1KSOA

Crystal structure of apo s100a3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S100 CALCIUM-BINDING PROTEIN A3
publication title Metal-free MIRAS phasing: structure of apo-S100A3.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ksoA00
4C0JA 1CM4A 2VRGA 4P2YB 2ZFDA 4PALA 4YGAA 1JFJA 2M9GA 1SCVA 2K0JA 3CR5X 2M8UA 2WNDA 4XJKA 1DF0B 1DJWA 1MHOA 2LUXA 1H8BA 1DJIA 1SPYA 4HRHA 1QX2A 1UURA 2K7DA 1QTXA 1PSBA 3DD4A 2KGRA 4PE4A 3NSLA 3IF7A 2FCEA 3CR2A 1TIZA 3PALA 1PK0D 1EG3A 3CR4X 1KK8C 3QRXA 2LV7A 1IKUA 3TUYC 4PHNA 3WXAA 1AK8A 1SRAA 2FOTA 4F0ZB 1WDCC 1M46A 1KQVA 3KEVA 1YX7A 2QPTA 4YRUA 1JF2A 1SBJA 3CS1A 3RM1A 2NLNA 4OCIA 4OVNF 2ZKMX 2JNXA 2M7LA 2KQ6A 5CSJA 3BUWB 1J7PA 1CFPA 1KQMB 1NUBA 2QACA 1V1FA 2M49B 1DMOA 4YI8A 1NIWA 1NX2A 2CTNA 2M0RA 1YX8A 1KFXL 2KAVA 2H61C 1D1OA 4GGFC 2I18A 2F2PA 3SG3A 1J1DA 3OHMB 1M31A 1XFVO 2MAZA 4YGEB 1Y1XA 1TNPA 5I2LA 3OB1B 1JBAA 2M1UA 3MSEB 2SCPA 1TOPA 1NWDA 1Y6WA 2M97A 4M2QA 1WRZA 1CNPA 5HLOA 3LCPC 3KF9A 5DKNA 2KYCA 1XFUO 5AANA 3IQOA 3DVJA 1IWQA 1A03A 2F8PA 1H4BA 3K21A 1HQVA 2KGBC 3EVVA 2OPOA 1AP4A 1G33A 3SIAA 4BY5A 1KQMC 3DF0A 3PATA 2B1UA 3NSIA 2ISDA 1BG1A 3D0YA 5DKQA 4P5OE 4I5NB 1BU3A 5CSIA 2IS9A 1ZOTB 2JT8A 2HQ8A 1OSAA 1UHJA 2PASA 2JT3A 3O78A 1GQMA 1SL8A 1JUOA 1AHRA 1DGUA 1IJ6A 3NXAA 2TN4A 1TNXA 1XO5A 2BE6A 3ZWHA 4DCKA 1FPWA 2LM5A 4PE0A 1YRTB 1BR1B 2MHHA 1WLZA 2K8MB 2O5GA 4OKHA 1NX0A 2M29A 4ZCVA 1DJGA 1S5GZ 3AAJA 2KFHA 1DJXA 1J7RA 3KHEA 4MLWA 3VGOA 1K9UA 2K7CA 2WC8A 4JQ0D 4CFQA 4GNKB 1S6CA 4DS7A 2DOQA 4GBAA 3WNXB 3C1VA 4MZLA 1Q80A 1SY9A 3GK2A 1MQ1A 4WRIA 4OV2A 2KHNA 3O6BA 1DF0A 3DVMA 2HF5A 4GGFA 1S6IA 1W7IB 1SR6B 3DF0B 4AQIA 1SW8A 1PSRA 2CBLA 1BODA 1QVIZ 1R2UA 5JOLA 3VRQA 2K2AA 1B8RA 3O2PA 1BF5A 2MJWB 3TS5B 2NXQA 4GAOA 3FWBA 4A4BA 1FBVA 2ZRTA 5GQQC 4AOMA 1K9KA 2JWWA 2KNEA 4MVFA 1K2HA 3CWGA 1IQ3A 4MZJA 1QV0A 1TTXA 1LXFC 1B1GA 5JJGA 2BECA 1OOJA 2LE9B 4CLNA 2FJUB 1TN4A 2JPTA 1NCZA 3EK7A 1WY9A 2HETA 4HRGA 4HREE 1QIWA 1VRKA 2LCPA 1WRKA 3M0WA 2L2EA 5HKZA 5AFPA 1SYMA 5K89A 2Y4QA 3NSOA 2KI4B 1UWOA 1UP5A 1FI5A 1JF0A 2V53A 1CTRA 1SR6C 2JTTA 2I7AA 4MBEA 1IQ5A 2F3ZA 3GK1A 2MLFC 5D7FA 1IH0A 3TS5C 2F2OA 3SIBA 5HLVA 1SCMB 1NX3A 1QX5B 1OMRA 1YVLA 1UUSA 2KSPA 1NP8A 3TDUA 4NQGA 2WCEA 1MF8B 5DKRA 4N1FA 1NSHA 5KSZA 1TRFA 1PVBA 4MN0A 1DTLA 1F4OA 2SASA 4M2OA 4MRYA 1JWDA 2LC5A 3GOFA 2E30A 5F6TA 2KQYA 4UPGA 4MRXA 1B4CA 3A8RA 2NZ0A 1IRJA 4A4CA 1K90D 1YTZC 2R2IA 3SG5A 4N5XA 2FCDA 3ZNIA 3PN7B 1YR5A 1B7TZ 1KFUS 2LLTA 3PSRA 2KI4C 4PCWA 4DUQA 4QJ5B 3OX5A 5KTYA 1UHKA 2Q91A 4NDCA 1EL4A 3KPXA 3AAKA 1J7OA 3SG7A 3VROA 5CPVA 1OE9B 3FIAA 3EKHA 4PHJA 1C7VA 1C7WA 4GUKA 4DIRA 1XVJA 2JU0A 2Y1NA 1SCMC 1RK9A 1RWYA 3JVTB 1KK7Z 1N65A 1M39A 2LP3A 3EK8A 1CDLA 1A75A 2BE4A 1RJVA 4FQOA 3BUMB 3I5HB 3OP0A 1K8UA 2M7NA 1CLLA 3KO0A 1AVSA 1IJ5A 1G8IA 1QLSA 4PDZA 1XFXO 2HQWA 1ZACA 1OMDA 3DVKA 1UHNA 1YUUA 2BBMA 5PALA 1GGZA 3I5IB 3CZTX 4PHMA 1BR4B 3LL8B 5I2OA 2ZNEA 2E6WA 3PN7C 1NCYA 2EC6B 2AAOA 3O4YA 1TCFA 1PVAA 1KSMA 2G2BA 1QX7A 2LANA 1XYDA 1OQPA 1SNLA 2JT0A 3PLFB 1JFKA 3VRNA 4XYNA 2BKHB 4ORAB 4MEWA 2CCMA 1B8CA 2MLEC 3DVEA 2BCXA 2LLUA 2JXLA 2LNKA 3BQ3A 3JVTC 1F4QA 1ZFSA 5HYDA 2JZIA 3IQQA 5ER4X 1ZUZA 3EKJA 3I5HC 5KU1A 1QIVA 1S5GY 1ALWA 1B9AA 1A75B 1F70A 4ETOA 1G4YR 1QLKA 5J3XA 4BY4A 4C0LA 1LKJA 4YGCB 1CLMA 1R6PA 3BYAA 2LUCA 4GGNA 3SG2A 1KFXS 3I5IC 3NSKA 2JXCA 2K2FA 3I5FB 2Q4UA 2EC6C 1EJ3A 1AJ5A 1QVIY 1E8AA 1GJYA 2L50A 3HX4A 2K61A 2A4JA 3BOWB 2NCPA 3H4SE 5FYXA 2K7BA 3OX6A 4ZCUA 5ER5A 2AUCA 1QV1A 1DJYA 1YRUB 2K7OA 3OB2B 2JULA 4PE1A 2M3WA 3SG4A 4TNCA 2BBNA 1S36A 4ORBB 1DT7B 2KBIA 1YVHA 1S26D 1FI6A 1Y0VH 1KSOA 1SMGA 2KAXA 2LVJA 1KWOB 1EG4A 2H2KA 3I5GB 1CDMA 1K94A 2LVIA 2PALA 1JC2A 4MSPA 3WHTB 3I5FC 1CFCA 4OR9B 4YI9A 4CIDA 2L98A 2F33A 1C07A 2LMVA 4DRWA 2L51A 1RFJA 1J55A 1WLMA 2BCAA 4FTGA 3FWCA 4I5KA 1F71A 1K93D 1SL9A 1M45A 2I2RE 1CMGA 2LHIA 3SG6A 4CPVA 3PFVA 1BOCA 2O60A 1K96A 1NYAA 1OMVA 1RECA 1CDPA 5AXIA 3TDIA 1QASA 2GGMA 5AERA 1CFDA 2PRUA 1L2OB 2MRDA 1KWOC 2JQ6A 3EVUA 5B8IB 3I5GC 5HKYA 2LP2A 2PVBA 1BLQA 1B7TY 1A29A 1B8LA 2WCFA 1RROA 5I8NA 1XA5A 4YGBB 1L7ZA 1A4PA 3EVRA 1CDNA 3D10A 4JPZB 2LAPA 2P6BB 2L4IA 1YURA 2CT9A 1N2DA 1SK6D 1QS7A 1DJZA 2F3YA 1FW4A 1KK7Y 1S6JA 2EGDA 3WHUB 1AJ4A 2LVVA 1OZSA 1MUXA 1MXEA 5CSNA 1NCXA 2JC2A 1F54A 2LLSA 1XK4C 1Y1AA 2CXJA 4Q04A 1DGVA 2MA2A 4AQJA 1Y1UA 1XFWO 1TCOB 4C0KA 1ZMZA 1LINA 1L2OC 1J7QA 1HT9A 3JTDB 2GGZA 2HPSA 5I2QA 1WRLA 1V1GA 5CSFA 3LLEA 1XFZO 2CNPA 1XFYO 2KI6D 2LMUA 4XJKB 1F55A 3BOWA 2KOTA 4U8DA 4YGDB 3GK4X 1PRWA 4E68A 2EHBA 2I94A 3BUXB 1CMFA 1NPQA 3RLZA 2D8NA 1IG5A 1LVCD 1A2XA 4JWQA 2OS8B 3CTNA 1EH2A 1JSAA 4YBHB 3LK1A 2KYFA 1UHIA 2ZNDA 3E3RA 4M2PA 4PE7A 1KCYA 2RGIA 4I5LB 1PALA 1S1EA 1J1EA 3A4UB 3PM8A 1CM1A 1YUTA 2MBXA 4CFRA 3SJSA 3VRPA 4R1EA 1B47A 1CFFA 1UHHA 3BXKA 1M63B 2LHLA 2WOSA 1TNWA 3JTDC 1DVIA 2KDHA 1LA3A 3CLNA 5TNCA 2JRFA 1AUIB 2PSRA 3VRRA 1U5IA 4WQ3A 1RTP1 2Y1MA 1EXRA 3CGAA 2PMYA 4NDDA 1MXLC 3LK0A 4I5JA 4WQ2A 1F8HA 1ALVA 5BPJA 1NX1A 4USLA 2AMIA 1XK4A 3HCMA 2Y5IA 2OS8C 2KFGA 3F45A 3FS7A 2BCBA 1SL7A 1TNQA 3BUNB 4HSZA 4ICBA 2BKIB 2LVKA 2OTGB 5D69A 1CLBA 1CB1A 2WCBA 1BMOA 1DJHA 1QXPA 1OZOA 4GFTA 3TZ1A 1GGWA 1X02A 2BL0B 4L9MA 1BT6A 2LMTA 2WORA 4N1GA 2H61A 4QJ3B 2KFFA 2M1KB 2NCOA 1K9PA 2L4HA 1KFUL 3D0YB 3AKAA 2KI6C 1ODBA 1PULA 2G9BA 1YUSA 3BUOB 4MZKA 4NDBA 1MWNA 4GPLB 1CKKA 2COLB 1BJFA 4PHKA 1KK8B 1S3PA 5IBWA 1QJTA 1QATA 1U5IB 3TUYB 2L5XB 1W7JB 3ICBA 5G08A 2ZRSA 1SKTA 1WDCB 2JTZA 5HKWA 2KBMA 2ZN8A 4IL1A 2L0PA 2JOJA 1MR8A 2JNFA 3TDZA 4ORCB 2GV5A 3EK4A 3AKBA 2ZN9A 2OTGC 1N0YA 1LA0A 1FF1A 1K95A 2KAYA 5AEQA 4D1EA 1IGVA 2BL0C 4QJ4B
chains in the Genus database with same CATH superfamily
4C0JA 1CM4A 2VRGA 4P2YB 2ZFDA 4PALA 4YGAA 1DC1A 2M9GA 1SCVA 1JFJA 2K0JA 3CR5X 3FE9A 2M8UA 2WNDA 4XJKA 1DF0B 1DJWA 3RZSA 1MHOA 2LUXA 3R72A 1H8BA 1DJIA 1SPYA 4HRHA 1QX2A 1UURA 2K7DA 3FE6A 1ORGA 1QTXA 1PSBA 3DD4A 2KGRA 4PE4A 3NSLA 3IF7A 2FCEA 3CR2A 1TIZA 2H8VA 1PK0D 1EG3A 3CR4X 3PALA 1KK8C 3QRXA 2LV7A 3K1EA 1IKUA 3CABA 3TUYC 3VB1A 4PHNA 3WXAA 1AK8A 1SRAA 2FOTA 3NHTA 1WDCC 4F0ZB 1M46A 1KQVA 3KEVA 1YX7A 3S0AA 2QPTA 4YRUA 1JF2A 1SBJA 3CS1A 1Z4HA 3RM1A 3S0DA 2NLNA 2WCKA 4OCIA 2ZKMX 2JNXA 4OVNF 2M7LA 2KQ6A 5CSJA 3BUWB 1J7PA 1CFPA 1KQMB 1NUBA 1QWVA 2QACA 1V1FA 2M49B 2WCLA 1DMOA 4YI8A 1NIWA 1NX2A 2CTNA 2M0RA 1YX8A 1KFXL 2KAVA 2H61C 1D1OA 4GGFC 2I18A 2F2PA 4FQTA 3OBVA 3SG3A 1J1DA 3OHMB 1M31A 1XFVO 2MAZA 4YGEB 1Y1XA 1TNPA 5I2LA 3OB1B 1JBAA 2M1UA 3MSEB 2SCPA 1TOPA 3CZ2A 1NWDA 1Y6WA 2M97A 4M2QA 1WRZA 1CNPA 5HLOA 3LCPC 3KF9A 5DKNA 2KYCA 1XFUO 5AANA 3IQOA 3DVJA 1LS8A 1SSEB 1IWQA 2KPHA 1A03A 5FI7A 2F8PA 1H4BA 3K21A 3O4XA 1HQVA 2KGBC 3EVVA 3PJIA 2OPOA 1AP4A 3SS3A 1G33A 3SIAA 4BY5A 1KQMC 3DF0A 3PATA 2B1UA 3NSIA 2ISDA 1BG1A 3B6XA 3D0YA 5DKQA 4P5OE 4I5NB 1BU3A 3DZTA 1OOIX 3R1PA 5CSIA 2IS9A 1ZOTB 2JT8A 2HQ8A 1OSAA 1UHJA 2PASA 3R1VA 2JT3A 3O78A 1GQMA 1SL8A 1JUOA 4IJ7A 1AHRA 1DGUA 1IJ6A 3NGVA 2TN4A 1TNXA 3NXAA 1XO5A 2BE6A 3ZWHA 4DCKA 1FPWA 2LM5A 4PE0A 1YRTB 1BR1B 2MHHA 1WLZA 2K8MB 2O5GA 4OKHA 1Z2CB 1NX0A 2M29A 3B7AA 1DJGA 5FI6A 1S5GZ 3AAJA 1TWOA 2KFHA 1DJXA 1J7RA 3KHEA 4MLWA 3VGOA 1K9UA 2K7CA 2WC8A 4JQ0D 2P70A 4CFQA 3L47A 1S6CA 4GNKB 2DOQA 4GBAA 3WNXB 3C1VA 4MZLA 1Q80A 1SY9A 3GK2A 1MQ1A 4WRIA 4OV2A 2KHNA 3O6BA 1DF0A 3DVMA 3D77A 2HF5A 4GGFA 1S6IA 1W7IB 1SR6B 2WCMA 3DF0B 4AQIA 1SW8A 1PSRA 1DQEA 2CBLA 1DELA 1BODA 1QVIZ 1R2UA 5JOLA 3VRQA 2K2AA 1B8RA 3O2PA 1BF5A 2MJWB 3TS5B 2NXQA 4GAOA 3FWBA 4A4BA 1FBVA 2ZRTA 5GQQC 4AOMA 1K9KA 2JWWA 2KNEA 4MVFA 1K2HA 3CWGA 1IQ3A 4MZJA 1QV0A 1TTXA 1LXFC 1OOHA 2YGUA 1B1GA 5JJGA 2BECA 1OOJA 3SS5A 2LE9B 4CLNA 2FJUB 1TN4A 1OOGA 2JPTA 1NCZA 3EK7A 1WY9A 2HETA 4HRGA 4HREE 1QIWA 5D3OA 1VRKA 2L2CA 1WRKA 2LCPA 3V2LA 3EG5B 3M0WA 4DS7A 2L2EA 5HKZA 5AFPA 1SYMA 5K89A 2Y4QA 2WCJA 3NSOA 2WC6A 2KI4B 1UWOA 1UP5A 1FI5A 1JF0A 2V53A 1CTRA 1SR6C 2JTTA 2I7AA 4MBEA 3S0FA 1IQ5A 2F3ZA 3GK1A 2MLFC 5D7FA 1IH0A 3TS5C 2F2OA 3SIBA 2KLEA 5HLVA 1SCMB 1NX3A 1QX5B 1OMRA 1W9ZA 1UUSA 1YVLA 1NP8A 2KSPA 4NQGA 3TDUA 2WCEA 1MF8B 5DKRA 4N1FA 1NSHA 3D75A 5KSZA 1TRFA 1PVBA 4MN0A 1DTLA 1F4OA 2SASA 4M2OA 4MRYA 1JWDA 2LC5A 3GOFA 2E30A 3N7HA 5F6TA 5DICA 2KQYA 4UPGA 4MRXA 1B4CA 3A8RA 2NZ0A 1IRJA 4A4CA 1K90D 1YTZC 3OGNA 3QMEA 2R2IA 3SG5A 4N5XA 2FCDA 3ZNIA 3PN7B 1YR5A 1B7TZ 1KFUS 2LLTA 3PSRA 2KI4C 4PCWA 4DUQA 4QJ5B 3OX5A 5KTYA 1UHKA 2Q91A 4NDCA 1EL4A 3KPXA 3CZ0A 3AAKA 1J7OA 3SG7A 3VROA 5CPVA 1OE9B 3FIAA 3EKHA 4PHJA 1C7VA 1C7WA 4GUKA 4DIRA 1XVJA 2JU0A 2Y1NA 1SCMC 1C3ZA 2WCHA 1RK9A 1RWYA 3JVTB 1KK7Z 1N65A 1M39A 2LP3A 3EK8A 1CDLA 1A75A 2BE4A 1RJVA 3D78A 4FQOA 3BUMB 3I5HB 3B87A 3OP0A 1K8UA 2M7NA 1CLLA 3KO0A 1AVSA 1IJ5A 3S0EA 1G8IA 4OZDA 1QLSA 4PDZA 1XFXO 2HQWA 1ZACA 1OMDA 3DVKA 2QEOA 1UHNA 1YUUA 2BBMA 5PALA 1GGZA 3I5IB 3CZTX 4PHMA 1BR4B 3LL8B 5I2OA 3Q8IA 3PM2A 2ZNEA 2E6WA 3PN7C 1NCYA 2EC6B 2AAOA 3O4YA 1TCFA 1PVAA 1KSMA 2G2BA 1QX7A 2LANA 1XYDA 2K60A 1OQPA 1SNLA 2JT0A 3PLFB 1JFKA 3VRNA 4XYNA 3L4AA 5FI2A 3FE8A 2BKHB 4ORAB 3IVTA 4MEWA 2CCMA 1B8CA 2MLEC 1OOFA 3DVEA 2BCXA 2LLUA 2JXLA 2LNKA 3BQ3A 3BFAA 3JVTC 1F4QA 1ZFSA 5HYDA 3S0GA 2JZIA 3IQQA 1C3YA 5ER4X 1ZUZA 3EKJA 3I5HC 5KU1A 1QIVA 1S5GY 1ALWA 1B9AA 1A75B 1F70A 4ETOA 1G4YR 1QLKA 5J3XA 4BY4A 2GTEA 4C0LA 1LKJA 4YGCB 1CLMA 1R6PA 3BYAA 2LUCA 4GGNA 3SG2A 1KFXS 3I5IC 3NSKA 2JXCA 2K2FA 3I5FB 2Q4UA 2EC6C 1EJ3A 1AJ5A 1QVIY 1E8AA 1GJYA 2L50A 3HX4A 3S0BA 2K61A 2A4JA 3BOWB 2NCPA 3H4SE 5FYXA 2K7BA 3OX6A 4ZCUA 5ER5A 2AUCA 1QV1A 2QEVA 1DJYA 5EL2A 1YRUB 2K7OA 3OB2B 2JULA 4PE1A 2M3WA 3SG4A 4TNCA 2BBNA 1S36A 4ORBB 1DT7B 2QEBA 2KBIA 1YVHA 1S26D 1FI6A 1Y0VH 1KSOA 1SMGA 2BNXA 2KAXA 3D73A 2LVJA 1KWOB 3BFBA 1EG4A 2H2KA 3I5GB 1CDMA 1K94A 2LVIA 2PALA 4KYNA 4F7FA 1JC2A 1TUJA 2PYQA 4MSPA 3UNWA 3WHTB 3D76A 3I5FC 1CFCA 4OR9B 4YI9A 4CIDA 2L98A 2F33A 1DEKA 1C07A 2LMVA 4DRWA 2L51A 1RFJA 1J55A 1WLMA 2BCAA 4FTGA 1XFRA 2FJYA 3B86A 3FWCA 4I5KA 1F71A 1K93D 1SL9A 3R1OA 1M45A 2I2RE 1CMGA 2LHIA 3SG6A 5I94A 4CPVA 3PFVA 1BOCA 2O60A 1K96A 1NYAA 1OMVA 1RECA 1CDPA 3B88A 5AXIA 3TDIA 1QASA 2GGMA 5AERA 1CFDA 2PRUA 1L2OB 2MRDA 1KWOC 2JQ6A 3EVUA 4JKTA 5B8IB 3I5GC 1GM0A 5HKYA 2LP2A 2PVBA 1BLQA 1B7TY 2JPOA 1A29A 1B8LA 2WCFA 3BFHA 1RROA 5I8NA 1XA5A 4ZCVA 4YGBB 1L7ZA 1A4PA 3EVRA 1CDNA 3D10A 2WC5A 4JPZB 3L4LA 3D74A 2LAPA 2P6BB 2L4IA 1YURA 2CT9A 1N2DA 1SK6D 1QS7A 1DJZA 2F3YA 1FW4A 1KK7Y 1S6JA 2EGDA 3WHUB 1AJ4A 2LVVA 1OZSA 1MUXA 1MXEA 5CSNA 1NCXA 2JC2A 1F54A 2LLSA 1XK4C 5HL1A 1Y1AA 2CXJA 4Q04A 1DGVA 2MA2A 4AQJA 1Y1UA 1XFWO 1TCOB 3DXLA 2MBXA 4C0KA 1ZMZA 4JD9A 2PQLA 1LINA 1L2OC 1J7QA 1HT9A 3JTDB 2GGZA 2HPSA 5I2QA 1WRLA 1V1GA 5CSFA 3LLEA 1XFZO 2CNPA 1XFYO 2KI6D 2LMUA 2QDIA 4XJKB 1F55A 3BOWA 2KOTA 4U8DA 4YGDB 3GK4X 1PRWA 4E68A 2EHBA 3DY9A 2I94A 4INXA 3BUXB 1CMFA 1NPQA 3RLZA 2D8NA 2KLDA 1IG5A 4PT1A 1LVCD 1A2XA 4JWQA 2OS8B 3CTNA 1EH2A 1JSAA 3BJHA 4YBHB 3LK1A 3UO9A 2KYFA 1UHIA 2ZNDA 3E3RA 1OW4A 4M2PA 4PE7A 2RGIA 4I5LB 1PALA 1S1EA 1J1EA 3A4UB 3PM8A 1CM1A 1YUTA 3CZ1A 4INWA 4CFRA 3SJSA 3VRPA 4R1EA 1B47A 1CFFA 1UHHA 3BXKA 1M63B 2LHLA 2WOSA 2P71A 1TNWA 2QEHA 3DYEA 3JTDC 3SS4A 1DVIA 2KDHA 1LA3A 3CLNA 5TNCA 2JRFA 1AUIB 2PSRA 3VRRA 1U5IA 3CDNA 4WQ3A 1RTP1 2Y1MA 1EXRA 3CGAA 2PMYA 4NDDA 1MXLC 3LK0A 4I5JA 4WQ2A 1F8HA 1ALVA 1TUZA 5BPJA 1NX1A 4USLA 2AMIA 1XK4A 3NHIA 3HCMA 2Y5IA 2OS8C 2KFGA 3F45A 3FS7A 2BCBA 1SL7A 1TNQA 3BUNB 4HSZA 4ICBA 2BKIB 2LVKA 2OTGB 5D69A 1CLBA 1CB1A 2WCBA 1BMOA 1DJHA 1QXPA 1OZOA 4GFTA 3TZ1A 1GGWA 1X02A 2BL0B 4L9MA 1BT6A 2LMTA 2WORA 4N1GA 2H61A 4QJ3B 2KFFA 2BL0C 2M1KB 2NCOA 1IIOA 1K9PA 2L4HA 1KFUL 3D0YB 3AKAA 2KI6C 1ODBA 1PULA 2G9BA 1YUSA 3BUOB 4MZKA 4NDBA 1T14A 1MWNA 4GPLB 1CKKA 2COLB 1BJFA 4PHKA 1KK8B 1P28A 1S3PA 5IBWA 1QJTA 1QATA 1U5IB 3TUYB 2L5XB 1W7JB 3ICBA 5G08A 1KCYA 2ZRSA 1SKTA 3CYZA 1WDCB 2JTZA 2L5YA 2KBMA 5HKWA 2ZN8A 4IL1A 2L0PA 2JOJA 1MR8A 2JNFA 3TDZA 4ORCB 2GV5A 3EK4A 3AKBA 2ZN9A 2OTGC 1N0YA 1LA0A 1FF1A 1K95A 2KAYA 5AEQA 4D1EA 2ERBA 1IGVA 2BAPA 4QJ4B
chains in the Genus database with same CATH topology
4C0JA 1CM4A 2VRGA 4P2YB 2ZFDA 4PALA 4YGAA 1JFJA 2M9GA 1SCVA 2K0JA 3CR5X 2M8UA 2WNDA 4XJKA 1DF0B 1DJWA 1MHOA 2LUXA 1H8BA 1DJIA 1SPYA 4HRHA 1QX2A 1UURA 2K7DA 1QTXA 1PSBA 3DD4A 2KGRA 4PE4A 3NSLA 3IF7A 2FCEA 3CR2A 1TIZA 3PALA 1PK0D 1EG3A 3CR4X 1KK8C 3QRXA 2LV7A 1IKUA 3TUYC 4PHNA 3WXAA 1AK8A 1SRAA 2FOTA 4F0ZB 1WDCC 1M46A 1KQVA 3KEVA 1YX7A 2QPTA 4YRUA 1JF2A 1SBJA 3CS1A 3RM1A 2NLNA 4OCIA 4OVNF 2ZKMX 2JNXA 2M7LA 2KQ6A 5CSJA 3BUWB 1J7PA 1CFPA 1KQMB 1NUBA 2QACA 1V1FA 2M49B 1DMOA 4YI8A 1NIWA 1NX2A 2CTNA 2M0RA 1YX8A 1KFXL 2KAVA 2H61C 1D1OA 4GGFC 2I18A 2F2PA 3SG3A 1J1DA 3OHMB 1M31A 1XFVO 2MAZA 4YGEB 1Y1XA 1TNPA 5I2LA 3OB1B 1JBAA 2M1UA 3MSEB 2SCPA 1TOPA 1NWDA 1Y6WA 2M97A 4M2QA 1WRZA 1CNPA 5HLOA 3LCPC 3KF9A 5DKNA 2KYCA 1XFUO 5AANA 3IQOA 3DVJA 1IWQA 1A03A 2F8PA 1H4BA 3K21A 1HQVA 2KGBC 3EVVA 2OPOA 1AP4A 1G33A 3SIAA 4BY5A 1KQMC 3DF0A 3PATA 2B1UA 3NSIA 2ISDA 1BG1A 3D0YA 5DKQA 4P5OE 4I5NB 1BU3A 5CSIA 2IS9A 1ZOTB 2JT8A 2HQ8A 1OSAA 1UHJA 2PASA 2JT3A 3O78A 1GQMA 1SL8A 1JUOA 1AHRA 1DGUA 1IJ6A 3NXAA 2TN4A 1TNXA 1XO5A 2BE6A 3ZWHA 4DCKA 1FPWA 2LM5A 4PE0A 1YRTB 1BR1B 2MHHA 1WLZA 2K8MB 2O5GA 4OKHA 1NX0A 2M29A 4ZCVA 1DJGA 1S5GZ 3AAJA 2KFHA 1DJXA 1J7RA 3KHEA 4MLWA 3VGOA 1K9UA 2K7CA 2WC8A 4JQ0D 4CFQA 4GNKB 1S6CA 4DS7A 2DOQA 4GBAA 3WNXB 3C1VA 4MZLA 1Q80A 1SY9A 3GK2A 1MQ1A 4WRIA 4OV2A 2KHNA 3O6BA 1DF0A 3DVMA 2HF5A 4GGFA 1S6IA 1W7IB 1SR6B 3DF0B 4AQIA 1SW8A 1PSRA 2CBLA 1BODA 1QVIZ 1R2UA 5JOLA 3VRQA 2K2AA 1B8RA 3O2PA 1BF5A 2MJWB 3TS5B 2NXQA 4GAOA 3FWBA 4A4BA 1FBVA 2ZRTA 5GQQC 4AOMA 1K9KA 2JWWA 2KNEA 4MVFA 1K2HA 3CWGA 1IQ3A 4MZJA 1QV0A 1TTXA 1LXFC 1B1GA 5JJGA 2BECA 1OOJA 2LE9B 4CLNA 2FJUB 1TN4A 2JPTA 1NCZA 3EK7A 1WY9A 2HETA 4HRGA 4HREE 1QIWA 1VRKA 2LCPA 1WRKA 3M0WA 2L2EA 5HKZA 5AFPA 1SYMA 5K89A 2Y4QA 3NSOA 2KI4B 1UWOA 1UP5A 1FI5A 1JF0A 2V53A 1CTRA 1SR6C 2JTTA 2I7AA 4MBEA 1IQ5A 2F3ZA 3GK1A 2MLFC 5D7FA 1IH0A 3TS5C 2F2OA 3SIBA 5HLVA 1SCMB 1NX3A 1QX5B 1OMRA 1YVLA 1UUSA 2KSPA 1NP8A 3TDUA 4NQGA 2WCEA 1MF8B 5DKRA 4N1FA 1NSHA 5KSZA 1TRFA 1PVBA 4MN0A 1DTLA 1F4OA 2SASA 4M2OA 4MRYA 1JWDA 2LC5A 3GOFA 2E30A 5F6TA 2KQYA 4UPGA 4MRXA 1B4CA 3A8RA 2NZ0A 1IRJA 4A4CA 1K90D 1YTZC 2R2IA 3SG5A 4N5XA 2FCDA 3ZNIA 3PN7B 1YR5A 1B7TZ 1KFUS 2LLTA 3PSRA 2KI4C 4PCWA 4DUQA 4QJ5B 3OX5A 5KTYA 1UHKA 2Q91A 4NDCA 1EL4A 3KPXA 3AAKA 1J7OA 3SG7A 3VROA 5CPVA 1OE9B 3FIAA 3EKHA 4PHJA 1C7VA 1C7WA 4GUKA 4DIRA 1XVJA 2JU0A 2Y1NA 1SCMC 1RK9A 1RWYA 3JVTB 1KK7Z 1N65A 1M39A 2LP3A 3EK8A 1CDLA 1A75A 2BE4A 1RJVA 4FQOA 3BUMB 3I5HB 3OP0A 1K8UA 2M7NA 1CLLA 3KO0A 1AVSA 1IJ5A 1G8IA 1QLSA 4PDZA 1XFXO 2HQWA 1ZACA 1OMDA 3DVKA 1UHNA 1YUUA 2BBMA 5PALA 1GGZA 3I5IB 3CZTX 4PHMA 1BR4B 3LL8B 5I2OA 2ZNEA 2E6WA 3PN7C 1NCYA 2EC6B 2AAOA 3O4YA 1TCFA 1PVAA 1KSMA 2G2BA 1QX7A 2LANA 1XYDA 1OQPA 1SNLA 2JT0A 3PLFB 1JFKA 3VRNA 4XYNA 2BKHB 4ORAB 4MEWA 2CCMA 1B8CA 2MLEC 3DVEA 2BCXA 2LLUA 2JXLA 2LNKA 3BQ3A 3JVTC 1F4QA 1ZFSA 5HYDA 2JZIA 3IQQA 5ER4X 1ZUZA 3EKJA 3I5HC 5KU1A 1QIVA 1S5GY 1ALWA 1B9AA 1A75B 1F70A 4ETOA 1G4YR 1QLKA 5J3XA 4BY4A 4C0LA 1LKJA 4YGCB 1CLMA 1R6PA 3BYAA 2LUCA 4GGNA 3SG2A 1KFXS 3I5IC 3NSKA 2JXCA 2K2FA 3I5FB 2Q4UA 2EC6C 1EJ3A 1AJ5A 1QVIY 1E8AA 1GJYA 2L50A 3HX4A 2K61A 2A4JA 3BOWB 2NCPA 3H4SE 5FYXA 2K7BA 3OX6A 4ZCUA 5ER5A 2AUCA 1QV1A 1DJYA 1YRUB 2K7OA 3OB2B 2JULA 4PE1A 2M3WA 3SG4A 4TNCA 2BBNA 1S36A 4ORBB 1DT7B 2KBIA 1YVHA 1S26D 1FI6A 1Y0VH 1KSOA 1SMGA 2KAXA 2LVJA 1KWOB 1EG4A 2H2KA 3I5GB 1CDMA 1K94A 2LVIA 2PALA 1JC2A 4MSPA 3WHTB 3I5FC 1CFCA 4OR9B 4YI9A 4CIDA 2L98A 2F33A 1C07A 2LMVA 4DRWA 2L51A 1RFJA 1J55A 1WLMA 2BCAA 4FTGA 3FWCA 4I5KA 1F71A 1K93D 1SL9A 1M45A 2I2RE 1CMGA 2LHIA 3SG6A 4CPVA 3PFVA 1BOCA 2O60A 1K96A 1NYAA 1OMVA 1RECA 1CDPA 5AXIA 3TDIA 1QASA 2GGMA 5AERA 1CFDA 2PRUA 1L2OB 2MRDA 1KWOC 2JQ6A 3EVUA 5B8IB 3I5GC 5HKYA 2LP2A 2PVBA 1BLQA 1B7TY 1A29A 1B8LA 2WCFA 1RROA 5I8NA 1XA5A 4YGBB 1L7ZA 1A4PA 3EVRA 1CDNA 3D10A 4JPZB 2LAPA 2P6BB 2L4IA 1YURA 2CT9A 1N2DA 1SK6D 1QS7A 1DJZA 2F3YA 1FW4A 1KK7Y 1S6JA 2EGDA 3WHUB 1AJ4A 2LVVA 1OZSA 1MUXA 1MXEA 5CSNA 1NCXA 2JC2A 1F54A 2LLSA 1XK4C 1Y1AA 2CXJA 4Q04A 1DGVA 2MA2A 4AQJA 1Y1UA 1XFWO 1TCOB 4C0KA 1ZMZA 1LINA 1L2OC 1J7QA 1HT9A 3JTDB 2GGZA 2HPSA 5I2QA 1WRLA 1V1GA 5CSFA 3LLEA 1XFZO 2CNPA 1XFYO 2KI6D 2LMUA 4XJKB 1F55A 3BOWA 2KOTA 4U8DA 4YGDB 3GK4X 1PRWA 4E68A 2EHBA 2I94A 3BUXB 1CMFA 1NPQA 3RLZA 2D8NA 1IG5A 1LVCD 1A2XA 4JWQA 2OS8B 3CTNA 1EH2A 1JSAA 4YBHB 3LK1A 2KYFA 1UHIA 2ZNDA 3E3RA 4M2PA 4PE7A 1KCYA 2RGIA 4I5LB 1PALA 1S1EA 1J1EA 3A4UB 3PM8A 1CM1A 1YUTA 2MBXA 4CFRA 3SJSA 3VRPA 4R1EA 1B47A 1CFFA 1UHHA 3BXKA 1M63B 2LHLA 2WOSA 1TNWA 3JTDC 1DVIA 2KDHA 1LA3A 3CLNA 5TNCA 2JRFA 1AUIB 2PSRA 3VRRA 1U5IA 4WQ3A 1RTP1 2Y1MA 1EXRA 3CGAA 2PMYA 4NDDA 1MXLC 3LK0A 4I5JA 4WQ2A 1F8HA 1ALVA 5BPJA 1NX1A 4USLA 2AMIA 1XK4A 3HCMA 2Y5IA 2OS8C 2KFGA 3F45A 3FS7A 2BCBA 1SL7A 1TNQA 3BUNB 4HSZA 4ICBA 2BKIB 2LVKA 2OTGB 5D69A 1CLBA 1CB1A 2WCBA 1BMOA 1DJHA 1QXPA 1OZOA 4GFTA 3TZ1A 1GGWA 1X02A 2BL0B 4L9MA 1BT6A 2LMTA 2WORA 4N1GA 2H61A 4QJ3B 2KFFA 2M1KB 2NCOA 1K9PA 2L4HA 1KFUL 3D0YB 3AKAA 2KI6C 1ODBA 1PULA 2G9BA 1YUSA 3BUOB 4MZKA 4NDBA 1MWNA 4GPLB 1CKKA 2COLB 1BJFA 4PHKA 1KK8B 1S3PA 5IBWA 1QJTA 1QATA 1U5IB 3TUYB 2L5XB 1W7JB 3ICBA 5G08A 2ZRSA 1SKTA 1WDCB 2JTZA 5HKWA 2KBMA 2ZN8A 4IL1A 2L0PA 2JOJA 1MR8A 2JNFA 3TDZA 4ORCB 2GV5A 3EK4A 3AKBA 2ZN9A 2OTGC 1N0YA 1LA0A 1FF1A 1K95A 2KAYA 5AEQA 4D1EA 1IGVA 2BL0C 4QJ4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0J A;  1CM4 A;  2VRG A;  4P2Y B;  2ZFD A;  4PAL A;  4YGA A;  1JFJ A;  2M9G A;  1SCV A;  2K0J A;  3CR5 X;  2M8U A;  2WND A;  4XJK A;  1DF0 B;  1DJW A;  1MHO A;  2LUX A;  1H8B A;  1DJI A;  1SPY A;  4HRH A;  1QX2 A;  1UUR A;  2K7D A;  1QTX A;  1PSB A;  3DD4 A;  2KGR A;  4PE4 A;  3NSL A;  3IF7 A;  2FCE A;  3CR2 A;  1TIZ A;  3PAL A;  1PK0 D;  1EG3 A;  3CR4 X;  1KK8 C;  3QRX A;  2LV7 A;  1IKU A;  3TUY C;  4PHN A;  3WXA A;  1AK8 A;  1SRA A;  2FOT A;  4F0Z B;  1WDC C;  1M46 A;  1KQV A;  3KEV A;  1YX7 A;  2QPT A;  4YRU A;  1JF2 A;  1SBJ A;  3CS1 A;  3RM1 A;  2NLN A;  4OCI A;  4OVN F;  2ZKM X;  2JNX A;  2M7L A;  2KQ6 A;  5CSJ A;  3BUW B;  1J7P A;  1CFP A;  1KQM B;  1NUB A;  2QAC A;  1V1F A;  2M49 B;  1DMO A;  4YI8 A;  1NIW A;  1NX2 A;  2CTN A;  2M0R A;  1YX8 A;  1KFX L;  2KAV A;  2H61 C;  1D1O A;  4GGF C;  2I18 A;  2F2P A;  3SG3 A;  1J1D A;  3OHM B;  1M31 A;  1XFV O;  2MAZ A;  4YGE B;  1Y1X A;  1TNP A;  5I2L A;  3OB1 B;  1JBA A;  2M1U A;  3MSE B;  2SCP A;  1TOP A;  1NWD A;  1Y6W A;  2M97 A;  4M2Q A;  1WRZ A;  1CNP A;  5HLO A;  3LCP C;  3KF9 A;  5DKN A;  2KYC A;  1XFU O;  5AAN A;  3IQO A;  3DVJ A;  1IWQ A;  1A03 A;  2F8P A;  1H4B A;  3K21 A;  1HQV A;  2KGB C;  3EVV A;  2OPO A;  1AP4 A;  1G33 A;  3SIA A;  4BY5 A;  1KQM C;  3DF0 A;  3PAT A;  2B1U A;  3NSI A;  2ISD A;  1BG1 A;  3D0Y A;  5DKQ A;  4P5O E;  4I5N B;  1BU3 A;  5CSI A;  2IS9 A;  1ZOT B;  2JT8 A;  2HQ8 A;  1OSA A;  1UHJ A;  2PAS A;  2JT3 A;  3O78 A;  1GQM A;  1SL8 A;  1JUO A;  1AHR A;  1DGU A;  1IJ6 A;  3NXA A;  2TN4 A;  1TNX A;  1XO5 A;  2BE6 A;  3ZWH A;  4DCK A;  1FPW A;  2LM5 A;  4PE0 A;  1YRT B;  1BR1 B;  2MHH A;  1WLZ A;  2K8M B;  2O5G A;  4OKH A;  1NX0 A;  2M29 A;  4ZCV A;  1DJG A;  1S5G Z;  3AAJ A;  2KFH A;  1DJX A;  1J7R A;  3KHE A;  4MLW A;  3VGO A;  1K9U A;  2K7C A;  2WC8 A;  4JQ0 D;  4CFQ A;  4GNK B;  1S6C A;  4DS7 A;  2DOQ A;  4GBA A;  3WNX B;  3C1V A;  4MZL A;  1Q80 A;  1SY9 A;  3GK2 A;  1MQ1 A;  4WRI A;  4OV2 A;  2KHN A;  3O6B A;  1DF0 A;  3DVM A;  2HF5 A;  4GGF A;  1S6I A;  1W7I B;  1SR6 B;  3DF0 B;  4AQI A;  1SW8 A;  1PSR A;  2CBL A;  1BOD A;  1QVI Z;  1R2U A;  5JOL A;  3VRQ A;  2K2A A;  1B8R A;  3O2P A;  1BF5 A;  2MJW B;  3TS5 B;  2NXQ A;  4GAO A;  3FWB A;  4A4B A;  1FBV A;  2ZRT A;  5GQQ C;  4AOM A;  1K9K A;  2JWW A;  2KNE A;  4MVF A;  1K2H A;  3CWG A;  1IQ3 A;  4MZJ A;  1QV0 A;  1TTX A;  1LXF C;  1B1G A;  5JJG A;  2BEC A;  1OOJ A;  2LE9 B;  4CLN A;  2FJU B;  1TN4 A;  2JPT A;  1NCZ A;  3EK7 A;  1WY9 A;  2HET A;  4HRG A;  4HRE E;  1QIW A;  1VRK A;  2LCP A;  1WRK A;  3M0W A;  2L2E A;  5HKZ A;  5AFP A;  1SYM A;  5K89 A;  2Y4Q A;  3NSO A;  2KI4 B;  1UWO A;  1UP5 A;  1FI5 A;  1JF0 A;  2V53 A;  1CTR A;  1SR6 C;  2JTT A;  2I7A A;  4MBE A;  1IQ5 A;  2F3Z A;  3GK1 A;  2MLF C;  5D7F A;  1IH0 A;  3TS5 C;  2F2O A;  3SIB A;  5HLV A;  1SCM B;  1NX3 A;  1QX5 B;  1OMR A;  1YVL A;  1UUS A;  2KSP A;  1NP8 A;  3TDU A;  4NQG A;  2WCE A;  1MF8 B;  5DKR A;  4N1F A;  1NSH A;  5KSZ A;  1TRF A;  1PVB A;  4MN0 A;  1DTL A;  1F4O A;  2SAS A;  4M2O A;  4MRY A;  1JWD A;  2LC5 A;  3GOF A;  2E30 A;  5F6T A;  2KQY A;  4UPG A;  4MRX A;  1B4C A;  3A8R A;  2NZ0 A;  1IRJ A;  4A4C A;  1K90 D;  1YTZ C;  2R2I A;  3SG5 A;  4N5X A;  2FCD A;  3ZNI A;  3PN7 B;  1YR5 A;  1B7T Z;  1KFU S;  2LLT A;  3PSR A;  2KI4 C;  4PCW A;  4DUQ A;  4QJ5 B;  3OX5 A;  5KTY A;  1UHK A;  2Q91 A;  4NDC A;  1EL4 A;  3KPX A;  3AAK A;  1J7O A;  3SG7 A;  3VRO A;  5CPV A;  1OE9 B;  3FIA A;  3EKH A;  4PHJ A;  1C7V A;  1C7W A;  4GUK A;  4DIR A;  1XVJ A;  2JU0 A;  2Y1N A;  1SCM C;  1RK9 A;  1RWY A;  3JVT B;  1KK7 Z;  1N65 A;  1M39 A;  2LP3 A;  3EK8 A;  1CDL A;  1A75 A;  2BE4 A;  1RJV A;  4FQO A;  3BUM B;  3I5H B;  3OP0 A;  1K8U A;  2M7N A;  1CLL A;  3KO0 A;  1AVS A;  1IJ5 A;  1G8I A;  1QLS A;  4PDZ A;  1XFX O;  2HQW A;  1ZAC A;  1OMD A;  3DVK A;  1UHN A;  1YUU A;  2BBM A;  5PAL A;  1GGZ A;  3I5I B;  3CZT X;  4PHM A;  1BR4 B;  3LL8 B;  5I2O A;  2ZNE A;  2E6W A;  3PN7 C;  1NCY A;  2EC6 B;  2AAO A;  3O4Y A;  1TCF A;  1PVA A;  1KSM A;  2G2B A;  1QX7 A;  2LAN A;  1XYD A;  1OQP A;  1SNL A;  2JT0 A;  3PLF B;  1JFK A;  3VRN A;  4XYN A;  2BKH B;  4ORA B;  4MEW A;  2CCM A;  1B8C A;  2MLE C;  3DVE A;  2BCX A;  2LLU A;  2JXL A;  2LNK A;  3BQ3 A;  3JVT C;  1F4Q A;  1ZFS A;  5HYD A;  2JZI A;  3IQQ A;  5ER4 X;  1ZUZ A;  3EKJ A;  3I5H C;  5KU1 A;  1QIV A;  1S5G Y;  1ALW A;  1B9A A;  1A75 B;  1F70 A;  4ETO A;  1G4Y R;  1QLK A;  5J3X A;  4BY4 A;  4C0L A;  1LKJ A;  4YGC B;  1CLM A;  1R6P A;  3BYA A;  2LUC A;  4GGN A;  3SG2 A;  1KFX S;  3I5I C;  3NSK A;  2JXC A;  2K2F A;  3I5F B;  2Q4U A;  2EC6 C;  1EJ3 A;  1AJ5 A;  1QVI Y;  1E8A A;  1GJY A;  2L50 A;  3HX4 A;  2K61 A;  2A4J A;  3BOW B;  2NCP A;  3H4S E;  5FYX A;  2K7B A;  3OX6 A;  4ZCU A;  5ER5 A;  2AUC A;  1QV1 A;  1DJY A;  1YRU B;  2K7O A;  3OB2 B;  2JUL A;  4PE1 A;  2M3W A;  3SG4 A;  4TNC A;  2BBN A;  1S36 A;  4ORB B;  1DT7 B;  2KBI A;  1YVH A;  1S26 D;  1FI6 A;  1Y0V H;  1KSO A;  1SMG A;  2KAX A;  2LVJ A;  1KWO B;  1EG4 A;  2H2K A;  3I5G B;  1CDM A;  1K94 A;  2LVI A;  2PAL A;  1JC2 A;  4MSP A;  3WHT B;  3I5F C;  1CFC A;  4OR9 B;  4YI9 A;  4CID A;  2L98 A;  2F33 A;  1C07 A;  2LMV A;  4DRW A;  2L51 A;  1RFJ A;  1J55 A;  1WLM A;  2BCA A;  4FTG A;  3FWC A;  4I5K A;  1F71 A;  1K93 D;  1SL9 A;  1M45 A;  2I2R E;  1CMG A;  2LHI A;  3SG6 A;  4CPV A;  3PFV A;  1BOC A;  2O60 A;  1K96 A;  1NYA A;  1OMV A;  1REC A;  1CDP A;  5AXI A;  3TDI A;  1QAS A;  2GGM A;  5AER A;  1CFD A;  2PRU A;  1L2O B;  2MRD A;  1KWO C;  2JQ6 A;  3EVU A;  5B8I B;  3I5G C;  5HKY A;  2LP2 A;  2PVB A;  1BLQ A;  1B7T Y;  1A29 A;  1B8L A;  2WCF A;  1RRO A;  5I8N A;  1XA5 A;  4YGB B;  1L7Z A;  1A4P A;  3EVR A;  1CDN A;  3D10 A;  4JPZ B;  2LAP A;  2P6B B;  2L4I A;  1YUR A;  2CT9 A;  1N2D A;  1SK6 D;  1QS7 A;  1DJZ A;  2F3Y A;  1FW4 A;  1KK7 Y;  1S6J A;  2EGD A;  3WHU B;  1AJ4 A;  2LVV A;  1OZS A;  1MUX A;  1MXE A;  5CSN A;  1NCX A;  2JC2 A;  1F54 A;  2LLS A;  1XK4 C;  1Y1A A;  2CXJ A;  4Q04 A;  1DGV A;  2MA2 A;  4AQJ A;  1Y1U A;  1XFW O;  1TCO B;  4C0K A;  1ZMZ A;  1LIN A;  1L2O C;  1J7Q A;  1HT9 A;  3JTD B;  2GGZ A;  2HPS A;  5I2Q A;  1WRL A;  1V1G A;  5CSF A;  3LLE A;  1XFZ O;  2CNP A;  1XFY O;  2KI6 D;  2LMU A;  4XJK B;  1F55 A;  3BOW A;  2KOT A;  4U8D A;  4YGD B;  3GK4 X;  1PRW A;  4E68 A;  2EHB A;  2I94 A;  3BUX B;  1CMF A;  1NPQ A;  3RLZ A;  2D8N A;  1IG5 A;  1LVC D;  1A2X A;  4JWQ A;  2OS8 B;  3CTN A;  1EH2 A;  1JSA A;  4YBH B;  3LK1 A;  2KYF A;  1UHI A;  2ZND A;  3E3R A;  4M2P A;  4PE7 A;  1KCY A;  2RGI A;  4I5L B;  1PAL A;  1S1E A;  1J1E A;  3A4U B;  3PM8 A;  1CM1 A;  1YUT A;  2MBX A;  4CFR A;  3SJS A;  3VRP A;  4R1E A;  1B47 A;  1CFF A;  1UHH A;  3BXK A;  1M63 B;  2LHL A;  2WOS A;  1TNW A;  3JTD C;  1DVI A;  2KDH A;  1LA3 A;  3CLN A;  5TNC A;  2JRF A;  1AUI B;  2PSR A;  3VRR A;  1U5I A;  4WQ3 A;  1RTP 1;  2Y1M A;  1EXR A;  3CGA A;  2PMY A;  4NDD A;  1MXL C;  3LK0 A;  4I5J A;  4WQ2 A;  1F8H A;  1ALV A;  5BPJ A;  1NX1 A;  4USL A;  2AMI A;  1XK4 A;  3HCM A;  2Y5I A;  2OS8 C;  2KFG A;  3F45 A;  3FS7 A;  2BCB A;  1SL7 A;  1TNQ A;  3BUN B;  4HSZ A;  4ICB A;  2BKI B;  2LVK A;  2OTG B;  5D69 A;  1CLB A;  1CB1 A;  2WCB A;  1BMO A;  1DJH A;  1QXP A;  1OZO A;  4GFT A;  3TZ1 A;  1GGW A;  1X02 A;  2BL0 B;  4L9M A;  1BT6 A;  2LMT A;  2WOR A;  4N1G A;  2H61 A;  4QJ3 B;  2KFF A;  2M1K B;  2NCO A;  1K9P A;  2L4H A;  1KFU L;  3D0Y B;  3AKA A;  2KI6 C;  1ODB A;  1PUL A;  2G9B A;  1YUS A;  3BUO B;  4MZK A;  4NDB A;  1MWN A;  4GPL B;  1CKK A;  2COL B;  1BJF A;  4PHK A;  1KK8 B;  1S3P A;  5IBW A;  1QJT A;  1QAT A;  1U5I B;  3TUY B;  2L5X B;  1W7J B;  3ICB A;  5G08 A;  2ZRS A;  1SKT A;  1WDC B;  2JTZ A;  5HKW A;  2KBM A;  2ZN8 A;  4IL1 A;  2L0P A;  2JOJ A;  1MR8 A;  2JNF A;  3TDZ A;  4ORC B;  2GV5 A;  3EK4 A;  3AKB A;  2ZN9 A;  2OTG C;  1N0Y A;  1LA0 A;  1FF1 A;  1K95 A;  2KAY A;  5AEQ A;  4D1E A;  1IGV A;  2BL0 C;  4QJ4 B; 
#chains in the Genus database with same CATH topology
 4C0J A;  1CM4 A;  2VRG A;  4P2Y B;  2ZFD A;  4PAL A;  4YGA A;  1DC1 A;  2M9G A;  1SCV A;  1JFJ A;  2K0J A;  3CR5 X;  3FE9 A;  2M8U A;  2WND A;  4XJK A;  1DF0 B;  1DJW A;  3RZS A;  1MHO A;  2LUX A;  3R72 A;  1H8B A;  1DJI A;  1SPY A;  4HRH A;  1QX2 A;  1UUR A;  2K7D A;  3FE6 A;  1ORG A;  1QTX A;  1PSB A;  3DD4 A;  2KGR A;  4PE4 A;  3NSL A;  3IF7 A;  2FCE A;  3CR2 A;  1TIZ A;  2H8V A;  1PK0 D;  1EG3 A;  3CR4 X;  3PAL A;  1KK8 C;  3QRX A;  2LV7 A;  3K1E A;  1IKU A;  3CAB A;  3TUY C;  3VB1 A;  4PHN A;  3WXA A;  1AK8 A;  1SRA A;  2FOT A;  3NHT A;  1WDC C;  4F0Z B;  1M46 A;  1KQV A;  3KEV A;  1YX7 A;  3S0A A;  2QPT A;  4YRU A;  1JF2 A;  1SBJ A;  3CS1 A;  1Z4H A;  3RM1 A;  3S0D A;  2NLN A;  2WCK A;  4OCI A;  2ZKM X;  2JNX A;  4OVN F;  2M7L A;  2KQ6 A;  5CSJ A;  3BUW B;  1J7P A;  1CFP A;  1KQM B;  1NUB A;  1QWV A;  2QAC A;  1V1F A;  2M49 B;  2WCL A;  1DMO A;  4YI8 A;  1NIW A;  1NX2 A;  2CTN A;  2M0R A;  1YX8 A;  1KFX L;  2KAV A;  2H61 C;  1D1O A;  4GGF C;  2I18 A;  2F2P A;  4FQT A;  3OBV A;  3SG3 A;  1J1D A;  3OHM B;  1M31 A;  1XFV O;  2MAZ A;  4YGE B;  1Y1X A;  1TNP A;  5I2L A;  3OB1 B;  1JBA A;  2M1U A;  3MSE B;  2SCP A;  1TOP A;  3CZ2 A;  1NWD A;  1Y6W A;  2M97 A;  4M2Q A;  1WRZ A;  1CNP A;  5HLO A;  3LCP C;  3KF9 A;  5DKN A;  2KYC A;  1XFU O;  5AAN A;  3IQO A;  3DVJ A;  1LS8 A;  1SSE B;  1IWQ A;  2KPH A;  1A03 A;  5FI7 A;  2F8P A;  1H4B A;  3K21 A;  3O4X A;  1HQV A;  2KGB C;  3EVV A;  3PJI A;  2OPO A;  1AP4 A;  3SS3 A;  1G33 A;  3SIA A;  4BY5 A;  1KQM C;  3DF0 A;  3PAT A;  2B1U A;  3NSI A;  2ISD A;  1BG1 A;  3B6X A;  3D0Y A;  5DKQ A;  4P5O E;  4I5N B;  1BU3 A;  3DZT A;  1OOI X;  3R1P A;  5CSI A;  2IS9 A;  1ZOT B;  2JT8 A;  2HQ8 A;  1OSA A;  1UHJ A;  2PAS A;  3R1V A;  2JT3 A;  3O78 A;  1GQM A;  1SL8 A;  1JUO A;  4IJ7 A;  1AHR A;  1DGU A;  1IJ6 A;  3NGV A;  2TN4 A;  1TNX A;  3NXA A;  1XO5 A;  2BE6 A;  3ZWH A;  4DCK A;  1FPW A;  2LM5 A;  4PE0 A;  1YRT B;  1BR1 B;  2MHH A;  1WLZ A;  2K8M B;  2O5G A;  4OKH A;  1Z2C B;  1NX0 A;  2M29 A;  3B7A A;  1DJG A;  5FI6 A;  1S5G Z;  3AAJ A;  1TWO A;  2KFH A;  1DJX A;  1J7R A;  3KHE A;  4MLW A;  3VGO A;  1K9U A;  2K7C A;  2WC8 A;  4JQ0 D;  2P70 A;  4CFQ A;  3L47 A;  1S6C A;  4GNK B;  2DOQ A;  4GBA A;  3WNX B;  3C1V A;  4MZL A;  1Q80 A;  1SY9 A;  3GK2 A;  1MQ1 A;  4WRI A;  4OV2 A;  2KHN A;  3O6B A;  1DF0 A;  3DVM A;  3D77 A;  2HF5 A;  4GGF A;  1S6I A;  1W7I B;  1SR6 B;  2WCM A;  3DF0 B;  4AQI A;  1SW8 A;  1PSR A;  1DQE A;  2CBL A;  1DEL A;  1BOD A;  1QVI Z;  1R2U A;  5JOL A;  3VRQ A;  2K2A A;  1B8R A;  3O2P A;  1BF5 A;  2MJW B;  3TS5 B;  2NXQ A;  4GAO A;  3FWB A;  4A4B A;  1FBV A;  2ZRT A;  5GQQ C;  4AOM A;  1K9K A;  2JWW A;  2KNE A;  4MVF A;  1K2H A;  3CWG A;  1IQ3 A;  4MZJ A;  1QV0 A;  1TTX A;  1LXF C;  1OOH A;  2YGU A;  1B1G A;  5JJG A;  2BEC A;  1OOJ A;  3SS5 A;  2LE9 B;  4CLN A;  2FJU B;  1TN4 A;  1OOG A;  2JPT A;  1NCZ A;  3EK7 A;  1WY9 A;  2HET A;  4HRG A;  4HRE E;  1QIW A;  5D3O A;  1VRK A;  2L2C A;  1WRK A;  2LCP A;  3V2L A;  3EG5 B;  3M0W A;  4DS7 A;  2L2E A;  5HKZ A;  5AFP A;  1SYM A;  5K89 A;  2Y4Q A;  2WCJ A;  3NSO A;  2WC6 A;  2KI4 B;  1UWO A;  1UP5 A;  1FI5 A;  1JF0 A;  2V53 A;  1CTR A;  1SR6 C;  2JTT A;  2I7A A;  4MBE A;  3S0F A;  1IQ5 A;  2F3Z A;  3GK1 A;  2MLF C;  5D7F A;  1IH0 A;  3TS5 C;  2F2O A;  3SIB A;  2KLE A;  5HLV A;  1SCM B;  1NX3 A;  1QX5 B;  1OMR A;  1W9Z A;  1UUS A;  1YVL A;  1NP8 A;  2KSP A;  4NQG A;  3TDU A;  2WCE A;  1MF8 B;  5DKR A;  4N1F A;  1NSH A;  3D75 A;  5KSZ A;  1TRF A;  1PVB A;  4MN0 A;  1DTL A;  1F4O A;  2SAS A;  4M2O A;  4MRY A;  1JWD A;  2LC5 A;  3GOF A;  2E30 A;  3N7H A;  5F6T A;  5DIC A;  2KQY A;  4UPG A;  4MRX A;  1B4C A;  3A8R A;  2NZ0 A;  1IRJ A;  4A4C A;  1K90 D;  1YTZ C;  3OGN A;  3QME A;  2R2I A;  3SG5 A;  4N5X A;  2FCD A;  3ZNI A;  3PN7 B;  1YR5 A;  1B7T Z;  1KFU S;  2LLT A;  3PSR A;  2KI4 C;  4PCW A;  4DUQ A;  4QJ5 B;  3OX5 A;  5KTY A;  1UHK A;  2Q91 A;  4NDC A;  1EL4 A;  3KPX A;  3CZ0 A;  3AAK A;  1J7O A;  3SG7 A;  3VRO A;  5CPV A;  1OE9 B;  3FIA A;  3EKH A;  4PHJ A;  1C7V A;  1C7W A;  4GUK A;  4DIR A;  1XVJ A;  2JU0 A;  2Y1N A;  1SCM C;  1C3Z A;  2WCH A;  1RK9 A;  1RWY A;  3JVT B;  1KK7 Z;  1N65 A;  1M39 A;  2LP3 A;  3EK8 A;  1CDL A;  1A75 A;  2BE4 A;  1RJV A;  3D78 A;  4FQO A;  3BUM B;  3I5H B;  3B87 A;  3OP0 A;  1K8U A;  2M7N A;  1CLL A;  3KO0 A;  1AVS A;  1IJ5 A;  3S0E A;  1G8I A;  4OZD A;  1QLS A;  4PDZ A;  1XFX O;  2HQW A;  1ZAC A;  1OMD A;  3DVK A;  2QEO A;  1UHN A;  1YUU A;  2BBM A;  5PAL A;  1GGZ A;  3I5I B;  3CZT X;  4PHM A;  1BR4 B;  3LL8 B;  5I2O A;  3Q8I A;  3PM2 A;  2ZNE A;  2E6W A;  3PN7 C;  1NCY A;  2EC6 B;  2AAO A;  3O4Y A;  1TCF A;  1PVA A;  1KSM A;  2G2B A;  1QX7 A;  2LAN A;  1XYD A;  2K60 A;  1OQP A;  1SNL A;  2JT0 A;  3PLF B;  1JFK A;  3VRN A;  4XYN A;  3L4A A;  5FI2 A;  3FE8 A;  2BKH B;  4ORA B;  3IVT A;  4MEW A;  2CCM A;  1B8C A;  2MLE C;  1OOF A;  3DVE A;  2BCX A;  2LLU A;  2JXL A;  2LNK A;  3BQ3 A;  3BFA A;  3JVT C;  1F4Q A;  1ZFS A;  5HYD A;  3S0G A;  2JZI A;  3IQQ A;  1C3Y A;  5ER4 X;  1ZUZ A;  3EKJ A;  3I5H C;  5KU1 A;  1QIV A;  1S5G Y;  1ALW A;  1B9A A;  1A75 B;  1F70 A;  4ETO A;  1G4Y R;  1QLK A;  5J3X A;  4BY4 A;  2GTE A;  4C0L A;  1LKJ A;  4YGC B;  1CLM A;  1R6P A;  3BYA A;  2LUC A;  4GGN A;  3SG2 A;  1KFX S;  3I5I C;  3NSK A;  2JXC A;  2K2F A;  3I5F B;  2Q4U A;  2EC6 C;  1EJ3 A;  1AJ5 A;  1QVI Y;  1E8A A;  1GJY A;  2L50 A;  3HX4 A;  3S0B A;  2K61 A;  2A4J A;  3BOW B;  2NCP A;  3H4S E;  5FYX A;  2K7B A;  3OX6 A;  4ZCU A;  5ER5 A;  2AUC A;  1QV1 A;  2QEV A;  1DJY A;  5EL2 A;  1YRU B;  2K7O A;  3OB2 B;  2JUL A;  4PE1 A;  2M3W A;  3SG4 A;  4TNC A;  2BBN A;  1S36 A;  4ORB B;  1DT7 B;  2QEB A;  2KBI A;  1YVH A;  1S26 D;  1FI6 A;  1Y0V H;  1KSO A;  1SMG A;  2BNX A;  2KAX A;  3D73 A;  2LVJ A;  1KWO B;  3BFB A;  1EG4 A;  2H2K A;  3I5G B;  1CDM A;  1K94 A;  2LVI A;  2PAL A;  4KYN A;  4F7F A;  1JC2 A;  1TUJ A;  2PYQ A;  4MSP A;  3UNW A;  3WHT B;  3D76 A;  3I5F C;  1CFC A;  4OR9 B;  4YI9 A;  4CID A;  2L98 A;  2F33 A;  1DEK A;  1C07 A;  2LMV A;  4DRW A;  2L51 A;  1RFJ A;  1J55 A;  1WLM A;  2BCA A;  4FTG A;  1XFR A;  2FJY A;  3B86 A;  3FWC A;  4I5K A;  1F71 A;  1K93 D;  1SL9 A;  3R1O A;  1M45 A;  2I2R E;  1CMG A;  2LHI A;  3SG6 A;  5I94 A;  4CPV A;  3PFV A;  1BOC A;  2O60 A;  1K96 A;  1NYA A;  1OMV A;  1REC A;  1CDP A;  3B88 A;  5AXI A;  3TDI A;  1QAS A;  2GGM A;  5AER A;  1CFD A;  2PRU A;  1L2O B;  2MRD A;  1KWO C;  2JQ6 A;  3EVU A;  4JKT A;  5B8I B;  3I5G C;  1GM0 A;  5HKY A;  2LP2 A;  2PVB A;  1BLQ A;  1B7T Y;  2JPO A;  1A29 A;  1B8L A;  2WCF A;  3BFH A;  1RRO A;  5I8N A;  1XA5 A;  4ZCV A;  4YGB B;  1L7Z A;  1A4P A;  3EVR A;  1CDN A;  3D10 A;  2WC5 A;  4JPZ B;  3L4L A;  3D74 A;  2LAP A;  2P6B B;  2L4I A;  1YUR A;  2CT9 A;  1N2D A;  1SK6 D;  1QS7 A;  1DJZ A;  2F3Y A;  1FW4 A;  1KK7 Y;  1S6J A;  2EGD A;  3WHU B;  1AJ4 A;  2LVV A;  1OZS A;  1MUX A;  1MXE A;  5CSN A;  1NCX A;  2JC2 A;  1F54 A;  2LLS A;  1XK4 C;  5HL1 A;  1Y1A A;  2CXJ A;  4Q04 A;  1DGV A;  2MA2 A;  4AQJ A;  1Y1U A;  1XFW O;  1TCO B;  3DXL A;  2MBX A;  4C0K A;  1ZMZ A;  4JD9 A;  2PQL A;  1LIN A;  1L2O C;  1J7Q A;  1HT9 A;  3JTD B;  2GGZ A;  2HPS A;  5I2Q A;  1WRL A;  1V1G A;  5CSF A;  3LLE A;  1XFZ O;  2CNP A;  1XFY O;  2KI6 D;  2LMU A;  2QDI A;  4XJK B;  1F55 A;  3BOW A;  2KOT A;  4U8D A;  4YGD B;  3GK4 X;  1PRW A;  4E68 A;  2EHB A;  3DY9 A;  2I94 A;  4INX A;  3BUX B;  1CMF A;  1NPQ A;  3RLZ A;  2D8N A;  2KLD A;  1IG5 A;  4PT1 A;  1LVC D;  1A2X A;  4JWQ A;  2OS8 B;  3CTN A;  1EH2 A;  1JSA A;  3BJH A;  4YBH B;  3LK1 A;  3UO9 A;  2KYF A;  1UHI A;  2ZND A;  3E3R A;  1OW4 A;  4M2P A;  4PE7 A;  2RGI A;  4I5L B;  1PAL A;  1S1E A;  1J1E A;  3A4U B;  3PM8 A;  1CM1 A;  1YUT A;  3CZ1 A;  4INW A;  4CFR A;  3SJS A;  3VRP A;  4R1E A;  1B47 A;  1CFF A;  1UHH A;  3BXK A;  1M63 B;  2LHL A;  2WOS A;  2P71 A;  1TNW A;  2QEH A;  3DYE A;  3JTD C;  3SS4 A;  1DVI A;  2KDH A;  1LA3 A;  3CLN A;  5TNC A;  2JRF A;  1AUI B;  2PSR A;  3VRR A;  1U5I A;  3CDN A;  4WQ3 A;  1RTP 1;  2Y1M A;  1EXR A;  3CGA A;  2PMY A;  4NDD A;  1MXL C;  3LK0 A;  4I5J A;  4WQ2 A;  1F8H A;  1ALV A;  1TUZ A;  5BPJ A;  1NX1 A;  4USL A;  2AMI A;  1XK4 A;  3NHI A;  3HCM A;  2Y5I A;  2OS8 C;  2KFG A;  3F45 A;  3FS7 A;  2BCB A;  1SL7 A;  1TNQ A;  3BUN B;  4HSZ A;  4ICB A;  2BKI B;  2LVK A;  2OTG B;  5D69 A;  1CLB A;  1CB1 A;  2WCB A;  1BMO A;  1DJH A;  1QXP A;  1OZO A;  4GFT A;  3TZ1 A;  1GGW A;  1X02 A;  2BL0 B;  4L9M A;  1BT6 A;  2LMT A;  2WOR A;  4N1G A;  2H61 A;  4QJ3 B;  2KFF A;  2BL0 C;  2M1K B;  2NCO A;  1IIO A;  1K9P A;  2L4H A;  1KFU L;  3D0Y B;  3AKA A;  2KI6 C;  1ODB A;  1PUL A;  2G9B A;  1YUS A;  3BUO B;  4MZK A;  4NDB A;  1T14 A;  1MWN A;  4GPL B;  1CKK A;  2COL B;  1BJF A;  4PHK A;  1KK8 B;  1P28 A;  1S3P A;  5IBW A;  1QJT A;  1QAT A;  1U5I B;  3TUY B;  2L5X B;  1W7J B;  3ICB A;  5G08 A;  1KCY A;  2ZRS A;  1SKT A;  3CYZ A;  1WDC B;  2JTZ A;  2L5Y A;  2KBM A;  5HKW A;  2ZN8 A;  4IL1 A;  2L0P A;  2JOJ A;  1MR8 A;  2JNF A;  3TDZ A;  4ORC B;  2GV5 A;  3EK4 A;  3AKB A;  2ZN9 A;  2OTG C;  1N0Y A;  1LA0 A;  1FF1 A;  1K95 A;  2KAY A;  5AEQ A;  4D1E A;  2ERB A;  1IGV A;  2BAP A;  4QJ4 B; 
#chains in the Genus database with same CATH homology
 4C0J A;  1CM4 A;  2VRG A;  4P2Y B;  2ZFD A;  4PAL A;  4YGA A;  1JFJ A;  2M9G A;  1SCV A;  2K0J A;  3CR5 X;  2M8U A;  2WND A;  4XJK A;  1DF0 B;  1DJW A;  1MHO A;  2LUX A;  1H8B A;  1DJI A;  1SPY A;  4HRH A;  1QX2 A;  1UUR A;  2K7D A;  1QTX A;  1PSB A;  3DD4 A;  2KGR A;  4PE4 A;  3NSL A;  3IF7 A;  2FCE A;  3CR2 A;  1TIZ A;  3PAL A;  1PK0 D;  1EG3 A;  3CR4 X;  1KK8 C;  3QRX A;  2LV7 A;  1IKU A;  3TUY C;  4PHN A;  3WXA A;  1AK8 A;  1SRA A;  2FOT A;  4F0Z B;  1WDC C;  1M46 A;  1KQV A;  3KEV A;  1YX7 A;  2QPT A;  4YRU A;  1JF2 A;  1SBJ A;  3CS1 A;  3RM1 A;  2NLN A;  4OCI A;  4OVN F;  2ZKM X;  2JNX A;  2M7L A;  2KQ6 A;  5CSJ A;  3BUW B;  1J7P A;  1CFP A;  1KQM B;  1NUB A;  2QAC A;  1V1F A;  2M49 B;  1DMO A;  4YI8 A;  1NIW A;  1NX2 A;  2CTN A;  2M0R A;  1YX8 A;  1KFX L;  2KAV A;  2H61 C;  1D1O A;  4GGF C;  2I18 A;  2F2P A;  3SG3 A;  1J1D A;  3OHM B;  1M31 A;  1XFV O;  2MAZ A;  4YGE B;  1Y1X A;  1TNP A;  5I2L A;  3OB1 B;  1JBA A;  2M1U A;  3MSE B;  2SCP A;  1TOP A;  1NWD A;  1Y6W A;  2M97 A;  4M2Q A;  1WRZ A;  1CNP A;  5HLO A;  3LCP C;  3KF9 A;  5DKN A;  2KYC A;  1XFU O;  5AAN A;  3IQO A;  3DVJ A;  1IWQ A;  1A03 A;  2F8P A;  1H4B A;  3K21 A;  1HQV A;  2KGB C;  3EVV A;  2OPO A;  1AP4 A;  1G33 A;  3SIA A;  4BY5 A;  1KQM C;  3DF0 A;  3PAT A;  2B1U A;  3NSI A;  2ISD A;  1BG1 A;  3D0Y A;  5DKQ A;  4P5O E;  4I5N B;  1BU3 A;  5CSI A;  2IS9 A;  1ZOT B;  2JT8 A;  2HQ8 A;  1OSA A;  1UHJ A;  2PAS A;  2JT3 A;  3O78 A;  1GQM A;  1SL8 A;  1JUO A;  1AHR A;  1DGU A;  1IJ6 A;  3NXA A;  2TN4 A;  1TNX A;  1XO5 A;  2BE6 A;  3ZWH A;  4DCK A;  1FPW A;  2LM5 A;  4PE0 A;  1YRT B;  1BR1 B;  2MHH A;  1WLZ A;  2K8M B;  2O5G A;  4OKH A;  1NX0 A;  2M29 A;  4ZCV A;  1DJG A;  1S5G Z;  3AAJ A;  2KFH A;  1DJX A;  1J7R A;  3KHE A;  4MLW A;  3VGO A;  1K9U A;  2K7C A;  2WC8 A;  4JQ0 D;  4CFQ A;  4GNK B;  1S6C A;  4DS7 A;  2DOQ A;  4GBA A;  3WNX B;  3C1V A;  4MZL A;  1Q80 A;  1SY9 A;  3GK2 A;  1MQ1 A;  4WRI A;  4OV2 A;  2KHN A;  3O6B A;  1DF0 A;  3DVM A;  2HF5 A;  4GGF A;  1S6I A;  1W7I B;  1SR6 B;  3DF0 B;  4AQI A;  1SW8 A;  1PSR A;  2CBL A;  1BOD A;  1QVI Z;  1R2U A;  5JOL A;  3VRQ A;  2K2A A;  1B8R A;  3O2P A;  1BF5 A;  2MJW B;  3TS5 B;  2NXQ A;  4GAO A;  3FWB A;  4A4B A;  1FBV A;  2ZRT A;  5GQQ C;  4AOM A;  1K9K A;  2JWW A;  2KNE A;  4MVF A;  1K2H A;  3CWG A;  1IQ3 A;  4MZJ A;  1QV0 A;  1TTX A;  1LXF C;  1B1G A;  5JJG A;  2BEC A;  1OOJ A;  2LE9 B;  4CLN A;  2FJU B;  1TN4 A;  2JPT A;  1NCZ A;  3EK7 A;  1WY9 A;  2HET A;  4HRG A;  4HRE E;  1QIW A;  1VRK A;  2LCP A;  1WRK A;  3M0W A;  2L2E A;  5HKZ A;  5AFP A;  1SYM A;  5K89 A;  2Y4Q A;  3NSO A;  2KI4 B;  1UWO A;  1UP5 A;  1FI5 A;  1JF0 A;  2V53 A;  1CTR A;  1SR6 C;  2JTT A;  2I7A A;  4MBE A;  1IQ5 A;  2F3Z A;  3GK1 A;  2MLF C;  5D7F A;  1IH0 A;  3TS5 C;  2F2O A;  3SIB A;  5HLV A;  1SCM B;  1NX3 A;  1QX5 B;  1OMR A;  1YVL A;  1UUS A;  2KSP A;  1NP8 A;  3TDU A;  4NQG A;  2WCE A;  1MF8 B;  5DKR A;  4N1F A;  1NSH A;  5KSZ A;  1TRF A;  1PVB A;  4MN0 A;  1DTL A;  1F4O A;  2SAS A;  4M2O A;  4MRY A;  1JWD A;  2LC5 A;  3GOF A;  2E30 A;  5F6T A;  2KQY A;  4UPG A;  4MRX A;  1B4C A;  3A8R A;  2NZ0 A;  1IRJ A;  4A4C A;  1K90 D;  1YTZ C;  2R2I A;  3SG5 A;  4N5X A;  2FCD A;  3ZNI A;  3PN7 B;  1YR5 A;  1B7T Z;  1KFU S;  2LLT A;  3PSR A;  2KI4 C;  4PCW A;  4DUQ A;  4QJ5 B;  3OX5 A;  5KTY A;  1UHK A;  2Q91 A;  4NDC A;  1EL4 A;  3KPX A;  3AAK A;  1J7O A;  3SG7 A;  3VRO A;  5CPV A;  1OE9 B;  3FIA A;  3EKH A;  4PHJ A;  1C7V A;  1C7W A;  4GUK A;  4DIR A;  1XVJ A;  2JU0 A;  2Y1N A;  1SCM C;  1RK9 A;  1RWY A;  3JVT B;  1KK7 Z;  1N65 A;  1M39 A;  2LP3 A;  3EK8 A;  1CDL A;  1A75 A;  2BE4 A;  1RJV A;  4FQO A;  3BUM B;  3I5H B;  3OP0 A;  1K8U A;  2M7N A;  1CLL A;  3KO0 A;  1AVS A;  1IJ5 A;  1G8I A;  1QLS A;  4PDZ A;  1XFX O;  2HQW A;  1ZAC A;  1OMD A;  3DVK A;  1UHN A;  1YUU A;  2BBM A;  5PAL A;  1GGZ A;  3I5I B;  3CZT X;  4PHM A;  1BR4 B;  3LL8 B;  5I2O A;  2ZNE A;  2E6W A;  3PN7 C;  1NCY A;  2EC6 B;  2AAO A;  3O4Y A;  1TCF A;  1PVA A;  1KSM A;  2G2B A;  1QX7 A;  2LAN A;  1XYD A;  1OQP A;  1SNL A;  2JT0 A;  3PLF B;  1JFK A;  3VRN A;  4XYN A;  2BKH B;  4ORA B;  4MEW A;  2CCM A;  1B8C A;  2MLE C;  3DVE A;  2BCX A;  2LLU A;  2JXL A;  2LNK A;  3BQ3 A;  3JVT C;  1F4Q A;  1ZFS A;  5HYD A;  2JZI A;  3IQQ A;  5ER4 X;  1ZUZ A;  3EKJ A;  3I5H C;  5KU1 A;  1QIV A;  1S5G Y;  1ALW A;  1B9A A;  1A75 B;  1F70 A;  4ETO A;  1G4Y R;  1QLK A;  5J3X A;  4BY4 A;  4C0L A;  1LKJ A;  4YGC B;  1CLM A;  1R6P A;  3BYA A;  2LUC A;  4GGN A;  3SG2 A;  1KFX S;  3I5I C;  3NSK A;  2JXC A;  2K2F A;  3I5F B;  2Q4U A;  2EC6 C;  1EJ3 A;  1AJ5 A;  1QVI Y;  1E8A A;  1GJY A;  2L50 A;  3HX4 A;  2K61 A;  2A4J A;  3BOW B;  2NCP A;  3H4S E;  5FYX A;  2K7B A;  3OX6 A;  4ZCU A;  5ER5 A;  2AUC A;  1QV1 A;  1DJY A;  1YRU B;  2K7O A;  3OB2 B;  2JUL A;  4PE1 A;  2M3W A;  3SG4 A;  4TNC A;  2BBN A;  1S36 A;  4ORB B;  1DT7 B;  2KBI A;  1YVH A;  1S26 D;  1FI6 A;  1Y0V H;  1KSO A;  1SMG A;  2KAX A;  2LVJ A;  1KWO B;  1EG4 A;  2H2K A;  3I5G B;  1CDM A;  1K94 A;  2LVI A;  2PAL A;  1JC2 A;  4MSP A;  3WHT B;  3I5F C;  1CFC A;  4OR9 B;  4YI9 A;  4CID A;  2L98 A;  2F33 A;  1C07 A;  2LMV A;  4DRW A;  2L51 A;  1RFJ A;  1J55 A;  1WLM A;  2BCA A;  4FTG A;  3FWC A;  4I5K A;  1F71 A;  1K93 D;  1SL9 A;  1M45 A;  2I2R E;  1CMG A;  2LHI A;  3SG6 A;  4CPV A;  3PFV A;  1BOC A;  2O60 A;  1K96 A;  1NYA A;  1OMV A;  1REC A;  1CDP A;  5AXI A;  3TDI A;  1QAS A;  2GGM A;  5AER A;  1CFD A;  2PRU A;  1L2O B;  2MRD A;  1KWO C;  2JQ6 A;  3EVU A;  5B8I B;  3I5G C;  5HKY A;  2LP2 A;  2PVB A;  1BLQ A;  1B7T Y;  1A29 A;  1B8L A;  2WCF A;  1RRO A;  5I8N A;  1XA5 A;  4YGB B;  1L7Z A;  1A4P A;  3EVR A;  1CDN A;  3D10 A;  4JPZ B;  2LAP A;  2P6B B;  2L4I A;  1YUR A;  2CT9 A;  1N2D A;  1SK6 D;  1QS7 A;  1DJZ A;  2F3Y A;  1FW4 A;  1KK7 Y;  1S6J A;  2EGD A;  3WHU B;  1AJ4 A;  2LVV A;  1OZS A;  1MUX A;  1MXE A;  5CSN A;  1NCX A;  2JC2 A;  1F54 A;  2LLS A;  1XK4 C;  1Y1A A;  2CXJ A;  4Q04 A;  1DGV A;  2MA2 A;  4AQJ A;  1Y1U A;  1XFW O;  1TCO B;  4C0K A;  1ZMZ A;  1LIN A;  1L2O C;  1J7Q A;  1HT9 A;  3JTD B;  2GGZ A;  2HPS A;  5I2Q A;  1WRL A;  1V1G A;  5CSF A;  3LLE A;  1XFZ O;  2CNP A;  1XFY O;  2KI6 D;  2LMU A;  4XJK B;  1F55 A;  3BOW A;  2KOT A;  4U8D A;  4YGD B;  3GK4 X;  1PRW A;  4E68 A;  2EHB A;  2I94 A;  3BUX B;  1CMF A;  1NPQ A;  3RLZ A;  2D8N A;  1IG5 A;  1LVC D;  1A2X A;  4JWQ A;  2OS8 B;  3CTN A;  1EH2 A;  1JSA A;  4YBH B;  3LK1 A;  2KYF A;  1UHI A;  2ZND A;  3E3R A;  4M2P A;  4PE7 A;  1KCY A;  2RGI A;  4I5L B;  1PAL A;  1S1E A;  1J1E A;  3A4U B;  3PM8 A;  1CM1 A;  1YUT A;  2MBX A;  4CFR A;  3SJS A;  3VRP A;  4R1E A;  1B47 A;  1CFF A;  1UHH A;  3BXK A;  1M63 B;  2LHL A;  2WOS A;  1TNW A;  3JTD C;  1DVI A;  2KDH A;  1LA3 A;  3CLN A;  5TNC A;  2JRF A;  1AUI B;  2PSR A;  3VRR A;  1U5I A;  4WQ3 A;  1RTP 1;  2Y1M A;  1EXR A;  3CGA A;  2PMY A;  4NDD A;  1MXL C;  3LK0 A;  4I5J A;  4WQ2 A;  1F8H A;  1ALV A;  5BPJ A;  1NX1 A;  4USL A;  2AMI A;  1XK4 A;  3HCM A;  2Y5I A;  2OS8 C;  2KFG A;  3F45 A;  3FS7 A;  2BCB A;  1SL7 A;  1TNQ A;  3BUN B;  4HSZ A;  4ICB A;  2BKI B;  2LVK A;  2OTG B;  5D69 A;  1CLB A;  1CB1 A;  2WCB A;  1BMO A;  1DJH A;  1QXP A;  1OZO A;  4GFT A;  3TZ1 A;  1GGW A;  1X02 A;  2BL0 B;  4L9M A;  1BT6 A;  2LMT A;  2WOR A;  4N1G A;  2H61 A;  4QJ3 B;  2KFF A;  2M1K B;  2NCO A;  1K9P A;  2L4H A;  1KFU L;  3D0Y B;  3AKA A;  2KI6 C;  1ODB A;  1PUL A;  2G9B A;  1YUS A;  3BUO B;  4MZK A;  4NDB A;  1MWN A;  4GPL B;  1CKK A;  2COL B;  1BJF A;  4PHK A;  1KK8 B;  1S3P A;  5IBW A;  1QJT A;  1QAT A;  1U5I B;  3TUY B;  2L5X B;  1W7J B;  3ICB A;  5G08 A;  2ZRS A;  1SKT A;  1WDC B;  2JTZ A;  5HKW A;  2KBM A;  2ZN8 A;  4IL1 A;  2L0P A;  2JOJ A;  1MR8 A;  2JNF A;  3TDZ A;  4ORC B;  2GV5 A;  3EK4 A;  3AKB A;  2ZN9 A;  2OTG C;  1N0Y A;  1LA0 A;  1FF1 A;  1K95 A;  2KAY A;  5AEQ A;  4D1E A;  1IGV A;  2BL0 C;  4QJ4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...