1KSOA

Crystal structure of apo s100a3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
b'ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 CALCIUM-BINDING PROTEIN A3
publication title Metal-free MIRAS phasing: structure of apo-S100A3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ksoA00
2M7LA 2M1KB 3GK2A 2PALA 1EH2A 1IQ5A 2FOTA 1QVIZ 1YURA 1MF8B 1XFZO 2JU0A 3CLNA 1TOPA 1UUSA 5KSZA 4MLWA 1F4QA 1IKUA 2PASA 1ZFSA 1OMRA 1EG3A 2L51A 2L98A 2R2IA 1J7QA 4C0JA 1SPYA 1A4PA 2L0PA 1WY9A 3O4YA 4PE0A 2PRUA 5AFPA 1F8HA 2BBNA 1L2OC 3BUWB 1ZACA 3KEVA 1CDNA 4MSPA 2ZRTA 1LVCD 1CMGA 1K90D 1Y1AA 1ZOTB 4WRIA 4C0LA 3JVTC 2Y1MA 4M2QA 1DJZA 2JXLA 1QX5B 2MHHA 3O2PA 1DGUA 2TN4A 1NX1A 1J1EA 2KFFA 4GGFC 2H61A 3PN7B 1Y6WA 4XJKA 4A4CA 5HKYA 1MXEA 2F33A 5HKZA 2COLB 5F6TA 2LP3A 1SR6C 1YX8A 4PHKA 4GBAA 5GQQC 1JFJA 4YGEB 4CPVA 1F70A 3WHUB 1J7RA 1WLMA 3FWBA 2K7DA 3CR4X 3FWCA 1SNLA 1BOCA 2JRFA 4JWQA 3K21A 3RLZA 2K0JA 5CPVA 5IBWA 3I5FC 3DF0A 3QRXA 1DJXA 2M7NA 4OVNF 2G2BA 2F2PA 3DD4A 2OS8B 3TZ1A 2HQ8A 4BY4A 4GFTA 2LANA 4M2PA 1Y0VH 1DTLA 4NDCA 5HLVA 4AQJA 1Q80A 5JJGA 1NX2A 1SL8A 4DRWA 1SCMC 2JQ6A 1DJYA 1TNXA 4HRHA 4WQ3A 1NCXA 1XFUO 5B8IB 3TDUA 4PCWA 1BR1B 2LHLA 1TIZA 4YGBB 4Q04A 1QLKA 3CZTX 1NYAA 3NXAA 2D8NA 3AAKA 2E6WA 2WNDA 5J3XA 2MLEC 3VRRA 3OB1B 1DT7B 5HLOA 1F55A 5FYXA 3CR2A 3DF0B 1DJHA 2KFGA 2BE6A 1W7JB 2CCMA 1KK7Y 4GAOA 2EC6B 2KHNA 2LM5A 3KO0A 4PDZA 3VRPA 3AKBA 1QIVA 1B8RA 2KI6D 1JBAA 2O60A 2JT0A 3VRNA 1X02A 2CT9A 3EKHA 4MRXA 3ZNIA 2LLSA 2JZIA 4P5OE 1BODA 1N2DA 2CXJA 1FI6A 1OZOA 3NSOA 1XFWO 1SY9A 1SYMA 4I5LB 4YRUA 4MZKA 3GK1A 1UHNA 2JT8A 4MBEA 2KDHA 1CTRA 1DJWA 1VRKA 2MJWB 3MSEB 3PN7C 4PHJA 4N1GA 4ORCB 1PALA 2KGRA 1F54A 1NX3A 2WCBA 2LMUA 1CFCA 2JOJA 2G9BA 2IS9A 4U8DA 4ETOA 3NSLA 1QS7A 5D7FA 1V1FA 1CM4A 1JF0A 1M45A 4QJ4B 2Q4UA 4OKHA 2ZRSA 1NIWA 5K89A 2KBIA 2LLTA 3C1VA 2KNEA 4DS7A 1YRUB 1KFUL 1KQMB 4CLNA 2NCOA 2MBXA 1XYDA 2V53A 4L9MA 4YGDB 1ZMZA 1MQ1A 2M29A 4CFRA 2H61C 1YVLA 2LUXA 2OS8C 2F3ZA 4DUQA 1YUSA 1S6JA 1XA5A 3SG3A 1B4CA 1KWOB 2ZNDA 2LVVA 1FBVA 2K7OA 2M3WA 1K9UA 2JNFA 2FCEA 1YUTA 1G4YR 1KSMA 4ORAB 3CS1A 3I5IC 4XYNA 4PE7A 3LK0A 2KOTA 2JT3A 2BECA 2LHIA 3SG7A 1AJ5A 2L50A 1R2UA 1LXFC 1J1DA 5ER5A 4CIDA 1UURA 4MZJA 1XO5A 4UPGA 1A29A 1BT6A 1PVAA 2Y5IA 1GJYA 4HRGA 4A4BA 3PFVA 4DIRA 2L2EA 3I5GB 1A75B 1YRTB 2DOQA 2WORA 4NQGA 1JC2A 4GNKB 2BL0B 1QTXA 4OV2A 1SL7A 2EGDA 4PE4A 1XK4C 1Y1XA 1IH0A 2H2KA 1B47A 1BJFA 1MWNA 2LAPA 1J7OA 1IWQA 1TTXA 1QIWA 1ALWA 1KK8C 1QLSA 1YTZC 1SMGA 3EVVA 1H4BA 1B7TZ 1C7WA 3LLEA 1JFKA 2KYCA 2K61A 2F2OA 3O6BA 1KSOA 5JOLA 2BCBA 3EVRA 5HYDA 1SW8A 1CMFA 1F4OA 1K2HA 2NCPA 3TUYB 3JTDB 1XVJA 3D0YA 2JTTA 1QV0A 5CSNA 3RM1A 2CTNA 1H8BA 2KI4B 2NXQA 4GPLB 1Y1UA 3NSKA 4XJKB 3EKJA 1S5GY 2JC2A 2NLNA 3WHTB 1DJIA 3OX5A 1OQPA 1RECA 1K9PA 1QATA 3BQ3A 2KQYA 1CLBA 2LE9B 2FCDA 4YGAA 3WNXB 2OTGC 1SCVA 1K8UA 2F3YA 1CDPA 3PM8A 3O78A 2EHBA 3BOWA 3D0YB 4OR9B 1KWOC 1B9AA 3TDZA 1PVBA 4N5XA 1TCFA 3M0WA 1OSAA 1UHJA 3E3RA 1S6IA 4GGFA 2RGIA 4YGCB 4C0KA 1UP5A 1EXRA 1MHOA 2I18A 3DVJA 1G33A 1NCZA 2L4HA 4WQ2A 5G08A 3DVKA 2L4IA 4QJ5B 3ZWHA 3TDIA 2O5GA 1MUXA 3KF9A 2VRGA 1K94A 1RROA 1RTP1 1ZUZA 1L2OB 3A8RA 2HF5A 1AUIB 1S26D 2BL0C 2I7AA 1K95A 3BOWB 3PLFB 1SL9A 1TNPA 4ORBB 4TNCA 5KTYA 2Y1NA 4JPZB 2K2AA 4BY5A 2PMYA 3JVTB 2F8PA 2SASA 2QACA 3PATA 1IQ3A 5D69A 2JWWA 2AAOA 1FPWA 1CFFA 1M46A 1E8AA 4YI9A 4F0ZB 1PK0D 2OPOA 5I2LA 1KFXS 2BBMA 1SR6B 5I8NA 2PVBA 4PE1A 3DVMA 1NX0A 1NCYA 2LC5A 2SCPA 1DVIA 3A4UB 3LK1A 4MZLA 1B8LA 1DMOA 3TUYC 1J55A 1M39A 1XFVO 3OB2B 3JTDC 3PALA 3D10A 3I5HB 2KBMA 2M49B 2ZN8A 1GGWA 3PSRA 1K93D 1HT9A 2M8UA 2MAZA 2PSRA 1B1GA 1CNPA 2M9GA 1KQVA 1OE9B 2KI4C 1EL4A 1GQMA 2ZNEA 1V1GA 3F45A 1RFJA 5TNCA 1EG4A 1R6PA 2ZN9A 2JULA 4QJ3B 1LKJA 3SG4A 1C7VA 2KYFA 3TS5B 4PHMA 1BLQA 2BE4A 1QJTA 1XFYO 4GGNA 1JF2A 1IG5A 2MRDA 2M1UA 2BCAA 2KSPA 5ER4X 3BUMB 3SG6A 5CSIA 1QX2A 3VRQA 5AEQA 1BMOA 1UWOA 1EJ3A 1UHIA 1SK6D 2KI6C 4USLA 2KGBC 2B1UA 2CNPA 1SKTA 2HETA 2K7BA 2K8MB 1WDCB 2EC6C 2AMIA 1CDMA 4I5NB 3AKAA 1A2XA 1QV1A 2WOSA 1FI5A 3FS7A 4PALA 1IJ6A 1KK7Z 1RJVA 1M31A 3WXAA 1SBJA 4HSZA 1NPQA 1MR8A 2KAYA 4IL1A 1YR5A 3OP0A 2ISDA 1HQVA 2L5XB 4MVFA 3BUXB 2NZ0A 5DKQA 1WRZA 5HKWA 3VROA 1DGVA 1PSBA 1QASA 1LINA 1CLMA 1OOJA 3CTNA 1NP8A 1D1OA 5DKNA 1DJGA 1ALVA 3VGOA 1C07A 1JUOA 2K7CA 2LVJA 2M0RA 3ICBA 1YX7A 1S6CA 2LUCA 5BPJA 1IRJA 1CLLA 1S36A 3DVEA 5PALA 1U5IA 3GOFA 4MRYA 3SG5A 4AQIA 2BKHB 2P6BB 2FJUB 1NWDA 1UHHA 3HX4A 4FTGA 3SJSA 1DF0A 5I2OA 2GV5A 3I5HC 4ICBA 1F71A 1UHKA 5I2QA 2JNXA 1KQMC 1WRKA 3HCMA 1QXPA 3IQOA 2Y4QA 1BU3A 1AP4A 1ODBA 3NSIA 4D1EA 3OHMB 3SG2A 1QVIY 1W7IB 3H4SE 2M97A 1CM1A 2LNKA 1AHRA 1BG1A 3CWGA 2WC8A 5AANA 1IJ5A 2JTZA 1LA3A 3EVUA 4MN0A 1U5IB 2Q91A 1XK4A 3IF7A 2E30A 3TS5C 4JQ0D 1N65A 1PRWA 4OCIA 1S3PA 1CDLA 1RWYA 1SRAA 1NSHA 2BCXA 2CBLA 3AAJA 1JWDA 3I5IB 4ZCUA 1BF5A 1DF0B 1TNWA 4NDDA 1WLZA 2I2RE 1K96A 1PULA 3EK4A 1BR4B 4YI8A 3EK8A 2I94A 2LMVA 3SIAA 1WDCC 3I5GC 1YUUA 1M63B 2GGZA 2KAXA 3LCPC 3LL8B 4R1EA 3EK7A 2KQ6A 1PSRA 1YVHA 1CFPA 1FF1A 4PHNA 1G8IA 3BUOB 4M2OA 5AXIA 2MLFC 2WCEA 2BKIB 1K9KA 2KAVA 2LLUA 3CGAA 3OX6A 4MEWA 4CFQA 1TCOB 1B7TY 2ZKMX 4N1FA 2HQWA 1KFXL 4NDBA 1TRFA 1MXLC 1AK8A 5KU1A 3SIBA 3BUNB 1KK8B 1OMDA 4I5KA 5DKRA 2LV7A 5CSJA 1N0YA 2WCFA 4E68A 1JSAA 1FW4A 2JPTA 1XFXO 5CSFA 1WRLA 4GUKA 4P2YB 1LA0A 3FIAA 1B8CA 4HREE 1RK9A 5AERA 1TN4A 3BYAA 2KFHA 1OZSA 4DCKA 2LVIA 2HPSA 1S1EA 1AVSA 3IQQA 3I5FB 2A4JA 2ZFDA 1IGVA 1A03A 1J7PA 1QX7A 3KPXA 3BXKA 2K2FA 1KCYA 2MA2A 1CKKA 2LCPA 2LMTA 1NUBA 2GGMA 1S5GZ 4FQOA 1SCMB 2QPTA 2LVKA 1GGZA 4ZCVA 1CB1A 4I5JA 1TNQA 2OTGB 2LP2A 1CFDA 4AOMA 2AUCA 3GK4X 3KHEA 1KFUS 1AJ4A 3CR5X 4YBHB 1L7ZA 2JXCA 1A75A 1OMVA
chains in the Genus database with same CATH superfamily
2M7LA 2M1KB 3GK2A 3NGVA 3CDNA 2PALA 3V2LA 1XFRA 1EH2A 1IQ5A 2FOTA 1QVIZ 1YURA 1MF8B 1XFZO 2JU0A 3CLNA 1TOPA 1UUSA 5KSZA 4MLWA 1F4QA 1IKUA 2PASA 1ZFSA 1OMRA 1EG3A 3SS5A 2L51A 2L98A 2R2IA 1J7QA 4C0JA 2QEHA 1SPYA 1A4PA 2L0PA 1WY9A 3O4YA 2QDIA 2PRUA 4PE0A 3UNWA 5AFPA 1F8HA 2BBNA 3K1EA 1L2OC 3D76A 3BUWB 1ZACA 3KEVA 1CDNA 4MSPA 2ZRTA 1LVCD 1CMGA 1K90D 1Y1AA 1ZOTB 4OZDA 4WRIA 3JVTC 2Y1MA 1LS8A 3IVTA 4M2QA 4C0LA 1DJZA 2JXLA 1QX5B 2MHHA 3O2PA 1DGUA 2TN4A 1NX1A 3PM2A 1J1EA 2KFFA 3O4XA 4GGFC 1SSEB 2H61A 3PN7B 5EL2A 1Y6WA 4XJKA 4A4CA 5HKYA 1MXEA 1OOFA 2F33A 5HKZA 2COLB 3NHTA 5F6TA 2LP3A 1SR6C 1YX8A 4PHKA 3EG5B 3OGNA 4GBAA 5GQQC 1JFJA 4YGEB 4CPVA 1F70A 3WHUB 1J7RA 1WLMA 3FWBA 2K7DA 3CR4X 3FWCA 1SNLA 1BOCA 2JRFA 5FI7A 2WC5A 4JWQA 5I94A 3K21A 3RLZA 2K0JA 5CPVA 5IBWA 3I5FC 3DF0A 2P71A 3QRXA 1DJXA 2M7NA 4OVNF 2G2BA 1OOIX 1Z4HA 2F2PA 3DD4A 1DC1A 2OS8B 3TZ1A 2HQ8A 4BY4A 4GFTA 2LANA 3D74A 4M2PA 1Y0VH 1DTLA 4NDCA 5HLVA 4AQJA 1Q80A 5JJGA 1NX2A 1SL8A 2WC6A 1SCMC 2JQ6A 1DJYA 1TNXA 4HRHA 4WQ3A 4DRWA 1NCXA 1XFUO 5B8IB 3TDUA 4PCWA 1BR1B 2LHLA 1TIZA 1T14A 4YGBB 3S0FA 3FE8A 4Q04A 1QLKA 3CZTX 1NYAA 3R1PA 4CLNA 3NXAA 2D8NA 3AAKA 2E6WA 2WNDA 5J3XA 2MLEC 3VRRA 3OB1B 1DT7B 5HLOA 1F55A 5FYXA 3CR2A 3DF0B 1DJHA 2KFGA 2BE6A 1W7JB 2CCMA 1KK7Y 4GAOA 2EC6B 2KHNA 2LM5A 3KO0A 4PDZA 5DICA 3VRPA 3AKBA 1QIVA 1B8RA 2KI6D 1JBAA 2O60A 2JT0A 3VRNA 1X02A 2CT9A 3EKHA 1W9ZA 3BFAA 2LLSA 4MRXA 2JZIA 4FQTA 4P5OE 3ZNIA 1BODA 3N7HA 1N2DA 2K60A 2CXJA 3OBVA 1OZOA 3NSOA 1FI6A 1XFWO 3SS4A 1SY9A 1SYMA 4I5LB 2QEVA 4YRUA 4MZKA 3GK1A 1UHNA 2JT8A 4MBEA 2KDHA 3BFHA 1CTRA 2BAPA 5HL1A 1DJWA 1VRKA 2MJWB 3MSEB 3PN7C 4PHJA 4N1GA 3RZSA 1DELA 4ORCB 1PALA 3B87A 2KGRA 1F54A 1NX3A 2WCBA 2LMUA 3D75A 1CFCA 2JOJA 2G9BA 2IS9A 4U8DA 4ETOA 3BJHA 3NSLA 1QS7A 5D7FA 1V1FA 1CM4A 1JF0A 1M45A 3NHIA 2Q4UA 4QJ4B 3D77A 4OKHA 2ZRSA 1DQEA 1NIWA 5K89A 2KBIA 2LLTA 3C1VA 2KNEA 4INXA 4DS7A 1YRUB 1KFUL 1KQMB 3D73A 2NCOA 3R72A 1XYDA 2V53A 4IJ7A 4L9MA 4YGDB 2MBXA 1ZMZA 1MQ1A 2KLEA 2M29A 3L4AA 4CFRA 2H61C 1YVLA 2LUXA 2OS8C 2F3ZA 4DUQA 1YUSA 1S6JA 1XA5A 3SG3A 1B4CA 1KWOB 2ZNDA 2LVVA 1FBVA 2K7OA 3CZ0A 1C3YA 2M3WA 1K9UA 2JNFA 2FCEA 1YUTA 1G4YR 1KSMA 4ORAB 3CS1A 3I5IC 4XYNA 4PE7A 3LK0A 2KOTA 2JT3A 2BECA 2LHIA 3SG7A 1AJ5A 2L50A 1R2UA 1LXFC 1J1DA 5ER5A 3CZ1A 4CIDA 1UURA 2KLDA 1XO5A 4MZJA 4UPGA 1A29A 1BT6A 1PVAA 1TUZA 5D3OA 2Y5IA 1GJYA 4HRGA 2H8VA 4A4BA 3PFVA 4DIRA 2L2EA 3I5GB 1A75B 1YRTB 2DOQA 2WORA 4NQGA 1JC2A 4GNKB 2BL0B 1QTXA 4OV2A 1SL7A 2EGDA 4PE4A 1XK4C 1Y1XA 1IH0A 1DEKA 1B47A 1BJFA 1MWNA 2H2KA 2LAPA 3S0GA 1J7OA 3CYZA 1IWQA 1TTXA 1QIWA 1ALWA 1KK8C 2PQLA 4INWA 1QLSA 1YTZC 1SMGA 5FI2A 3EVVA 1H4BA 1B7TZ 1C7WA 3LLEA 1JFKA 2KYCA 2K61A 2F2OA 3O6BA 1KSOA 5JOLA 2BCBA 2ERBA 3EVRA 1SW8A 5HYDA 1F4OA 1CMFA 3S0EA 1K2HA 2NCPA 3TUYB 3JTDB 1OOGA 1XVJA 3DXLA 3D0YA 2JTTA 1QV0A 5CSNA 3RM1A 2CTNA 1H8BA 2KI4B 2NXQA 4GPLB 2L2CA 1Y1UA 3NSKA 4XJKB 3EKJA 1S5GY 2JC2A 2NLNA 3WHTB 1DJIA 3OX5A 1OQPA 1RECA 1K9PA 1QATA 3BQ3A 2KQYA 1CLBA 2BNXA 2LE9B 2FCDA 4YGAA 3WNXB 2OTGC 1SCVA 2WCLA 1K8UA 3B7AA 2F3YA 1CDPA 3PM8A 3O78A 2EHBA 3BOWA 3D0YB 3SS3A 4OR9B 1KWOC 1B9AA 3TDZA 1PVBA 4N5XA 1TCFA 3M0WA 1OSAA 1UHJA 3E3RA 1S6IA 4GGFA 2RGIA 4YGCB 4C0KA 1UP5A 2KPHA 1EXRA 1MHOA 2I18A 3DVJA 1G33A 1NCZA 2L4HA 4WQ2A 5G08A 3DVKA 2L4IA 4QJ5B 3ZWHA 3TDIA 3UO9A 2O5GA 1MUXA 3KF9A 2VRGA 1K94A 3S0AA 1RROA 1RTP1 1ZUZA 1L2OB 3A8RA 1GM0A 2HF5A 2P70A 1AUIB 1S26D 2BL0C 2I7AA 1K95A 3BOWB 3PLFB 1SL9A 1TNPA 4ORBB 4TNCA 5KTYA 2Y1NA 4JPZB 2K2AA 3FE9A 2PMYA 4BY5A 3JVTB 3S0DA 2F8PA 2SASA 2QACA 3PATA 1IQ3A 5D69A 2JWWA 2AAOA 3QMEA 1FPWA 1CFFA 1M46A 1E8AA 4YI9A 5FI6A 1PK0D 3B6XA 2OPOA 4F0ZB 5I2LA 1KFXS 2BBMA 1SR6B 5I8NA 2PVBA 4PE1A 3DVMA 2QEBA 1NX0A 1NCYA 2LC5A 2YGUA 1QWVA 2SCPA 1DVIA 3A4UB 3LK1A 3B86A 1B8LA 4MZLA 1DMOA 3TUYC 1J55A 1M39A 1XFVO 3OB2B 3JTDC 3L47A 3PALA 3D10A 3I5HB 2KBMA 2M49B 2ZN8A 4JKTA 3PSRA 1OOHA 2WCHA 3L4LA 3R1VA 1GGWA 3D78A 1K93D 1HT9A 2M8UA 2MAZA 2PSRA 1B1GA 1CNPA 2M9GA 1KQVA 1OE9B 2KI4C 1EL4A 1GQMA 2ZNEA 1V1GA 3F45A 1RFJA 5TNCA 1EG4A 1Z2CB 1R6PA 2ZN9A 2JULA 4QJ3B 1LKJA 3SG4A 1C7VA 2KYFA 3R1OA 3TS5B 4PHMA 1BLQA 1TWOA 1QJTA 1XFYO 2BE4A 4GGNA 1JF2A 1IG5A 2MRDA 2M1UA 2BCAA 2KSPA 5ER4X 3BFBA 4PT1A 3BUMB 3SG6A 5CSIA 1QX2A 3VRQA 5AEQA 1BMOA 1UWOA 1EJ3A 1UHIA 1SK6D 2KI6C 4USLA 2KGBC 2B1UA 2CNPA 1SKTA 2HETA 2K7BA 2K8MB 1WDCB 2EC6C 2AMIA 1CDMA 2WCJA 4I5NB 3AKAA 1OW4A 1A2XA 1QV1A 2WOSA 1FI5A 3FS7A 4PALA 2L5YA 1IJ6A 1KK7Z 1RJVA 1M31A 3WXAA 1SBJA 4HSZA 1ORGA 1NPQA 1MR8A 2KAYA 4IL1A 1YR5A 3OP0A 2ISDA 1HQVA 3DYEA 2L5XB 4MVFA 3BUXB 3CABA 2NZ0A 5DKQA 1WRZA 5HKWA 3VROA 1DGVA 1PSBA 1QASA 1LINA 4F7FA 1CLMA 1OOJA 3CTNA 1NP8A 1D1OA 5DKNA 1DJGA 1ALVA 3Q8IA 3VGOA 1C07A 1JUOA 2K7CA 2LVJA 2GTEA 2M0RA 3ICBA 1YX7A 1S6CA 2LUCA 5BPJA 1IRJA 1CLLA 1S36A 3DVEA 5PALA 1U5IA 3GOFA 4MRYA 3SG5A 4AQIA 2BKHB 3DZTA 2P6BB 2FJUB 1NWDA 1UHHA 3HX4A 4FTGA 3SJSA 2PYQA 1DF0A 5I2OA 2GV5A 2JPOA 3I5HC 4ICBA 1F71A 1UHKA 5I2QA 2JNXA 1KQMC 1WRKA 3HCMA 1QXPA 3IQOA 2Y4QA 2WCMA 1BU3A 1AP4A 1ODBA 3NSIA 4D1EA 3OHMB 3SG2A 1QVIY 1W7IB 3H4SE 2M97A 1CM1A 2LNKA 1AHRA 1BG1A 3CWGA 2WC8A 5AANA 1IJ5A 2JTZA 1LA3A 3EVUA 4MN0A 1U5IB 2Q91A 1XK4A 3IF7A 2E30A 3TS5C 4JQ0D 1N65A 1PRWA 4OCIA 4KYNA 1S3PA 1CDLA 1RWYA 1SRAA 1NSHA 2BCXA 2CBLA 3AAJA 1JWDA 3I5IB 4ZCUA 1BF5A 1DF0B 1TNWA 4NDDA 1WLZA 2I2RE 1K96A 1PULA 3EK4A 1BR4B 4YI8A 3EK8A 2QEOA 2I94A 2LMVA 3SIAA 1WDCC 3I5GC 1YUUA 1M63B 2GGZA 2KAXA 3LCPC 3LL8B 4R1EA 3EK7A 2KQ6A 1PSRA 1YVHA 1CFPA 1FF1A 4PHNA 1G8IA 3BUOB 3DY9A 4M2OA 5AXIA 2MLFC 2WCEA 2BKIB 1K9KA 2KAVA 2LLUA 3CGAA 3OX6A 4MEWA 4CFQA 1TCOB 1B7TY 2ZKMX 4N1FA 2HQWA 1KFXL 4NDBA 1TRFA 1TUJA 1MXLC 1AK8A 5KU1A 3SIBA 3BUNB 1KK8B 1OMDA 4I5KA 5DKRA 2LV7A 5CSJA 1N0YA 2WCFA 4E68A 1JSAA 1FW4A 2JPTA 1XFXO 5CSFA 1WRLA 4GUKA 4P2YB 1LA0A 3FIAA 3VB1A 1B8CA 2FJYA 1RK9A 2WCKA 1TN4A 4HREE 3BYAA 5AERA 2KFHA 1OZSA 4DCKA 2LVIA 2HPSA 4JD9A 1S1EA 1AVSA 3IQQA 3PJIA 3I5FB 2A4JA 3S0BA 2ZFDA 1IGVA 3B88A 1A03A 1J7PA 1QX7A 3KPXA 3BXKA 2K2FA 1KCYA 2MA2A 3CZ2A 1CKKA 2LCPA 2LMTA 1NUBA 3FE6A 2GGMA 1S5GZ 4FQOA 1SCMB 2QPTA 2LVKA 1GGZA 4ZCVA 1CB1A 4I5JA 1TNQA 2OTGB 2LP2A 1CFDA 4AOMA 2AUCA 3GK4X 1P28A 1KFUS 3KHEA 1AJ4A 3CR5X 1C3ZA 4YBHB 1IIOA 1L7ZA 2JXCA 1A75A 1OMVA
chains in the Genus database with same CATH topology
2M7LA 2M1KB 3GK2A 2PALA 1EH2A 1IQ5A 2FOTA 1QVIZ 1YURA 1MF8B 1XFZO 2JU0A 3CLNA 1TOPA 1UUSA 5KSZA 4MLWA 1F4QA 1IKUA 2PASA 1ZFSA 1OMRA 1EG3A 2L51A 2L98A 2R2IA 1J7QA 4C0JA 1SPYA 1A4PA 2L0PA 1WY9A 3O4YA 4PE0A 2PRUA 5AFPA 1F8HA 2BBNA 1L2OC 3BUWB 1ZACA 3KEVA 1CDNA 4MSPA 2ZRTA 1LVCD 1CMGA 1K90D 1Y1AA 1ZOTB 4WRIA 4C0LA 3JVTC 2Y1MA 4M2QA 1DJZA 2JXLA 1QX5B 2MHHA 3O2PA 1DGUA 2TN4A 1NX1A 1J1EA 2KFFA 4GGFC 2H61A 3PN7B 1Y6WA 4XJKA 4A4CA 5HKYA 1MXEA 2F33A 5HKZA 2COLB 5F6TA 2LP3A 1SR6C 1YX8A 4PHKA 4GBAA 5GQQC 1JFJA 4YGEB 4CPVA 1F70A 3WHUB 1J7RA 1WLMA 3FWBA 2K7DA 3CR4X 3FWCA 1SNLA 1BOCA 2JRFA 4JWQA 3K21A 3RLZA 2K0JA 5CPVA 5IBWA 3I5FC 3DF0A 3QRXA 1DJXA 2M7NA 4OVNF 2G2BA 2F2PA 3DD4A 2OS8B 3TZ1A 2HQ8A 4BY4A 4GFTA 2LANA 4M2PA 1Y0VH 1DTLA 4NDCA 5HLVA 4AQJA 1Q80A 5JJGA 1NX2A 1SL8A 4DRWA 1SCMC 2JQ6A 1DJYA 1TNXA 4HRHA 4WQ3A 1NCXA 1XFUO 5B8IB 3TDUA 4PCWA 1BR1B 2LHLA 1TIZA 4YGBB 4Q04A 1QLKA 3CZTX 1NYAA 3NXAA 2D8NA 3AAKA 2E6WA 2WNDA 5J3XA 2MLEC 3VRRA 3OB1B 1DT7B 5HLOA 1F55A 5FYXA 3CR2A 3DF0B 1DJHA 2KFGA 2BE6A 1W7JB 2CCMA 1KK7Y 4GAOA 2EC6B 2KHNA 2LM5A 3KO0A 4PDZA 3VRPA 3AKBA 1QIVA 1B8RA 2KI6D 1JBAA 2O60A 2JT0A 3VRNA 1X02A 2CT9A 3EKHA 4MRXA 3ZNIA 2LLSA 2JZIA 4P5OE 1BODA 1N2DA 2CXJA 1FI6A 1OZOA 3NSOA 1XFWO 1SY9A 1SYMA 4I5LB 4YRUA 4MZKA 3GK1A 1UHNA 2JT8A 4MBEA 2KDHA 1CTRA 1DJWA 1VRKA 2MJWB 3MSEB 3PN7C 4PHJA 4N1GA 4ORCB 1PALA 2KGRA 1F54A 1NX3A 2WCBA 2LMUA 1CFCA 2JOJA 2G9BA 2IS9A 4U8DA 4ETOA 3NSLA 1QS7A 5D7FA 1V1FA 1CM4A 1JF0A 1M45A 4QJ4B 2Q4UA 4OKHA 2ZRSA 1NIWA 5K89A 2KBIA 2LLTA 3C1VA 2KNEA 4DS7A 1YRUB 1KFUL 1KQMB 4CLNA 2NCOA 2MBXA 1XYDA 2V53A 4L9MA 4YGDB 1ZMZA 1MQ1A 2M29A 4CFRA 2H61C 1YVLA 2LUXA 2OS8C 2F3ZA 4DUQA 1YUSA 1S6JA 1XA5A 3SG3A 1B4CA 1KWOB 2ZNDA 2LVVA 1FBVA 2K7OA 2M3WA 1K9UA 2JNFA 2FCEA 1YUTA 1G4YR 1KSMA 4ORAB 3CS1A 3I5IC 4XYNA 4PE7A 3LK0A 2KOTA 2JT3A 2BECA 2LHIA 3SG7A 1AJ5A 2L50A 1R2UA 1LXFC 1J1DA 5ER5A 4CIDA 1UURA 4MZJA 1XO5A 4UPGA 1A29A 1BT6A 1PVAA 2Y5IA 1GJYA 4HRGA 4A4BA 3PFVA 4DIRA 2L2EA 3I5GB 1A75B 1YRTB 2DOQA 2WORA 4NQGA 1JC2A 4GNKB 2BL0B 1QTXA 4OV2A 1SL7A 2EGDA 4PE4A 1XK4C 1Y1XA 1IH0A 2H2KA 1B47A 1BJFA 1MWNA 2LAPA 1J7OA 1IWQA 1TTXA 1QIWA 1ALWA 1KK8C 1QLSA 1YTZC 1SMGA 3EVVA 1H4BA 1B7TZ 1C7WA 3LLEA 1JFKA 2KYCA 2K61A 2F2OA 3O6BA 1KSOA 5JOLA 2BCBA 3EVRA 5HYDA 1SW8A 1CMFA 1F4OA 1K2HA 2NCPA 3TUYB 3JTDB 1XVJA 3D0YA 2JTTA 1QV0A 5CSNA 3RM1A 2CTNA 1H8BA 2KI4B 2NXQA 4GPLB 1Y1UA 3NSKA 4XJKB 3EKJA 1S5GY 2JC2A 2NLNA 3WHTB 1DJIA 3OX5A 1OQPA 1RECA 1K9PA 1QATA 3BQ3A 2KQYA 1CLBA 2LE9B 2FCDA 4YGAA 3WNXB 2OTGC 1SCVA 1K8UA 2F3YA 1CDPA 3PM8A 3O78A 2EHBA 3BOWA 3D0YB 4OR9B 1KWOC 1B9AA 3TDZA 1PVBA 4N5XA 1TCFA 3M0WA 1OSAA 1UHJA 3E3RA 1S6IA 4GGFA 2RGIA 4YGCB 4C0KA 1UP5A 1EXRA 1MHOA 2I18A 3DVJA 1G33A 1NCZA 2L4HA 4WQ2A 5G08A 3DVKA 2L4IA 4QJ5B 3ZWHA 3TDIA 2O5GA 1MUXA 3KF9A 2VRGA 1K94A 1RROA 1RTP1 1ZUZA 1L2OB 3A8RA 2HF5A 1AUIB 1S26D 2BL0C 2I7AA 1K95A 3BOWB 3PLFB 1SL9A 1TNPA 4ORBB 4TNCA 5KTYA 2Y1NA 4JPZB 2K2AA 4BY5A 2PMYA 3JVTB 2F8PA 2SASA 2QACA 3PATA 1IQ3A 5D69A 2JWWA 2AAOA 1FPWA 1CFFA 1M46A 1E8AA 4YI9A 4F0ZB 1PK0D 2OPOA 5I2LA 1KFXS 2BBMA 1SR6B 5I8NA 2PVBA 4PE1A 3DVMA 1NX0A 1NCYA 2LC5A 2SCPA 1DVIA 3A4UB 3LK1A 4MZLA 1B8LA 1DMOA 3TUYC 1J55A 1M39A 1XFVO 3OB2B 3JTDC 3PALA 3D10A 3I5HB 2KBMA 2M49B 2ZN8A 1GGWA 3PSRA 1K93D 1HT9A 2M8UA 2MAZA 2PSRA 1B1GA 1CNPA 2M9GA 1KQVA 1OE9B 2KI4C 1EL4A 1GQMA 2ZNEA 1V1GA 3F45A 1RFJA 5TNCA 1EG4A 1R6PA 2ZN9A 2JULA 4QJ3B 1LKJA 3SG4A 1C7VA 2KYFA 3TS5B 4PHMA 1BLQA 2BE4A 1QJTA 1XFYO 4GGNA 1JF2A 1IG5A 2MRDA 2M1UA 2BCAA 2KSPA 5ER4X 3BUMB 3SG6A 5CSIA 1QX2A 3VRQA 5AEQA 1BMOA 1UWOA 1EJ3A 1UHIA 1SK6D 2KI6C 4USLA 2KGBC 2B1UA 2CNPA 1SKTA 2HETA 2K7BA 2K8MB 1WDCB 2EC6C 2AMIA 1CDMA 4I5NB 3AKAA 1A2XA 1QV1A 2WOSA 1FI5A 3FS7A 4PALA 1IJ6A 1KK7Z 1RJVA 1M31A 3WXAA 1SBJA 4HSZA 1NPQA 1MR8A 2KAYA 4IL1A 1YR5A 3OP0A 2ISDA 1HQVA 2L5XB 4MVFA 3BUXB 2NZ0A 5DKQA 1WRZA 5HKWA 3VROA 1DGVA 1PSBA 1QASA 1LINA 1CLMA 1OOJA 3CTNA 1NP8A 1D1OA 5DKNA 1DJGA 1ALVA 3VGOA 1C07A 1JUOA 2K7CA 2LVJA 2M0RA 3ICBA 1YX7A 1S6CA 2LUCA 5BPJA 1IRJA 1CLLA 1S36A 3DVEA 5PALA 1U5IA 3GOFA 4MRYA 3SG5A 4AQIA 2BKHB 2P6BB 2FJUB 1NWDA 1UHHA 3HX4A 4FTGA 3SJSA 1DF0A 5I2OA 2GV5A 3I5HC 4ICBA 1F71A 1UHKA 5I2QA 2JNXA 1KQMC 1WRKA 3HCMA 1QXPA 3IQOA 2Y4QA 1BU3A 1AP4A 1ODBA 3NSIA 4D1EA 3OHMB 3SG2A 1QVIY 1W7IB 3H4SE 2M97A 1CM1A 2LNKA 1AHRA 1BG1A 3CWGA 2WC8A 5AANA 1IJ5A 2JTZA 1LA3A 3EVUA 4MN0A 1U5IB 2Q91A 1XK4A 3IF7A 2E30A 3TS5C 4JQ0D 1N65A 1PRWA 4OCIA 1S3PA 1CDLA 1RWYA 1SRAA 1NSHA 2BCXA 2CBLA 3AAJA 1JWDA 3I5IB 4ZCUA 1BF5A 1DF0B 1TNWA 4NDDA 1WLZA 2I2RE 1K96A 1PULA 3EK4A 1BR4B 4YI8A 3EK8A 2I94A 2LMVA 3SIAA 1WDCC 3I5GC 1YUUA 1M63B 2GGZA 2KAXA 3LCPC 3LL8B 4R1EA 3EK7A 2KQ6A 1PSRA 1YVHA 1CFPA 1FF1A 4PHNA 1G8IA 3BUOB 4M2OA 5AXIA 2MLFC 2WCEA 2BKIB 1K9KA 2KAVA 2LLUA 3CGAA 3OX6A 4MEWA 4CFQA 1TCOB 1B7TY 2ZKMX 4N1FA 2HQWA 1KFXL 4NDBA 1TRFA 1MXLC 1AK8A 5KU1A 3SIBA 3BUNB 1KK8B 1OMDA 4I5KA 5DKRA 2LV7A 5CSJA 1N0YA 2WCFA 4E68A 1JSAA 1FW4A 2JPTA 1XFXO 5CSFA 1WRLA 4GUKA 4P2YB 1LA0A 3FIAA 1B8CA 4HREE 1RK9A 5AERA 1TN4A 3BYAA 2KFHA 1OZSA 4DCKA 2LVIA 2HPSA 1S1EA 1AVSA 3IQQA 3I5FB 2A4JA 2ZFDA 1IGVA 1A03A 1J7PA 1QX7A 3KPXA 3BXKA 2K2FA 1KCYA 2MA2A 1CKKA 2LCPA 2LMTA 1NUBA 2GGMA 1S5GZ 4FQOA 1SCMB 2QPTA 2LVKA 1GGZA 4ZCVA 1CB1A 4I5JA 1TNQA 2OTGB 2LP2A 1CFDA 4AOMA 2AUCA 3GK4X 3KHEA 1KFUS 1AJ4A 3CR5X 4YBHB 1L7ZA 2JXCA 1A75A 1OMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7L A;  2M1K B;  3GK2 A;  2PAL A;  1EH2 A;  1IQ5 A;  2FOT A;  1QVI Z;  1YUR A;  1MF8 B;  1XFZ O;  2JU0 A;  3CLN A;  1TOP A;  1UUS A;  5KSZ A;  4MLW A;  1F4Q A;  1IKU A;  2PAS A;  1ZFS A;  1OMR A;  1EG3 A;  2L51 A;  2L98 A;  2R2I A;  1J7Q A;  4C0J A;  1SPY A;  1A4P A;  2L0P A;  1WY9 A;  3O4Y A;  4PE0 A;  2PRU A;  5AFP A;  1F8H A;  2BBN A;  1L2O C;  3BUW B;  1ZAC A;  3KEV A;  1CDN A;  4MSP A;  2ZRT A;  1LVC D;  1CMG A;  1K90 D;  1Y1A A;  1ZOT B;  4WRI A;  4C0L A;  3JVT C;  2Y1M A;  4M2Q A;  1DJZ A;  2JXL A;  1QX5 B;  2MHH A;  3O2P A;  1DGU A;  2TN4 A;  1NX1 A;  1J1E A;  2KFF A;  4GGF C;  2H61 A;  3PN7 B;  1Y6W A;  4XJK A;  4A4C A;  5HKY A;  1MXE A;  2F33 A;  5HKZ A;  2COL B;  5F6T A;  2LP3 A;  1SR6 C;  1YX8 A;  4PHK A;  4GBA A;  5GQQ C;  1JFJ A;  4YGE B;  4CPV A;  1F70 A;  3WHU B;  1J7R A;  1WLM A;  3FWB A;  2K7D A;  3CR4 X;  3FWC A;  1SNL A;  1BOC A;  2JRF A;  4JWQ A;  3K21 A;  3RLZ A;  2K0J A;  5CPV A;  5IBW A;  3I5F C;  3DF0 A;  3QRX A;  1DJX A;  2M7N A;  4OVN F;  2G2B A;  2F2P A;  3DD4 A;  2OS8 B;  3TZ1 A;  2HQ8 A;  4BY4 A;  4GFT A;  2LAN A;  4M2P A;  1Y0V H;  1DTL A;  4NDC A;  5HLV A;  4AQJ A;  1Q80 A;  5JJG A;  1NX2 A;  1SL8 A;  4DRW A;  1SCM C;  2JQ6 A;  1DJY A;  1TNX A;  4HRH A;  4WQ3 A;  1NCX A;  1XFU O;  5B8I B;  3TDU A;  4PCW A;  1BR1 B;  2LHL A;  1TIZ A;  4YGB B;  4Q04 A;  1QLK A;  3CZT X;  1NYA A;  3NXA A;  2D8N A;  3AAK A;  2E6W A;  2WND A;  5J3X A;  2MLE C;  3VRR A;  3OB1 B;  1DT7 B;  5HLO A;  1F55 A;  5FYX A;  3CR2 A;  3DF0 B;  1DJH A;  2KFG A;  2BE6 A;  1W7J B;  2CCM A;  1KK7 Y;  4GAO A;  2EC6 B;  2KHN A;  2LM5 A;  3KO0 A;  4PDZ A;  3VRP A;  3AKB A;  1QIV A;  1B8R A;  2KI6 D;  1JBA A;  2O60 A;  2JT0 A;  3VRN A;  1X02 A;  2CT9 A;  3EKH A;  4MRX A;  3ZNI A;  2LLS A;  2JZI A;  4P5O E;  1BOD A;  1N2D A;  2CXJ A;  1FI6 A;  1OZO A;  3NSO A;  1XFW O;  1SY9 A;  1SYM A;  4I5L B;  4YRU A;  4MZK A;  3GK1 A;  1UHN A;  2JT8 A;  4MBE A;  2KDH A;  1CTR A;  1DJW A;  1VRK A;  2MJW B;  3MSE B;  3PN7 C;  4PHJ A;  4N1G A;  4ORC B;  1PAL A;  2KGR A;  1F54 A;  1NX3 A;  2WCB A;  2LMU A;  1CFC A;  2JOJ A;  2G9B A;  2IS9 A;  4U8D A;  4ETO A;  3NSL A;  1QS7 A;  5D7F A;  1V1F A;  1CM4 A;  1JF0 A;  1M45 A;  4QJ4 B;  2Q4U A;  4OKH A;  2ZRS A;  1NIW A;  5K89 A;  2KBI A;  2LLT A;  3C1V A;  2KNE A;  4DS7 A;  1YRU B;  1KFU L;  1KQM B;  4CLN A;  2NCO A;  2MBX A;  1XYD A;  2V53 A;  4L9M A;  4YGD B;  1ZMZ A;  1MQ1 A;  2M29 A;  4CFR A;  2H61 C;  1YVL A;  2LUX A;  2OS8 C;  2F3Z A;  4DUQ A;  1YUS A;  1S6J A;  1XA5 A;  3SG3 A;  1B4C A;  1KWO B;  2ZND A;  2LVV A;  1FBV A;  2K7O A;  2M3W A;  1K9U A;  2JNF A;  2FCE A;  1YUT A;  1G4Y R;  1KSM A;  4ORA B;  3CS1 A;  3I5I C;  4XYN A;  4PE7 A;  3LK0 A;  2KOT A;  2JT3 A;  2BEC A;  2LHI A;  3SG7 A;  1AJ5 A;  2L50 A;  1R2U A;  1LXF C;  1J1D A;  5ER5 A;  4CID A;  1UUR A;  4MZJ A;  1XO5 A;  4UPG A;  1A29 A;  1BT6 A;  1PVA A;  2Y5I A;  1GJY A;  4HRG A;  4A4B A;  3PFV A;  4DIR A;  2L2E A;  3I5G B;  1A75 B;  1YRT B;  2DOQ A;  2WOR A;  4NQG A;  1JC2 A;  4GNK B;  2BL0 B;  1QTX A;  4OV2 A;  1SL7 A;  2EGD A;  4PE4 A;  1XK4 C;  1Y1X A;  1IH0 A;  2H2K A;  1B47 A;  1BJF A;  1MWN A;  2LAP A;  1J7O A;  1IWQ A;  1TTX A;  1QIW A;  1ALW A;  1KK8 C;  1QLS A;  1YTZ C;  1SMG A;  3EVV A;  1H4B A;  1B7T Z;  1C7W A;  3LLE A;  1JFK A;  2KYC A;  2K61 A;  2F2O A;  3O6B A;  1KSO A;  5JOL A;  2BCB A;  3EVR A;  5HYD A;  1SW8 A;  1CMF A;  1F4O A;  1K2H A;  2NCP A;  3TUY B;  3JTD B;  1XVJ A;  3D0Y A;  2JTT A;  1QV0 A;  5CSN A;  3RM1 A;  2CTN A;  1H8B A;  2KI4 B;  2NXQ A;  4GPL B;  1Y1U A;  3NSK A;  4XJK B;  3EKJ A;  1S5G Y;  2JC2 A;  2NLN A;  3WHT B;  1DJI A;  3OX5 A;  1OQP A;  1REC A;  1K9P A;  1QAT A;  3BQ3 A;  2KQY A;  1CLB A;  2LE9 B;  2FCD A;  4YGA A;  3WNX B;  2OTG C;  1SCV A;  1K8U A;  2F3Y A;  1CDP A;  3PM8 A;  3O78 A;  2EHB A;  3BOW A;  3D0Y B;  4OR9 B;  1KWO C;  1B9A A;  3TDZ A;  1PVB A;  4N5X A;  1TCF A;  3M0W A;  1OSA A;  1UHJ A;  3E3R A;  1S6I A;  4GGF A;  2RGI A;  4YGC B;  4C0K A;  1UP5 A;  1EXR A;  1MHO A;  2I18 A;  3DVJ A;  1G33 A;  1NCZ A;  2L4H A;  4WQ2 A;  5G08 A;  3DVK A;  2L4I A;  4QJ5 B;  3ZWH A;  3TDI A;  2O5G A;  1MUX A;  3KF9 A;  2VRG A;  1K94 A;  1RRO A;  1RTP 1;  1ZUZ A;  1L2O B;  3A8R A;  2HF5 A;  1AUI B;  1S26 D;  2BL0 C;  2I7A A;  1K95 A;  3BOW B;  3PLF B;  1SL9 A;  1TNP A;  4ORB B;  4TNC A;  5KTY A;  2Y1N A;  4JPZ B;  2K2A A;  4BY5 A;  2PMY A;  3JVT B;  2F8P A;  2SAS A;  2QAC A;  3PAT A;  1IQ3 A;  5D69 A;  2JWW A;  2AAO A;  1FPW A;  1CFF A;  1M46 A;  1E8A A;  4YI9 A;  4F0Z B;  1PK0 D;  2OPO A;  5I2L A;  1KFX S;  2BBM A;  1SR6 B;  5I8N A;  2PVB A;  4PE1 A;  3DVM A;  1NX0 A;  1NCY A;  2LC5 A;  2SCP A;  1DVI A;  3A4U B;  3LK1 A;  4MZL A;  1B8L A;  1DMO A;  3TUY C;  1J55 A;  1M39 A;  1XFV O;  3OB2 B;  3JTD C;  3PAL A;  3D10 A;  3I5H B;  2KBM A;  2M49 B;  2ZN8 A;  1GGW A;  3PSR A;  1K93 D;  1HT9 A;  2M8U A;  2MAZ A;  2PSR A;  1B1G A;  1CNP A;  2M9G A;  1KQV A;  1OE9 B;  2KI4 C;  1EL4 A;  1GQM A;  2ZNE A;  1V1G A;  3F45 A;  1RFJ A;  5TNC A;  1EG4 A;  1R6P A;  2ZN9 A;  2JUL A;  4QJ3 B;  1LKJ A;  3SG4 A;  1C7V A;  2KYF A;  3TS5 B;  4PHM A;  1BLQ A;  2BE4 A;  1QJT A;  1XFY O;  4GGN A;  1JF2 A;  1IG5 A;  2MRD A;  2M1U A;  2BCA A;  2KSP A;  5ER4 X;  3BUM B;  3SG6 A;  5CSI A;  1QX2 A;  3VRQ A;  5AEQ A;  1BMO A;  1UWO A;  1EJ3 A;  1UHI A;  1SK6 D;  2KI6 C;  4USL A;  2KGB C;  2B1U A;  2CNP A;  1SKT A;  2HET A;  2K7B A;  2K8M B;  1WDC B;  2EC6 C;  2AMI A;  1CDM A;  4I5N B;  3AKA A;  1A2X A;  1QV1 A;  2WOS A;  1FI5 A;  3FS7 A;  4PAL A;  1IJ6 A;  1KK7 Z;  1RJV A;  1M31 A;  3WXA A;  1SBJ A;  4HSZ A;  1NPQ A;  1MR8 A;  2KAY A;  4IL1 A;  1YR5 A;  3OP0 A;  2ISD A;  1HQV A;  2L5X B;  4MVF A;  3BUX B;  2NZ0 A;  5DKQ A;  1WRZ A;  5HKW A;  3VRO A;  1DGV A;  1PSB A;  1QAS A;  1LIN A;  1CLM A;  1OOJ A;  3CTN A;  1NP8 A;  1D1O A;  5DKN A;  1DJG A;  1ALV A;  3VGO A;  1C07 A;  1JUO A;  2K7C A;  2LVJ A;  2M0R A;  3ICB A;  1YX7 A;  1S6C A;  2LUC A;  5BPJ A;  1IRJ A;  1CLL A;  1S36 A;  3DVE A;  5PAL A;  1U5I A;  3GOF A;  4MRY A;  3SG5 A;  4AQI A;  2BKH B;  2P6B B;  2FJU B;  1NWD A;  1UHH A;  3HX4 A;  4FTG A;  3SJS A;  1DF0 A;  5I2O A;  2GV5 A;  3I5H C;  4ICB A;  1F71 A;  1UHK A;  5I2Q A;  2JNX A;  1KQM C;  1WRK A;  3HCM A;  1QXP A;  3IQO A;  2Y4Q A;  1BU3 A;  1AP4 A;  1ODB A;  3NSI A;  4D1E A;  3OHM B;  3SG2 A;  1QVI Y;  1W7I B;  3H4S E;  2M97 A;  1CM1 A;  2LNK A;  1AHR A;  1BG1 A;  3CWG A;  2WC8 A;  5AAN A;  1IJ5 A;  2JTZ A;  1LA3 A;  3EVU A;  4MN0 A;  1U5I B;  2Q91 A;  1XK4 A;  3IF7 A;  2E30 A;  3TS5 C;  4JQ0 D;  1N65 A;  1PRW A;  4OCI A;  1S3P A;  1CDL A;  1RWY A;  1SRA A;  1NSH A;  2BCX A;  2CBL A;  3AAJ A;  1JWD A;  3I5I B;  4ZCU A;  1BF5 A;  1DF0 B;  1TNW A;  4NDD A;  1WLZ A;  2I2R E;  1K96 A;  1PUL A;  3EK4 A;  1BR4 B;  4YI8 A;  3EK8 A;  2I94 A;  2LMV A;  3SIA A;  1WDC C;  3I5G C;  1YUU A;  1M63 B;  2GGZ A;  2KAX A;  3LCP C;  3LL8 B;  4R1E A;  3EK7 A;  2KQ6 A;  1PSR A;  1YVH A;  1CFP A;  1FF1 A;  4PHN A;  1G8I A;  3BUO B;  4M2O A;  5AXI A;  2MLF C;  2WCE A;  2BKI B;  1K9K A;  2KAV A;  2LLU A;  3CGA A;  3OX6 A;  4MEW A;  4CFQ A;  1TCO B;  1B7T Y;  2ZKM X;  4N1F A;  2HQW A;  1KFX L;  4NDB A;  1TRF A;  1MXL C;  1AK8 A;  5KU1 A;  3SIB A;  3BUN B;  1KK8 B;  1OMD A;  4I5K A;  5DKR A;  2LV7 A;  5CSJ A;  1N0Y A;  2WCF A;  4E68 A;  1JSA A;  1FW4 A;  2JPT A;  1XFX O;  5CSF A;  1WRL A;  4GUK A;  4P2Y B;  1LA0 A;  3FIA A;  1B8C A;  4HRE E;  1RK9 A;  5AER A;  1TN4 A;  3BYA A;  2KFH A;  1OZS A;  4DCK A;  2LVI A;  2HPS A;  1S1E A;  1AVS A;  3IQQ A;  3I5F B;  2A4J A;  2ZFD A;  1IGV A;  1A03 A;  1J7P A;  1QX7 A;  3KPX A;  3BXK A;  2K2F A;  1KCY A;  2MA2 A;  1CKK A;  2LCP A;  2LMT A;  1NUB A;  2GGM A;  1S5G Z;  4FQO A;  1SCM B;  2QPT A;  2LVK A;  1GGZ A;  4ZCV A;  1CB1 A;  4I5J A;  1TNQ A;  2OTG B;  2LP2 A;  1CFD A;  4AOM A;  2AUC A;  3GK4 X;  3KHE A;  1KFU S;  1AJ4 A;  3CR5 X;  4YBH B;  1L7Z A;  2JXC A;  1A75 A;  1OMV A; 
#chains in the Genus database with same CATH topology
 2M7L A;  2M1K B;  3GK2 A;  3NGV A;  3CDN A;  2PAL A;  3V2L A;  1XFR A;  1EH2 A;  1IQ5 A;  2FOT A;  1QVI Z;  1YUR A;  1MF8 B;  1XFZ O;  2JU0 A;  3CLN A;  1TOP A;  1UUS A;  5KSZ A;  4MLW A;  1F4Q A;  1IKU A;  2PAS A;  1ZFS A;  1OMR A;  1EG3 A;  3SS5 A;  2L51 A;  2L98 A;  2R2I A;  1J7Q A;  4C0J A;  2QEH A;  1SPY A;  1A4P A;  2L0P A;  1WY9 A;  3O4Y A;  2QDI A;  2PRU A;  4PE0 A;  3UNW A;  5AFP A;  1F8H A;  2BBN A;  3K1E A;  1L2O C;  3D76 A;  3BUW B;  1ZAC A;  3KEV A;  1CDN A;  4MSP A;  2ZRT A;  1LVC D;  1CMG A;  1K90 D;  1Y1A A;  1ZOT B;  4OZD A;  4WRI A;  3JVT C;  2Y1M A;  1LS8 A;  3IVT A;  4M2Q A;  4C0L A;  1DJZ A;  2JXL A;  1QX5 B;  2MHH A;  3O2P A;  1DGU A;  2TN4 A;  1NX1 A;  3PM2 A;  1J1E A;  2KFF A;  3O4X A;  4GGF C;  1SSE B;  2H61 A;  3PN7 B;  5EL2 A;  1Y6W A;  4XJK A;  4A4C A;  5HKY A;  1MXE A;  1OOF A;  2F33 A;  5HKZ A;  2COL B;  3NHT A;  5F6T A;  2LP3 A;  1SR6 C;  1YX8 A;  4PHK A;  3EG5 B;  3OGN A;  4GBA A;  5GQQ C;  1JFJ A;  4YGE B;  4CPV A;  1F70 A;  3WHU B;  1J7R A;  1WLM A;  3FWB A;  2K7D A;  3CR4 X;  3FWC A;  1SNL A;  1BOC A;  2JRF A;  5FI7 A;  2WC5 A;  4JWQ A;  5I94 A;  3K21 A;  3RLZ A;  2K0J A;  5CPV A;  5IBW A;  3I5F C;  3DF0 A;  2P71 A;  3QRX A;  1DJX A;  2M7N A;  4OVN F;  2G2B A;  1OOI X;  1Z4H A;  2F2P A;  3DD4 A;  1DC1 A;  2OS8 B;  3TZ1 A;  2HQ8 A;  4BY4 A;  4GFT A;  2LAN A;  3D74 A;  4M2P A;  1Y0V H;  1DTL A;  4NDC A;  5HLV A;  4AQJ A;  1Q80 A;  5JJG A;  1NX2 A;  1SL8 A;  2WC6 A;  1SCM C;  2JQ6 A;  1DJY A;  1TNX A;  4HRH A;  4WQ3 A;  4DRW A;  1NCX A;  1XFU O;  5B8I B;  3TDU A;  4PCW A;  1BR1 B;  2LHL A;  1TIZ A;  1T14 A;  4YGB B;  3S0F A;  3FE8 A;  4Q04 A;  1QLK A;  3CZT X;  1NYA A;  3R1P A;  4CLN A;  3NXA A;  2D8N A;  3AAK A;  2E6W A;  2WND A;  5J3X A;  2MLE C;  3VRR A;  3OB1 B;  1DT7 B;  5HLO A;  1F55 A;  5FYX A;  3CR2 A;  3DF0 B;  1DJH A;  2KFG A;  2BE6 A;  1W7J B;  2CCM A;  1KK7 Y;  4GAO A;  2EC6 B;  2KHN A;  2LM5 A;  3KO0 A;  4PDZ A;  5DIC A;  3VRP A;  3AKB A;  1QIV A;  1B8R A;  2KI6 D;  1JBA A;  2O60 A;  2JT0 A;  3VRN A;  1X02 A;  2CT9 A;  3EKH A;  1W9Z A;  3BFA A;  2LLS A;  4MRX A;  2JZI A;  4FQT A;  4P5O E;  3ZNI A;  1BOD A;  3N7H A;  1N2D A;  2K60 A;  2CXJ A;  3OBV A;  1OZO A;  3NSO A;  1FI6 A;  1XFW O;  3SS4 A;  1SY9 A;  1SYM A;  4I5L B;  2QEV A;  4YRU A;  4MZK A;  3GK1 A;  1UHN A;  2JT8 A;  4MBE A;  2KDH A;  3BFH A;  1CTR A;  2BAP A;  5HL1 A;  1DJW A;  1VRK A;  2MJW B;  3MSE B;  3PN7 C;  4PHJ A;  4N1G A;  3RZS A;  1DEL A;  4ORC B;  1PAL A;  3B87 A;  2KGR A;  1F54 A;  1NX3 A;  2WCB A;  2LMU A;  3D75 A;  1CFC A;  2JOJ A;  2G9B A;  2IS9 A;  4U8D A;  4ETO A;  3BJH A;  3NSL A;  1QS7 A;  5D7F A;  1V1F A;  1CM4 A;  1JF0 A;  1M45 A;  3NHI A;  2Q4U A;  4QJ4 B;  3D77 A;  4OKH A;  2ZRS A;  1DQE A;  1NIW A;  5K89 A;  2KBI A;  2LLT A;  3C1V A;  2KNE A;  4INX A;  4DS7 A;  1YRU B;  1KFU L;  1KQM B;  3D73 A;  2NCO A;  3R72 A;  1XYD A;  2V53 A;  4IJ7 A;  4L9M A;  4YGD B;  2MBX A;  1ZMZ A;  1MQ1 A;  2KLE A;  2M29 A;  3L4A A;  4CFR A;  2H61 C;  1YVL A;  2LUX A;  2OS8 C;  2F3Z A;  4DUQ A;  1YUS A;  1S6J A;  1XA5 A;  3SG3 A;  1B4C A;  1KWO B;  2ZND A;  2LVV A;  1FBV A;  2K7O A;  3CZ0 A;  1C3Y A;  2M3W A;  1K9U A;  2JNF A;  2FCE A;  1YUT A;  1G4Y R;  1KSM A;  4ORA B;  3CS1 A;  3I5I C;  4XYN A;  4PE7 A;  3LK0 A;  2KOT A;  2JT3 A;  2BEC A;  2LHI A;  3SG7 A;  1AJ5 A;  2L50 A;  1R2U A;  1LXF C;  1J1D A;  5ER5 A;  3CZ1 A;  4CID A;  1UUR A;  2KLD A;  1XO5 A;  4MZJ A;  4UPG A;  1A29 A;  1BT6 A;  1PVA A;  1TUZ A;  5D3O A;  2Y5I A;  1GJY A;  4HRG A;  2H8V A;  4A4B A;  3PFV A;  4DIR A;  2L2E A;  3I5G B;  1A75 B;  1YRT B;  2DOQ A;  2WOR A;  4NQG A;  1JC2 A;  4GNK B;  2BL0 B;  1QTX A;  4OV2 A;  1SL7 A;  2EGD A;  4PE4 A;  1XK4 C;  1Y1X A;  1IH0 A;  1DEK A;  1B47 A;  1BJF A;  1MWN A;  2H2K A;  2LAP A;  3S0G A;  1J7O A;  3CYZ A;  1IWQ A;  1TTX A;  1QIW A;  1ALW A;  1KK8 C;  2PQL A;  4INW A;  1QLS A;  1YTZ C;  1SMG A;  5FI2 A;  3EVV A;  1H4B A;  1B7T Z;  1C7W A;  3LLE A;  1JFK A;  2KYC A;  2K61 A;  2F2O A;  3O6B A;  1KSO A;  5JOL A;  2BCB A;  2ERB A;  3EVR A;  1SW8 A;  5HYD A;  1F4O A;  1CMF A;  3S0E A;  1K2H A;  2NCP A;  3TUY B;  3JTD B;  1OOG A;  1XVJ A;  3DXL A;  3D0Y A;  2JTT A;  1QV0 A;  5CSN A;  3RM1 A;  2CTN A;  1H8B A;  2KI4 B;  2NXQ A;  4GPL B;  2L2C A;  1Y1U A;  3NSK A;  4XJK B;  3EKJ A;  1S5G Y;  2JC2 A;  2NLN A;  3WHT B;  1DJI A;  3OX5 A;  1OQP A;  1REC A;  1K9P A;  1QAT A;  3BQ3 A;  2KQY A;  1CLB A;  2BNX A;  2LE9 B;  2FCD A;  4YGA A;  3WNX B;  2OTG C;  1SCV A;  2WCL A;  1K8U A;  3B7A A;  2F3Y A;  1CDP A;  3PM8 A;  3O78 A;  2EHB A;  3BOW A;  3D0Y B;  3SS3 A;  4OR9 B;  1KWO C;  1B9A A;  3TDZ A;  1PVB A;  4N5X A;  1TCF A;  3M0W A;  1OSA A;  1UHJ A;  3E3R A;  1S6I A;  4GGF A;  2RGI A;  4YGC B;  4C0K A;  1UP5 A;  2KPH A;  1EXR A;  1MHO A;  2I18 A;  3DVJ A;  1G33 A;  1NCZ A;  2L4H A;  4WQ2 A;  5G08 A;  3DVK A;  2L4I A;  4QJ5 B;  3ZWH A;  3TDI A;  3UO9 A;  2O5G A;  1MUX A;  3KF9 A;  2VRG A;  1K94 A;  3S0A A;  1RRO A;  1RTP 1;  1ZUZ A;  1L2O B;  3A8R A;  1GM0 A;  2HF5 A;  2P70 A;  1AUI B;  1S26 D;  2BL0 C;  2I7A A;  1K95 A;  3BOW B;  3PLF B;  1SL9 A;  1TNP A;  4ORB B;  4TNC A;  5KTY A;  2Y1N A;  4JPZ B;  2K2A A;  3FE9 A;  2PMY A;  4BY5 A;  3JVT B;  3S0D A;  2F8P A;  2SAS A;  2QAC A;  3PAT A;  1IQ3 A;  5D69 A;  2JWW A;  2AAO A;  3QME A;  1FPW A;  1CFF A;  1M46 A;  1E8A A;  4YI9 A;  5FI6 A;  1PK0 D;  3B6X A;  2OPO A;  4F0Z B;  5I2L A;  1KFX S;  2BBM A;  1SR6 B;  5I8N A;  2PVB A;  4PE1 A;  3DVM A;  2QEB A;  1NX0 A;  1NCY A;  2LC5 A;  2YGU A;  1QWV A;  2SCP A;  1DVI A;  3A4U B;  3LK1 A;  3B86 A;  1B8L A;  4MZL A;  1DMO A;  3TUY C;  1J55 A;  1M39 A;  1XFV O;  3OB2 B;  3JTD C;  3L47 A;  3PAL A;  3D10 A;  3I5H B;  2KBM A;  2M49 B;  2ZN8 A;  4JKT A;  3PSR A;  1OOH A;  2WCH A;  3L4L A;  3R1V A;  1GGW A;  3D78 A;  1K93 D;  1HT9 A;  2M8U A;  2MAZ A;  2PSR A;  1B1G A;  1CNP A;  2M9G A;  1KQV A;  1OE9 B;  2KI4 C;  1EL4 A;  1GQM A;  2ZNE A;  1V1G A;  3F45 A;  1RFJ A;  5TNC A;  1EG4 A;  1Z2C B;  1R6P A;  2ZN9 A;  2JUL A;  4QJ3 B;  1LKJ A;  3SG4 A;  1C7V A;  2KYF A;  3R1O A;  3TS5 B;  4PHM A;  1BLQ A;  1TWO A;  1QJT A;  1XFY O;  2BE4 A;  4GGN A;  1JF2 A;  1IG5 A;  2MRD A;  2M1U A;  2BCA A;  2KSP A;  5ER4 X;  3BFB A;  4PT1 A;  3BUM B;  3SG6 A;  5CSI A;  1QX2 A;  3VRQ A;  5AEQ A;  1BMO A;  1UWO A;  1EJ3 A;  1UHI A;  1SK6 D;  2KI6 C;  4USL A;  2KGB C;  2B1U A;  2CNP A;  1SKT A;  2HET A;  2K7B A;  2K8M B;  1WDC B;  2EC6 C;  2AMI A;  1CDM A;  2WCJ A;  4I5N B;  3AKA A;  1OW4 A;  1A2X A;  1QV1 A;  2WOS A;  1FI5 A;  3FS7 A;  4PAL A;  2L5Y A;  1IJ6 A;  1KK7 Z;  1RJV A;  1M31 A;  3WXA A;  1SBJ A;  4HSZ A;  1ORG A;  1NPQ A;  1MR8 A;  2KAY A;  4IL1 A;  1YR5 A;  3OP0 A;  2ISD A;  1HQV A;  3DYE A;  2L5X B;  4MVF A;  3BUX B;  3CAB A;  2NZ0 A;  5DKQ A;  1WRZ A;  5HKW A;  3VRO A;  1DGV A;  1PSB A;  1QAS A;  1LIN A;  4F7F A;  1CLM A;  1OOJ A;  3CTN A;  1NP8 A;  1D1O A;  5DKN A;  1DJG A;  1ALV A;  3Q8I A;  3VGO A;  1C07 A;  1JUO A;  2K7C A;  2LVJ A;  2GTE A;  2M0R A;  3ICB A;  1YX7 A;  1S6C A;  2LUC A;  5BPJ A;  1IRJ A;  1CLL A;  1S36 A;  3DVE A;  5PAL A;  1U5I A;  3GOF A;  4MRY A;  3SG5 A;  4AQI A;  2BKH B;  3DZT A;  2P6B B;  2FJU B;  1NWD A;  1UHH A;  3HX4 A;  4FTG A;  3SJS A;  2PYQ A;  1DF0 A;  5I2O A;  2GV5 A;  2JPO A;  3I5H C;  4ICB A;  1F71 A;  1UHK A;  5I2Q A;  2JNX A;  1KQM C;  1WRK A;  3HCM A;  1QXP A;  3IQO A;  2Y4Q A;  2WCM A;  1BU3 A;  1AP4 A;  1ODB A;  3NSI A;  4D1E A;  3OHM B;  3SG2 A;  1QVI Y;  1W7I B;  3H4S E;  2M97 A;  1CM1 A;  2LNK A;  1AHR A;  1BG1 A;  3CWG A;  2WC8 A;  5AAN A;  1IJ5 A;  2JTZ A;  1LA3 A;  3EVU A;  4MN0 A;  1U5I B;  2Q91 A;  1XK4 A;  3IF7 A;  2E30 A;  3TS5 C;  4JQ0 D;  1N65 A;  1PRW A;  4OCI A;  4KYN A;  1S3P A;  1CDL A;  1RWY A;  1SRA A;  1NSH A;  2BCX A;  2CBL A;  3AAJ A;  1JWD A;  3I5I B;  4ZCU A;  1BF5 A;  1DF0 B;  1TNW A;  4NDD A;  1WLZ A;  2I2R E;  1K96 A;  1PUL A;  3EK4 A;  1BR4 B;  4YI8 A;  3EK8 A;  2QEO A;  2I94 A;  2LMV A;  3SIA A;  1WDC C;  3I5G C;  1YUU A;  1M63 B;  2GGZ A;  2KAX A;  3LCP C;  3LL8 B;  4R1E A;  3EK7 A;  2KQ6 A;  1PSR A;  1YVH A;  1CFP A;  1FF1 A;  4PHN A;  1G8I A;  3BUO B;  3DY9 A;  4M2O A;  5AXI A;  2MLF C;  2WCE A;  2BKI B;  1K9K A;  2KAV A;  2LLU A;  3CGA A;  3OX6 A;  4MEW A;  4CFQ A;  1TCO B;  1B7T Y;  2ZKM X;  4N1F A;  2HQW A;  1KFX L;  4NDB A;  1TRF A;  1TUJ A;  1MXL C;  1AK8 A;  5KU1 A;  3SIB A;  3BUN B;  1KK8 B;  1OMD A;  4I5K A;  5DKR A;  2LV7 A;  5CSJ A;  1N0Y A;  2WCF A;  4E68 A;  1JSA A;  1FW4 A;  2JPT A;  1XFX O;  5CSF A;  1WRL A;  4GUK A;  4P2Y B;  1LA0 A;  3FIA A;  3VB1 A;  1B8C A;  2FJY A;  1RK9 A;  2WCK A;  1TN4 A;  4HRE E;  3BYA A;  5AER A;  2KFH A;  1OZS A;  4DCK A;  2LVI A;  2HPS A;  4JD9 A;  1S1E A;  1AVS A;  3IQQ A;  3PJI A;  3I5F B;  2A4J A;  3S0B A;  2ZFD A;  1IGV A;  3B88 A;  1A03 A;  1J7P A;  1QX7 A;  3KPX A;  3BXK A;  2K2F A;  1KCY A;  2MA2 A;  3CZ2 A;  1CKK A;  2LCP A;  2LMT A;  1NUB A;  3FE6 A;  2GGM A;  1S5G Z;  4FQO A;  1SCM B;  2QPT A;  2LVK A;  1GGZ A;  4ZCV A;  1CB1 A;  4I5J A;  1TNQ A;  2OTG B;  2LP2 A;  1CFD A;  4AOM A;  2AUC A;  3GK4 X;  1P28 A;  1KFU S;  3KHE A;  1AJ4 A;  3CR5 X;  1C3Z A;  4YBH B;  1IIO A;  1L7Z A;  2JXC A;  1A75 A;  1OMV A; 
#chains in the Genus database with same CATH homology
 2M7L A;  2M1K B;  3GK2 A;  2PAL A;  1EH2 A;  1IQ5 A;  2FOT A;  1QVI Z;  1YUR A;  1MF8 B;  1XFZ O;  2JU0 A;  3CLN A;  1TOP A;  1UUS A;  5KSZ A;  4MLW A;  1F4Q A;  1IKU A;  2PAS A;  1ZFS A;  1OMR A;  1EG3 A;  2L51 A;  2L98 A;  2R2I A;  1J7Q A;  4C0J A;  1SPY A;  1A4P A;  2L0P A;  1WY9 A;  3O4Y A;  4PE0 A;  2PRU A;  5AFP A;  1F8H A;  2BBN A;  1L2O C;  3BUW B;  1ZAC A;  3KEV A;  1CDN A;  4MSP A;  2ZRT A;  1LVC D;  1CMG A;  1K90 D;  1Y1A A;  1ZOT B;  4WRI A;  4C0L A;  3JVT C;  2Y1M A;  4M2Q A;  1DJZ A;  2JXL A;  1QX5 B;  2MHH A;  3O2P A;  1DGU A;  2TN4 A;  1NX1 A;  1J1E A;  2KFF A;  4GGF C;  2H61 A;  3PN7 B;  1Y6W A;  4XJK A;  4A4C A;  5HKY A;  1MXE A;  2F33 A;  5HKZ A;  2COL B;  5F6T A;  2LP3 A;  1SR6 C;  1YX8 A;  4PHK A;  4GBA A;  5GQQ C;  1JFJ A;  4YGE B;  4CPV A;  1F70 A;  3WHU B;  1J7R A;  1WLM A;  3FWB A;  2K7D A;  3CR4 X;  3FWC A;  1SNL A;  1BOC A;  2JRF A;  4JWQ A;  3K21 A;  3RLZ A;  2K0J A;  5CPV A;  5IBW A;  3I5F C;  3DF0 A;  3QRX A;  1DJX A;  2M7N A;  4OVN F;  2G2B A;  2F2P A;  3DD4 A;  2OS8 B;  3TZ1 A;  2HQ8 A;  4BY4 A;  4GFT A;  2LAN A;  4M2P A;  1Y0V H;  1DTL A;  4NDC A;  5HLV A;  4AQJ A;  1Q80 A;  5JJG A;  1NX2 A;  1SL8 A;  4DRW A;  1SCM C;  2JQ6 A;  1DJY A;  1TNX A;  4HRH A;  4WQ3 A;  1NCX A;  1XFU O;  5B8I B;  3TDU A;  4PCW A;  1BR1 B;  2LHL A;  1TIZ A;  4YGB B;  4Q04 A;  1QLK A;  3CZT X;  1NYA A;  3NXA A;  2D8N A;  3AAK A;  2E6W A;  2WND A;  5J3X A;  2MLE C;  3VRR A;  3OB1 B;  1DT7 B;  5HLO A;  1F55 A;  5FYX A;  3CR2 A;  3DF0 B;  1DJH A;  2KFG A;  2BE6 A;  1W7J B;  2CCM A;  1KK7 Y;  4GAO A;  2EC6 B;  2KHN A;  2LM5 A;  3KO0 A;  4PDZ A;  3VRP A;  3AKB A;  1QIV A;  1B8R A;  2KI6 D;  1JBA A;  2O60 A;  2JT0 A;  3VRN A;  1X02 A;  2CT9 A;  3EKH A;  4MRX A;  3ZNI A;  2LLS A;  2JZI A;  4P5O E;  1BOD A;  1N2D A;  2CXJ A;  1FI6 A;  1OZO A;  3NSO A;  1XFW O;  1SY9 A;  1SYM A;  4I5L B;  4YRU A;  4MZK A;  3GK1 A;  1UHN A;  2JT8 A;  4MBE A;  2KDH A;  1CTR A;  1DJW A;  1VRK A;  2MJW B;  3MSE B;  3PN7 C;  4PHJ A;  4N1G A;  4ORC B;  1PAL A;  2KGR A;  1F54 A;  1NX3 A;  2WCB A;  2LMU A;  1CFC A;  2JOJ A;  2G9B A;  2IS9 A;  4U8D A;  4ETO A;  3NSL A;  1QS7 A;  5D7F A;  1V1F A;  1CM4 A;  1JF0 A;  1M45 A;  4QJ4 B;  2Q4U A;  4OKH A;  2ZRS A;  1NIW A;  5K89 A;  2KBI A;  2LLT A;  3C1V A;  2KNE A;  4DS7 A;  1YRU B;  1KFU L;  1KQM B;  4CLN A;  2NCO A;  2MBX A;  1XYD A;  2V53 A;  4L9M A;  4YGD B;  1ZMZ A;  1MQ1 A;  2M29 A;  4CFR A;  2H61 C;  1YVL A;  2LUX A;  2OS8 C;  2F3Z A;  4DUQ A;  1YUS A;  1S6J A;  1XA5 A;  3SG3 A;  1B4C A;  1KWO B;  2ZND A;  2LVV A;  1FBV A;  2K7O A;  2M3W A;  1K9U A;  2JNF A;  2FCE A;  1YUT A;  1G4Y R;  1KSM A;  4ORA B;  3CS1 A;  3I5I C;  4XYN A;  4PE7 A;  3LK0 A;  2KOT A;  2JT3 A;  2BEC A;  2LHI A;  3SG7 A;  1AJ5 A;  2L50 A;  1R2U A;  1LXF C;  1J1D A;  5ER5 A;  4CID A;  1UUR A;  4MZJ A;  1XO5 A;  4UPG A;  1A29 A;  1BT6 A;  1PVA A;  2Y5I A;  1GJY A;  4HRG A;  4A4B A;  3PFV A;  4DIR A;  2L2E A;  3I5G B;  1A75 B;  1YRT B;  2DOQ A;  2WOR A;  4NQG A;  1JC2 A;  4GNK B;  2BL0 B;  1QTX A;  4OV2 A;  1SL7 A;  2EGD A;  4PE4 A;  1XK4 C;  1Y1X A;  1IH0 A;  2H2K A;  1B47 A;  1BJF A;  1MWN A;  2LAP A;  1J7O A;  1IWQ A;  1TTX A;  1QIW A;  1ALW A;  1KK8 C;  1QLS A;  1YTZ C;  1SMG A;  3EVV A;  1H4B A;  1B7T Z;  1C7W A;  3LLE A;  1JFK A;  2KYC A;  2K61 A;  2F2O A;  3O6B A;  1KSO A;  5JOL A;  2BCB A;  3EVR A;  5HYD A;  1SW8 A;  1CMF A;  1F4O A;  1K2H A;  2NCP A;  3TUY B;  3JTD B;  1XVJ A;  3D0Y A;  2JTT A;  1QV0 A;  5CSN A;  3RM1 A;  2CTN A;  1H8B A;  2KI4 B;  2NXQ A;  4GPL B;  1Y1U A;  3NSK A;  4XJK B;  3EKJ A;  1S5G Y;  2JC2 A;  2NLN A;  3WHT B;  1DJI A;  3OX5 A;  1OQP A;  1REC A;  1K9P A;  1QAT A;  3BQ3 A;  2KQY A;  1CLB A;  2LE9 B;  2FCD A;  4YGA A;  3WNX B;  2OTG C;  1SCV A;  1K8U A;  2F3Y A;  1CDP A;  3PM8 A;  3O78 A;  2EHB A;  3BOW A;  3D0Y B;  4OR9 B;  1KWO C;  1B9A A;  3TDZ A;  1PVB A;  4N5X A;  1TCF A;  3M0W A;  1OSA A;  1UHJ A;  3E3R A;  1S6I A;  4GGF A;  2RGI A;  4YGC B;  4C0K A;  1UP5 A;  1EXR A;  1MHO A;  2I18 A;  3DVJ A;  1G33 A;  1NCZ A;  2L4H A;  4WQ2 A;  5G08 A;  3DVK A;  2L4I A;  4QJ5 B;  3ZWH A;  3TDI A;  2O5G A;  1MUX A;  3KF9 A;  2VRG A;  1K94 A;  1RRO A;  1RTP 1;  1ZUZ A;  1L2O B;  3A8R A;  2HF5 A;  1AUI B;  1S26 D;  2BL0 C;  2I7A A;  1K95 A;  3BOW B;  3PLF B;  1SL9 A;  1TNP A;  4ORB B;  4TNC A;  5KTY A;  2Y1N A;  4JPZ B;  2K2A A;  4BY5 A;  2PMY A;  3JVT B;  2F8P A;  2SAS A;  2QAC A;  3PAT A;  1IQ3 A;  5D69 A;  2JWW A;  2AAO A;  1FPW A;  1CFF A;  1M46 A;  1E8A A;  4YI9 A;  4F0Z B;  1PK0 D;  2OPO A;  5I2L A;  1KFX S;  2BBM A;  1SR6 B;  5I8N A;  2PVB A;  4PE1 A;  3DVM A;  1NX0 A;  1NCY A;  2LC5 A;  2SCP A;  1DVI A;  3A4U B;  3LK1 A;  4MZL A;  1B8L A;  1DMO A;  3TUY C;  1J55 A;  1M39 A;  1XFV O;  3OB2 B;  3JTD C;  3PAL A;  3D10 A;  3I5H B;  2KBM A;  2M49 B;  2ZN8 A;  1GGW A;  3PSR A;  1K93 D;  1HT9 A;  2M8U A;  2MAZ A;  2PSR A;  1B1G A;  1CNP A;  2M9G A;  1KQV A;  1OE9 B;  2KI4 C;  1EL4 A;  1GQM A;  2ZNE A;  1V1G A;  3F45 A;  1RFJ A;  5TNC A;  1EG4 A;  1R6P A;  2ZN9 A;  2JUL A;  4QJ3 B;  1LKJ A;  3SG4 A;  1C7V A;  2KYF A;  3TS5 B;  4PHM A;  1BLQ A;  2BE4 A;  1QJT A;  1XFY O;  4GGN A;  1JF2 A;  1IG5 A;  2MRD A;  2M1U A;  2BCA A;  2KSP A;  5ER4 X;  3BUM B;  3SG6 A;  5CSI A;  1QX2 A;  3VRQ A;  5AEQ A;  1BMO A;  1UWO A;  1EJ3 A;  1UHI A;  1SK6 D;  2KI6 C;  4USL A;  2KGB C;  2B1U A;  2CNP A;  1SKT A;  2HET A;  2K7B A;  2K8M B;  1WDC B;  2EC6 C;  2AMI A;  1CDM A;  4I5N B;  3AKA A;  1A2X A;  1QV1 A;  2WOS A;  1FI5 A;  3FS7 A;  4PAL A;  1IJ6 A;  1KK7 Z;  1RJV A;  1M31 A;  3WXA A;  1SBJ A;  4HSZ A;  1NPQ A;  1MR8 A;  2KAY A;  4IL1 A;  1YR5 A;  3OP0 A;  2ISD A;  1HQV A;  2L5X B;  4MVF A;  3BUX B;  2NZ0 A;  5DKQ A;  1WRZ A;  5HKW A;  3VRO A;  1DGV A;  1PSB A;  1QAS A;  1LIN A;  1CLM A;  1OOJ A;  3CTN A;  1NP8 A;  1D1O A;  5DKN A;  1DJG A;  1ALV A;  3VGO A;  1C07 A;  1JUO A;  2K7C A;  2LVJ A;  2M0R A;  3ICB A;  1YX7 A;  1S6C A;  2LUC A;  5BPJ A;  1IRJ A;  1CLL A;  1S36 A;  3DVE A;  5PAL A;  1U5I A;  3GOF A;  4MRY A;  3SG5 A;  4AQI A;  2BKH B;  2P6B B;  2FJU B;  1NWD A;  1UHH A;  3HX4 A;  4FTG A;  3SJS A;  1DF0 A;  5I2O A;  2GV5 A;  3I5H C;  4ICB A;  1F71 A;  1UHK A;  5I2Q A;  2JNX A;  1KQM C;  1WRK A;  3HCM A;  1QXP A;  3IQO A;  2Y4Q A;  1BU3 A;  1AP4 A;  1ODB A;  3NSI A;  4D1E A;  3OHM B;  3SG2 A;  1QVI Y;  1W7I B;  3H4S E;  2M97 A;  1CM1 A;  2LNK A;  1AHR A;  1BG1 A;  3CWG A;  2WC8 A;  5AAN A;  1IJ5 A;  2JTZ A;  1LA3 A;  3EVU A;  4MN0 A;  1U5I B;  2Q91 A;  1XK4 A;  3IF7 A;  2E30 A;  3TS5 C;  4JQ0 D;  1N65 A;  1PRW A;  4OCI A;  1S3P A;  1CDL A;  1RWY A;  1SRA A;  1NSH A;  2BCX A;  2CBL A;  3AAJ A;  1JWD A;  3I5I B;  4ZCU A;  1BF5 A;  1DF0 B;  1TNW A;  4NDD A;  1WLZ A;  2I2R E;  1K96 A;  1PUL A;  3EK4 A;  1BR4 B;  4YI8 A;  3EK8 A;  2I94 A;  2LMV A;  3SIA A;  1WDC C;  3I5G C;  1YUU A;  1M63 B;  2GGZ A;  2KAX A;  3LCP C;  3LL8 B;  4R1E A;  3EK7 A;  2KQ6 A;  1PSR A;  1YVH A;  1CFP A;  1FF1 A;  4PHN A;  1G8I A;  3BUO B;  4M2O A;  5AXI A;  2MLF C;  2WCE A;  2BKI B;  1K9K A;  2KAV A;  2LLU A;  3CGA A;  3OX6 A;  4MEW A;  4CFQ A;  1TCO B;  1B7T Y;  2ZKM X;  4N1F A;  2HQW A;  1KFX L;  4NDB A;  1TRF A;  1MXL C;  1AK8 A;  5KU1 A;  3SIB A;  3BUN B;  1KK8 B;  1OMD A;  4I5K A;  5DKR A;  2LV7 A;  5CSJ A;  1N0Y A;  2WCF A;  4E68 A;  1JSA A;  1FW4 A;  2JPT A;  1XFX O;  5CSF A;  1WRL A;  4GUK A;  4P2Y B;  1LA0 A;  3FIA A;  1B8C A;  4HRE E;  1RK9 A;  5AER A;  1TN4 A;  3BYA A;  2KFH A;  1OZS A;  4DCK A;  2LVI A;  2HPS A;  1S1E A;  1AVS A;  3IQQ A;  3I5F B;  2A4J A;  2ZFD A;  1IGV A;  1A03 A;  1J7P A;  1QX7 A;  3KPX A;  3BXK A;  2K2F A;  1KCY A;  2MA2 A;  1CKK A;  2LCP A;  2LMT A;  1NUB A;  2GGM A;  1S5G Z;  4FQO A;  1SCM B;  2QPT A;  2LVK A;  1GGZ A;  4ZCV A;  1CB1 A;  4I5J A;  1TNQ A;  2OTG B;  2LP2 A;  1CFD A;  4AOM A;  2AUC A;  3GK4 X;  3KHE A;  1KFU S;  1AJ4 A;  3CR5 X;  4YBH B;  1L7Z A;  2JXC A;  1A75 A;  1OMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...