN D9K
publication title Solution structure of (Cd2+)1-calbindin D9k reveals details of the stepwise structural changes along the Apo-->(Ca2+)II1-->(Ca2+)I,II2 binding pathway.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 27
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1995-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cdnA00
1TOPA 2LNKA 2PRUA 3KHEA 4DS7A 2PSRA 3I5HC 4PCWA 1PSRA 3EK7A 3PATA 2KAXA 2MAZA 2G9BA 2SASA 3OHMB 1OMDA 1EXRA 1M45A 4MEWA 1KK8B 2LVVA 2JTZA 1PVBA 4XJKB 1K96A 2BKHB 1CM4A 5CSNA 5ER4X 1JF0A 2HPSA 1SL9A 2LE9B 2F2OA 2KFGA 3ZWHA 1KWOB 1CNPA 1B8LA 2I18A 4HRHA 3JVTC 2EHBA 2KFFA 2WNDA 1B4CA 3PLFB 4N1FA 2IS9A 2JZIA 1QTXA 2NCOA 2R2IA 5HKYA 2FCEA 1AUIB 3E3RA 1NYAA 3VGOA 1K90D 1MF8B 3I5GB 4JPZB 1MXLC 1S6CA 2BKIB 2KBMA 2ISDA 1Y1XA 2L0PA 1BLQA 4YGBB 1CTRA 4YGEB 1CLLA 2H2KA 5JJGA 1ZOTB 1M39A 1N0YA 2FJUB 1IWQA 4AQJA 1KQVA 2WCBA 1RK9A 1DJZA 4FTGA 1S6JA 4GGNA 1GGZA 2HQ8A 3SJSA 1SYMA 3VRQA 1K94A 2KI4C 1W7JB 3O2PA 4MVFA 4ZCUA 1PVAA 5CSJA 1JWDA 4DIRA 5HLOA 4YGDB 2ZNEA 3IF7A 4YGAA 5GQQC 1AJ4A 3DF0A 2AMIA 3PSRA 3VRRA 4OR9B 1PRWA 1JFKA 4WQ3A 1SNLA 1Y6WA 3TDUA 1WDCC 5D7FA 1B47A 3LCPC 1A75B 2L50A 2M7NA 2L51A 1KFXS 1K93D 1K8UA 1PK0D 1DGUA 4PHNA 4C0KA 5HKZA 1AK8A 1WRZA 4AQIA 2LVKA 3DVEA 3EKHA 2L4IA 1XFUO 1SCVA 4MRYA 4OKHA 3RLZA 2K8MB 2COLB 1RTP1 2ZKMX 1CB1A 1CFDA 1KFXL 4GFTA 1CFFA 3I5FB 2F3YA 1SR6B 2JRFA 3RM1A 1XFVO 1YX7A 2M9GA 2JNFA 3AKAA 4DCKA 1L2OB 1ZUZA 1KSOA 1CM1A 1NWDA 1YVHA 1OSAA 2JXCA 3BYAA 2Y5IA 1LA3A 2BL0C 1TNWA 4QJ5B 1CMFA 1QIWA 1U5IA 2F8PA 1IQ5A 4PHJA 2MHHA 2BCXA 3A4UB 1UURA 2GGZA 3CWGA 2WORA 2OTGB 4D1EA 1XFZO 3CR5X 3KF9A 4I5JA 1IKUA 2CBLA 4N1GA 1G4YR 1FPWA 1X02A 1UHJA 1CKKA 1D1OA 1IG5A 1RWYA 1CLBA 2WC8A 1KQMC 4PDZA 2JQ6A 2KYFA 5I2QA 1L7ZA 2K7BA 2Y1MA 3SG4A 3CGAA 5CSIA 4ORCB 5CPVA 3SG7A 1EG4A 1DJWA 1YX8A 2B1UA 2LLSA 2LVJA 1MWNA 2PASA 4F0ZB 5AXIA 3LK1A 3TS5B 1V1GA 4I5LB 3I5IC 4M2OA 4TNCA 1NCYA 2HF5A 3JTDB 1CDLA 4I5NB 1SCMC 3OX5A 2CCMA 2D8NA 4YI9A 2G2BA 1OZOA 5AEQA 1M31A 1HT9A 2LLTA 1CFPA 1GQMA 1JUOA 1XVJA 1LKJA 1DGVA 5DKQA 2NZ0A 2M1UA 1NX1A 1QVIZ 3EVRA 3BUNB 2MBXA 2HQWA 2M1KB 2BCBA 1Q80A 5BPJA 1F4OA 5TNCA 1BOCA 5DKNA 1DJYA 4FQOA 2LMVA 1ZFSA 1SRAA 2F33A 5G08A 4Q04A 3EK4A 2PMYA 1MQ1A 1GGWA 4GPLB 1TCFA 2PALA 4U8DA 2MJWB 3H4SE 3I5HB 4NQGA 1JBAA 4XJKA 1J7RA 5FYXA 1N65A 1A29A 3EKJA 3BOWA 5CSFA 1WLZA 2L2EA 1B9AA 1YUTA 3I5GC 3AAKA 3PFVA 1OZSA 2KBIA 1J7OA 3TUYB 1B1GA 2K2FA 5ER5A 1QS7A 4PE0A 1PULA 1BODA 5IBWA 2LP2A 3NSLA 1M46A 2OS8B 2Q91A 3JVTB 4GGFC 4OCIA 2LHLA 3K21A 1BT6A 1Y0VH 1N2DA 2WCEA 1DMOA 1EH2A 1YUSA 1ODBA 2NCPA 3CR2A 1B7TZ 1UP5A 3WHUB 3HX4A 4PHMA 2NLNA 1TNXA 3SG5A 2EC6C 2JT8A 3TZ1A 1Y1AA 1PSBA 1C07A 2JU0A 4GGFA 1BR4B 5AFPA 2KGRA 2ZN9A 1ALWA 2JC2A 5HYDA 2JNXA 2FOTA 1MHOA 1NCXA 2BBNA 2L5XB 4MBEA 4CLNA 5HLVA 1YR5A 1AJ5A 4P5OE 1R2UA 3BUXB 1H4BA 5KU1A 4AOMA 1S5GZ 1EJ3A 2VRGA 1CDPA 4QJ3B 1QATA 1FF1A 1JSAA 3NSIA 1CLMA 2KI4B 3A8RA 2LCPA 1TN4A 3QRXA 4IL1A 1CDNA 2GV5A 1UWOA 3VRPA 2BE4A 5I2OA 2QPTA 4WRIA 5AANA 4HRGA 1DVIA 1S3PA 1QLKA 1ZMZA 4QJ4B 1DJGA 3LK0A 1KSMA 2CNPA 3OP0A 1SL8A 1EG3A 1DF0A 2K7DA 1CMGA 1RROA 3GK1A 4MZKA 4YGCB 2LC5A 2LANA 1NX3A 4MSPA 1B8CA 2KOTA 3EVUA 5AERA 1UHNA 2SCPA 3ICBA 4N5XA 3KEVA 1XO5A 3LL8B 4A4CA 1H8BA 2LP3A 1K9UA 2JT0A 2P6BB 1NUBA 2ZFDA 3KPXA 2OTGC 1FBVA 2L4HA 2M3WA 1SKTA 4GNKB 1IJ5A 3CZTX 3SG3A 3TDZA 4DUQA 1U5IB 3OX6A 1BF5A 1PALA 3TDIA 3VROA 2K0JA 3FWBA 1QX5B 1BG1A 3SG6A 2KQ6A 1M63B 3C1VA 3WHTB 1IRJA 2BL0B 1IH0A 1WRLA 1UHIA 4M2QA 4ORBB 1C7VA 4YI8A 1XFWO 5K89A 2E6WA 2WOSA 3FS7A 1FI6A 2JTTA 2FCDA 2K2AA 1NCZA 2K7CA 1MUXA 4YBHB 4XYNA 5D69A 2JULA 1BJFA 2KAYA 1BR1B 3BXKA 1KK7Z 2I7AA 1K9PA 3D0YA 1F55A 3MSEB 1NX2A 1UHHA 3EK8A 3JTDC 1TCOB 1S6IA 2KHNA 1SW8A 4PE7A 1OMRA 2JT3A 2LLUA 4GAOA 3GK2A 4HSZA 2LM5A 2E30A 1YRUB 1F8HA 2RGIA 1F71A 1TNPA 3CLNA 1QIVA 1ZACA 3D10A 1GJYA 3FIAA 4L9MA 3EVVA 5I2LA 3PN7B 3VRNA 1KK8C 1LINA 4MZLA 2CXJA 1YRTB 2H61A 4MRXA 2WCFA 2MLFC 2LVIA 2PVBA 1QLSA 3KO0A 4NDCA 1KWOC 2CTNA 3DD4A 5I8NA 1SCMB 3LLEA 5F6TA 4ETOA 2LV7A 1K2HA 4MN0A 3ZNIA 2KNEA 1NIWA 1AVSA 1TRFA 1WLMA 1XA5A 4NDBA 4CFQA 3M0WA 2JPTA 1J1DA 4C0JA 1KK7Y 4BY5A 2MLEC 4R1EA 4YRUA 2LUXA 3TUYC 4ICBA 4NDDA 1WY9A 1AHRA 1MR8A 1JFJA 2L98A 3BOWB 3WXAA 1IGVA 2OS8C 3BUOB 3GK4X 4CIDA 1OMVA 3IQOA 1DTLA 3O78A 2AAOA 2ZNDA 1QV0A 1CFCA 3DVJA 4CPVA 1QVIY 1F4QA 2ZRSA 3NXAA 1F54A 2M7LA 1NP8A 2JOJA 2OPOA 4C0LA 1TIZA 4M2PA 1DJXA 2Q4UA 1NX0A 2I2RE 3CR4X 3SG2A 2O5GA 1XFYO 2AUCA 1QJTA 1WRKA 1G8IA 4MZJA 3CTNA 2JWWA 1YURA 1QASA 1OOJA 2K7OA 2KDHA 1K9KA 3DF0B 1LVCD 2LHIA 1F70A 2I94A 1SY9A 3F45A 3BUMB 1UUSA 2EC6B 2QACA 2BECA 1C7WA 3DVKA 3NSOA 1R6PA 5J3XA 2F3ZA 1DT7B 1DJHA 1KFUS 1A03A 1UHKA 2KI6D 4USLA 4DRWA 5KTYA 2BBMA 1HQVA 2M8UA 2LAPA 3IQQA 4JWQA 1MXEA 5B8IB 1A75A 2ZN8A 2K61A 4PHKA 1LA0A 1J7QA 1ALVA 1JF2A 1B7TY 1YVLA 4OVNF 4E68A 2KYCA 3CS1A 3I5FC 2HETA 1WDCB 1SR6C 4CFRA 1AP4A 2KSPA 1KFUL 2GGMA 2Y4QA 4UPGA 1L2OC 4ORAB 1YTZC 3BQ3A 1V1FA 1YUUA 5HKWA 1SMGA 4BY4A 4ZCVA 1W7IB 1OE9B 1DF0B 1QXPA 3AKBA 3O4YA 1OQPA 4A4BA 1S26D 4MLWA 3OB1B 1JC2A 1VRKA 1QX2A 1S36A 2JXLA 1S5GY 4PE4A 1BU3A 2KI6C 2V53A 2LMUA 3HCMA 1TTXA 1SK6D 1TNQA 1SPYA 1XFXO 2F2PA 1A2XA 4GBAA 3PM8A 1EL4A 4HREE 2CT9A 1RECA 3DVMA 5KSZA 4GUKA 3OB2B 2KGBC 4PALA 3AAJA 1A4PA 1CDMA 2BE6A 3GOFA 2NXQA 2A4JA 1QX7A 5DKRA 1NPQA 2LUCA 1SL7A 1J55A 4I5KA 2O60A 1KCYA 4OV2A 1DJIA 3TS5C 2ZRTA 1Y1UA 1J7PA 2LMTA 2EGDA 4WQ2A 2KFHA 1RJVA 3O6BA 3NSKA 1QV1A 3PALA 1KQMB 1B8RA 1XYDA 1FI5A 2H61C 3D0YB 1S1EA 1XK4C 1LXFC 2DOQA 2Y1NA 3WNXB 1J1EA 2M97A 4JQ0D 2M49B 5PALA 2MA2A 3BUWB 2TN4A 1IJ6A 1FW4A 1RFJA 2KQYA 3SIBA 3PN7C 1IQ3A 2BCAA 4P2YB 3I5IB 1XK4A 5JOLA 3FWCA 1K95A 1SBJA 3SIAA 1E8AA 1G33A 2KAVA 1BMOA 2M0RA 4PE1A 2MRDA 1NSHA 2M29A
chains in the Genus database with same CATH superfamily
1TOPA 2LNKA 2PRUA 3KHEA 3L4LA 4DS7A 2PSRA 3I5HC 4PCWA 1PSRA 3EK7A 3PATA 2KAXA 5FI7A 2KLEA 2MAZA 1TWOA 2G9BA 2SASA 5HL1A 3OHMB 1OMDA 1EXRA 1M45A 4MEWA 1KK8B 2LVVA 2JTZA 1PVBA 4XJKB 1K96A 2BKHB 1CM4A 5CSNA 5ER4X 1JF0A 2HPSA 1SL9A 2LE9B 2F2OA 2KFGA 3ZWHA 1KWOB 1CNPA 1B8LA 2I18A 4HRHA 3JVTC 4PT1A 2EHBA 2KFFA 2WNDA 1B4CA 3PLFB 4N1FA 2IS9A 2JZIA 3L4AA 1QTXA 2NCOA 2R2IA 5HKYA 2KLDA 2FCEA 3FE6A 1AUIB 3E3RA 1NYAA 3VGOA 1K90D 1MF8B 5I94A 3I5GB 4JPZB 2WCKA 1MXLC 4JD9A 1S6CA 3NGVA 3CZ1A 2BKIB 2KBMA 2ISDA 1Y1XA 2L0PA 1BLQA 4YGBB 1CTRA 4YGEB 1CLLA 2H8VA 2H2KA 2QEOA 5JJGA 1QWVA 1IIOA 1ZOTB 1M39A 1N0YA 2FJUB 1IWQA 4AQJA 1KQVA 2WCBA 1RK9A 1DJZA 4FTGA 4INWA 1S6JA 4GGNA 1GGZA 2HQ8A 3SJSA 1SYMA 3VRQA 1K94A 2KI4C 1W7JB 3O2PA 1SSEB 4MVFA 4ZCUA 3FE9A 2FJYA 1PVAA 4KYNA 5CSJA 1JWDA 4DIRA 5HLOA 4YGDB 2ZNEA 3IF7A 4YGAA 1C3ZA 5GQQC 1AJ4A 3DF0A 2AMIA 2K60A 3S0BA 3PSRA 3VRRA 4OR9B 3SS4A 1PRWA 1P28A 1JFKA 4WQ3A 1SNLA 1Y6WA 3TDUA 1WDCC 2P71A 5D7FA 1B47A 3LCPC 1A75B 2L50A 2M7NA 2L51A 1KFXS 1K93D 1K8UA 1OW4A 1PK0D 1DGUA 2QEBA 4PHNA 4C0KA 5HKZA 1AK8A 1WRZA 4AQIA 2QEHA 2LVKA 3DVEA 3EKHA 2L4IA 1XFUO 1SCVA 4MRYA 4OKHA 3RLZA 2K8MB 2COLB 5EL2A 3S0GA 1RTP1 2ZKMX 1CB1A 1CFDA 1KFXL 4GFTA 1CFFA 3I5FB 2F3YA 1SR6B 3R1OA 2JRFA 3RM1A 1DQEA 1YX7A 1XFVO 2M9GA 2JNFA 3NHIA 3AKAA 4DCKA 1L2OB 1ZUZA 1KSOA 1CM1A 1NWDA 1YVHA 1OSAA 2JXCA 3BYAA 3V2LA 2Y5IA 1LA3A 2BL0C 1TNWA 3R1VA 4QJ5B 1CMFA 1QIWA 1U5IA 2F8PA 1IQ5A 4PHJA 2MHHA 2BCXA 3A4UB 1UURA 2GGZA 3CWGA 2WORA 2OTGB 4D1EA 1XFZO 3CR5X 3KF9A 4I5JA 1IKUA 2CBLA 4N1GA 1G4YR 1FPWA 1X02A 1UHJA 1CKKA 1D1OA 1IG5A 1RWYA 1CLBA 2WC8A 1KQMC 4PDZA 2JQ6A 2KYFA 5I2QA 1L7ZA 2K7BA 3UO9A 2Y1MA 3SG4A 3CGAA 5CSIA 4ORCB 5CPVA 3SG7A 1OOIX 1EG4A 1DJWA 1YX8A 2B1UA 2LLSA 2LVJA 1MWNA 2PASA 4F0ZB 5AXIA 3LK1A 3TS5B 3L47A 2WC6A 1V1GA 4I5LB 3I5IC 4M2OA 4TNCA 1NCYA 2HF5A 3JTDB 1CDLA 4I5NB 1SCMC 3OX5A 2CCMA 1C3YA 2D8NA 1DEKA 4YI9A 2G2BA 1OZOA 5AEQA 1W9ZA 1M31A 2PQLA 1HT9A 2LLTA 1CFPA 1GQMA 1JUOA 1XVJA 1LKJA 1DGVA 5DKQA 2NZ0A 2M1UA 1NX1A 1QVIZ 3EVRA 3BUNB 5FI2A 3D77A 2MBXA 2HQWA 2M1KB 2BCBA 1Q80A 5BPJA 1F4OA 5TNCA 1BOCA 3B7AA 3PJIA 5DKNA 3K1EA 1DJYA 4FQOA 2LMVA 1ZFSA 1SRAA 2F33A 2YGUA 5G08A 4Q04A 3EK4A 2PMYA 1MQ1A 1GGWA 4GPLB 1TCFA 2PALA 4U8DA 2MJWB 3H4SE 3I5HB 4NQGA 1JBAA 3CZ2A 4XJKA 1J7RA 3QMEA 5FYXA 1N65A 1A29A 3EKJA 3BOWA 3CDNA 5CSFA 1WLZA 2L2EA 1B9AA 1YUTA 2WCMA 3AAKA 3I5GC 1OZSA 3PFVA 2KBIA 1J7OA 3TUYB 1B1GA 2K2FA 5ER5A 1QS7A 4PE0A 3VB1A 1PULA 1BODA 5IBWA 2LP2A 3NSLA 4IJ7A 1M46A 2OS8B 2Q91A 3JVTB 4GGFC 4OCIA 2LHLA 3K21A 1BT6A 1TUJA 1N2DA 1Y0VH 2WCEA 1DMOA 1EH2A 1YUSA 1ODBA 2NCPA 3CR2A 1B7TZ 1UP5A 3WHUB 3HX4A 4PHMA 2NLNA 1TNXA 4FQTA 3SG5A 2EC6C 2JT8A 3TZ1A 1Y1AA 1PSBA 1C07A 2JU0A 4GGFA 1BR4B 5AFPA 2KGRA 2ZN9A 1ALWA 2JC2A 5HYDA 2JNXA 2FOTA 1MHOA 1NCXA 2BBNA 2L5XB 4MBEA 4CLNA 5HLVA 1YR5A 1AJ5A 4P5OE 4OZDA 1R2UA 3BUXB 3RZSA 1H4BA 5KU1A 3CYZA 1ORGA 3D75A 2L5YA 4AOMA 3PM2A 1S5GZ 4F7FA 1EJ3A 2VRGA 1CDPA 4QJ3B 1QATA 1FF1A 1JSAA 3NSIA 1CLMA 2KI4B 3A8RA 2LCPA 1TN4A 3QRXA 4IL1A 3S0EA 1CDNA 2GV5A 1UWOA 3VRPA 2BE4A 5I2OA 2QPTA 1LS8A 4WRIA 5AANA 3SS5A 4HRGA 1DVIA 1S3PA 3S0FA 1QLKA 1ZMZA 4QJ4B 1DJGA 3LK0A 1KSMA 2CNPA 3OP0A 1SL8A 1EG3A 1DF0A 2K7DA 1CMGA 1RROA 3GK1A 4MZKA 4YGCB 2LC5A 2LANA 1NX3A 4MSPA 1B8CA 2ERBA 2KOTA 3EVUA 1UHNA 2SCPA 3ICBA 4N5XA 5AERA 1XFRA 3KEVA 1XO5A 3LL8B 4A4CA 1H8BA 2LP3A 1K9UA 2JT0A 2P6BB 3B6XA 3CABA 1NUBA 2ZFDA 3KPXA 2OTGC 1FBVA 2L4HA 2M3WA 1SKTA 4GNKB 1IJ5A 3CZTX 3SG3A 3TDZA 4DUQA 1U5IB 3OX6A 3DZTA 1PALA 1BF5A 1OOHA 3TDIA 3VROA 2K0JA 3FWBA 1QX5B 1BG1A 3DYEA 3SG6A 2KQ6A 1M63B 3C1VA 3WHTB 1IRJA 5D3OA 2BL0B 1IH0A 1WRLA 1UHIA 4M2QA 4ORBB 1C7VA 4YI8A 1XFWO 5K89A 2E6WA 2GTEA 2WOSA 3FS7A 1FI6A 2JTTA 3D73A 2FCDA 2K2AA 1NCZA 2K7CA 1MUXA 4YBHB 4XYNA 5D69A 2JULA 1BJFA 2KAYA 1BR1B 3BXKA 3FE8A 1KK7Z 2I7AA 1K9PA 3D0YA 1F55A 1GM0A 3MSEB 1NX2A 1UHHA 3EK8A 3JTDC 1TCOB 1S6IA 2KHNA 1SW8A 2KPHA 4PE7A 1OMRA 2JT3A 2LLUA 4GAOA 3GK2A 4HSZA 2LM5A 2E30A 3N7HA 1YRUB 1F8HA 2RGIA 2P70A 1F71A 1TNPA 3CLNA 3SS3A 1QIVA 1ZACA 3D10A 3O4XA 1GJYA 3FIAA 4L9MA 2JPOA 3EVVA 5I2LA 1DELA 3PN7B 3VRNA 1KK8C 3S0AA 1LINA 4MZLA 2CXJA 1YRTB 2H61A 4MRXA 2WCFA 2MLFC 2LVIA 2PVBA 1QLSA 3KO0A 4NDCA 3S0DA 1KWOC 2CTNA 3DD4A 5I8NA 1SCMB 3LLEA 5F6TA 4ETOA 2LV7A 1K2HA 4MN0A 3ZNIA 3D76A 1TUZA 2KNEA 1NIWA 1AVSA 1TRFA 1WLMA 1XA5A 3CZ0A 4NDBA 4CFQA 3M0WA 2JPTA 1J1DA 4C0JA 1KK7Y 4BY5A 2MLEC 4R1EA 4YRUA 2LUXA 3TUYC 2QEVA 4ICBA 4NDDA 1WY9A 1AHRA 1MR8A 1JFJA 2L98A 3BOWB 3WXAA 1IGVA 2OS8C 3BUOB 3GK4X 4CIDA 1OMVA 3IQOA 1DTLA 3O78A 2AAOA 3OGNA 2ZNDA 1QV0A 1CFCA 3DVJA 4CPVA 3EG5B 1QVIY 1F4QA 2ZRSA 3NXAA 1F54A 2M7LA 1NP8A 2JOJA 2OPOA 4C0LA 1TIZA 4M2PA 1DJXA 2Q4UA 1NX0A 2I2RE 2WC5A 3CR4X 3SG2A 2O5GA 1XFYO 2AUCA 2PYQA 1QJTA 1WRKA 1G8IA 4MZJA 3CTNA 2JWWA 1YURA 1Z4HA 1QASA 1OOJA 2K7OA 2KDHA 2WCLA 3IVTA 1K9KA 3B86A 3DF0B 1LVCD 2LHIA 1F70A 2I94A 1SY9A 3F45A 3BUMB 1UUSA 2EC6B 2QACA 2BECA 1C7WA 3DVKA 3NSOA 1R6PA 3D74A 5J3XA 2F3ZA 1DT7B 1DJHA 1KFUS 1A03A 1UHKA 2KI6D 4USLA 4DRWA 5KTYA 2BBMA 1HQVA 2M8UA 2LAPA 3IQQA 3BJHA 2BNXA 4JWQA 1MXEA 5B8IB 1A75A 2ZN8A 2K61A 4PHKA 1LA0A 1J7QA 1ALVA 1JF2A 1B7TY 1YVLA 4OVNF 4E68A 2KYCA 3CS1A 3I5FC 2HETA 1WDCB 1SR6C 4CFRA 1AP4A 2KSPA 1KFUL 2GGMA 2Y4QA 1Z2CB 4UPGA 1L2OC 4ORAB 3D78A 1YTZC 3BQ3A 1V1FA 1T14A 1YUUA 3R1PA 5HKWA 1SMGA 4BY4A 4ZCVA 1W7IB 2QDIA 1OE9B 1DF0B 1QXPA 3AKBA 3O4YA 1OQPA 4A4BA 3BFHA 1S26D 4MLWA 3OB1B 1JC2A 1VRKA 1QX2A 1S36A 2JXLA 1S5GY 4PE4A 1BU3A 2KI6C 2V53A 3BFAA 2LMUA 3HCMA 1TTXA 3OBVA 1SK6D 1TNQA 1SPYA 1XFXO 2F2PA 2L2CA 1A2XA 2WCJA 2WCHA 3PM8A 1EL4A 4GBAA 2CT9A 4HREE 1RECA 3DVMA 5KSZA 4GUKA 3B87A 3OB2B 2KGBC 4PALA 3AAJA 1A4PA 1CDMA 2BE6A 3GOFA 4JKTA 2NXQA 2A4JA 1QX7A 5DKRA 1NPQA 2LUCA 3DXLA 1SL7A 1J55A 3Q8IA 4I5KA 2O60A 1KCYA 5DICA 4OV2A 1DJIA 3NHTA 3TS5C 2ZRTA 1Y1UA 1J7PA 2LMTA 2EGDA 4WQ2A 2KFHA 1RJVA 3O6BA 3NSKA 1QV1A 2BAPA 3PALA 1KQMB 4INXA 1B8RA 1XYDA 1FI5A 2H61C 3D0YB 1S1EA 1XK4C 1LXFC 1OOFA 2DOQA 2Y1NA 3WNXB 1J1EA 5FI6A 2M97A 1OOGA 4JQ0D 2M49B 5PALA 2MA2A 3BUWB 1DC1A 2TN4A 1IJ6A 1FW4A 1RFJA 2KQYA 3SIBA 3PN7C 1IQ3A 2BCAA 4P2YB 3R72A 3I5IB 1XK4A 3DY9A 5JOLA 3FWCA 1K95A 3BFBA 3UNWA 1SBJA 3B88A 1E8AA 1G33A 3SIAA 2KAVA 1BMOA 2M0RA 4PE1A 2MRDA 1NSHA 2M29A
chains in the Genus database with same CATH topology
1TOPA 2LNKA 2PRUA 3KHEA 4DS7A 2PSRA 3I5HC 4PCWA 1PSRA 3EK7A 3PATA 2KAXA 2MAZA 2G9BA 2SASA 3OHMB 1OMDA 1EXRA 1M45A 4MEWA 1KK8B 2LVVA 2JTZA 1PVBA 4XJKB 1K96A 2BKHB 1CM4A 5CSNA 5ER4X 1JF0A 2HPSA 1SL9A 2LE9B 2F2OA 2KFGA 3ZWHA 1KWOB 1CNPA 1B8LA 2I18A 4HRHA 3JVTC 2EHBA 2KFFA 2WNDA 1B4CA 3PLFB 4N1FA 2IS9A 2JZIA 1QTXA 2NCOA 2R2IA 5HKYA 2FCEA 1AUIB 3E3RA 1NYAA 3VGOA 1K90D 1MF8B 3I5GB 4JPZB 1MXLC 1S6CA 2BKIB 2KBMA 2ISDA 1Y1XA 2L0PA 1BLQA 4YGBB 1CTRA 4YGEB 1CLLA 2H2KA 5JJGA 1ZOTB 1M39A 1N0YA 2FJUB 1IWQA 4AQJA 1KQVA 2WCBA 1RK9A 1DJZA 4FTGA 1S6JA 4GGNA 1GGZA 2HQ8A 3SJSA 1SYMA 3VRQA 1K94A 2KI4C 1W7JB 3O2PA 4MVFA 4ZCUA 1PVAA 5CSJA 1JWDA 4DIRA 5HLOA 4YGDB 2ZNEA 3IF7A 4YGAA 5GQQC 1AJ4A 3DF0A 2AMIA 3PSRA 3VRRA 4OR9B 1PRWA 1JFKA 4WQ3A 1SNLA 1Y6WA 3TDUA 1WDCC 5D7FA 1B47A 3LCPC 1A75B 2L50A 2M7NA 2L51A 1KFXS 1K93D 1K8UA 1PK0D 1DGUA 4PHNA 4C0KA 5HKZA 1AK8A 1WRZA 4AQIA 2LVKA 3DVEA 3EKHA 2L4IA 1XFUO 1SCVA 4MRYA 4OKHA 3RLZA 2K8MB 2COLB 1RTP1 2ZKMX 1CB1A 1CFDA 1KFXL 4GFTA 1CFFA 3I5FB 2F3YA 1SR6B 2JRFA 3RM1A 1XFVO 1YX7A 2M9GA 2JNFA 3AKAA 4DCKA 1L2OB 1ZUZA 1KSOA 1CM1A 1NWDA 1YVHA 1OSAA 2JXCA 3BYAA 2Y5IA 1LA3A 2BL0C 1TNWA 4QJ5B 1CMFA 1QIWA 1U5IA 2F8PA 1IQ5A 4PHJA 2MHHA 2BCXA 3A4UB 1UURA 2GGZA 3CWGA 2WORA 2OTGB 4D1EA 1XFZO 3CR5X 3KF9A 4I5JA 1IKUA 2CBLA 4N1GA 1G4YR 1FPWA 1X02A 1UHJA 1CKKA 1D1OA 1IG5A 1RWYA 1CLBA 2WC8A 1KQMC 4PDZA 2JQ6A 2KYFA 5I2QA 1L7ZA 2K7BA 2Y1MA 3SG4A 3CGAA 5CSIA 4ORCB 5CPVA 3SG7A 1EG4A 1DJWA 1YX8A 2B1UA 2LLSA 2LVJA 1MWNA 2PASA 4F0ZB 5AXIA 3LK1A 3TS5B 1V1GA 4I5LB 3I5IC 4M2OA 4TNCA 1NCYA 2HF5A 3JTDB 1CDLA 4I5NB 1SCMC 3OX5A 2CCMA 2D8NA 4YI9A 2G2BA 1OZOA 5AEQA 1M31A 1HT9A 2LLTA 1CFPA 1GQMA 1JUOA 1XVJA 1LKJA 1DGVA 5DKQA 2NZ0A 2M1UA 1NX1A 1QVIZ 3EVRA 3BUNB 2MBXA 2HQWA 2M1KB 2BCBA 1Q80A 5BPJA 1F4OA 5TNCA 1BOCA 5DKNA 1DJYA 4FQOA 2LMVA 1ZFSA 1SRAA 2F33A 5G08A 4Q04A 3EK4A 2PMYA 1MQ1A 1GGWA 4GPLB 1TCFA 2PALA 4U8DA 2MJWB 3H4SE 3I5HB 4NQGA 1JBAA 4XJKA 1J7RA 5FYXA 1N65A 1A29A 3EKJA 3BOWA 5CSFA 1WLZA 2L2EA 1B9AA 1YUTA 3I5GC 3AAKA 3PFVA 1OZSA 2KBIA 1J7OA 3TUYB 1B1GA 2K2FA 5ER5A 1QS7A 4PE0A 1PULA 1BODA 5IBWA 2LP2A 3NSLA 1M46A 2OS8B 2Q91A 3JVTB 4GGFC 4OCIA 2LHLA 3K21A 1BT6A 1Y0VH 1N2DA 2WCEA 1DMOA 1EH2A 1YUSA 1ODBA 2NCPA 3CR2A 1B7TZ 1UP5A 3WHUB 3HX4A 4PHMA 2NLNA 1TNXA 3SG5A 2EC6C 2JT8A 3TZ1A 1Y1AA 1PSBA 1C07A 2JU0A 4GGFA 1BR4B 5AFPA 2KGRA 2ZN9A 1ALWA 2JC2A 5HYDA 2JNXA 2FOTA 1MHOA 1NCXA 2BBNA 2L5XB 4MBEA 4CLNA 5HLVA 1YR5A 1AJ5A 4P5OE 1R2UA 3BUXB 1H4BA 5KU1A 4AOMA 1S5GZ 1EJ3A 2VRGA 1CDPA 4QJ3B 1QATA 1FF1A 1JSAA 3NSIA 1CLMA 2KI4B 3A8RA 2LCPA 1TN4A 3QRXA 4IL1A 1CDNA 2GV5A 1UWOA 3VRPA 2BE4A 5I2OA 2QPTA 4WRIA 5AANA 4HRGA 1DVIA 1S3PA 1QLKA 1ZMZA 4QJ4B 1DJGA 3LK0A 1KSMA 2CNPA 3OP0A 1SL8A 1EG3A 1DF0A 2K7DA 1CMGA 1RROA 3GK1A 4MZKA 4YGCB 2LC5A 2LANA 1NX3A 4MSPA 1B8CA 2KOTA 3EVUA 5AERA 1UHNA 2SCPA 3ICBA 4N5XA 3KEVA 1XO5A 3LL8B 4A4CA 1H8BA 2LP3A 1K9UA 2JT0A 2P6BB 1NUBA 2ZFDA 3KPXA 2OTGC 1FBVA 2L4HA 2M3WA 1SKTA 4GNKB 1IJ5A 3CZTX 3SG3A 3TDZA 4DUQA 1U5IB 3OX6A 1BF5A 1PALA 3TDIA 3VROA 2K0JA 3FWBA 1QX5B 1BG1A 3SG6A 2KQ6A 1M63B 3C1VA 3WHTB 1IRJA 2BL0B 1IH0A 1WRLA 1UHIA 4M2QA 4ORBB 1C7VA 4YI8A 1XFWO 5K89A 2E6WA 2WOSA 3FS7A 1FI6A 2JTTA 2FCDA 2K2AA 1NCZA 2K7CA 1MUXA 4YBHB 4XYNA 5D69A 2JULA 1BJFA 2KAYA 1BR1B 3BXKA 1KK7Z 2I7AA 1K9PA 3D0YA 1F55A 3MSEB 1NX2A 1UHHA 3EK8A 3JTDC 1TCOB 1S6IA 2KHNA 1SW8A 4PE7A 1OMRA 2JT3A 2LLUA 4GAOA 3GK2A 4HSZA 2LM5A 2E30A 1YRUB 1F8HA 2RGIA 1F71A 1TNPA 3CLNA 1QIVA 1ZACA 3D10A 1GJYA 3FIAA 4L9MA 3EVVA 5I2LA 3PN7B 3VRNA 1KK8C 1LINA 4MZLA 2CXJA 1YRTB 2H61A 4MRXA 2WCFA 2MLFC 2LVIA 2PVBA 1QLSA 3KO0A 4NDCA 1KWOC 2CTNA 3DD4A 5I8NA 1SCMB 3LLEA 5F6TA 4ETOA 2LV7A 1K2HA 4MN0A 3ZNIA 2KNEA 1NIWA 1AVSA 1TRFA 1WLMA 1XA5A 4NDBA 4CFQA 3M0WA 2JPTA 1J1DA 4C0JA 1KK7Y 4BY5A 2MLEC 4R1EA 4YRUA 2LUXA 3TUYC 4ICBA 4NDDA 1WY9A 1AHRA 1MR8A 1JFJA 2L98A 3BOWB 3WXAA 1IGVA 2OS8C 3BUOB 3GK4X 4CIDA 1OMVA 3IQOA 1DTLA 3O78A 2AAOA 2ZNDA 1QV0A 1CFCA 3DVJA 4CPVA 1QVIY 1F4QA 2ZRSA 3NXAA 1F54A 2M7LA 1NP8A 2JOJA 2OPOA 4C0LA 1TIZA 4M2PA 1DJXA 2Q4UA 1NX0A 2I2RE 3CR4X 3SG2A 2O5GA 1XFYO 2AUCA 1QJTA 1WRKA 1G8IA 4MZJA 3CTNA 2JWWA 1YURA 1QASA 1OOJA 2K7OA 2KDHA 1K9KA 3DF0B 1LVCD 2LHIA 1F70A 2I94A 1SY9A 3F45A 3BUMB 1UUSA 2EC6B 2QACA 2BECA 1C7WA 3DVKA 3NSOA 1R6PA 5J3XA 2F3ZA 1DT7B 1DJHA 1KFUS 1A03A 1UHKA 2KI6D 4USLA 4DRWA 5KTYA 2BBMA 1HQVA 2M8UA 2LAPA 3IQQA 4JWQA 1MXEA 5B8IB 1A75A 2ZN8A 2K61A 4PHKA 1LA0A 1J7QA 1ALVA 1JF2A 1B7TY 1YVLA 4OVNF 4E68A 2KYCA 3CS1A 3I5FC 2HETA 1WDCB 1SR6C 4CFRA 1AP4A 2KSPA 1KFUL 2GGMA 2Y4QA 4UPGA 1L2OC 4ORAB 1YTZC 3BQ3A 1V1FA 1YUUA 5HKWA 1SMGA 4BY4A 4ZCVA 1W7IB 1OE9B 1DF0B 1QXPA 3AKBA 3O4YA 1OQPA 4A4BA 1S26D 4MLWA 3OB1B 1JC2A 1VRKA 1QX2A 1S36A 2JXLA 1S5GY 4PE4A 1BU3A 2KI6C 2V53A 2LMUA 3HCMA 1TTXA 1SK6D 1TNQA 1SPYA 1XFXO 2F2PA 1A2XA 4GBAA 3PM8A 1EL4A 4HREE 2CT9A 1RECA 3DVMA 5KSZA 4GUKA 3OB2B 2KGBC 4PALA 3AAJA 1A4PA 1CDMA 2BE6A 3GOFA 2NXQA 2A4JA 1QX7A 5DKRA 1NPQA 2LUCA 1SL7A 1J55A 4I5KA 2O60A 1KCYA 4OV2A 1DJIA 3TS5C 2ZRTA 1Y1UA 1J7PA 2LMTA 2EGDA 4WQ2A 2KFHA 1RJVA 3O6BA 3NSKA 1QV1A 3PALA 1KQMB 1B8RA 1XYDA 1FI5A 2H61C 3D0YB 1S1EA 1XK4C 1LXFC 2DOQA 2Y1NA 3WNXB 1J1EA 2M97A 4JQ0D 2M49B 5PALA 2MA2A 3BUWB 2TN4A 1IJ6A 1FW4A 1RFJA 2KQYA 3SIBA 3PN7C 1IQ3A 2BCAA 4P2YB 3I5IB 1XK4A 5JOLA 3FWCA 1K95A 1SBJA 3SIAA 1E8AA 1G33A 2KAVA 1BMOA 2M0RA 4PE1A 2MRDA 1NSHA 2M29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOP A;  2LNK A;  2PRU A;  3KHE A;  4DS7 A;  2PSR A;  3I5H C;  4PCW A;  1PSR A;  3EK7 A;  3PAT A;  2KAX A;  2MAZ A;  2G9B A;  2SAS A;  3OHM B;  1OMD A;  1EXR A;  1M45 A;  4MEW A;  1KK8 B;  2LVV A;  2JTZ A;  1PVB A;  4XJK B;  1K96 A;  2BKH B;  1CM4 A;  5CSN A;  5ER4 X;  1JF0 A;  2HPS A;  1SL9 A;  2LE9 B;  2F2O A;  2KFG A;  3ZWH A;  1KWO B;  1CNP A;  1B8L A;  2I18 A;  4HRH A;  3JVT C;  2EHB A;  2KFF A;  2WND A;  1B4C A;  3PLF B;  4N1F A;  2IS9 A;  2JZI A;  1QTX A;  2NCO A;  2R2I A;  5HKY A;  2FCE A;  1AUI B;  3E3R A;  1NYA A;  3VGO A;  1K90 D;  1MF8 B;  3I5G B;  4JPZ B;  1MXL C;  1S6C A;  2BKI B;  2KBM A;  2ISD A;  1Y1X A;  2L0P A;  1BLQ A;  4YGB B;  1CTR A;  4YGE B;  1CLL A;  2H2K A;  5JJG A;  1ZOT B;  1M39 A;  1N0Y A;  2FJU B;  1IWQ A;  4AQJ A;  1KQV A;  2WCB A;  1RK9 A;  1DJZ A;  4FTG A;  1S6J A;  4GGN A;  1GGZ A;  2HQ8 A;  3SJS A;  1SYM A;  3VRQ A;  1K94 A;  2KI4 C;  1W7J B;  3O2P A;  4MVF A;  4ZCU A;  1PVA A;  5CSJ A;  1JWD A;  4DIR A;  5HLO A;  4YGD B;  2ZNE A;  3IF7 A;  4YGA A;  5GQQ C;  1AJ4 A;  3DF0 A;  2AMI A;  3PSR A;  3VRR A;  4OR9 B;  1PRW A;  1JFK A;  4WQ3 A;  1SNL A;  1Y6W A;  3TDU A;  1WDC C;  5D7F A;  1B47 A;  3LCP C;  1A75 B;  2L50 A;  2M7N A;  2L51 A;  1KFX S;  1K93 D;  1K8U A;  1PK0 D;  1DGU A;  4PHN A;  4C0K A;  5HKZ A;  1AK8 A;  1WRZ A;  4AQI A;  2LVK A;  3DVE A;  3EKH A;  2L4I A;  1XFU O;  1SCV A;  4MRY A;  4OKH A;  3RLZ A;  2K8M B;  2COL B;  1RTP 1;  2ZKM X;  1CB1 A;  1CFD A;  1KFX L;  4GFT A;  1CFF A;  3I5F B;  2F3Y A;  1SR6 B;  2JRF A;  3RM1 A;  1XFV O;  1YX7 A;  2M9G A;  2JNF A;  3AKA A;  4DCK A;  1L2O B;  1ZUZ A;  1KSO A;  1CM1 A;  1NWD A;  1YVH A;  1OSA A;  2JXC A;  3BYA A;  2Y5I A;  1LA3 A;  2BL0 C;  1TNW A;  4QJ5 B;  1CMF A;  1QIW A;  1U5I A;  2F8P A;  1IQ5 A;  4PHJ A;  2MHH A;  2BCX A;  3A4U B;  1UUR A;  2GGZ A;  3CWG A;  2WOR A;  2OTG B;  4D1E A;  1XFZ O;  3CR5 X;  3KF9 A;  4I5J A;  1IKU A;  2CBL A;  4N1G A;  1G4Y R;  1FPW A;  1X02 A;  1UHJ A;  1CKK A;  1D1O A;  1IG5 A;  1RWY A;  1CLB A;  2WC8 A;  1KQM C;  4PDZ A;  2JQ6 A;  2KYF A;  5I2Q A;  1L7Z A;  2K7B A;  2Y1M A;  3SG4 A;  3CGA A;  5CSI A;  4ORC B;  5CPV A;  3SG7 A;  1EG4 A;  1DJW A;  1YX8 A;  2B1U A;  2LLS A;  2LVJ A;  1MWN A;  2PAS A;  4F0Z B;  5AXI A;  3LK1 A;  3TS5 B;  1V1G A;  4I5L B;  3I5I C;  4M2O A;  4TNC A;  1NCY A;  2HF5 A;  3JTD B;  1CDL A;  4I5N B;  1SCM C;  3OX5 A;  2CCM A;  2D8N A;  4YI9 A;  2G2B A;  1OZO A;  5AEQ A;  1M31 A;  1HT9 A;  2LLT A;  1CFP A;  1GQM A;  1JUO A;  1XVJ A;  1LKJ A;  1DGV A;  5DKQ A;  2NZ0 A;  2M1U A;  1NX1 A;  1QVI Z;  3EVR A;  3BUN B;  2MBX A;  2HQW A;  2M1K B;  2BCB A;  1Q80 A;  5BPJ A;  1F4O A;  5TNC A;  1BOC A;  5DKN A;  1DJY A;  4FQO A;  2LMV A;  1ZFS A;  1SRA A;  2F33 A;  5G08 A;  4Q04 A;  3EK4 A;  2PMY A;  1MQ1 A;  1GGW A;  4GPL B;  1TCF A;  2PAL A;  4U8D A;  2MJW B;  3H4S E;  3I5H B;  4NQG A;  1JBA A;  4XJK A;  1J7R A;  5FYX A;  1N65 A;  1A29 A;  3EKJ A;  3BOW A;  5CSF A;  1WLZ A;  2L2E A;  1B9A A;  1YUT A;  3I5G C;  3AAK A;  3PFV A;  1OZS A;  2KBI A;  1J7O A;  3TUY B;  1B1G A;  2K2F A;  5ER5 A;  1QS7 A;  4PE0 A;  1PUL A;  1BOD A;  5IBW A;  2LP2 A;  3NSL A;  1M46 A;  2OS8 B;  2Q91 A;  3JVT B;  4GGF C;  4OCI A;  2LHL A;  3K21 A;  1BT6 A;  1Y0V H;  1N2D A;  2WCE A;  1DMO A;  1EH2 A;  1YUS A;  1ODB A;  2NCP A;  3CR2 A;  1B7T Z;  1UP5 A;  3WHU B;  3HX4 A;  4PHM A;  2NLN A;  1TNX A;  3SG5 A;  2EC6 C;  2JT8 A;  3TZ1 A;  1Y1A A;  1PSB A;  1C07 A;  2JU0 A;  4GGF A;  1BR4 B;  5AFP A;  2KGR A;  2ZN9 A;  1ALW A;  2JC2 A;  5HYD A;  2JNX A;  2FOT A;  1MHO A;  1NCX A;  2BBN A;  2L5X B;  4MBE A;  4CLN A;  5HLV A;  1YR5 A;  1AJ5 A;  4P5O E;  1R2U A;  3BUX B;  1H4B A;  5KU1 A;  4AOM A;  1S5G Z;  1EJ3 A;  2VRG A;  1CDP A;  4QJ3 B;  1QAT A;  1FF1 A;  1JSA A;  3NSI A;  1CLM A;  2KI4 B;  3A8R A;  2LCP A;  1TN4 A;  3QRX A;  4IL1 A;  1CDN A;  2GV5 A;  1UWO A;  3VRP A;  2BE4 A;  5I2O A;  2QPT A;  4WRI A;  5AAN A;  4HRG A;  1DVI A;  1S3P A;  1QLK A;  1ZMZ A;  4QJ4 B;  1DJG A;  3LK0 A;  1KSM A;  2CNP A;  3OP0 A;  1SL8 A;  1EG3 A;  1DF0 A;  2K7D A;  1CMG A;  1RRO A;  3GK1 A;  4MZK A;  4YGC B;  2LC5 A;  2LAN A;  1NX3 A;  4MSP A;  1B8C A;  2KOT A;  3EVU A;  5AER A;  1UHN A;  2SCP A;  3ICB A;  4N5X A;  3KEV A;  1XO5 A;  3LL8 B;  4A4C A;  1H8B A;  2LP3 A;  1K9U A;  2JT0 A;  2P6B B;  1NUB A;  2ZFD A;  3KPX A;  2OTG C;  1FBV A;  2L4H A;  2M3W A;  1SKT A;  4GNK B;  1IJ5 A;  3CZT X;  3SG3 A;  3TDZ A;  4DUQ A;  1U5I B;  3OX6 A;  1BF5 A;  1PAL A;  3TDI A;  3VRO A;  2K0J A;  3FWB A;  1QX5 B;  1BG1 A;  3SG6 A;  2KQ6 A;  1M63 B;  3C1V A;  3WHT B;  1IRJ A;  2BL0 B;  1IH0 A;  1WRL A;  1UHI A;  4M2Q A;  4ORB B;  1C7V A;  4YI8 A;  1XFW O;  5K89 A;  2E6W A;  2WOS A;  3FS7 A;  1FI6 A;  2JTT A;  2FCD A;  2K2A A;  1NCZ A;  2K7C A;  1MUX A;  4YBH B;  4XYN A;  5D69 A;  2JUL A;  1BJF A;  2KAY A;  1BR1 B;  3BXK A;  1KK7 Z;  2I7A A;  1K9P A;  3D0Y A;  1F55 A;  3MSE B;  1NX2 A;  1UHH A;  3EK8 A;  3JTD C;  1TCO B;  1S6I A;  2KHN A;  1SW8 A;  4PE7 A;  1OMR A;  2JT3 A;  2LLU A;  4GAO A;  3GK2 A;  4HSZ A;  2LM5 A;  2E30 A;  1YRU B;  1F8H A;  2RGI A;  1F71 A;  1TNP A;  3CLN A;  1QIV A;  1ZAC A;  3D10 A;  1GJY A;  3FIA A;  4L9M A;  3EVV A;  5I2L A;  3PN7 B;  3VRN A;  1KK8 C;  1LIN A;  4MZL A;  2CXJ A;  1YRT B;  2H61 A;  4MRX A;  2WCF A;  2MLF C;  2LVI A;  2PVB A;  1QLS A;  3KO0 A;  4NDC A;  1KWO C;  2CTN A;  3DD4 A;  5I8N A;  1SCM B;  3LLE A;  5F6T A;  4ETO A;  2LV7 A;  1K2H A;  4MN0 A;  3ZNI A;  2KNE A;  1NIW A;  1AVS A;  1TRF A;  1WLM A;  1XA5 A;  4NDB A;  4CFQ A;  3M0W A;  2JPT A;  1J1D A;  4C0J A;  1KK7 Y;  4BY5 A;  2MLE C;  4R1E A;  4YRU A;  2LUX A;  3TUY C;  4ICB A;  4NDD A;  1WY9 A;  1AHR A;  1MR8 A;  1JFJ A;  2L98 A;  3BOW B;  3WXA A;  1IGV A;  2OS8 C;  3BUO B;  3GK4 X;  4CID A;  1OMV A;  3IQO A;  1DTL A;  3O78 A;  2AAO A;  2ZND A;  1QV0 A;  1CFC A;  3DVJ A;  4CPV A;  1QVI Y;  1F4Q A;  2ZRS A;  3NXA A;  1F54 A;  2M7L A;  1NP8 A;  2JOJ A;  2OPO A;  4C0L A;  1TIZ A;  4M2P A;  1DJX A;  2Q4U A;  1NX0 A;  2I2R E;  3CR4 X;  3SG2 A;  2O5G A;  1XFY O;  2AUC A;  1QJT A;  1WRK A;  1G8I A;  4MZJ A;  3CTN A;  2JWW A;  1YUR A;  1QAS A;  1OOJ A;  2K7O A;  2KDH A;  1K9K A;  3DF0 B;  1LVC D;  2LHI A;  1F70 A;  2I94 A;  1SY9 A;  3F45 A;  3BUM B;  1UUS A;  2EC6 B;  2QAC A;  2BEC A;  1C7W A;  3DVK A;  3NSO A;  1R6P A;  5J3X A;  2F3Z A;  1DT7 B;  1DJH A;  1KFU S;  1A03 A;  1UHK A;  2KI6 D;  4USL A;  4DRW A;  5KTY A;  2BBM A;  1HQV A;  2M8U A;  2LAP A;  3IQQ A;  4JWQ A;  1MXE A;  5B8I B;  1A75 A;  2ZN8 A;  2K61 A;  4PHK A;  1LA0 A;  1J7Q A;  1ALV A;  1JF2 A;  1B7T Y;  1YVL A;  4OVN F;  4E68 A;  2KYC A;  3CS1 A;  3I5F C;  2HET A;  1WDC B;  1SR6 C;  4CFR A;  1AP4 A;  2KSP A;  1KFU L;  2GGM A;  2Y4Q A;  4UPG A;  1L2O C;  4ORA B;  1YTZ C;  3BQ3 A;  1V1F A;  1YUU A;  5HKW A;  1SMG A;  4BY4 A;  4ZCV A;  1W7I B;  1OE9 B;  1DF0 B;  1QXP A;  3AKB A;  3O4Y A;  1OQP A;  4A4B A;  1S26 D;  4MLW A;  3OB1 B;  1JC2 A;  1VRK A;  1QX2 A;  1S36 A;  2JXL A;  1S5G Y;  4PE4 A;  1BU3 A;  2KI6 C;  2V53 A;  2LMU A;  3HCM A;  1TTX A;  1SK6 D;  1TNQ A;  1SPY A;  1XFX O;  2F2P A;  1A2X A;  4GBA A;  3PM8 A;  1EL4 A;  4HRE E;  2CT9 A;  1REC A;  3DVM A;  5KSZ A;  4GUK A;  3OB2 B;  2KGB C;  4PAL A;  3AAJ A;  1A4P A;  1CDM A;  2BE6 A;  3GOF A;  2NXQ A;  2A4J A;  1QX7 A;  5DKR A;  1NPQ A;  2LUC A;  1SL7 A;  1J55 A;  4I5K A;  2O60 A;  1KCY A;  4OV2 A;  1DJI A;  3TS5 C;  2ZRT A;  1Y1U A;  1J7P A;  2LMT A;  2EGD A;  4WQ2 A;  2KFH A;  1RJV A;  3O6B A;  3NSK A;  1QV1 A;  3PAL A;  1KQM B;  1B8R A;  1XYD A;  1FI5 A;  2H61 C;  3D0Y B;  1S1E A;  1XK4 C;  1LXF C;  2DOQ A;  2Y1N A;  3WNX B;  1J1E A;  2M97 A;  4JQ0 D;  2M49 B;  5PAL A;  2MA2 A;  3BUW B;  2TN4 A;  1IJ6 A;  1FW4 A;  1RFJ A;  2KQY A;  3SIB A;  3PN7 C;  1IQ3 A;  2BCA A;  4P2Y B;  3I5I B;  1XK4 A;  5JOL A;  3FWC A;  1K95 A;  1SBJ A;  3SIA A;  1E8A A;  1G33 A;  2KAV A;  1BMO A;  2M0R A;  4PE1 A;  2MRD A;  1NSH A;  2M29 A; 
#chains in the Genus database with same CATH topology
 1TOP A;  2LNK A;  2PRU A;  3KHE A;  3L4L A;  4DS7 A;  2PSR A;  3I5H C;  4PCW A;  1PSR A;  3EK7 A;  3PAT A;  2KAX A;  5FI7 A;  2KLE A;  2MAZ A;  1TWO A;  2G9B A;  2SAS A;  5HL1 A;  3OHM B;  1OMD A;  1EXR A;  1M45 A;  4MEW A;  1KK8 B;  2LVV A;  2JTZ A;  1PVB A;  4XJK B;  1K96 A;  2BKH B;  1CM4 A;  5CSN A;  5ER4 X;  1JF0 A;  2HPS A;  1SL9 A;  2LE9 B;  2F2O A;  2KFG A;  3ZWH A;  1KWO B;  1CNP A;  1B8L A;  2I18 A;  4HRH A;  3JVT C;  4PT1 A;  2EHB A;  2KFF A;  2WND A;  1B4C A;  3PLF B;  4N1F A;  2IS9 A;  2JZI A;  3L4A A;  1QTX A;  2NCO A;  2R2I A;  5HKY A;  2KLD A;  2FCE A;  3FE6 A;  1AUI B;  3E3R A;  1NYA A;  3VGO A;  1K90 D;  1MF8 B;  5I94 A;  3I5G B;  4JPZ B;  2WCK A;  1MXL C;  4JD9 A;  1S6C A;  3NGV A;  3CZ1 A;  2BKI B;  2KBM A;  2ISD A;  1Y1X A;  2L0P A;  1BLQ A;  4YGB B;  1CTR A;  4YGE B;  1CLL A;  2H8V A;  2H2K A;  2QEO A;  5JJG A;  1QWV A;  1IIO A;  1ZOT B;  1M39 A;  1N0Y A;  2FJU B;  1IWQ A;  4AQJ A;  1KQV A;  2WCB A;  1RK9 A;  1DJZ A;  4FTG A;  4INW A;  1S6J A;  4GGN A;  1GGZ A;  2HQ8 A;  3SJS A;  1SYM A;  3VRQ A;  1K94 A;  2KI4 C;  1W7J B;  3O2P A;  1SSE B;  4MVF A;  4ZCU A;  3FE9 A;  2FJY A;  1PVA A;  4KYN A;  5CSJ A;  1JWD A;  4DIR A;  5HLO A;  4YGD B;  2ZNE A;  3IF7 A;  4YGA A;  1C3Z A;  5GQQ C;  1AJ4 A;  3DF0 A;  2AMI A;  2K60 A;  3S0B A;  3PSR A;  3VRR A;  4OR9 B;  3SS4 A;  1PRW A;  1P28 A;  1JFK A;  4WQ3 A;  1SNL A;  1Y6W A;  3TDU A;  1WDC C;  2P71 A;  5D7F A;  1B47 A;  3LCP C;  1A75 B;  2L50 A;  2M7N A;  2L51 A;  1KFX S;  1K93 D;  1K8U A;  1OW4 A;  1PK0 D;  1DGU A;  2QEB A;  4PHN A;  4C0K A;  5HKZ A;  1AK8 A;  1WRZ A;  4AQI A;  2QEH A;  2LVK A;  3DVE A;  3EKH A;  2L4I A;  1XFU O;  1SCV A;  4MRY A;  4OKH A;  3RLZ A;  2K8M B;  2COL B;  5EL2 A;  3S0G A;  1RTP 1;  2ZKM X;  1CB1 A;  1CFD A;  1KFX L;  4GFT A;  1CFF A;  3I5F B;  2F3Y A;  1SR6 B;  3R1O A;  2JRF A;  3RM1 A;  1DQE A;  1YX7 A;  1XFV O;  2M9G A;  2JNF A;  3NHI A;  3AKA A;  4DCK A;  1L2O B;  1ZUZ A;  1KSO A;  1CM1 A;  1NWD A;  1YVH A;  1OSA A;  2JXC A;  3BYA A;  3V2L A;  2Y5I A;  1LA3 A;  2BL0 C;  1TNW A;  3R1V A;  4QJ5 B;  1CMF A;  1QIW A;  1U5I A;  2F8P A;  1IQ5 A;  4PHJ A;  2MHH A;  2BCX A;  3A4U B;  1UUR A;  2GGZ A;  3CWG A;  2WOR A;  2OTG B;  4D1E A;  1XFZ O;  3CR5 X;  3KF9 A;  4I5J A;  1IKU A;  2CBL A;  4N1G A;  1G4Y R;  1FPW A;  1X02 A;  1UHJ A;  1CKK A;  1D1O A;  1IG5 A;  1RWY A;  1CLB A;  2WC8 A;  1KQM C;  4PDZ A;  2JQ6 A;  2KYF A;  5I2Q A;  1L7Z A;  2K7B A;  3UO9 A;  2Y1M A;  3SG4 A;  3CGA A;  5CSI A;  4ORC B;  5CPV A;  3SG7 A;  1OOI X;  1EG4 A;  1DJW A;  1YX8 A;  2B1U A;  2LLS A;  2LVJ A;  1MWN A;  2PAS A;  4F0Z B;  5AXI A;  3LK1 A;  3TS5 B;  3L47 A;  2WC6 A;  1V1G A;  4I5L B;  3I5I C;  4M2O A;  4TNC A;  1NCY A;  2HF5 A;  3JTD B;  1CDL A;  4I5N B;  1SCM C;  3OX5 A;  2CCM A;  1C3Y A;  2D8N A;  1DEK A;  4YI9 A;  2G2B A;  1OZO A;  5AEQ A;  1W9Z A;  1M31 A;  2PQL A;  1HT9 A;  2LLT A;  1CFP A;  1GQM A;  1JUO A;  1XVJ A;  1LKJ A;  1DGV A;  5DKQ A;  2NZ0 A;  2M1U A;  1NX1 A;  1QVI Z;  3EVR A;  3BUN B;  5FI2 A;  3D77 A;  2MBX A;  2HQW A;  2M1K B;  2BCB A;  1Q80 A;  5BPJ A;  1F4O A;  5TNC A;  1BOC A;  3B7A A;  3PJI A;  5DKN A;  3K1E A;  1DJY A;  4FQO A;  2LMV A;  1ZFS A;  1SRA A;  2F33 A;  2YGU A;  5G08 A;  4Q04 A;  3EK4 A;  2PMY A;  1MQ1 A;  1GGW A;  4GPL B;  1TCF A;  2PAL A;  4U8D A;  2MJW B;  3H4S E;  3I5H B;  4NQG A;  1JBA A;  3CZ2 A;  4XJK A;  1J7R A;  3QME A;  5FYX A;  1N65 A;  1A29 A;  3EKJ A;  3BOW A;  3CDN A;  5CSF A;  1WLZ A;  2L2E A;  1B9A A;  1YUT A;  2WCM A;  3AAK A;  3I5G C;  1OZS A;  3PFV A;  2KBI A;  1J7O A;  3TUY B;  1B1G A;  2K2F A;  5ER5 A;  1QS7 A;  4PE0 A;  3VB1 A;  1PUL A;  1BOD A;  5IBW A;  2LP2 A;  3NSL A;  4IJ7 A;  1M46 A;  2OS8 B;  2Q91 A;  3JVT B;  4GGF C;  4OCI A;  2LHL A;  3K21 A;  1BT6 A;  1TUJ A;  1N2D A;  1Y0V H;  2WCE A;  1DMO A;  1EH2 A;  1YUS A;  1ODB A;  2NCP A;  3CR2 A;  1B7T Z;  1UP5 A;  3WHU B;  3HX4 A;  4PHM A;  2NLN A;  1TNX A;  4FQT A;  3SG5 A;  2EC6 C;  2JT8 A;  3TZ1 A;  1Y1A A;  1PSB A;  1C07 A;  2JU0 A;  4GGF A;  1BR4 B;  5AFP A;  2KGR A;  2ZN9 A;  1ALW A;  2JC2 A;  5HYD A;  2JNX A;  2FOT A;  1MHO A;  1NCX A;  2BBN A;  2L5X B;  4MBE A;  4CLN A;  5HLV A;  1YR5 A;  1AJ5 A;  4P5O E;  4OZD A;  1R2U A;  3BUX B;  3RZS A;  1H4B A;  5KU1 A;  3CYZ A;  1ORG A;  3D75 A;  2L5Y A;  4AOM A;  3PM2 A;  1S5G Z;  4F7F A;  1EJ3 A;  2VRG A;  1CDP A;  4QJ3 B;  1QAT A;  1FF1 A;  1JSA A;  3NSI A;  1CLM A;  2KI4 B;  3A8R A;  2LCP A;  1TN4 A;  3QRX A;  4IL1 A;  3S0E A;  1CDN A;  2GV5 A;  1UWO A;  3VRP A;  2BE4 A;  5I2O A;  2QPT A;  1LS8 A;  4WRI A;  5AAN A;  3SS5 A;  4HRG A;  1DVI A;  1S3P A;  3S0F A;  1QLK A;  1ZMZ A;  4QJ4 B;  1DJG A;  3LK0 A;  1KSM A;  2CNP A;  3OP0 A;  1SL8 A;  1EG3 A;  1DF0 A;  2K7D A;  1CMG A;  1RRO A;  3GK1 A;  4MZK A;  4YGC B;  2LC5 A;  2LAN A;  1NX3 A;  4MSP A;  1B8C A;  2ERB A;  2KOT A;  3EVU A;  1UHN A;  2SCP A;  3ICB A;  4N5X A;  5AER A;  1XFR A;  3KEV A;  1XO5 A;  3LL8 B;  4A4C A;  1H8B A;  2LP3 A;  1K9U A;  2JT0 A;  2P6B B;  3B6X A;  3CAB A;  1NUB A;  2ZFD A;  3KPX A;  2OTG C;  1FBV A;  2L4H A;  2M3W A;  1SKT A;  4GNK B;  1IJ5 A;  3CZT X;  3SG3 A;  3TDZ A;  4DUQ A;  1U5I B;  3OX6 A;  3DZT A;  1PAL A;  1BF5 A;  1OOH A;  3TDI A;  3VRO A;  2K0J A;  3FWB A;  1QX5 B;  1BG1 A;  3DYE A;  3SG6 A;  2KQ6 A;  1M63 B;  3C1V A;  3WHT B;  1IRJ A;  5D3O A;  2BL0 B;  1IH0 A;  1WRL A;  1UHI A;  4M2Q A;  4ORB B;  1C7V A;  4YI8 A;  1XFW O;  5K89 A;  2E6W A;  2GTE A;  2WOS A;  3FS7 A;  1FI6 A;  2JTT A;  3D73 A;  2FCD A;  2K2A A;  1NCZ A;  2K7C A;  1MUX A;  4YBH B;  4XYN A;  5D69 A;  2JUL A;  1BJF A;  2KAY A;  1BR1 B;  3BXK A;  3FE8 A;  1KK7 Z;  2I7A A;  1K9P A;  3D0Y A;  1F55 A;  1GM0 A;  3MSE B;  1NX2 A;  1UHH A;  3EK8 A;  3JTD C;  1TCO B;  1S6I A;  2KHN A;  1SW8 A;  2KPH A;  4PE7 A;  1OMR A;  2JT3 A;  2LLU A;  4GAO A;  3GK2 A;  4HSZ A;  2LM5 A;  2E30 A;  3N7H A;  1YRU B;  1F8H A;  2RGI A;  2P70 A;  1F71 A;  1TNP A;  3CLN A;  3SS3 A;  1QIV A;  1ZAC A;  3D10 A;  3O4X A;  1GJY A;  3FIA A;  4L9M A;  2JPO A;  3EVV A;  5I2L A;  1DEL A;  3PN7 B;  3VRN A;  1KK8 C;  3S0A A;  1LIN A;  4MZL A;  2CXJ A;  1YRT B;  2H61 A;  4MRX A;  2WCF A;  2MLF C;  2LVI A;  2PVB A;  1QLS A;  3KO0 A;  4NDC A;  3S0D A;  1KWO C;  2CTN A;  3DD4 A;  5I8N A;  1SCM B;  3LLE A;  5F6T A;  4ETO A;  2LV7 A;  1K2H A;  4MN0 A;  3ZNI A;  3D76 A;  1TUZ A;  2KNE A;  1NIW A;  1AVS A;  1TRF A;  1WLM A;  1XA5 A;  3CZ0 A;  4NDB A;  4CFQ A;  3M0W A;  2JPT A;  1J1D A;  4C0J A;  1KK7 Y;  4BY5 A;  2MLE C;  4R1E A;  4YRU A;  2LUX A;  3TUY C;  2QEV A;  4ICB A;  4NDD A;  1WY9 A;  1AHR A;  1MR8 A;  1JFJ A;  2L98 A;  3BOW B;  3WXA A;  1IGV A;  2OS8 C;  3BUO B;  3GK4 X;  4CID A;  1OMV A;  3IQO A;  1DTL A;  3O78 A;  2AAO A;  3OGN A;  2ZND A;  1QV0 A;  1CFC A;  3DVJ A;  4CPV A;  3EG5 B;  1QVI Y;  1F4Q A;  2ZRS A;  3NXA A;  1F54 A;  2M7L A;  1NP8 A;  2JOJ A;  2OPO A;  4C0L A;  1TIZ A;  4M2P A;  1DJX A;  2Q4U A;  1NX0 A;  2I2R E;  2WC5 A;  3CR4 X;  3SG2 A;  2O5G A;  1XFY O;  2AUC A;  2PYQ A;  1QJT A;  1WRK A;  1G8I A;  4MZJ A;  3CTN A;  2JWW A;  1YUR A;  1Z4H A;  1QAS A;  1OOJ A;  2K7O A;  2KDH A;  2WCL A;  3IVT A;  1K9K A;  3B86 A;  3DF0 B;  1LVC D;  2LHI A;  1F70 A;  2I94 A;  1SY9 A;  3F45 A;  3BUM B;  1UUS A;  2EC6 B;  2QAC A;  2BEC A;  1C7W A;  3DVK A;  3NSO A;  1R6P A;  3D74 A;  5J3X A;  2F3Z A;  1DT7 B;  1DJH A;  1KFU S;  1A03 A;  1UHK A;  2KI6 D;  4USL A;  4DRW A;  5KTY A;  2BBM A;  1HQV A;  2M8U A;  2LAP A;  3IQQ A;  3BJH A;  2BNX A;  4JWQ A;  1MXE A;  5B8I B;  1A75 A;  2ZN8 A;  2K61 A;  4PHK A;  1LA0 A;  1J7Q A;  1ALV A;  1JF2 A;  1B7T Y;  1YVL A;  4OVN F;  4E68 A;  2KYC A;  3CS1 A;  3I5F C;  2HET A;  1WDC B;  1SR6 C;  4CFR A;  1AP4 A;  2KSP A;  1KFU L;  2GGM A;  2Y4Q A;  1Z2C B;  4UPG A;  1L2O C;  4ORA B;  3D78 A;  1YTZ C;  3BQ3 A;  1V1F A;  1T14 A;  1YUU A;  3R1P A;  5HKW A;  1SMG A;  4BY4 A;  4ZCV A;  1W7I B;  2QDI A;  1OE9 B;  1DF0 B;  1QXP A;  3AKB A;  3O4Y A;  1OQP A;  4A4B A;  3BFH A;  1S26 D;  4MLW A;  3OB1 B;  1JC2 A;  1VRK A;  1QX2 A;  1S36 A;  2JXL A;  1S5G Y;  4PE4 A;  1BU3 A;  2KI6 C;  2V53 A;  3BFA A;  2LMU A;  3HCM A;  1TTX A;  3OBV A;  1SK6 D;  1TNQ A;  1SPY A;  1XFX O;  2F2P A;  2L2C A;  1A2X A;  2WCJ A;  2WCH A;  3PM8 A;  1EL4 A;  4GBA A;  2CT9 A;  4HRE E;  1REC A;  3DVM A;  5KSZ A;  4GUK A;  3B87 A;  3OB2 B;  2KGB C;  4PAL A;  3AAJ A;  1A4P A;  1CDM A;  2BE6 A;  3GOF A;  4JKT A;  2NXQ A;  2A4J A;  1QX7 A;  5DKR A;  1NPQ A;  2LUC A;  3DXL A;  1SL7 A;  1J55 A;  3Q8I A;  4I5K A;  2O60 A;  1KCY A;  5DIC A;  4OV2 A;  1DJI A;  3NHT A;  3TS5 C;  2ZRT A;  1Y1U A;  1J7P A;  2LMT A;  2EGD A;  4WQ2 A;  2KFH A;  1RJV A;  3O6B A;  3NSK A;  1QV1 A;  2BAP A;  3PAL A;  1KQM B;  4INX A;  1B8R A;  1XYD A;  1FI5 A;  2H61 C;  3D0Y B;  1S1E A;  1XK4 C;  1LXF C;  1OOF A;  2DOQ A;  2Y1N A;  3WNX B;  1J1E A;  5FI6 A;  2M97 A;  1OOG A;  4JQ0 D;  2M49 B;  5PAL A;  2MA2 A;  3BUW B;  1DC1 A;  2TN4 A;  1IJ6 A;  1FW4 A;  1RFJ A;  2KQY A;  3SIB A;  3PN7 C;  1IQ3 A;  2BCA A;  4P2Y B;  3R72 A;  3I5I B;  1XK4 A;  3DY9 A;  5JOL A;  3FWC A;  1K95 A;  3BFB A;  3UNW A;  1SBJ A;  3B88 A;  1E8A A;  1G33 A;  3SIA A;  2KAV A;  1BMO A;  2M0R A;  4PE1 A;  2MRD A;  1NSH A;  2M29 A; 
#chains in the Genus database with same CATH homology
 1TOP A;  2LNK A;  2PRU A;  3KHE A;  4DS7 A;  2PSR A;  3I5H C;  4PCW A;  1PSR A;  3EK7 A;  3PAT A;  2KAX A;  2MAZ A;  2G9B A;  2SAS A;  3OHM B;  1OMD A;  1EXR A;  1M45 A;  4MEW A;  1KK8 B;  2LVV A;  2JTZ A;  1PVB A;  4XJK B;  1K96 A;  2BKH B;  1CM4 A;  5CSN A;  5ER4 X;  1JF0 A;  2HPS A;  1SL9 A;  2LE9 B;  2F2O A;  2KFG A;  3ZWH A;  1KWO B;  1CNP A;  1B8L A;  2I18 A;  4HRH A;  3JVT C;  2EHB A;  2KFF A;  2WND A;  1B4C A;  3PLF B;  4N1F A;  2IS9 A;  2JZI A;  1QTX A;  2NCO A;  2R2I A;  5HKY A;  2FCE A;  1AUI B;  3E3R A;  1NYA A;  3VGO A;  1K90 D;  1MF8 B;  3I5G B;  4JPZ B;  1MXL C;  1S6C A;  2BKI B;  2KBM A;  2ISD A;  1Y1X A;  2L0P A;  1BLQ A;  4YGB B;  1CTR A;  4YGE B;  1CLL A;  2H2K A;  5JJG A;  1ZOT B;  1M39 A;  1N0Y A;  2FJU B;  1IWQ A;  4AQJ A;  1KQV A;  2WCB A;  1RK9 A;  1DJZ A;  4FTG A;  1S6J A;  4GGN A;  1GGZ A;  2HQ8 A;  3SJS A;  1SYM A;  3VRQ A;  1K94 A;  2KI4 C;  1W7J B;  3O2P A;  4MVF A;  4ZCU A;  1PVA A;  5CSJ A;  1JWD A;  4DIR A;  5HLO A;  4YGD B;  2ZNE A;  3IF7 A;  4YGA A;  5GQQ C;  1AJ4 A;  3DF0 A;  2AMI A;  3PSR A;  3VRR A;  4OR9 B;  1PRW A;  1JFK A;  4WQ3 A;  1SNL A;  1Y6W A;  3TDU A;  1WDC C;  5D7F A;  1B47 A;  3LCP C;  1A75 B;  2L50 A;  2M7N A;  2L51 A;  1KFX S;  1K93 D;  1K8U A;  1PK0 D;  1DGU A;  4PHN A;  4C0K A;  5HKZ A;  1AK8 A;  1WRZ A;  4AQI A;  2LVK A;  3DVE A;  3EKH A;  2L4I A;  1XFU O;  1SCV A;  4MRY A;  4OKH A;  3RLZ A;  2K8M B;  2COL B;  1RTP 1;  2ZKM X;  1CB1 A;  1CFD A;  1KFX L;  4GFT A;  1CFF A;  3I5F B;  2F3Y A;  1SR6 B;  2JRF A;  3RM1 A;  1XFV O;  1YX7 A;  2M9G A;  2JNF A;  3AKA A;  4DCK A;  1L2O B;  1ZUZ A;  1KSO A;  1CM1 A;  1NWD A;  1YVH A;  1OSA A;  2JXC A;  3BYA A;  2Y5I A;  1LA3 A;  2BL0 C;  1TNW A;  4QJ5 B;  1CMF A;  1QIW A;  1U5I A;  2F8P A;  1IQ5 A;  4PHJ A;  2MHH A;  2BCX A;  3A4U B;  1UUR A;  2GGZ A;  3CWG A;  2WOR A;  2OTG B;  4D1E A;  1XFZ O;  3CR5 X;  3KF9 A;  4I5J A;  1IKU A;  2CBL A;  4N1G A;  1G4Y R;  1FPW A;  1X02 A;  1UHJ A;  1CKK A;  1D1O A;  1IG5 A;  1RWY A;  1CLB A;  2WC8 A;  1KQM C;  4PDZ A;  2JQ6 A;  2KYF A;  5I2Q A;  1L7Z A;  2K7B A;  2Y1M A;  3SG4 A;  3CGA A;  5CSI A;  4ORC B;  5CPV A;  3SG7 A;  1EG4 A;  1DJW A;  1YX8 A;  2B1U A;  2LLS A;  2LVJ A;  1MWN A;  2PAS A;  4F0Z B;  5AXI A;  3LK1 A;  3TS5 B;  1V1G A;  4I5L B;  3I5I C;  4M2O A;  4TNC A;  1NCY A;  2HF5 A;  3JTD B;  1CDL A;  4I5N B;  1SCM C;  3OX5 A;  2CCM A;  2D8N A;  4YI9 A;  2G2B A;  1OZO A;  5AEQ A;  1M31 A;  1HT9 A;  2LLT A;  1CFP A;  1GQM A;  1JUO A;  1XVJ A;  1LKJ A;  1DGV A;  5DKQ A;  2NZ0 A;  2M1U A;  1NX1 A;  1QVI Z;  3EVR A;  3BUN B;  2MBX A;  2HQW A;  2M1K B;  2BCB A;  1Q80 A;  5BPJ A;  1F4O A;  5TNC A;  1BOC A;  5DKN A;  1DJY A;  4FQO A;  2LMV A;  1ZFS A;  1SRA A;  2F33 A;  5G08 A;  4Q04 A;  3EK4 A;  2PMY A;  1MQ1 A;  1GGW A;  4GPL B;  1TCF A;  2PAL A;  4U8D A;  2MJW B;  3H4S E;  3I5H B;  4NQG A;  1JBA A;  4XJK A;  1J7R A;  5FYX A;  1N65 A;  1A29 A;  3EKJ A;  3BOW A;  5CSF A;  1WLZ A;  2L2E A;  1B9A A;  1YUT A;  3I5G C;  3AAK A;  3PFV A;  1OZS A;  2KBI A;  1J7O A;  3TUY B;  1B1G A;  2K2F A;  5ER5 A;  1QS7 A;  4PE0 A;  1PUL A;  1BOD A;  5IBW A;  2LP2 A;  3NSL A;  1M46 A;  2OS8 B;  2Q91 A;  3JVT B;  4GGF C;  4OCI A;  2LHL A;  3K21 A;  1BT6 A;  1Y0V H;  1N2D A;  2WCE A;  1DMO A;  1EH2 A;  1YUS A;  1ODB A;  2NCP A;  3CR2 A;  1B7T Z;  1UP5 A;  3WHU B;  3HX4 A;  4PHM A;  2NLN A;  1TNX A;  3SG5 A;  2EC6 C;  2JT8 A;  3TZ1 A;  1Y1A A;  1PSB A;  1C07 A;  2JU0 A;  4GGF A;  1BR4 B;  5AFP A;  2KGR A;  2ZN9 A;  1ALW A;  2JC2 A;  5HYD A;  2JNX A;  2FOT A;  1MHO A;  1NCX A;  2BBN A;  2L5X B;  4MBE A;  4CLN A;  5HLV A;  1YR5 A;  1AJ5 A;  4P5O E;  1R2U A;  3BUX B;  1H4B A;  5KU1 A;  4AOM A;  1S5G Z;  1EJ3 A;  2VRG A;  1CDP A;  4QJ3 B;  1QAT A;  1FF1 A;  1JSA A;  3NSI A;  1CLM A;  2KI4 B;  3A8R A;  2LCP A;  1TN4 A;  3QRX A;  4IL1 A;  1CDN A;  2GV5 A;  1UWO A;  3VRP A;  2BE4 A;  5I2O A;  2QPT A;  4WRI A;  5AAN A;  4HRG A;  1DVI A;  1S3P A;  1QLK A;  1ZMZ A;  4QJ4 B;  1DJG A;  3LK0 A;  1KSM A;  2CNP A;  3OP0 A;  1SL8 A;  1EG3 A;  1DF0 A;  2K7D A;  1CMG A;  1RRO A;  3GK1 A;  4MZK A;  4YGC B;  2LC5 A;  2LAN A;  1NX3 A;  4MSP A;  1B8C A;  2KOT A;  3EVU A;  5AER A;  1UHN A;  2SCP A;  3ICB A;  4N5X A;  3KEV A;  1XO5 A;  3LL8 B;  4A4C A;  1H8B A;  2LP3 A;  1K9U A;  2JT0 A;  2P6B B;  1NUB A;  2ZFD A;  3KPX A;  2OTG C;  1FBV A;  2L4H A;  2M3W A;  1SKT A;  4GNK B;  1IJ5 A;  3CZT X;  3SG3 A;  3TDZ A;  4DUQ A;  1U5I B;  3OX6 A;  1BF5 A;  1PAL A;  3TDI A;  3VRO A;  2K0J A;  3FWB A;  1QX5 B;  1BG1 A;  3SG6 A;  2KQ6 A;  1M63 B;  3C1V A;  3WHT B;  1IRJ A;  2BL0 B;  1IH0 A;  1WRL A;  1UHI A;  4M2Q A;  4ORB B;  1C7V A;  4YI8 A;  1XFW O;  5K89 A;  2E6W A;  2WOS A;  3FS7 A;  1FI6 A;  2JTT A;  2FCD A;  2K2A A;  1NCZ A;  2K7C A;  1MUX A;  4YBH B;  4XYN A;  5D69 A;  2JUL A;  1BJF A;  2KAY A;  1BR1 B;  3BXK A;  1KK7 Z;  2I7A A;  1K9P A;  3D0Y A;  1F55 A;  3MSE B;  1NX2 A;  1UHH A;  3EK8 A;  3JTD C;  1TCO B;  1S6I A;  2KHN A;  1SW8 A;  4PE7 A;  1OMR A;  2JT3 A;  2LLU A;  4GAO A;  3GK2 A;  4HSZ A;  2LM5 A;  2E30 A;  1YRU B;  1F8H A;  2RGI A;  1F71 A;  1TNP A;  3CLN A;  1QIV A;  1ZAC A;  3D10 A;  1GJY A;  3FIA A;  4L9M A;  3EVV A;  5I2L A;  3PN7 B;  3VRN A;  1KK8 C;  1LIN A;  4MZL A;  2CXJ A;  1YRT B;  2H61 A;  4MRX A;  2WCF A;  2MLF C;  2LVI A;  2PVB A;  1QLS A;  3KO0 A;  4NDC A;  1KWO C;  2CTN A;  3DD4 A;  5I8N A;  1SCM B;  3LLE A;  5F6T A;  4ETO A;  2LV7 A;  1K2H A;  4MN0 A;  3ZNI A;  2KNE A;  1NIW A;  1AVS A;  1TRF A;  1WLM A;  1XA5 A;  4NDB A;  4CFQ A;  3M0W A;  2JPT A;  1J1D A;  4C0J A;  1KK7 Y;  4BY5 A;  2MLE C;  4R1E A;  4YRU A;  2LUX A;  3TUY C;  4ICB A;  4NDD A;  1WY9 A;  1AHR A;  1MR8 A;  1JFJ A;  2L98 A;  3BOW B;  3WXA A;  1IGV A;  2OS8 C;  3BUO B;  3GK4 X;  4CID A;  1OMV A;  3IQO A;  1DTL A;  3O78 A;  2AAO A;  2ZND A;  1QV0 A;  1CFC A;  3DVJ A;  4CPV A;  1QVI Y;  1F4Q A;  2ZRS A;  3NXA A;  1F54 A;  2M7L A;  1NP8 A;  2JOJ A;  2OPO A;  4C0L A;  1TIZ A;  4M2P A;  1DJX A;  2Q4U A;  1NX0 A;  2I2R E;  3CR4 X;  3SG2 A;  2O5G A;  1XFY O;  2AUC A;  1QJT A;  1WRK A;  1G8I A;  4MZJ A;  3CTN A;  2JWW A;  1YUR A;  1QAS A;  1OOJ A;  2K7O A;  2KDH A;  1K9K A;  3DF0 B;  1LVC D;  2LHI A;  1F70 A;  2I94 A;  1SY9 A;  3F45 A;  3BUM B;  1UUS A;  2EC6 B;  2QAC A;  2BEC A;  1C7W A;  3DVK A;  3NSO A;  1R6P A;  5J3X A;  2F3Z A;  1DT7 B;  1DJH A;  1KFU S;  1A03 A;  1UHK A;  2KI6 D;  4USL A;  4DRW A;  5KTY A;  2BBM A;  1HQV A;  2M8U A;  2LAP A;  3IQQ A;  4JWQ A;  1MXE A;  5B8I B;  1A75 A;  2ZN8 A;  2K61 A;  4PHK A;  1LA0 A;  1J7Q A;  1ALV A;  1JF2 A;  1B7T Y;  1YVL A;  4OVN F;  4E68 A;  2KYC A;  3CS1 A;  3I5F C;  2HET A;  1WDC B;  1SR6 C;  4CFR A;  1AP4 A;  2KSP A;  1KFU L;  2GGM A;  2Y4Q A;  4UPG A;  1L2O C;  4ORA B;  1YTZ C;  3BQ3 A;  1V1F A;  1YUU A;  5HKW A;  1SMG A;  4BY4 A;  4ZCV A;  1W7I B;  1OE9 B;  1DF0 B;  1QXP A;  3AKB A;  3O4Y A;  1OQP A;  4A4B A;  1S26 D;  4MLW A;  3OB1 B;  1JC2 A;  1VRK A;  1QX2 A;  1S36 A;  2JXL A;  1S5G Y;  4PE4 A;  1BU3 A;  2KI6 C;  2V53 A;  2LMU A;  3HCM A;  1TTX A;  1SK6 D;  1TNQ A;  1SPY A;  1XFX O;  2F2P A;  1A2X A;  4GBA A;  3PM8 A;  1EL4 A;  4HRE E;  2CT9 A;  1REC A;  3DVM A;  5KSZ A;  4GUK A;  3OB2 B;  2KGB C;  4PAL A;  3AAJ A;  1A4P A;  1CDM A;  2BE6 A;  3GOF A;  2NXQ A;  2A4J A;  1QX7 A;  5DKR A;  1NPQ A;  2LUC A;  1SL7 A;  1J55 A;  4I5K A;  2O60 A;  1KCY A;  4OV2 A;  1DJI A;  3TS5 C;  2ZRT A;  1Y1U A;  1J7P A;  2LMT A;  2EGD A;  4WQ2 A;  2KFH A;  1RJV A;  3O6B A;  3NSK A;  1QV1 A;  3PAL A;  1KQM B;  1B8R A;  1XYD A;  1FI5 A;  2H61 C;  3D0Y B;  1S1E A;  1XK4 C;  1LXF C;  2DOQ A;  2Y1N A;  3WNX B;  1J1E A;  2M97 A;  4JQ0 D;  2M49 B;  5PAL A;  2MA2 A;  3BUW B;  2TN4 A;  1IJ6 A;  1FW4 A;  1RFJ A;  2KQY A;  3SIB A;  3PN7 C;  1IQ3 A;  2BCA A;  4P2Y B;  3I5I B;  1XK4 A;  5JOL A;  3FWC A;  1K95 A;  1SBJ A;  3SIA A;  1E8A A;  1G33 A;  2KAV A;  1BMO A;  2M0R A;  4PE1 A;  2MRD A;  1NSH A;  2M29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...