1KSOA

Crystal structure of apo s100a3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 CALCIUM-BINDING PROTEIN A3
publication title Metal-free MIRAS phasing: structure of apo-S100A3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ksoA00
1UHKA 2OS8B 3BOWA 4GGNA 2M97A 1QLSA 4MZKA 1DJYA 1SL8A 4PE0A 1J7PA 2F3YA 1K94A 1QVIZ 4IL1A 3KEVA 4P2YB 2FOTA 2KI6C 3E3RA 2H61A 2BBMA 3JVTC 1KWOC 3O2PA 5HLVA 1RJVA 3SJSA 3EVRA 2KYCA 2M49B 4C0LA 2WORA 5I2OA 2K7CA 1UP5A 3SG2A 5CPVA 3BUMB 4FQOA 3DF0A 1DJIA 3EKJA 1FI6A 3BQ3A 1K8UA 1NX1A 3GK4X 2OS8C 2PSRA 1QLKA 1Y0VH 2F3ZA 2KBMA 4USLA 1BR1B 4AOMA 2JTZA 2PVBA 2JXLA 1YTZC 1B8RA 3WHUB 1OZSA 1J7OA 1QV1A 4MBEA 2LVVA 2JC2A 3SG7A 1DVIA 3DVEA 1S5GY 1KSMA 2BE6A 2NXQA 2HPSA 2LNKA 1AVSA 2ISDA 3O78A 1ODBA 1AP4A 1NX0A 4MRXA 2CT9A 2MLEC 1F54A 1TN4A 1Y6WA 1SNLA 1EXRA 1K9KA 2P6BB 5AEQA 2OTGC 4CPVA 1SBJA 1C7WA 1RECA 5I8NA 1CFPA 2NCPA 1JF0A 2SASA 2KFHA 3SIAA 1BG1A 2BKHB 1WY9A 1DJHA 3GOFA 3EKHA 4CFQA 1CLMA 1OMRA 1QX2A 1N2DA 4R1EA 1X02A 3FWCA 1EH2A 4XJKB 2KI6D 1IWQA 3O4YA 3OB1B 1DF0B 2LVKA 2LM5A 2Y1NA 3D0YB 1SR6B 1UHJA 1E8AA 3KF9A 4A4CA 1YVHA 2I2RE 1NPQA 3IF7A 1MXLC 1Y1UA 4WQ3A 2M9GA 1S3PA 2BE4A 2JZIA 3H4SE 4JQ0D 2LANA 2MHHA 1CFDA 4GAOA 4E68A 1TNWA 5DKQA 1K93D 2LVIA 1ALVA 1ZUZA 1TNXA 1SL9A 4N1FA 2F8PA 1RWYA 1BLQA 4OKHA 2V53A 1NCXA 5I2QA 1F70A 1KFXL 1FF1A 1M31A 2CNPA 2RGIA 2CTNA 2JT8A 1XFWO 2HQ8A 1NUBA 2ZKMX 3TS5B 1SMGA 2H2KA 1JSAA 2Q91A 4F0ZB 3BOWB 4GFTA 2LV7A 2LP3A 1YRUB 2JTTA 2ZFDA 4Q04A 5TNCA 3SIBA 1SY9A 4HRGA 1K2HA 4I5JA 1B1GA 5KSZA 2KAXA 2M7LA 3DVJA 3FS7A 3LK1A 2JT3A 5AFPA 2JRFA 1OQPA 4ORCB 1J7RA 1G8IA 4PHNA 5AXIA 1JFKA 2PALA 4NDCA 2K0JA 2KSPA 1TOPA 3NXAA 2I7AA 2K61A 4OCIA 1MQ1A 2M1KB 1SK6D 1EG4A 1TCOB 2LP2A 2ZRTA 3DF0B 3TS5C 1CB1A 1F71A 3JTDB 1CMFA 1KK8B 1LA3A 2WCFA 1IJ6A 2M29A 2QACA 3KHEA 2JULA 5D69A 2K7OA 1J7QA 1S6CA 4XYNA 1J55A 1F8HA 1U5IA 1OSAA 1KCYA 5AERA 1YUUA 1AJ5A 1IRJA 2JT0A 4YGDB 1S5GZ 3DVKA 3VRQA 3OB2B 2H61C 4MZJA 2BECA 1F55A 2QPTA 4JPZB 5PALA 2M3WA 1F4OA 1AK8A 1K95A 4CLNA 1B8LA 1NSHA 1WLZA 3SG3A 2LCPA 1ZOTB 1A29A 2KAVA 1M63B 3OX5A 1WRKA 5AANA 2Y5IA 1WRLA 3JTDC 1KK8C 2EGDA 1YVLA 4YGEB 3LL8B 1H8BA 1DGVA 2JWWA 2L50A 4PE4A 3NSKA 4P5OE 3PATA 2E30A 3VRNA 1K90D 2GV5A 1JF2A 3OP0A 2BCAA 1IGVA 3MSEB 4BY5A 1CTRA 2JPTA 1XA5A 1CM4A 4ZCUA 2MAZA 1TCFA 3PSRA 2MA2A 1SPYA 3A8RA 2AAOA 2M8UA 1OZOA 3BUWB 2LLTA 1Y1AA 3TZ1A 1QATA 2JNXA 2LUCA 4QJ5B 1RFJA 5JOLA 4NDDA 3K21A 2IS9A 2LVJA 1R2UA 4I5NB 1A03A 1B7TY 3EK4A 4MN0A 4WQ2A 4YRUA 4MSPA 2M7NA 5JJGA 1D1OA 1MHOA 5I2LA 2KQ6A 2K7DA 2KHNA 2PRUA 2FCDA 1M39A 2KBIA 2PASA 1HQVA 2G2BA 1DGUA 3BUNB 2L98A 1CDNA 1IH0A 3HX4A 2L4IA 4OV2A 2MBXA 3TDUA 1QJTA 2LMUA 1ZFSA 3CWGA 2KAYA 1BR4B 5FYXA 3AAKA 3LCPC 1UURA 1CM1A 1YR5A 4I5KA 4A4BA 1CDPA 2WCBA 1KQVA 1QX5B 1OOJA 2KDHA 3DD4A 3CR4X 1YUTA 2K2FA 2FCEA 1JC2A 4YBHB 1XFVO 2G9BA 1QASA 1DTLA 5CSIA 3ICBA 1DMOA 2ZRSA 1PVBA 1QTXA 3KPXA 1SW8A 1UHIA 4ORBB 1RROA 4MEWA 1XVJA 1S36A 1NWDA 2WCEA 1KK7Y 2BCXA 1UUSA 3IQQA 3PM8A 1JBAA 1MR8A 4M2QA 2GGMA 1U5IB 1ZACA 2AUCA 1KFXS 3A4UB 1PULA 4ETOA 3QRXA 5B8IB 2BL0B 1XK4A 2D8NA 1EJ3A 1J1EA 1PK0D 1SCMB 1W7IB 1SR6C 3TUYB 1YX7A 4GUKA 1C7VA 1B4CA 4GPLB 1TNQA 2E6WA 4YGAA 1L2OB 2NCOA 4QJ4B 3EVUA 1WDCB 1PVAA 1LVCD 1SCVA 2M1UA 1IQ5A 1PALA 1A4PA 3AKBA 4PDZA 1QS7A 1GGWA 3ZWHA 1IKUA 4N5XA 2EC6B 2AMIA 3BUOB 2NLNA 2L2EA 3BUXB 4L9MA 2LE9B 1S26D 2BBNA 1BT6A 3AKAA 5IBWA 1S6JA 2ZN8A 2WNDA 3OX6A 1C07A 2BL0C 4ICBA 1TIZA 1M46A 1MUXA 1NX2A 1UHNA 2FJUB 4GBAA 2EHBA 1BODA 1SCMC 3BXKA 3TUYC 4XJKA 3GK2A 1OMDA 2CCMA 4YGBB 1A75A 1BMOA 1QIWA 1KSOA 1YX8A 3NSIA 4YI8A 4ORAB 5ER5A 2HF5A 4MVFA 4PCWA 1L2OC 1L7ZA 1QXPA 3KO0A 4M2OA 4WRIA 1WDCC 5CSNA 1NP8A 5ER4X 3WXAA 1CDLA 4PHMA 1RTP1 4HREE 1LKJA 3C1VA 2M0RA 2L0PA 4FTGA 2CXJA 1K9UA 1ALWA 2JU0A 2LLSA 1YURA 2EC6C 2LMTA 4OR9B 2KI4B 3NSLA 4JWQA 4PHJA 2KGBC 4M2PA 4MZLA 1GJYA 5KU1A 3HCMA 2Y1MA 2LHIA 1K96A 1QIVA 1LA0A 1F4QA 2K7BA 1GQMA 3VRPA 1CNPA 1KQMB 1DT7B 4CIDA 1JFJA 2I94A 3LLEA 1NCYA 2HETA 4MLWA 1WLMA 1FW4A 1W7JB 1CFCA 2WC8A 3VGOA 2K8MB 1IQ3A 1CKKA 1Y1XA 1CDMA 2R2IA 3PN7B 1UHHA 1Q80A 1MXEA 2KQYA 4GGFA 3CZTX 1CLLA 1H4BA 2NZ0A 1EL4A 3D10A 1GGZA 2KI4C 4U8DA 1N65A 1XYDA 3CR2A 1KFUL 1DJZA 2LLUA 3OHMB 1BJFA 1AUIB 5CSFA 1KFUS 1B8CA 2JXCA 4C0JA 2GGZA 3VROA 2VRGA 2F2PA 1KK7Z 3I5IB 2OTGB 1K9PA 1KQMC 3CGAA 1RK9A 2L4HA 1PRWA 2O60A 1YRTB 2O5GA 5GQQC 2I18A 2MRDA 1AJ4A 1SKTA 5K89A 2ZNDA 2F2OA 2CBLA 2KGRA 1BU3A 3VRRA 3PN7C 2BCBA 2SCPA 1TTXA 1B9AA 1CMGA 4PE1A 1LXFC 1JUOA 1WRZA 3CS1A 1J1DA 2DOQA 1SRAA 3WHTB 5DKRA 3WNXB 2B1UA 2L51A 3LK0A 5HKYA 3CTNA 4I5LB 1XO5A 1OE9B 1VRKA 3TDIA 1QVIY 1FPWA 3I5IC 2L5XB 1B47A 2LMVA 4HRHA 2HQWA 2TN4A 1EG3A 3EK7A 4ZCVA 4AQIA 2KOTA 2LUXA 3I5HB 4DS7A 1QV0A 1XK4C 4C0KA 5D7FA 5KTYA 2OPOA 5HYDA 3NSOA 2Y4QA 2WOSA 1PSRA 4PALA 1BOCA 3EK8A 5HKWA 1A75B 1AHRA 2KNEA 3BYAA 4YI9A 1NYAA 2LHLA 1A2XA 2KFFA 1XFXO 5F6TA 2PMYA 1LINA 4HSZA 3ZNIA 5HLOA 1XFUO 3RM1A 3TDZA 1JWDA 5DKNA 2MJWB 1XFZO 2K2AA 2F33A 4UPGA 2KYFA 3PALA 2COLB 3I5GB 4QJ3B 3FWBA 5J3XA 3SG6A 1UWOA 3DVMA 3I5FB 4YGCB 1NCZA 1DJXA 3I5HC 1V1FA 1V1GA 2Q4UA 1IG5A 3CLNA 2LC5A 1S6IA 3PFVA 1G4YR 1QX7A 3AAJA 3PLFB 4PHKA 2JQ6A 1M45A 4NQGA 2JNFA 2JOJA 5G08A 1S1EA 1XFYO 1SYMA 3IQOA 3FIAA 4NDBA 4DUQA 3CR5X 4DRWA 3SG5A 5BPJA 1TNPA 1R6PA 5HKZA 1DJGA 1CLBA 2LAPA 3O6BA 3F45A 1FI5A 3SG4A 1DF0A 3D0YA 1ZMZA 2KFGA 4TNCA 1SL7A 3RLZA 3M0WA 3GK1A 4CFRA 2A4JA 3I5GC 1CFFA 3I5FC 4BY4A 1NIWA 2ZNEA 5CSJA 3JVTB 2MLFC 4DIRA 1KWOB 1PSBA 4OVNF 1OMVA 1N0YA 1DJWA 1FBVA 1B7TZ 1MF8B 2ZN9A 1TRFA 4N1GA 4D1EA 4MRYA 4PE7A 1BF5A 4AQJA 1MWNA 4DCKA 1IJ5A 3EVVA 4GNKB 1G33A 1NX3A 1YUSA 1HT9A 4GGFC 2BKIB
chains in the Genus database with same CATH superfamily
1UHKA 2OS8B 4OZDA 3L4LA 3SS5A 3BOWA 4GGNA 2M97A 1QLSA 3D73A 4MZKA 1DJYA 1SL8A 4PE0A 1J7PA 2F3YA 1K94A 1QVIZ 4IL1A 3KEVA 4P2YB 2FOTA 2KI6C 3E3RA 2H61A 2BBMA 3JVTC 1KWOC 3O2PA 5HLVA 1RJVA 3SJSA 3EVRA 1OOFA 2KYCA 2M49B 4C0LA 2WORA 5I2OA 2K7CA 1UP5A 3SG2A 5CPVA 3BUMB 4FQOA 3DF0A 1DJIA 3EKJA 1FI6A 3BQ3A 1K8UA 1NX1A 3GK4X 2OS8C 2PSRA 1ORGA 1QLKA 3Q8IA 1Y0VH 2F3ZA 2KBMA 4USLA 1BR1B 4AOMA 3SS4A 2JTZA 2PVBA 2JXLA 1YTZC 1B8RA 3WHUB 1OZSA 1J7OA 3IVTA 3B87A 1QV1A 4MBEA 2LVVA 2JC2A 3SG7A 1DVIA 3DVEA 1S5GY 1KSMA 2BE6A 2NXQA 2HPSA 2LNKA 1AVSA 2ISDA 3O78A 1ODBA 1AP4A 1NX0A 4MRXA 2CT9A 4KYNA 2MLEC 3DYEA 1F54A 1TN4A 1Y6WA 1SNLA 1EXRA 1K9KA 2P6BB 3PJIA 5AEQA 2OTGC 4CPVA 1SBJA 1C7WA 1RECA 5I8NA 1CFPA 2NCPA 1JF0A 2SASA 2KFHA 3SIAA 1BG1A 2BKHB 1WY9A 1DJHA 3GOFA 3EKHA 4CFQA 3S0FA 1CLMA 1OMRA 1QX2A 1N2DA 4R1EA 1X02A 3FWCA 1EH2A 4XJKB 2KI6D 1IWQA 1P28A 3O4YA 3OB1B 5FI6A 1DF0B 2LVKA 1TWOA 2LM5A 2Y1NA 3D0YB 1SR6B 1UHJA 1E8AA 3KF9A 4A4CA 1YVHA 2I2RE 1NPQA 3IF7A 1MXLC 1Y1UA 4WQ3A 2M9GA 1S3PA 2BE4A 2JZIA 3H4SE 4JQ0D 2LANA 2MHHA 1CFDA 4GAOA 4E68A 1XFRA 1TNWA 5DKQA 1K93D 2LVIA 1DC1A 1ALVA 1ZUZA 1TNXA 1SL9A 4N1FA 2F8PA 1RWYA 4FQTA 1BLQA 4OKHA 2V53A 1NCXA 5I2QA 1F70A 1KFXL 1FF1A 1M31A 2CNPA 2RGIA 2CTNA 2JT8A 1XFWO 2ERBA 2HQ8A 1NUBA 2ZKMX 3TS5B 1SMGA 2H2KA 1JSAA 2Q91A 4F0ZB 1Z2CB 3B88A 3BOWB 4GFTA 3S0BA 2LV7A 2LP3A 1YRUB 2JTTA 2ZFDA 4Q04A 5TNCA 2P70A 3SIBA 1SY9A 4HRGA 1K2HA 4I5JA 1B1GA 5KSZA 2KAXA 2M7LA 3DVJA 3FS7A 2GTEA 2KLDA 1W9ZA 3LK1A 2JT3A 5AFPA 3D74A 2JRFA 1OQPA 4ORCB 1J7RA 1G8IA 1LS8A 4PHNA 5AXIA 1JFKA 2PALA 4NDCA 3SS3A 2K0JA 2KSPA 3V2LA 1TOPA 3NXAA 2I7AA 2K61A 3NGVA 4OCIA 2WC6A 1MQ1A 2M1KB 1SK6D 1EG4A 1TCOB 2LP2A 2ZRTA 3DF0B 3TS5C 1CB1A 1F71A 3JTDB 1CMFA 1KK8B 1LA3A 2WCFA 1IJ6A 2M29A 2QACA 3KHEA 2JULA 5D69A 2K7OA 1J7QA 1S6CA 4XYNA 1J55A 1F8HA 1DQEA 1U5IA 2P71A 1OSAA 1KCYA 5AERA 1YUUA 1AJ5A 1IRJA 2JT0A 4YGDB 1S5GZ 3DVKA 3VRQA 3OB2B 2H61C 4MZJA 2BECA 1F55A 2QPTA 3OGNA 4JPZB 5PALA 2M3WA 1F4OA 3EG5B 1AK8A 1K95A 4CLNA 3D77A 1B8LA 1NSHA 1WLZA 3SG3A 1T14A 2LCPA 1ZOTB 1A29A 2KAVA 1M63B 3OX5A 3D76A 1WRKA 5AANA 2Y5IA 5I94A 1OOGA 1WRLA 3JTDC 3RZSA 1KK8C 2EGDA 1YVLA 4YGEB 3LL8B 1H8BA 1DGVA 2JWWA 2L50A 2QEHA 1QWVA 4PE4A 3BJHA 3NSKA 4P5OE 2QEVA 3PATA 2E30A 3VRNA 1K90D 2GV5A 1JF2A 3OP0A 2BCAA 1IGVA 3R1VA 3MSEB 4BY5A 1CTRA 2JPTA 2KLEA 1C3YA 3DXLA 1XA5A 1CM4A 4ZCUA 2MAZA 1TCFA 3PSRA 2MA2A 1SPYA 3A8RA 1OW4A 2AAOA 3FE8A 4F7FA 2M8UA 1OZOA 3BUWB 2LLTA 1Y1AA 3FE9A 3TZ1A 1QATA 2JNXA 2LUCA 4QJ5B 1RFJA 1DELA 5JOLA 4NDDA 3K21A 2IS9A 2WC5A 2LVJA 1R2UA 4I5NB 1A03A 1B7TY 3EK4A 4MN0A 4WQ2A 4YRUA 4MSPA 2M7NA 5JJGA 1D1OA 1MHOA 5I2LA 2KQ6A 2K7DA 3PM2A 2KHNA 2PRUA 2FCDA 1M39A 2KBIA 2PASA 1HQVA 2G2BA 1DGUA 3BUNB 2L98A 3OBVA 1CDNA 1IH0A 3HX4A 2L4IA 4OV2A 2MBXA 3TDUA 1QJTA 2LMUA 1ZFSA 3CWGA 2KAYA 1BR4B 4JD9A 5FYXA 2PYQA 3AAKA 3LCPC 1UURA 1CM1A 1YR5A 4I5KA 4A4BA 1CDPA 2WCBA 1KQVA 1QX5B 1OOJA 2KDHA 3DD4A 3CR4X 1YUTA 2K2FA 2FCEA 4IJ7A 4YBHB 1JC2A 1XFVO 2G9BA 1QASA 1DTLA 5CSIA 3ICBA 1DMOA 2ZRSA 1PVBA 1QTXA 3KPXA 5FI7A 3S0DA 1SW8A 1UHIA 4ORBB 1RROA 4MEWA 2WCKA 3B86A 1XVJA 1S36A 1NWDA 2WCEA 1KK7Y 2BCXA 1UUSA 2BNXA 3NHIA 3IQQA 3PM8A 1JBAA 1MR8A 4M2QA 2JPOA 2GGMA 1U5IB 1ZACA 2AUCA 2BAPA 1KFXS 3FE6A 3A4UB 1PULA 4ETOA 3QRXA 5B8IB 2BL0B 1XK4A 2D8NA 1EJ3A 1J1EA 3S0GA 1PK0D 1SCMB 1W7IB 1SR6C 3TUYB 3VB1A 1YX7A 4GUKA 1C7VA 1B4CA 3CYZA 4GPLB 1TNQA 4JKTA 2E6WA 4YGAA 1L2OB 2NCOA 2PQLA 4QJ4B 3EVUA 1WDCB 1PVAA 1LVCD 1SCVA 2M1UA 1IQ5A 1PALA 1A4PA 2WCHA 3AKBA 5FI2A 2KPHA 4INXA 1QS7A 4PDZA 1GGWA 3ZWHA 1IKUA 4N5XA 2EC6B 2AMIA 3BUOB 2NLNA 2L2EA 3BUXB 2WCLA 4L9MA 2LE9B 1S26D 2BBNA 1BT6A 3AKAA 3B7AA 5IBWA 1S6JA 2ZN8A 2WNDA 3OX6A 1C07A 2BL0C 4ICBA 1TIZA 1M46A 1MUXA 1NX2A 1UHNA 2FJUB 3QMEA 2EHBA 4GBAA 1BODA 1SCMC 3BXKA 3TUYC 4XJKA 3GK2A 1SSEB 1OMDA 2CCMA 4YGBB 1A75A 1BMOA 1QIWA 1KSOA 1YX8A 2YGUA 3B6XA 3NSIA 4YI8A 4ORAB 5ER5A 2HF5A 4MVFA 4PCWA 1L2OC 1L7ZA 1QXPA 3KO0A 4M2OA 4WRIA 1WDCC 5CSNA 1NP8A 5ER4X 3WXAA 1GM0A 1CDLA 4PHMA 1RTP1 4HREE 1LKJA 3C1VA 2M0RA 2L0PA 2H8VA 2CXJA 4FTGA 1K9UA 1ALWA 2JU0A 2LLSA 1YURA 2EC6C 2LMTA 4OR9B 2KI4B 3NSLA 4JWQA 4PHJA 2KGBC 4M2PA 4MZLA 1GJYA 5KU1A 3HCMA 2Y1MA 2LHIA 3S0EA 1K96A 1QIVA 1LA0A 1F4QA 2K7BA 1GQMA 3VRPA 1TUZA 1CNPA 1C3ZA 1KQMB 1DT7B 4CIDA 1JFJA 2I94A 3LLEA 1NCYA 2HETA 4MLWA 1WLMA 1FW4A 1W7JB 1CFCA 3D78A 2WC8A 3VGOA 2K8MB 3CZ0A 1IQ3A 1CKKA 1Y1XA 1CDMA 2R2IA 3DY9A 3PN7B 1UHHA 1Q80A 1MXEA 2KQYA 3R1OA 3CZTX 1CLLA 4GGFA 1H4BA 2NZ0A 1EL4A 2FJYA 3D10A 1GGZA 2KI4C 4U8DA 1N65A 1XYDA 2QEBA 1KFUL 3CR2A 1DJZA 2LLUA 3DZTA 3OHMB 1BJFA 5EL2A 1AUIB 5CSFA 1KFUS 1B8CA 2JXCA 4C0JA 2GGZA 3VROA 2VRGA 2F2PA 1KK7Z 3I5IB 2OTGB 1DEKA 1K9PA 1KQMC 3CGAA 1RK9A 2L4HA 1PRWA 2O60A 1YRTB 2O5GA 5GQQC 3BFHA 2I18A 2L5YA 2MRDA 3L4AA 1AJ4A 1SKTA 5K89A 2ZNDA 2F2OA 2CBLA 2KGRA 1BU3A 3VRRA 3PN7C 3UNWA 2BCBA 2SCPA 5DICA 1TTXA 1B9AA 1CMGA 4PE1A 1LXFC 1JUOA 1WRZA 3CS1A 1J1DA 2DOQA 1SRAA 3NHTA 3WHTB 5DKRA 3WNXB 2B1UA 2L51A 5HL1A 3LK0A 5HKYA 3CTNA 4I5LB 1XO5A 1OE9B 1VRKA 3TDIA 1QVIY 2K60A 1FPWA 3I5IC 2L5XB 1B47A 3CDNA 2LMVA 3O4XA 2HQWA 2TN4A 4HRHA 1EG3A 3EK7A 4ZCVA 4AQIA 1Z4HA 2KOTA 2LUXA 4INWA 3I5HB 4DS7A 1QV0A 1XK4C 4C0KA 2L2CA 5D3OA 5D7FA 3R1PA 5KTYA 2OPOA 5HYDA 3NSOA 2Y4QA 2WOSA 1PSRA 4PALA 3K1EA 1BOCA 3EK8A 5HKWA 1A75B 1AHRA 2KNEA 3BYAA 4YI9A 1NYAA 3N7HA 2LHLA 1A2XA 2KFFA 1XFXO 5F6TA 2PMYA 1LINA 4HSZA 3ZNIA 5HLOA 1XFUO 3RM1A 3TDZA 1JWDA 3UO9A 5DKNA 2MJWB 1XFZO 4PT1A 2WCMA 2K2AA 2F33A 3L47A 4UPGA 2KYFA 3PALA 2COLB 3I5GB 4QJ3B 3FWBA 5J3XA 3SG6A 1UWOA 3DVMA 3I5FB 4YGCB 1NCZA 1DJXA 3I5HC 1V1FA 1V1GA 2Q4UA 1IG5A 3CLNA 2LC5A 1S6IA 3PFVA 1G4YR 1QX7A 3AAJA 3PLFB 4PHKA 2JQ6A 1M45A 4NQGA 2JNFA 2JOJA 3BFBA 5G08A 1OOIX 1S1EA 1XFYO 1SYMA 3IQOA 3FIAA 4NDBA 4DUQA 3CR5X 4DRWA 1IIOA 3SG5A 5BPJA 1TNPA 1R6PA 5HKZA 1DJGA 1CLBA 2LAPA 3O6BA 3F45A 3S0AA 3SG4A 1FI5A 1DF0A 3D0YA 1TUJA 1ZMZA 2WCJA 2KFGA 3CZ2A 4TNCA 1SL7A 3RLZA 3M0WA 3GK1A 4CFRA 2A4JA 3I5GC 1CFFA 2QEOA 3I5FC 4BY4A 1NIWA 2ZNEA 3R72A 5CSJA 3JVTB 2MLFC 4DIRA 1KWOB 1PSBA 4OVNF 1OMVA 1N0YA 1DJWA 1FBVA 1B7TZ 1MF8B 2ZN9A 1TRFA 4N1GA 4D1EA 3BFAA 4MRYA 4PE7A 3D75A 4AQJA 1BF5A 1MWNA 2QDIA 4DCKA 1IJ5A 3CABA 3EVVA 4GNKB 1OOHA 1G33A 3CZ1A 1NX3A 1YUSA 1HT9A 4GGFC 2BKIB
chains in the Genus database with same CATH topology
1UHKA 2OS8B 3BOWA 4GGNA 2M97A 1QLSA 4MZKA 1DJYA 1SL8A 4PE0A 1J7PA 2F3YA 1K94A 1QVIZ 4IL1A 3KEVA 4P2YB 2FOTA 2KI6C 3E3RA 2H61A 2BBMA 3JVTC 1KWOC 3O2PA 5HLVA 1RJVA 3SJSA 3EVRA 2KYCA 2M49B 4C0LA 2WORA 5I2OA 2K7CA 1UP5A 3SG2A 5CPVA 3BUMB 4FQOA 3DF0A 1DJIA 3EKJA 1FI6A 3BQ3A 1K8UA 1NX1A 3GK4X 2OS8C 2PSRA 1QLKA 1Y0VH 2F3ZA 2KBMA 4USLA 1BR1B 4AOMA 2JTZA 2PVBA 2JXLA 1YTZC 1B8RA 3WHUB 1OZSA 1J7OA 1QV1A 4MBEA 2LVVA 2JC2A 3SG7A 1DVIA 3DVEA 1S5GY 1KSMA 2BE6A 2NXQA 2HPSA 2LNKA 1AVSA 2ISDA 3O78A 1ODBA 1AP4A 1NX0A 4MRXA 2CT9A 2MLEC 1F54A 1TN4A 1Y6WA 1SNLA 1EXRA 1K9KA 2P6BB 5AEQA 2OTGC 4CPVA 1SBJA 1C7WA 1RECA 5I8NA 1CFPA 2NCPA 1JF0A 2SASA 2KFHA 3SIAA 1BG1A 2BKHB 1WY9A 1DJHA 3GOFA 3EKHA 4CFQA 1CLMA 1OMRA 1QX2A 1N2DA 4R1EA 1X02A 3FWCA 1EH2A 4XJKB 2KI6D 1IWQA 3O4YA 3OB1B 1DF0B 2LVKA 2LM5A 2Y1NA 3D0YB 1SR6B 1UHJA 1E8AA 3KF9A 4A4CA 1YVHA 2I2RE 1NPQA 3IF7A 1MXLC 1Y1UA 4WQ3A 2M9GA 1S3PA 2BE4A 2JZIA 3H4SE 4JQ0D 2LANA 2MHHA 1CFDA 4GAOA 4E68A 1TNWA 5DKQA 1K93D 2LVIA 1ALVA 1ZUZA 1TNXA 1SL9A 4N1FA 2F8PA 1RWYA 1BLQA 4OKHA 2V53A 1NCXA 5I2QA 1F70A 1KFXL 1FF1A 1M31A 2CNPA 2RGIA 2CTNA 2JT8A 1XFWO 2HQ8A 1NUBA 2ZKMX 3TS5B 1SMGA 2H2KA 1JSAA 2Q91A 4F0ZB 3BOWB 4GFTA 2LV7A 2LP3A 1YRUB 2JTTA 2ZFDA 4Q04A 5TNCA 3SIBA 1SY9A 4HRGA 1K2HA 4I5JA 1B1GA 5KSZA 2KAXA 2M7LA 3DVJA 3FS7A 3LK1A 2JT3A 5AFPA 2JRFA 1OQPA 4ORCB 1J7RA 1G8IA 4PHNA 5AXIA 1JFKA 2PALA 4NDCA 2K0JA 2KSPA 1TOPA 3NXAA 2I7AA 2K61A 4OCIA 1MQ1A 2M1KB 1SK6D 1EG4A 1TCOB 2LP2A 2ZRTA 3DF0B 3TS5C 1CB1A 1F71A 3JTDB 1CMFA 1KK8B 1LA3A 2WCFA 1IJ6A 2M29A 2QACA 3KHEA 2JULA 5D69A 2K7OA 1J7QA 1S6CA 4XYNA 1J55A 1F8HA 1U5IA 1OSAA 1KCYA 5AERA 1YUUA 1AJ5A 1IRJA 2JT0A 4YGDB 1S5GZ 3DVKA 3VRQA 3OB2B 2H61C 4MZJA 2BECA 1F55A 2QPTA 4JPZB 5PALA 2M3WA 1F4OA 1AK8A 1K95A 4CLNA 1B8LA 1NSHA 1WLZA 3SG3A 2LCPA 1ZOTB 1A29A 2KAVA 1M63B 3OX5A 1WRKA 5AANA 2Y5IA 1WRLA 3JTDC 1KK8C 2EGDA 1YVLA 4YGEB 3LL8B 1H8BA 1DGVA 2JWWA 2L50A 4PE4A 3NSKA 4P5OE 3PATA 2E30A 3VRNA 1K90D 2GV5A 1JF2A 3OP0A 2BCAA 1IGVA 3MSEB 4BY5A 1CTRA 2JPTA 1XA5A 1CM4A 4ZCUA 2MAZA 1TCFA 3PSRA 2MA2A 1SPYA 3A8RA 2AAOA 2M8UA 1OZOA 3BUWB 2LLTA 1Y1AA 3TZ1A 1QATA 2JNXA 2LUCA 4QJ5B 1RFJA 5JOLA 4NDDA 3K21A 2IS9A 2LVJA 1R2UA 4I5NB 1A03A 1B7TY 3EK4A 4MN0A 4WQ2A 4YRUA 4MSPA 2M7NA 5JJGA 1D1OA 1MHOA 5I2LA 2KQ6A 2K7DA 2KHNA 2PRUA 2FCDA 1M39A 2KBIA 2PASA 1HQVA 2G2BA 1DGUA 3BUNB 2L98A 1CDNA 1IH0A 3HX4A 2L4IA 4OV2A 2MBXA 3TDUA 1QJTA 2LMUA 1ZFSA 3CWGA 2KAYA 1BR4B 5FYXA 3AAKA 3LCPC 1UURA 1CM1A 1YR5A 4I5KA 4A4BA 1CDPA 2WCBA 1KQVA 1QX5B 1OOJA 2KDHA 3DD4A 3CR4X 1YUTA 2K2FA 2FCEA 1JC2A 4YBHB 1XFVO 2G9BA 1QASA 1DTLA 5CSIA 3ICBA 1DMOA 2ZRSA 1PVBA 1QTXA 3KPXA 1SW8A 1UHIA 4ORBB 1RROA 4MEWA 1XVJA 1S36A 1NWDA 2WCEA 1KK7Y 2BCXA 1UUSA 3IQQA 3PM8A 1JBAA 1MR8A 4M2QA 2GGMA 1U5IB 1ZACA 2AUCA 1KFXS 3A4UB 1PULA 4ETOA 3QRXA 5B8IB 2BL0B 1XK4A 2D8NA 1EJ3A 1J1EA 1PK0D 1SCMB 1W7IB 1SR6C 3TUYB 1YX7A 4GUKA 1C7VA 1B4CA 4GPLB 1TNQA 2E6WA 4YGAA 1L2OB 2NCOA 4QJ4B 3EVUA 1WDCB 1PVAA 1LVCD 1SCVA 2M1UA 1IQ5A 1PALA 1A4PA 3AKBA 4PDZA 1QS7A 1GGWA 3ZWHA 1IKUA 4N5XA 2EC6B 2AMIA 3BUOB 2NLNA 2L2EA 3BUXB 4L9MA 2LE9B 1S26D 2BBNA 1BT6A 3AKAA 5IBWA 1S6JA 2ZN8A 2WNDA 3OX6A 1C07A 2BL0C 4ICBA 1TIZA 1M46A 1MUXA 1NX2A 1UHNA 2FJUB 4GBAA 2EHBA 1BODA 1SCMC 3BXKA 3TUYC 4XJKA 3GK2A 1OMDA 2CCMA 4YGBB 1A75A 1BMOA 1QIWA 1KSOA 1YX8A 3NSIA 4YI8A 4ORAB 5ER5A 2HF5A 4MVFA 4PCWA 1L2OC 1L7ZA 1QXPA 3KO0A 4M2OA 4WRIA 1WDCC 5CSNA 1NP8A 5ER4X 3WXAA 1CDLA 4PHMA 1RTP1 4HREE 1LKJA 3C1VA 2M0RA 2L0PA 4FTGA 2CXJA 1K9UA 1ALWA 2JU0A 2LLSA 1YURA 2EC6C 2LMTA 4OR9B 2KI4B 3NSLA 4JWQA 4PHJA 2KGBC 4M2PA 4MZLA 1GJYA 5KU1A 3HCMA 2Y1MA 2LHIA 1K96A 1QIVA 1LA0A 1F4QA 2K7BA 1GQMA 3VRPA 1CNPA 1KQMB 1DT7B 4CIDA 1JFJA 2I94A 3LLEA 1NCYA 2HETA 4MLWA 1WLMA 1FW4A 1W7JB 1CFCA 2WC8A 3VGOA 2K8MB 1IQ3A 1CKKA 1Y1XA 1CDMA 2R2IA 3PN7B 1UHHA 1Q80A 1MXEA 2KQYA 4GGFA 3CZTX 1CLLA 1H4BA 2NZ0A 1EL4A 3D10A 1GGZA 2KI4C 4U8DA 1N65A 1XYDA 3CR2A 1KFUL 1DJZA 2LLUA 3OHMB 1BJFA 1AUIB 5CSFA 1KFUS 1B8CA 2JXCA 4C0JA 2GGZA 3VROA 2VRGA 2F2PA 1KK7Z 3I5IB 2OTGB 1K9PA 1KQMC 3CGAA 1RK9A 2L4HA 1PRWA 2O60A 1YRTB 2O5GA 5GQQC 2I18A 2MRDA 1AJ4A 1SKTA 5K89A 2ZNDA 2F2OA 2CBLA 2KGRA 1BU3A 3VRRA 3PN7C 2BCBA 2SCPA 1TTXA 1B9AA 1CMGA 4PE1A 1LXFC 1JUOA 1WRZA 3CS1A 1J1DA 2DOQA 1SRAA 3WHTB 5DKRA 3WNXB 2B1UA 2L51A 3LK0A 5HKYA 3CTNA 4I5LB 1XO5A 1OE9B 1VRKA 3TDIA 1QVIY 1FPWA 3I5IC 2L5XB 1B47A 2LMVA 4HRHA 2HQWA 2TN4A 1EG3A 3EK7A 4ZCVA 4AQIA 2KOTA 2LUXA 3I5HB 4DS7A 1QV0A 1XK4C 4C0KA 5D7FA 5KTYA 2OPOA 5HYDA 3NSOA 2Y4QA 2WOSA 1PSRA 4PALA 1BOCA 3EK8A 5HKWA 1A75B 1AHRA 2KNEA 3BYAA 4YI9A 1NYAA 2LHLA 1A2XA 2KFFA 1XFXO 5F6TA 2PMYA 1LINA 4HSZA 3ZNIA 5HLOA 1XFUO 3RM1A 3TDZA 1JWDA 5DKNA 2MJWB 1XFZO 2K2AA 2F33A 4UPGA 2KYFA 3PALA 2COLB 3I5GB 4QJ3B 3FWBA 5J3XA 3SG6A 1UWOA 3DVMA 3I5FB 4YGCB 1NCZA 1DJXA 3I5HC 1V1FA 1V1GA 2Q4UA 1IG5A 3CLNA 2LC5A 1S6IA 3PFVA 1G4YR 1QX7A 3AAJA 3PLFB 4PHKA 2JQ6A 1M45A 4NQGA 2JNFA 2JOJA 5G08A 1S1EA 1XFYO 1SYMA 3IQOA 3FIAA 4NDBA 4DUQA 3CR5X 4DRWA 3SG5A 5BPJA 1TNPA 1R6PA 5HKZA 1DJGA 1CLBA 2LAPA 3O6BA 3F45A 1FI5A 3SG4A 1DF0A 3D0YA 1ZMZA 2KFGA 4TNCA 1SL7A 3RLZA 3M0WA 3GK1A 4CFRA 2A4JA 3I5GC 1CFFA 3I5FC 4BY4A 1NIWA 2ZNEA 5CSJA 3JVTB 2MLFC 4DIRA 1KWOB 1PSBA 4OVNF 1OMVA 1N0YA 1DJWA 1FBVA 1B7TZ 1MF8B 2ZN9A 1TRFA 4N1GA 4D1EA 4MRYA 4PE7A 1BF5A 4AQJA 1MWNA 4DCKA 1IJ5A 3EVVA 4GNKB 1G33A 1NX3A 1YUSA 1HT9A 4GGFC 2BKIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHK A;  2OS8 B;  3BOW A;  4GGN A;  2M97 A;  1QLS A;  4MZK A;  1DJY A;  1SL8 A;  4PE0 A;  1J7P A;  2F3Y A;  1K94 A;  1QVI Z;  4IL1 A;  3KEV A;  4P2Y B;  2FOT A;  2KI6 C;  3E3R A;  2H61 A;  2BBM A;  3JVT C;  1KWO C;  3O2P A;  5HLV A;  1RJV A;  3SJS A;  3EVR A;  2KYC A;  2M49 B;  4C0L A;  2WOR A;  5I2O A;  2K7C A;  1UP5 A;  3SG2 A;  5CPV A;  3BUM B;  4FQO A;  3DF0 A;  1DJI A;  3EKJ A;  1FI6 A;  3BQ3 A;  1K8U A;  1NX1 A;  3GK4 X;  2OS8 C;  2PSR A;  1QLK A;  1Y0V H;  2F3Z A;  2KBM A;  4USL A;  1BR1 B;  4AOM A;  2JTZ A;  2PVB A;  2JXL A;  1YTZ C;  1B8R A;  3WHU B;  1OZS A;  1J7O A;  1QV1 A;  4MBE A;  2LVV A;  2JC2 A;  3SG7 A;  1DVI A;  3DVE A;  1S5G Y;  1KSM A;  2BE6 A;  2NXQ A;  2HPS A;  2LNK A;  1AVS A;  2ISD A;  3O78 A;  1ODB A;  1AP4 A;  1NX0 A;  4MRX A;  2CT9 A;  2MLE C;  1F54 A;  1TN4 A;  1Y6W A;  1SNL A;  1EXR A;  1K9K A;  2P6B B;  5AEQ A;  2OTG C;  4CPV A;  1SBJ A;  1C7W A;  1REC A;  5I8N A;  1CFP A;  2NCP A;  1JF0 A;  2SAS A;  2KFH A;  3SIA A;  1BG1 A;  2BKH B;  1WY9 A;  1DJH A;  3GOF A;  3EKH A;  4CFQ A;  1CLM A;  1OMR A;  1QX2 A;  1N2D A;  4R1E A;  1X02 A;  3FWC A;  1EH2 A;  4XJK B;  2KI6 D;  1IWQ A;  3O4Y A;  3OB1 B;  1DF0 B;  2LVK A;  2LM5 A;  2Y1N A;  3D0Y B;  1SR6 B;  1UHJ A;  1E8A A;  3KF9 A;  4A4C A;  1YVH A;  2I2R E;  1NPQ A;  3IF7 A;  1MXL C;  1Y1U A;  4WQ3 A;  2M9G A;  1S3P A;  2BE4 A;  2JZI A;  3H4S E;  4JQ0 D;  2LAN A;  2MHH A;  1CFD A;  4GAO A;  4E68 A;  1TNW A;  5DKQ A;  1K93 D;  2LVI A;  1ALV A;  1ZUZ A;  1TNX A;  1SL9 A;  4N1F A;  2F8P A;  1RWY A;  1BLQ A;  4OKH A;  2V53 A;  1NCX A;  5I2Q A;  1F70 A;  1KFX L;  1FF1 A;  1M31 A;  2CNP A;  2RGI A;  2CTN A;  2JT8 A;  1XFW O;  2HQ8 A;  1NUB A;  2ZKM X;  3TS5 B;  1SMG A;  2H2K A;  1JSA A;  2Q91 A;  4F0Z B;  3BOW B;  4GFT A;  2LV7 A;  2LP3 A;  1YRU B;  2JTT A;  2ZFD A;  4Q04 A;  5TNC A;  3SIB A;  1SY9 A;  4HRG A;  1K2H A;  4I5J A;  1B1G A;  5KSZ A;  2KAX A;  2M7L A;  3DVJ A;  3FS7 A;  3LK1 A;  2JT3 A;  5AFP A;  2JRF A;  1OQP A;  4ORC B;  1J7R A;  1G8I A;  4PHN A;  5AXI A;  1JFK A;  2PAL A;  4NDC A;  2K0J A;  2KSP A;  1TOP A;  3NXA A;  2I7A A;  2K61 A;  4OCI A;  1MQ1 A;  2M1K B;  1SK6 D;  1EG4 A;  1TCO B;  2LP2 A;  2ZRT A;  3DF0 B;  3TS5 C;  1CB1 A;  1F71 A;  3JTD B;  1CMF A;  1KK8 B;  1LA3 A;  2WCF A;  1IJ6 A;  2M29 A;  2QAC A;  3KHE A;  2JUL A;  5D69 A;  2K7O A;  1J7Q A;  1S6C A;  4XYN A;  1J55 A;  1F8H A;  1U5I A;  1OSA A;  1KCY A;  5AER A;  1YUU A;  1AJ5 A;  1IRJ A;  2JT0 A;  4YGD B;  1S5G Z;  3DVK A;  3VRQ A;  3OB2 B;  2H61 C;  4MZJ A;  2BEC A;  1F55 A;  2QPT A;  4JPZ B;  5PAL A;  2M3W A;  1F4O A;  1AK8 A;  1K95 A;  4CLN A;  1B8L A;  1NSH A;  1WLZ A;  3SG3 A;  2LCP A;  1ZOT B;  1A29 A;  2KAV A;  1M63 B;  3OX5 A;  1WRK A;  5AAN A;  2Y5I A;  1WRL A;  3JTD C;  1KK8 C;  2EGD A;  1YVL A;  4YGE B;  3LL8 B;  1H8B A;  1DGV A;  2JWW A;  2L50 A;  4PE4 A;  3NSK A;  4P5O E;  3PAT A;  2E30 A;  3VRN A;  1K90 D;  2GV5 A;  1JF2 A;  3OP0 A;  2BCA A;  1IGV A;  3MSE B;  4BY5 A;  1CTR A;  2JPT A;  1XA5 A;  1CM4 A;  4ZCU A;  2MAZ A;  1TCF A;  3PSR A;  2MA2 A;  1SPY A;  3A8R A;  2AAO A;  2M8U A;  1OZO A;  3BUW B;  2LLT A;  1Y1A A;  3TZ1 A;  1QAT A;  2JNX A;  2LUC A;  4QJ5 B;  1RFJ A;  5JOL A;  4NDD A;  3K21 A;  2IS9 A;  2LVJ A;  1R2U A;  4I5N B;  1A03 A;  1B7T Y;  3EK4 A;  4MN0 A;  4WQ2 A;  4YRU A;  4MSP A;  2M7N A;  5JJG A;  1D1O A;  1MHO A;  5I2L A;  2KQ6 A;  2K7D A;  2KHN A;  2PRU A;  2FCD A;  1M39 A;  2KBI A;  2PAS A;  1HQV A;  2G2B A;  1DGU A;  3BUN B;  2L98 A;  1CDN A;  1IH0 A;  3HX4 A;  2L4I A;  4OV2 A;  2MBX A;  3TDU A;  1QJT A;  2LMU A;  1ZFS A;  3CWG A;  2KAY A;  1BR4 B;  5FYX A;  3AAK A;  3LCP C;  1UUR A;  1CM1 A;  1YR5 A;  4I5K A;  4A4B A;  1CDP A;  2WCB A;  1KQV A;  1QX5 B;  1OOJ A;  2KDH A;  3DD4 A;  3CR4 X;  1YUT A;  2K2F A;  2FCE A;  1JC2 A;  4YBH B;  1XFV O;  2G9B A;  1QAS A;  1DTL A;  5CSI A;  3ICB A;  1DMO A;  2ZRS A;  1PVB A;  1QTX A;  3KPX A;  1SW8 A;  1UHI A;  4ORB B;  1RRO A;  4MEW A;  1XVJ A;  1S36 A;  1NWD A;  2WCE A;  1KK7 Y;  2BCX A;  1UUS A;  3IQQ A;  3PM8 A;  1JBA A;  1MR8 A;  4M2Q A;  2GGM A;  1U5I B;  1ZAC A;  2AUC A;  1KFX S;  3A4U B;  1PUL A;  4ETO A;  3QRX A;  5B8I B;  2BL0 B;  1XK4 A;  2D8N A;  1EJ3 A;  1J1E A;  1PK0 D;  1SCM B;  1W7I B;  1SR6 C;  3TUY B;  1YX7 A;  4GUK A;  1C7V A;  1B4C A;  4GPL B;  1TNQ A;  2E6W A;  4YGA A;  1L2O B;  2NCO A;  4QJ4 B;  3EVU A;  1WDC B;  1PVA A;  1LVC D;  1SCV A;  2M1U A;  1IQ5 A;  1PAL A;  1A4P A;  3AKB A;  4PDZ A;  1QS7 A;  1GGW A;  3ZWH A;  1IKU A;  4N5X A;  2EC6 B;  2AMI A;  3BUO B;  2NLN A;  2L2E A;  3BUX B;  4L9M A;  2LE9 B;  1S26 D;  2BBN A;  1BT6 A;  3AKA A;  5IBW A;  1S6J A;  2ZN8 A;  2WND A;  3OX6 A;  1C07 A;  2BL0 C;  4ICB A;  1TIZ A;  1M46 A;  1MUX A;  1NX2 A;  1UHN A;  2FJU B;  4GBA A;  2EHB A;  1BOD A;  1SCM C;  3BXK A;  3TUY C;  4XJK A;  3GK2 A;  1OMD A;  2CCM A;  4YGB B;  1A75 A;  1BMO A;  1QIW A;  1KSO A;  1YX8 A;  3NSI A;  4YI8 A;  4ORA B;  5ER5 A;  2HF5 A;  4MVF A;  4PCW A;  1L2O C;  1L7Z A;  1QXP A;  3KO0 A;  4M2O A;  4WRI A;  1WDC C;  5CSN A;  1NP8 A;  5ER4 X;  3WXA A;  1CDL A;  4PHM A;  1RTP 1;  4HRE E;  1LKJ A;  3C1V A;  2M0R A;  2L0P A;  4FTG A;  2CXJ A;  1K9U A;  1ALW A;  2JU0 A;  2LLS A;  1YUR A;  2EC6 C;  2LMT A;  4OR9 B;  2KI4 B;  3NSL A;  4JWQ A;  4PHJ A;  2KGB C;  4M2P A;  4MZL A;  1GJY A;  5KU1 A;  3HCM A;  2Y1M A;  2LHI A;  1K96 A;  1QIV A;  1LA0 A;  1F4Q A;  2K7B A;  1GQM A;  3VRP A;  1CNP A;  1KQM B;  1DT7 B;  4CID A;  1JFJ A;  2I94 A;  3LLE A;  1NCY A;  2HET A;  4MLW A;  1WLM A;  1FW4 A;  1W7J B;  1CFC A;  2WC8 A;  3VGO A;  2K8M B;  1IQ3 A;  1CKK A;  1Y1X A;  1CDM A;  2R2I A;  3PN7 B;  1UHH A;  1Q80 A;  1MXE A;  2KQY A;  4GGF A;  3CZT X;  1CLL A;  1H4B A;  2NZ0 A;  1EL4 A;  3D10 A;  1GGZ A;  2KI4 C;  4U8D A;  1N65 A;  1XYD A;  3CR2 A;  1KFU L;  1DJZ A;  2LLU A;  3OHM B;  1BJF A;  1AUI B;  5CSF A;  1KFU S;  1B8C A;  2JXC A;  4C0J A;  2GGZ A;  3VRO A;  2VRG A;  2F2P A;  1KK7 Z;  3I5I B;  2OTG B;  1K9P A;  1KQM C;  3CGA A;  1RK9 A;  2L4H A;  1PRW A;  2O60 A;  1YRT B;  2O5G A;  5GQQ C;  2I18 A;  2MRD A;  1AJ4 A;  1SKT A;  5K89 A;  2ZND A;  2F2O A;  2CBL A;  2KGR A;  1BU3 A;  3VRR A;  3PN7 C;  2BCB A;  2SCP A;  1TTX A;  1B9A A;  1CMG A;  4PE1 A;  1LXF C;  1JUO A;  1WRZ A;  3CS1 A;  1J1D A;  2DOQ A;  1SRA A;  3WHT B;  5DKR A;  3WNX B;  2B1U A;  2L51 A;  3LK0 A;  5HKY A;  3CTN A;  4I5L B;  1XO5 A;  1OE9 B;  1VRK A;  3TDI A;  1QVI Y;  1FPW A;  3I5I C;  2L5X B;  1B47 A;  2LMV A;  4HRH A;  2HQW A;  2TN4 A;  1EG3 A;  3EK7 A;  4ZCV A;  4AQI A;  2KOT A;  2LUX A;  3I5H B;  4DS7 A;  1QV0 A;  1XK4 C;  4C0K A;  5D7F A;  5KTY A;  2OPO A;  5HYD A;  3NSO A;  2Y4Q A;  2WOS A;  1PSR A;  4PAL A;  1BOC A;  3EK8 A;  5HKW A;  1A75 B;  1AHR A;  2KNE A;  3BYA A;  4YI9 A;  1NYA A;  2LHL A;  1A2X A;  2KFF A;  1XFX O;  5F6T A;  2PMY A;  1LIN A;  4HSZ A;  3ZNI A;  5HLO A;  1XFU O;  3RM1 A;  3TDZ A;  1JWD A;  5DKN A;  2MJW B;  1XFZ O;  2K2A A;  2F33 A;  4UPG A;  2KYF A;  3PAL A;  2COL B;  3I5G B;  4QJ3 B;  3FWB A;  5J3X A;  3SG6 A;  1UWO A;  3DVM A;  3I5F B;  4YGC B;  1NCZ A;  1DJX A;  3I5H C;  1V1F A;  1V1G A;  2Q4U A;  1IG5 A;  3CLN A;  2LC5 A;  1S6I A;  3PFV A;  1G4Y R;  1QX7 A;  3AAJ A;  3PLF B;  4PHK A;  2JQ6 A;  1M45 A;  4NQG A;  2JNF A;  2JOJ A;  5G08 A;  1S1E A;  1XFY O;  1SYM A;  3IQO A;  3FIA A;  4NDB A;  4DUQ A;  3CR5 X;  4DRW A;  3SG5 A;  5BPJ A;  1TNP A;  1R6P A;  5HKZ A;  1DJG A;  1CLB A;  2LAP A;  3O6B A;  3F45 A;  1FI5 A;  3SG4 A;  1DF0 A;  3D0Y A;  1ZMZ A;  2KFG A;  4TNC A;  1SL7 A;  3RLZ A;  3M0W A;  3GK1 A;  4CFR A;  2A4J A;  3I5G C;  1CFF A;  3I5F C;  4BY4 A;  1NIW A;  2ZNE A;  5CSJ A;  3JVT B;  2MLF C;  4DIR A;  1KWO B;  1PSB A;  4OVN F;  1OMV A;  1N0Y A;  1DJW A;  1FBV A;  1B7T Z;  1MF8 B;  2ZN9 A;  1TRF A;  4N1G A;  4D1E A;  4MRY A;  4PE7 A;  1BF5 A;  4AQJ A;  1MWN A;  4DCK A;  1IJ5 A;  3EVV A;  4GNK B;  1G33 A;  1NX3 A;  1YUS A;  1HT9 A;  4GGF C;  2BKI B; 
#chains in the Genus database with same CATH topology
 1UHK A;  2OS8 B;  4OZD A;  3L4L A;  3SS5 A;  3BOW A;  4GGN A;  2M97 A;  1QLS A;  3D73 A;  4MZK A;  1DJY A;  1SL8 A;  4PE0 A;  1J7P A;  2F3Y A;  1K94 A;  1QVI Z;  4IL1 A;  3KEV A;  4P2Y B;  2FOT A;  2KI6 C;  3E3R A;  2H61 A;  2BBM A;  3JVT C;  1KWO C;  3O2P A;  5HLV A;  1RJV A;  3SJS A;  3EVR A;  1OOF A;  2KYC A;  2M49 B;  4C0L A;  2WOR A;  5I2O A;  2K7C A;  1UP5 A;  3SG2 A;  5CPV A;  3BUM B;  4FQO A;  3DF0 A;  1DJI A;  3EKJ A;  1FI6 A;  3BQ3 A;  1K8U A;  1NX1 A;  3GK4 X;  2OS8 C;  2PSR A;  1ORG A;  1QLK A;  3Q8I A;  1Y0V H;  2F3Z A;  2KBM A;  4USL A;  1BR1 B;  4AOM A;  3SS4 A;  2JTZ A;  2PVB A;  2JXL A;  1YTZ C;  1B8R A;  3WHU B;  1OZS A;  1J7O A;  3IVT A;  3B87 A;  1QV1 A;  4MBE A;  2LVV A;  2JC2 A;  3SG7 A;  1DVI A;  3DVE A;  1S5G Y;  1KSM A;  2BE6 A;  2NXQ A;  2HPS A;  2LNK A;  1AVS A;  2ISD A;  3O78 A;  1ODB A;  1AP4 A;  1NX0 A;  4MRX A;  2CT9 A;  4KYN A;  2MLE C;  3DYE A;  1F54 A;  1TN4 A;  1Y6W A;  1SNL A;  1EXR A;  1K9K A;  2P6B B;  3PJI A;  5AEQ A;  2OTG C;  4CPV A;  1SBJ A;  1C7W A;  1REC A;  5I8N A;  1CFP A;  2NCP A;  1JF0 A;  2SAS A;  2KFH A;  3SIA A;  1BG1 A;  2BKH B;  1WY9 A;  1DJH A;  3GOF A;  3EKH A;  4CFQ A;  3S0F A;  1CLM A;  1OMR A;  1QX2 A;  1N2D A;  4R1E A;  1X02 A;  3FWC A;  1EH2 A;  4XJK B;  2KI6 D;  1IWQ A;  1P28 A;  3O4Y A;  3OB1 B;  5FI6 A;  1DF0 B;  2LVK A;  1TWO A;  2LM5 A;  2Y1N A;  3D0Y B;  1SR6 B;  1UHJ A;  1E8A A;  3KF9 A;  4A4C A;  1YVH A;  2I2R E;  1NPQ A;  3IF7 A;  1MXL C;  1Y1U A;  4WQ3 A;  2M9G A;  1S3P A;  2BE4 A;  2JZI A;  3H4S E;  4JQ0 D;  2LAN A;  2MHH A;  1CFD A;  4GAO A;  4E68 A;  1XFR A;  1TNW A;  5DKQ A;  1K93 D;  2LVI A;  1DC1 A;  1ALV A;  1ZUZ A;  1TNX A;  1SL9 A;  4N1F A;  2F8P A;  1RWY A;  4FQT A;  1BLQ A;  4OKH A;  2V53 A;  1NCX A;  5I2Q A;  1F70 A;  1KFX L;  1FF1 A;  1M31 A;  2CNP A;  2RGI A;  2CTN A;  2JT8 A;  1XFW O;  2ERB A;  2HQ8 A;  1NUB A;  2ZKM X;  3TS5 B;  1SMG A;  2H2K A;  1JSA A;  2Q91 A;  4F0Z B;  1Z2C B;  3B88 A;  3BOW B;  4GFT A;  3S0B A;  2LV7 A;  2LP3 A;  1YRU B;  2JTT A;  2ZFD A;  4Q04 A;  5TNC A;  2P70 A;  3SIB A;  1SY9 A;  4HRG A;  1K2H A;  4I5J A;  1B1G A;  5KSZ A;  2KAX A;  2M7L A;  3DVJ A;  3FS7 A;  2GTE A;  2KLD A;  1W9Z A;  3LK1 A;  2JT3 A;  5AFP A;  3D74 A;  2JRF A;  1OQP A;  4ORC B;  1J7R A;  1G8I A;  1LS8 A;  4PHN A;  5AXI A;  1JFK A;  2PAL A;  4NDC A;  3SS3 A;  2K0J A;  2KSP A;  3V2L A;  1TOP A;  3NXA A;  2I7A A;  2K61 A;  3NGV A;  4OCI A;  2WC6 A;  1MQ1 A;  2M1K B;  1SK6 D;  1EG4 A;  1TCO B;  2LP2 A;  2ZRT A;  3DF0 B;  3TS5 C;  1CB1 A;  1F71 A;  3JTD B;  1CMF A;  1KK8 B;  1LA3 A;  2WCF A;  1IJ6 A;  2M29 A;  2QAC A;  3KHE A;  2JUL A;  5D69 A;  2K7O A;  1J7Q A;  1S6C A;  4XYN A;  1J55 A;  1F8H A;  1DQE A;  1U5I A;  2P71 A;  1OSA A;  1KCY A;  5AER A;  1YUU A;  1AJ5 A;  1IRJ A;  2JT0 A;  4YGD B;  1S5G Z;  3DVK A;  3VRQ A;  3OB2 B;  2H61 C;  4MZJ A;  2BEC A;  1F55 A;  2QPT A;  3OGN A;  4JPZ B;  5PAL A;  2M3W A;  1F4O A;  3EG5 B;  1AK8 A;  1K95 A;  4CLN A;  3D77 A;  1B8L A;  1NSH A;  1WLZ A;  3SG3 A;  1T14 A;  2LCP A;  1ZOT B;  1A29 A;  2KAV A;  1M63 B;  3OX5 A;  3D76 A;  1WRK A;  5AAN A;  2Y5I A;  5I94 A;  1OOG A;  1WRL A;  3JTD C;  3RZS A;  1KK8 C;  2EGD A;  1YVL A;  4YGE B;  3LL8 B;  1H8B A;  1DGV A;  2JWW A;  2L50 A;  2QEH A;  1QWV A;  4PE4 A;  3BJH A;  3NSK A;  4P5O E;  2QEV A;  3PAT A;  2E30 A;  3VRN A;  1K90 D;  2GV5 A;  1JF2 A;  3OP0 A;  2BCA A;  1IGV A;  3R1V A;  3MSE B;  4BY5 A;  1CTR A;  2JPT A;  2KLE A;  1C3Y A;  3DXL A;  1XA5 A;  1CM4 A;  4ZCU A;  2MAZ A;  1TCF A;  3PSR A;  2MA2 A;  1SPY A;  3A8R A;  1OW4 A;  2AAO A;  3FE8 A;  4F7F A;  2M8U A;  1OZO A;  3BUW B;  2LLT A;  1Y1A A;  3FE9 A;  3TZ1 A;  1QAT A;  2JNX A;  2LUC A;  4QJ5 B;  1RFJ A;  1DEL A;  5JOL A;  4NDD A;  3K21 A;  2IS9 A;  2WC5 A;  2LVJ A;  1R2U A;  4I5N B;  1A03 A;  1B7T Y;  3EK4 A;  4MN0 A;  4WQ2 A;  4YRU A;  4MSP A;  2M7N A;  5JJG A;  1D1O A;  1MHO A;  5I2L A;  2KQ6 A;  2K7D A;  3PM2 A;  2KHN A;  2PRU A;  2FCD A;  1M39 A;  2KBI A;  2PAS A;  1HQV A;  2G2B A;  1DGU A;  3BUN B;  2L98 A;  3OBV A;  1CDN A;  1IH0 A;  3HX4 A;  2L4I A;  4OV2 A;  2MBX A;  3TDU A;  1QJT A;  2LMU A;  1ZFS A;  3CWG A;  2KAY A;  1BR4 B;  4JD9 A;  5FYX A;  2PYQ A;  3AAK A;  3LCP C;  1UUR A;  1CM1 A;  1YR5 A;  4I5K A;  4A4B A;  1CDP A;  2WCB A;  1KQV A;  1QX5 B;  1OOJ A;  2KDH A;  3DD4 A;  3CR4 X;  1YUT A;  2K2F A;  2FCE A;  4IJ7 A;  4YBH B;  1JC2 A;  1XFV O;  2G9B A;  1QAS A;  1DTL A;  5CSI A;  3ICB A;  1DMO A;  2ZRS A;  1PVB A;  1QTX A;  3KPX A;  5FI7 A;  3S0D A;  1SW8 A;  1UHI A;  4ORB B;  1RRO A;  4MEW A;  2WCK A;  3B86 A;  1XVJ A;  1S36 A;  1NWD A;  2WCE A;  1KK7 Y;  2BCX A;  1UUS A;  2BNX A;  3NHI A;  3IQQ A;  3PM8 A;  1JBA A;  1MR8 A;  4M2Q A;  2JPO A;  2GGM A;  1U5I B;  1ZAC A;  2AUC A;  2BAP A;  1KFX S;  3FE6 A;  3A4U B;  1PUL A;  4ETO A;  3QRX A;  5B8I B;  2BL0 B;  1XK4 A;  2D8N A;  1EJ3 A;  1J1E A;  3S0G A;  1PK0 D;  1SCM B;  1W7I B;  1SR6 C;  3TUY B;  3VB1 A;  1YX7 A;  4GUK A;  1C7V A;  1B4C A;  3CYZ A;  4GPL B;  1TNQ A;  4JKT A;  2E6W A;  4YGA A;  1L2O B;  2NCO A;  2PQL A;  4QJ4 B;  3EVU A;  1WDC B;  1PVA A;  1LVC D;  1SCV A;  2M1U A;  1IQ5 A;  1PAL A;  1A4P A;  2WCH A;  3AKB A;  5FI2 A;  2KPH A;  4INX A;  1QS7 A;  4PDZ A;  1GGW A;  3ZWH A;  1IKU A;  4N5X A;  2EC6 B;  2AMI A;  3BUO B;  2NLN A;  2L2E A;  3BUX B;  2WCL A;  4L9M A;  2LE9 B;  1S26 D;  2BBN A;  1BT6 A;  3AKA A;  3B7A A;  5IBW A;  1S6J A;  2ZN8 A;  2WND A;  3OX6 A;  1C07 A;  2BL0 C;  4ICB A;  1TIZ A;  1M46 A;  1MUX A;  1NX2 A;  1UHN A;  2FJU B;  3QME A;  2EHB A;  4GBA A;  1BOD A;  1SCM C;  3BXK A;  3TUY C;  4XJK A;  3GK2 A;  1SSE B;  1OMD A;  2CCM A;  4YGB B;  1A75 A;  1BMO A;  1QIW A;  1KSO A;  1YX8 A;  2YGU A;  3B6X A;  3NSI A;  4YI8 A;  4ORA B;  5ER5 A;  2HF5 A;  4MVF A;  4PCW A;  1L2O C;  1L7Z A;  1QXP A;  3KO0 A;  4M2O A;  4WRI A;  1WDC C;  5CSN A;  1NP8 A;  5ER4 X;  3WXA A;  1GM0 A;  1CDL A;  4PHM A;  1RTP 1;  4HRE E;  1LKJ A;  3C1V A;  2M0R A;  2L0P A;  2H8V A;  2CXJ A;  4FTG A;  1K9U A;  1ALW A;  2JU0 A;  2LLS A;  1YUR A;  2EC6 C;  2LMT A;  4OR9 B;  2KI4 B;  3NSL A;  4JWQ A;  4PHJ A;  2KGB C;  4M2P A;  4MZL A;  1GJY A;  5KU1 A;  3HCM A;  2Y1M A;  2LHI A;  3S0E A;  1K96 A;  1QIV A;  1LA0 A;  1F4Q A;  2K7B A;  1GQM A;  3VRP A;  1TUZ A;  1CNP A;  1C3Z A;  1KQM B;  1DT7 B;  4CID A;  1JFJ A;  2I94 A;  3LLE A;  1NCY A;  2HET A;  4MLW A;  1WLM A;  1FW4 A;  1W7J B;  1CFC A;  3D78 A;  2WC8 A;  3VGO A;  2K8M B;  3CZ0 A;  1IQ3 A;  1CKK A;  1Y1X A;  1CDM A;  2R2I A;  3DY9 A;  3PN7 B;  1UHH A;  1Q80 A;  1MXE A;  2KQY A;  3R1O A;  3CZT X;  1CLL A;  4GGF A;  1H4B A;  2NZ0 A;  1EL4 A;  2FJY A;  3D10 A;  1GGZ A;  2KI4 C;  4U8D A;  1N65 A;  1XYD A;  2QEB A;  1KFU L;  3CR2 A;  1DJZ A;  2LLU A;  3DZT A;  3OHM B;  1BJF A;  5EL2 A;  1AUI B;  5CSF A;  1KFU S;  1B8C A;  2JXC A;  4C0J A;  2GGZ A;  3VRO A;  2VRG A;  2F2P A;  1KK7 Z;  3I5I B;  2OTG B;  1DEK A;  1K9P A;  1KQM C;  3CGA A;  1RK9 A;  2L4H A;  1PRW A;  2O60 A;  1YRT B;  2O5G A;  5GQQ C;  3BFH A;  2I18 A;  2L5Y A;  2MRD A;  3L4A A;  1AJ4 A;  1SKT A;  5K89 A;  2ZND A;  2F2O A;  2CBL A;  2KGR A;  1BU3 A;  3VRR A;  3PN7 C;  3UNW A;  2BCB A;  2SCP A;  5DIC A;  1TTX A;  1B9A A;  1CMG A;  4PE1 A;  1LXF C;  1JUO A;  1WRZ A;  3CS1 A;  1J1D A;  2DOQ A;  1SRA A;  3NHT A;  3WHT B;  5DKR A;  3WNX B;  2B1U A;  2L51 A;  5HL1 A;  3LK0 A;  5HKY A;  3CTN A;  4I5L B;  1XO5 A;  1OE9 B;  1VRK A;  3TDI A;  1QVI Y;  2K60 A;  1FPW A;  3I5I C;  2L5X B;  1B47 A;  3CDN A;  2LMV A;  3O4X A;  2HQW A;  2TN4 A;  4HRH A;  1EG3 A;  3EK7 A;  4ZCV A;  4AQI A;  1Z4H A;  2KOT A;  2LUX A;  4INW A;  3I5H B;  4DS7 A;  1QV0 A;  1XK4 C;  4C0K A;  2L2C A;  5D3O A;  5D7F A;  3R1P A;  5KTY A;  2OPO A;  5HYD A;  3NSO A;  2Y4Q A;  2WOS A;  1PSR A;  4PAL A;  3K1E A;  1BOC A;  3EK8 A;  5HKW A;  1A75 B;  1AHR A;  2KNE A;  3BYA A;  4YI9 A;  1NYA A;  3N7H A;  2LHL A;  1A2X A;  2KFF A;  1XFX O;  5F6T A;  2PMY A;  1LIN A;  4HSZ A;  3ZNI A;  5HLO A;  1XFU O;  3RM1 A;  3TDZ A;  1JWD A;  3UO9 A;  5DKN A;  2MJW B;  1XFZ O;  4PT1 A;  2WCM A;  2K2A A;  2F33 A;  3L47 A;  4UPG A;  2KYF A;  3PAL A;  2COL B;  3I5G B;  4QJ3 B;  3FWB A;  5J3X A;  3SG6 A;  1UWO A;  3DVM A;  3I5F B;  4YGC B;  1NCZ A;  1DJX A;  3I5H C;  1V1F A;  1V1G A;  2Q4U A;  1IG5 A;  3CLN A;  2LC5 A;  1S6I A;  3PFV A;  1G4Y R;  1QX7 A;  3AAJ A;  3PLF B;  4PHK A;  2JQ6 A;  1M45 A;  4NQG A;  2JNF A;  2JOJ A;  3BFB A;  5G08 A;  1OOI X;  1S1E A;  1XFY O;  1SYM A;  3IQO A;  3FIA A;  4NDB A;  4DUQ A;  3CR5 X;  4DRW A;  1IIO A;  3SG5 A;  5BPJ A;  1TNP A;  1R6P A;  5HKZ A;  1DJG A;  1CLB A;  2LAP A;  3O6B A;  3F45 A;  3S0A A;  3SG4 A;  1FI5 A;  1DF0 A;  3D0Y A;  1TUJ A;  1ZMZ A;  2WCJ A;  2KFG A;  3CZ2 A;  4TNC A;  1SL7 A;  3RLZ A;  3M0W A;  3GK1 A;  4CFR A;  2A4J A;  3I5G C;  1CFF A;  2QEO A;  3I5F C;  4BY4 A;  1NIW A;  2ZNE A;  3R72 A;  5CSJ A;  3JVT B;  2MLF C;  4DIR A;  1KWO B;  1PSB A;  4OVN F;  1OMV A;  1N0Y A;  1DJW A;  1FBV A;  1B7T Z;  1MF8 B;  2ZN9 A;  1TRF A;  4N1G A;  4D1E A;  3BFA A;  4MRY A;  4PE7 A;  3D75 A;  4AQJ A;  1BF5 A;  1MWN A;  2QDI A;  4DCK A;  1IJ5 A;  3CAB A;  3EVV A;  4GNK B;  1OOH A;  1G33 A;  3CZ1 A;  1NX3 A;  1YUS A;  1HT9 A;  4GGF C;  2BKI B; 
#chains in the Genus database with same CATH homology
 1UHK A;  2OS8 B;  3BOW A;  4GGN A;  2M97 A;  1QLS A;  4MZK A;  1DJY A;  1SL8 A;  4PE0 A;  1J7P A;  2F3Y A;  1K94 A;  1QVI Z;  4IL1 A;  3KEV A;  4P2Y B;  2FOT A;  2KI6 C;  3E3R A;  2H61 A;  2BBM A;  3JVT C;  1KWO C;  3O2P A;  5HLV A;  1RJV A;  3SJS A;  3EVR A;  2KYC A;  2M49 B;  4C0L A;  2WOR A;  5I2O A;  2K7C A;  1UP5 A;  3SG2 A;  5CPV A;  3BUM B;  4FQO A;  3DF0 A;  1DJI A;  3EKJ A;  1FI6 A;  3BQ3 A;  1K8U A;  1NX1 A;  3GK4 X;  2OS8 C;  2PSR A;  1QLK A;  1Y0V H;  2F3Z A;  2KBM A;  4USL A;  1BR1 B;  4AOM A;  2JTZ A;  2PVB A;  2JXL A;  1YTZ C;  1B8R A;  3WHU B;  1OZS A;  1J7O A;  1QV1 A;  4MBE A;  2LVV A;  2JC2 A;  3SG7 A;  1DVI A;  3DVE A;  1S5G Y;  1KSM A;  2BE6 A;  2NXQ A;  2HPS A;  2LNK A;  1AVS A;  2ISD A;  3O78 A;  1ODB A;  1AP4 A;  1NX0 A;  4MRX A;  2CT9 A;  2MLE C;  1F54 A;  1TN4 A;  1Y6W A;  1SNL A;  1EXR A;  1K9K A;  2P6B B;  5AEQ A;  2OTG C;  4CPV A;  1SBJ A;  1C7W A;  1REC A;  5I8N A;  1CFP A;  2NCP A;  1JF0 A;  2SAS A;  2KFH A;  3SIA A;  1BG1 A;  2BKH B;  1WY9 A;  1DJH A;  3GOF A;  3EKH A;  4CFQ A;  1CLM A;  1OMR A;  1QX2 A;  1N2D A;  4R1E A;  1X02 A;  3FWC A;  1EH2 A;  4XJK B;  2KI6 D;  1IWQ A;  3O4Y A;  3OB1 B;  1DF0 B;  2LVK A;  2LM5 A;  2Y1N A;  3D0Y B;  1SR6 B;  1UHJ A;  1E8A A;  3KF9 A;  4A4C A;  1YVH A;  2I2R E;  1NPQ A;  3IF7 A;  1MXL C;  1Y1U A;  4WQ3 A;  2M9G A;  1S3P A;  2BE4 A;  2JZI A;  3H4S E;  4JQ0 D;  2LAN A;  2MHH A;  1CFD A;  4GAO A;  4E68 A;  1TNW A;  5DKQ A;  1K93 D;  2LVI A;  1ALV A;  1ZUZ A;  1TNX A;  1SL9 A;  4N1F A;  2F8P A;  1RWY A;  1BLQ A;  4OKH A;  2V53 A;  1NCX A;  5I2Q A;  1F70 A;  1KFX L;  1FF1 A;  1M31 A;  2CNP A;  2RGI A;  2CTN A;  2JT8 A;  1XFW O;  2HQ8 A;  1NUB A;  2ZKM X;  3TS5 B;  1SMG A;  2H2K A;  1JSA A;  2Q91 A;  4F0Z B;  3BOW B;  4GFT A;  2LV7 A;  2LP3 A;  1YRU B;  2JTT A;  2ZFD A;  4Q04 A;  5TNC A;  3SIB A;  1SY9 A;  4HRG A;  1K2H A;  4I5J A;  1B1G A;  5KSZ A;  2KAX A;  2M7L A;  3DVJ A;  3FS7 A;  3LK1 A;  2JT3 A;  5AFP A;  2JRF A;  1OQP A;  4ORC B;  1J7R A;  1G8I A;  4PHN A;  5AXI A;  1JFK A;  2PAL A;  4NDC A;  2K0J A;  2KSP A;  1TOP A;  3NXA A;  2I7A A;  2K61 A;  4OCI A;  1MQ1 A;  2M1K B;  1SK6 D;  1EG4 A;  1TCO B;  2LP2 A;  2ZRT A;  3DF0 B;  3TS5 C;  1CB1 A;  1F71 A;  3JTD B;  1CMF A;  1KK8 B;  1LA3 A;  2WCF A;  1IJ6 A;  2M29 A;  2QAC A;  3KHE A;  2JUL A;  5D69 A;  2K7O A;  1J7Q A;  1S6C A;  4XYN A;  1J55 A;  1F8H A;  1U5I A;  1OSA A;  1KCY A;  5AER A;  1YUU A;  1AJ5 A;  1IRJ A;  2JT0 A;  4YGD B;  1S5G Z;  3DVK A;  3VRQ A;  3OB2 B;  2H61 C;  4MZJ A;  2BEC A;  1F55 A;  2QPT A;  4JPZ B;  5PAL A;  2M3W A;  1F4O A;  1AK8 A;  1K95 A;  4CLN A;  1B8L A;  1NSH A;  1WLZ A;  3SG3 A;  2LCP A;  1ZOT B;  1A29 A;  2KAV A;  1M63 B;  3OX5 A;  1WRK A;  5AAN A;  2Y5I A;  1WRL A;  3JTD C;  1KK8 C;  2EGD A;  1YVL A;  4YGE B;  3LL8 B;  1H8B A;  1DGV A;  2JWW A;  2L50 A;  4PE4 A;  3NSK A;  4P5O E;  3PAT A;  2E30 A;  3VRN A;  1K90 D;  2GV5 A;  1JF2 A;  3OP0 A;  2BCA A;  1IGV A;  3MSE B;  4BY5 A;  1CTR A;  2JPT A;  1XA5 A;  1CM4 A;  4ZCU A;  2MAZ A;  1TCF A;  3PSR A;  2MA2 A;  1SPY A;  3A8R A;  2AAO A;  2M8U A;  1OZO A;  3BUW B;  2LLT A;  1Y1A A;  3TZ1 A;  1QAT A;  2JNX A;  2LUC A;  4QJ5 B;  1RFJ A;  5JOL A;  4NDD A;  3K21 A;  2IS9 A;  2LVJ A;  1R2U A;  4I5N B;  1A03 A;  1B7T Y;  3EK4 A;  4MN0 A;  4WQ2 A;  4YRU A;  4MSP A;  2M7N A;  5JJG A;  1D1O A;  1MHO A;  5I2L A;  2KQ6 A;  2K7D A;  2KHN A;  2PRU A;  2FCD A;  1M39 A;  2KBI A;  2PAS A;  1HQV A;  2G2B A;  1DGU A;  3BUN B;  2L98 A;  1CDN A;  1IH0 A;  3HX4 A;  2L4I A;  4OV2 A;  2MBX A;  3TDU A;  1QJT A;  2LMU A;  1ZFS A;  3CWG A;  2KAY A;  1BR4 B;  5FYX A;  3AAK A;  3LCP C;  1UUR A;  1CM1 A;  1YR5 A;  4I5K A;  4A4B A;  1CDP A;  2WCB A;  1KQV A;  1QX5 B;  1OOJ A;  2KDH A;  3DD4 A;  3CR4 X;  1YUT A;  2K2F A;  2FCE A;  1JC2 A;  4YBH B;  1XFV O;  2G9B A;  1QAS A;  1DTL A;  5CSI A;  3ICB A;  1DMO A;  2ZRS A;  1PVB A;  1QTX A;  3KPX A;  1SW8 A;  1UHI A;  4ORB B;  1RRO A;  4MEW A;  1XVJ A;  1S36 A;  1NWD A;  2WCE A;  1KK7 Y;  2BCX A;  1UUS A;  3IQQ A;  3PM8 A;  1JBA A;  1MR8 A;  4M2Q A;  2GGM A;  1U5I B;  1ZAC A;  2AUC A;  1KFX S;  3A4U B;  1PUL A;  4ETO A;  3QRX A;  5B8I B;  2BL0 B;  1XK4 A;  2D8N A;  1EJ3 A;  1J1E A;  1PK0 D;  1SCM B;  1W7I B;  1SR6 C;  3TUY B;  1YX7 A;  4GUK A;  1C7V A;  1B4C A;  4GPL B;  1TNQ A;  2E6W A;  4YGA A;  1L2O B;  2NCO A;  4QJ4 B;  3EVU A;  1WDC B;  1PVA A;  1LVC D;  1SCV A;  2M1U A;  1IQ5 A;  1PAL A;  1A4P A;  3AKB A;  4PDZ A;  1QS7 A;  1GGW A;  3ZWH A;  1IKU A;  4N5X A;  2EC6 B;  2AMI A;  3BUO B;  2NLN A;  2L2E A;  3BUX B;  4L9M A;  2LE9 B;  1S26 D;  2BBN A;  1BT6 A;  3AKA A;  5IBW A;  1S6J A;  2ZN8 A;  2WND A;  3OX6 A;  1C07 A;  2BL0 C;  4ICB A;  1TIZ A;  1M46 A;  1MUX A;  1NX2 A;  1UHN A;  2FJU B;  4GBA A;  2EHB A;  1BOD A;  1SCM C;  3BXK A;  3TUY C;  4XJK A;  3GK2 A;  1OMD A;  2CCM A;  4YGB B;  1A75 A;  1BMO A;  1QIW A;  1KSO A;  1YX8 A;  3NSI A;  4YI8 A;  4ORA B;  5ER5 A;  2HF5 A;  4MVF A;  4PCW A;  1L2O C;  1L7Z A;  1QXP A;  3KO0 A;  4M2O A;  4WRI A;  1WDC C;  5CSN A;  1NP8 A;  5ER4 X;  3WXA A;  1CDL A;  4PHM A;  1RTP 1;  4HRE E;  1LKJ A;  3C1V A;  2M0R A;  2L0P A;  4FTG A;  2CXJ A;  1K9U A;  1ALW A;  2JU0 A;  2LLS A;  1YUR A;  2EC6 C;  2LMT A;  4OR9 B;  2KI4 B;  3NSL A;  4JWQ A;  4PHJ A;  2KGB C;  4M2P A;  4MZL A;  1GJY A;  5KU1 A;  3HCM A;  2Y1M A;  2LHI A;  1K96 A;  1QIV A;  1LA0 A;  1F4Q A;  2K7B A;  1GQM A;  3VRP A;  1CNP A;  1KQM B;  1DT7 B;  4CID A;  1JFJ A;  2I94 A;  3LLE A;  1NCY A;  2HET A;  4MLW A;  1WLM A;  1FW4 A;  1W7J B;  1CFC A;  2WC8 A;  3VGO A;  2K8M B;  1IQ3 A;  1CKK A;  1Y1X A;  1CDM A;  2R2I A;  3PN7 B;  1UHH A;  1Q80 A;  1MXE A;  2KQY A;  4GGF A;  3CZT X;  1CLL A;  1H4B A;  2NZ0 A;  1EL4 A;  3D10 A;  1GGZ A;  2KI4 C;  4U8D A;  1N65 A;  1XYD A;  3CR2 A;  1KFU L;  1DJZ A;  2LLU A;  3OHM B;  1BJF A;  1AUI B;  5CSF A;  1KFU S;  1B8C A;  2JXC A;  4C0J A;  2GGZ A;  3VRO A;  2VRG A;  2F2P A;  1KK7 Z;  3I5I B;  2OTG B;  1K9P A;  1KQM C;  3CGA A;  1RK9 A;  2L4H A;  1PRW A;  2O60 A;  1YRT B;  2O5G A;  5GQQ C;  2I18 A;  2MRD A;  1AJ4 A;  1SKT A;  5K89 A;  2ZND A;  2F2O A;  2CBL A;  2KGR A;  1BU3 A;  3VRR A;  3PN7 C;  2BCB A;  2SCP A;  1TTX A;  1B9A A;  1CMG A;  4PE1 A;  1LXF C;  1JUO A;  1WRZ A;  3CS1 A;  1J1D A;  2DOQ A;  1SRA A;  3WHT B;  5DKR A;  3WNX B;  2B1U A;  2L51 A;  3LK0 A;  5HKY A;  3CTN A;  4I5L B;  1XO5 A;  1OE9 B;  1VRK A;  3TDI A;  1QVI Y;  1FPW A;  3I5I C;  2L5X B;  1B47 A;  2LMV A;  4HRH A;  2HQW A;  2TN4 A;  1EG3 A;  3EK7 A;  4ZCV A;  4AQI A;  2KOT A;  2LUX A;  3I5H B;  4DS7 A;  1QV0 A;  1XK4 C;  4C0K A;  5D7F A;  5KTY A;  2OPO A;  5HYD A;  3NSO A;  2Y4Q A;  2WOS A;  1PSR A;  4PAL A;  1BOC A;  3EK8 A;  5HKW A;  1A75 B;  1AHR A;  2KNE A;  3BYA A;  4YI9 A;  1NYA A;  2LHL A;  1A2X A;  2KFF A;  1XFX O;  5F6T A;  2PMY A;  1LIN A;  4HSZ A;  3ZNI A;  5HLO A;  1XFU O;  3RM1 A;  3TDZ A;  1JWD A;  5DKN A;  2MJW B;  1XFZ O;  2K2A A;  2F33 A;  4UPG A;  2KYF A;  3PAL A;  2COL B;  3I5G B;  4QJ3 B;  3FWB A;  5J3X A;  3SG6 A;  1UWO A;  3DVM A;  3I5F B;  4YGC B;  1NCZ A;  1DJX A;  3I5H C;  1V1F A;  1V1G A;  2Q4U A;  1IG5 A;  3CLN A;  2LC5 A;  1S6I A;  3PFV A;  1G4Y R;  1QX7 A;  3AAJ A;  3PLF B;  4PHK A;  2JQ6 A;  1M45 A;  4NQG A;  2JNF A;  2JOJ A;  5G08 A;  1S1E A;  1XFY O;  1SYM A;  3IQO A;  3FIA A;  4NDB A;  4DUQ A;  3CR5 X;  4DRW A;  3SG5 A;  5BPJ A;  1TNP A;  1R6P A;  5HKZ A;  1DJG A;  1CLB A;  2LAP A;  3O6B A;  3F45 A;  1FI5 A;  3SG4 A;  1DF0 A;  3D0Y A;  1ZMZ A;  2KFG A;  4TNC A;  1SL7 A;  3RLZ A;  3M0W A;  3GK1 A;  4CFR A;  2A4J A;  3I5G C;  1CFF A;  3I5F C;  4BY4 A;  1NIW A;  2ZNE A;  5CSJ A;  3JVT B;  2MLF C;  4DIR A;  1KWO B;  1PSB A;  4OVN F;  1OMV A;  1N0Y A;  1DJW A;  1FBV A;  1B7T Z;  1MF8 B;  2ZN9 A;  1TRF A;  4N1G A;  4D1E A;  4MRY A;  4PE7 A;  1BF5 A;  4AQJ A;  1MWN A;  4DCK A;  1IJ5 A;  3EVV A;  4GNK B;  1G33 A;  1NX3 A;  1YUS A;  1HT9 A;  4GGF C;  2BKI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...