1KSOA

Crystal structure of apo s100a3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 CALCIUM-BINDING PROTEIN A3
publication title Metal-free MIRAS phasing: structure of apo-S100A3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ksoA00
3AKAA 1K93D 2F2PA 2WCEA 3WXAA 2HPSA 3SIAA 2OS8C 1CLBA 2KGBC 5CPVA 1OE9B 3BUMB 1BMOA 1MQ1A 2LLSA 5I2OA 1SCVA 4P2YB 2VRGA 1AVSA 2RGIA 4QJ5B 2ZRSA 1UUSA 5CSNA 1NWDA 1FW4A 2L4IA 1DVIA 2FJUB 1S6IA 2BKIB 4IL1A 4MZJA 1K9PA 5ER4X 5AERA 2L2EA 1KWOB 1HT9A 2KI4C 3H4SE 2JT3A 1S6JA 2F2OA 1WY9A 1KWOC 5HLVA 1TNPA 1U5IB 2KSPA 1TIZA 3SG4A 4WQ3A 1JFJA 4PALA 5AANA 1SYMA 4BY4A 2M9GA 3HCMA 1K95A 1W7IB 2GV5A 1IQ5A 4GFTA 5K89A 1XFWO 1DTLA 2ZN8A 3LK0A 4A4BA 1M63B 1BODA 4M2PA 4ZCUA 1LA0A 1Y1XA 4CFRA 1C7VA 2CNPA 4CFQA 1IH0A 3AKBA 1M31A 3PN7C 2K7CA 2O5GA 3NSKA 1OMRA 3VROA 1B4CA 2JC2A 4YGEB 1KCYA 2SASA 4E68A 3DVEA 1AHRA 5I8NA 2EC6B 1KK7Z 2KNEA 2BCXA 3JTDB 2H61C 3DF0B 2WCBA 2FOTA 4MRYA 3BUXB 4N1GA 1LA3A 2I7AA 2NLNA 2PASA 3VGOA 2LVIA 2HQ8A 1DJXA 2K7DA 2JT8A 1IWQA 1YX8A 1DJIA 3I5GB 5KU1A 1WRLA 1JSAA 4MVFA 4F0ZB 1M46A 3PSRA 3OP0A 1SBJA 1L2OB 4GBAA 1KQMB 1U5IA 1J55A 4GGFC 4M2OA 4PHMA 1V1FA 1NX2A 1L2OC 2JXLA 1TN4A 3E3RA 1L7ZA 5B8IB 2K2AA 5IBWA 2KAVA 2LMTA 1S1EA 4DUQA 4PE0A 2LCPA 5JOLA 2PMYA 3K21A 2JWWA 4MZLA 4QJ3B 1QX2A 1QX7A 2P6BB 3CS1A 1BLQA 1TNXA 1XO5A 2ZNEA 1MWNA 1B8CA 1TNWA 1GQMA 3BXKA 3FWCA 2JU0A 1S26D 2BL0C 1PRWA 3CGAA 1G33A 3AAJA 4PHNA 2ISDA 3LLEA 2I2RE 3KO0A 1OQPA 1TCFA 1WDCC 2MAZA 4YRUA 3OB1B 2H2KA 2MLFC 3DF0A 3A4UB 1IG5A 1DF0B 2LANA 1DJGA 2BBMA 5PALA 1NX3A 1XK4A 3TDZA 4DCKA 2MJWB 1D1OA 5J3XA 1CFCA 2LE9B 4L9MA 1DGVA 1E8AA 1S5GZ 1SL9A 2BKHB 4PHJA 2K0JA 2CXJA 4ETOA 1SMGA 1NYAA 4M2QA 1DMOA 2FCEA 1A03A 1B7TZ 1CFFA 1F8HA 1NUBA 3FIAA 1KK7Y 1QXPA 4YI8A 1NSHA 4JWQA 3EVVA 1EG3A 2L50A 1YVLA 2OS8B 1RJVA 1NCXA 2F3YA 3I5HB 4CLNA 1IJ6A 2TN4A 2R2IA 2Y4QA 1RK9A 4JPZB 1SPYA 5I2QA 1WRZA 3FWBA 1R2UA 3TUYC 1SKTA 1CNPA 3I5HC 4MZKA 2LP2A 3EVRA 1OOJA 3TDIA 4U8DA 4N5XA 2Y1MA 1CDMA 1EJ3A 4YGDB 3PFVA 4HREE 1Y0VH 2KI4B 3OB2B 2KOTA 5JJGA 2HQWA 3MSEB 1ZMZA 1QS7A 4TNCA 2KFFA 2MLEC 2ZKMX 1QIWA 2M3WA 2HETA 4GPLB 3OX5A 2MRDA 2E30A 1JF2A 2OTGC 2DOQA 2LC5A 1MXEA 3EK4A 2WC8A 4I5JA 3WNXB 1KK8B 4MN0A 1X02A 2LUXA 1JF0A 2K7BA 4ORCB 5ER5A 2JTZA 3ZWHA 3SJSA 4AQIA 3BOWB 2KQ6A 1KK8C 2NZ0A 1B9AA 3PM8A 1BT6A 3HX4A 4UPGA 1A75B 1A2XA 1JFKA 1S3PA 1IQ3A 1GJYA 1XA5A 3A8RA 2JZIA 3KPXA 1WRKA 3PN7B 4A4CA 2ZFDA 2JQ6A 4C0KA 1SRAA 4ORAB 1N0YA 1QVIZ 2WNDA 2LV7A 3D0YA 1G8IA 2NXQA 1B1GA 3LL8B 5CSFA 1J1EA 1RECA 1BG1A 1PSRA 1KFUS 1XFVO 4GUKA 1YR5A 4JQ0D 4NDCA 4XYNA 1UHIA 1FI6A 1YVHA 1SR6C 1UHHA 1NX1A 4HRGA 4YGAA 2M1UA 1S36A 1AK8A 2K8MB 5TNCA 2L98A 1XFUO 1BR4B 1B7TY 2KFGA 1CLMA 4I5LB 1FBVA 1K94A 4DS7A 2KGRA 2Y5IA 2G2BA 3O2PA 2ZRTA 5HKWA 1K90D 1JC2A 1K9UA 4DRWA 1SNLA 1YTZC 4PHKA 5AXIA 3VRRA 3CR2A 5AFPA 1Q80A 1N65A 2JRFA 3BOWA 3SG3A 2PALA 1MXLC 3EVUA 1RTP1 3KEVA 3SG6A 2M0RA 1A75A 4I5KA 1LINA 3EK8A 2M8UA 1Y1UA 2KFHA 3WHUB 4Q04A 2BL0B 1RFJA 3DVJA 1KFXS 4USLA 3GOFA 1XYDA 1AP4A 1YRUB 4FTGA 3GK1A 3SG5A 1CDPA 5FYXA 4MRXA 3O78A 4MSPA 1JBAA 1TCOB 1F54A 1WDCB 1NIWA 1A4PA 2M29A 4I5NB 3LK1A 2KBMA 3WHTB 1YUTA 2K61A 5AEQA 4XJKB 1OMVA 4C0JA 3BUOB 3NSIA 1CB1A 1QASA 1IKUA 1XFXO 1F55A 2F8PA 1MF8B 2Q91A 1FI5A 1JWDA 3NSOA 1CMFA 2M1KB 4OR9B 2M7LA 3NSLA 1K96A 1ZACA 5HKYA 2JNFA 2K7OA 4YBHB 3IQOA 1N2DA 1QVIY 1AJ5A 3BQ3A 4GGFA 1DT7B 1F70A 4CPVA 1BR1B 1S6CA 3TZ1A 3CR4X 1KFUL 2CTNA 1CFPA 5I2LA 3EKJA 1DJYA 1DJZA 1HQVA 1FPWA 4R1EA 4NDBA 4GAOA 1MUXA 1V1GA 1NPQA 2BBNA 2JNXA 1LKJA 2V53A 4ZCVA 4WQ2A 1QLSA 1XFYO 2M7NA 1ODBA 2IS9A 2EGDA 4HRHA 1PALA 2E6WA 1SK6D 3TUYB 1G4YR 3SG2A 4CIDA 3DD4A 2LHIA 1W7JB 1OZOA 2LAPA 3ICBA 1RROA 1EH2A 1QX5B 2K2FA 2KDHA 3SIBA 2HF5A 2PVBA 2COLB 1KSOA 1GGWA 2A4JA 2KAYA 1DGUA 4YGBB 3C1VA 2CBLA 1WLMA 1M45A 1PK0D 5HKZA 2LNKA 4XJKA 4DIRA 1EL4A 2LVJA 5HYDA 2KYCA 1EG4A 3SG7A 3ZNIA 1YURA 1PSBA 2JXCA 3KHEA 2KYFA 1SW8A 2OTGB 3I5FB 4D1EA 1DF0A 1H4BA 2WORA 1IGVA 1KFXL 1XVJA 4QJ4B 1MHOA 1R6PA 5D7FA 1J7QA 2Q4UA 1PVBA 5GQQC 3I5FC 1IJ5A 4AOMA 2D8NA 3FS7A 3DVMA 3KF9A 1QV1A 1OMDA 4WRIA 4PCWA 1Y1AA 3O6BA 4PDZA 2L51A 1CFDA 1OSAA 1IRJA 1UHNA 1QV0A 4OCIA 1YUSA 3IF7A 5DKRA 2CT9A 1CDNA 1Y6WA 3CR5X 2AUCA 1TRFA 2KI6C 1CTRA 1CKKA 1AUIB 3TS5B 2LVKA 2B1UA 3GK2A 1SL8A 1SR6B 4ORBB 3TS5C 1GGZA 3F45A 2F33A 2QPTA 2BCBA 2KBIA 2KI6D 2I94A 1S5GY 3PATA 5F6TA 1K8UA 1F71A 5HLOA 2BE4A 3VRPA 1TNQA 1KQVA 2KHNA 3RLZA 1CMGA 1YUUA 4PE1A 2JOJA 1CDLA 1B8LA 5DKQA 4AQJA 1QLKA 3VRNA 4ICBA 1K2HA 1QATA 2F3ZA 3BUNB 2G9BA 3GK4X 2ZN9A 4NDDA 2LM5A 1UURA 2JT0A 3CWGA 2CCMA 1C7WA 4OV2A 1DJWA 4MLWA 5D69A 2FCDA 4PE7A 5KSZA 3CLNA 1QTXA 1J7OA 1UHKA 5G08A 3PLFB 2EC6C 2LLTA 3JTDC 1LXFC 1NP8A 3PALA 1BJFA 2MA2A 2MBXA 1C07A 3QRXA 2BCAA 1CM1A 2SCPA 2ZNDA 4P5OE 1XK4C 2Y1NA 3I5GC 2JTTA 2LP3A 4NQGA 3AAKA 4BY5A 3BYAA 2H61A 1KSMA 1KQMC 2WCFA 1PVAA 1XFZO 1J7RA 1OZSA 1F4QA 1PULA 3LCPC 1BU3A 3DVKA 1RWYA 1UP5A 3OHMB 1QJTA 4GNKB 4MEWA 1YX7A 1FF1A 4FQOA 1LVCD 4PE4A 1CLLA 1NCYA 2NCOA 1H8BA 2GGZA 2QACA 3JVTB 1ZFSA 3RM1A 5CSIA 1EXRA 3O4YA 4YI9A 1ZOTB 1YRTB 2BE6A 3EK7A 3CTNA 1UWOA 1DJHA 3D10A 2NCPA 4OKHA 2M49B 3JVTC 1VRKA 3OX6A 1BOCA 1SCMB 4GGNA 1NCZA 5DKNA 3TDUA 1JUOA 2AAOA 1SL7A 1ALWA 1UHJA 1SCMC 2LUCA 3EKHA 3BUWB 1K9KA 1CM4A 1B8RA 4OVNF 1ZUZA 2LMVA 2EHBA 1B47A 1WLZA 1AJ4A 1J1DA 2I18A 4C0LA 3CZTX 4HSZA 1TTXA 2GGMA 2PRUA 2WOSA 2L0PA 5BPJA 2L4HA 4YGCB 2LVVA 2L5XB 2PSRA 2LMUA 5KTYA 3I5IB 1TOPA 3NXAA 1J7PA 3IQQA 2MHHA 1NX0A 1A29A 1M39A 2KQYA 4N1FA 3VRQA 1MR8A 2BECA 2O60A 3M0WA 5CSJA 2LHLA 2JPTA 2M97A 3I5IC 1BF5A 1QIVA 2JULA 4MBEA 2LLUA 1F4OA 2AMIA 2KAXA 2OPOA 1ALVA 3D0YB 1SY9A
chains in the Genus database with same CATH superfamily
3AKAA 1K93D 2F2PA 2WCEA 3DZTA 3IVTA 3WXAA 2HPSA 3SIAA 2OS8C 1CLBA 2KGBC 5CPVA 1OE9B 3BUMB 1BMOA 1MQ1A 2LLSA 5I2OA 1SCVA 4P2YB 2VRGA 2YGUA 1AVSA 3RZSA 2RGIA 4QJ5B 2ZRSA 1UUSA 5CSNA 1NWDA 1FW4A 2BNXA 2L4IA 3R72A 1DVIA 2FJUB 1S6IA 2BKIB 4IL1A 4MZJA 1K9PA 5ER4X 5AERA 2L2EA 1KWOB 2QDIA 3Q8IA 1HT9A 2KI4C 3H4SE 2JT3A 1S6JA 2F2OA 1WY9A 1KWOC 3DY9A 5HLVA 1TNPA 1U5IB 2KSPA 1TIZA 3SG4A 2GTEA 4WQ3A 4PALA 1JFJA 1C3ZA 5AANA 1SYMA 4BY4A 2M9GA 3HCMA 1OOFA 1K95A 1W7IB 3D75A 2GV5A 3B86A 1OOGA 1IQ5A 4GFTA 3L4AA 5K89A 3FE8A 1XFWO 1DTLA 2ZN8A 3LK0A 4A4BA 1M63B 3B7AA 1BODA 4M2PA 4ZCUA 1LA0A 1Y1XA 4CFRA 1C7VA 3S0BA 2CNPA 4CFQA 1IH0A 3AKBA 1M31A 3PN7C 2K7CA 2O5GA 3NSKA 1OMRA 3VROA 1B4CA 2JC2A 2QEBA 4YGEB 3CDNA 3B6XA 2SASA 1KCYA 4E68A 5HL1A 3DVEA 1AHRA 5I8NA 2EC6B 1KK7Z 2KNEA 2BCXA 2WCJA 3JTDB 2H61C 3DF0B 4INXA 2WCBA 2FOTA 4MRYA 3BUXB 4N1GA 1LA3A 2I7AA 2NLNA 2PASA 3FE9A 3VGOA 2LVIA 2HQ8A 1DJXA 2K7DA 2JT8A 1IWQA 1YX8A 1DJIA 3I5GB 5KU1A 2QEHA 1WRLA 1JSAA 4MVFA 4F0ZB 1M46A 3PSRA 3OP0A 1SBJA 1L2OB 3NHTA 4GBAA 1KQMB 1U5IA 1QWVA 1J55A 4GGFC 4M2OA 3B87A 4PHMA 1V1FA 1NX2A 1L2OC 2JXLA 1TN4A 3E3RA 3N7HA 4OZDA 1L7ZA 5B8IB 2K2AA 2H8VA 5IBWA 2KAVA 2LMTA 1S1EA 4DUQA 4PE0A 1T14A 2LCPA 5JOLA 2PMYA 3K21A 2JWWA 3CABA 3D77A 4MZLA 4QJ3B 1QX2A 1QX7A 2P6BB 3CS1A 3SS3A 1BLQA 1TNXA 1XO5A 1Z2CB 2ZNEA 1MWNA 1B8CA 1TNWA 1GQMA 3BXKA 3FWCA 2JU0A 1S26D 2BL0C 1PRWA 3CGAA 1G33A 3AAJA 4PHNA 2ISDA 3LLEA 2I2RE 3KO0A 1OQPA 1TCFA 1WDCC 2MAZA 4YRUA 3OB1B 2H2KA 4KYNA 2MLFC 3DF0A 3A4UB 1IG5A 5EL2A 1DF0B 2LANA 1DJGA 2BBMA 5PALA 1NX3A 1XK4A 3TDZA 4DCKA 2MJWB 1D1OA 5J3XA 1CFCA 2LE9B 4L9MA 1DGVA 1E8AA 1S5GZ 1SL9A 2BKHB 4PHJA 2K0JA 2CXJA 4ETOA 1SMGA 1NYAA 4M2QA 1DMOA 2FCEA 3S0DA 1B7TZ 1A03A 1CFFA 1F8HA 3BFAA 1NUBA 3UNWA 3FIAA 3EG5B 1KK7Y 1QXPA 4YI8A 1NSHA 3S0EA 4JWQA 1DQEA 3DXLA 3EVVA 1EG3A 2L50A 1YVLA 2OS8B 1RJVA 2QEOA 1NCXA 2F3YA 3I5HB 4CLNA 1IJ6A 2TN4A 2KLDA 2R2IA 2Y4QA 1RK9A 4JPZB 1SPYA 1LS8A 1WRZA 3FWBA 5I2QA 1R2UA 3TUYC 1SKTA 1CNPA 3I5HC 4MZKA 2LP2A 3EVRA 1OOJA 3TDIA 3CZ0A 4U8DA 4N5XA 2Y1MA 1CDMA 1EJ3A 1TUZA 4YGDB 3BFHA 3PFVA 3DYEA 4HREE 1Y0VH 2KI4B 3OB2B 2KOTA 5JJGA 2HQWA 1ORGA 3OGNA 3MSEB 1ZMZA 1QS7A 4TNCA 2KFFA 2MLEC 2ZKMX 1QIWA 3NGVA 2M3WA 2HETA 2JPOA 4GPLB 3OX5A 2MRDA 2E30A 3OBVA 5DICA 1JF2A 2OTGC 2DOQA 2LC5A 1MXEA 3EK4A 2WC8A 4I5JA 3WNXB 1KK8B 2WC6A 1IIOA 4MN0A 1X02A 4F7FA 2LUXA 1JF0A 2K7BA 4ORCB 5ER5A 2JTZA 3ZWHA 3SJSA 4AQIA 3BOWB 2KQ6A 1KK8C 2NZ0A 2P70A 1B9AA 3PM8A 1BT6A 3HX4A 4UPGA 1A75B 1A2XA 1JFKA 1S3PA 3VB1A 1IQ3A 1GJYA 1XA5A 3A8RA 2JZIA 3KPXA 1WRKA 3PN7B 4A4CA 2ZFDA 2JQ6A 4C0KA 5I94A 1SRAA 2WCHA 4ORAB 1N0YA 1QVIZ 2WNDA 2LV7A 3D0YA 1G8IA 2NXQA 3D73A 1B1GA 3LL8B 5CSFA 1J1EA 1RECA 2P71A 1BG1A 1PSRA 1KFUS 1XFVO 3CZ1A 1YR5A 4GUKA 1C3YA 4JQ0D 4NDCA 4XYNA 1UHIA 2L2CA 4JKTA 3UO9A 1GM0A 1DEKA 1FI6A 1YVHA 1SR6C 1UHHA 1NX1A 4HRGA 4YGAA 2M1UA 1S36A 1AK8A 2K8MB 5TNCA 2L98A 1XFUO 1BR4B 1B7TY 2KFGA 1CLMA 4I5LB 1FBVA 1K94A 4DS7A 2KGRA 2Y5IA 2G2BA 1W9ZA 3O2PA 2ZRTA 5HKWA 1K90D 1JC2A 1K9UA 1XFRA 2WCMA 1SNLA 1YTZC 2WCKA 4PHKA 5AXIA 3CR2A 3VRRA 5AFPA 1Q80A 1N65A 2JRFA 5FI2A 3PJIA 3BOWA 3FE6A 2PALA 3SG3A 1MXLC 3EVUA 1RTP1 3KEVA 3SG6A 2M0RA 1A75A 4I5KA 1LINA 3EK8A 2M8UA 1Y1UA 2KFHA 3CZ2A 3WHUB 2L5YA 4Q04A 3NHIA 2BL0B 1RFJA 5D3OA 4FQTA 3DVJA 1KFXS 4USLA 3GOFA 1XYDA 1AP4A 1YRUB 4FTGA 4DRWA 3GK1A 3SG5A 1CDPA 5FYXA 4MRXA 3O78A 4MSPA 1JBAA 1TCOB 1F54A 1WDCB 1NIWA 1A4PA 2M29A 4I5NB 3LK1A 2KBMA 3WHTB 1YUTA 1Z4HA 2K61A 4XJKB 5AEQA 1OMVA 3D74A 4C0JA 3BUOB 3NSIA 1CB1A 1QASA 1IKUA 1DELA 1XFXO 1F55A 2F8PA 1MF8B 2Q91A 1FI5A 2PQLA 3NSOA 1CMFA 1JWDA 2M1KB 4OR9B 3R1VA 2M7LA 3NSLA 1K96A 1ZACA 5HKYA 2JNFA 2K7OA 4YBHB 3IQOA 1N2DA 4INWA 1QVIY 1AJ5A 3BQ3A 4GGFA 1DT7B 1F70A 4PT1A 4CPVA 1BR1B 1S6CA 3O4XA 3CR4X 1KFUL 3TZ1A 2KPHA 1OOIX 2CTNA 1CFPA 5I2LA 3EKJA 1DJYA 1DJZA 1HQVA 1FPWA 4R1EA 3L47A 4NDBA 4GAOA 1MUXA 1V1GA 1NPQA 2BBNA 2FJYA 1LKJA 2JNXA 2V53A 4ZCVA 4WQ2A 1QLSA 1XFYO 2M7NA 1ODBA 2IS9A 2EGDA 4HRHA 1PALA 2E6WA 3R1PA 1SK6D 3TUYB 1G4YR 3SG2A 3S0GA 4IJ7A 3DD4A 4CIDA 2LHIA 1W7JB 1OZOA 2LAPA 3D76A 3QMEA 3ICBA 1RROA 1EH2A 1QX5B 2K2FA 2KDHA 3SIBA 2HF5A 3L4LA 2PVBA 2COLB 1KSOA 1GGWA 2A4JA 2KAYA 1DGUA 4YGBB 3C1VA 2CBLA 1WLMA 1M45A 1PK0D 5HKZA 2LNKA 4XJKA 4DIRA 1EL4A 2LVJA 5HYDA 2KYCA 1EG4A 3SG7A 3ZNIA 1YURA 1PSBA 2JXCA 3KHEA 2KYFA 1SW8A 2OTGB 3I5FB 1TUJA 4D1EA 1DF0A 1H4BA 2WORA 1IGVA 1KFXL 1XVJA 4QJ4B 1MHOA 1R6PA 5D7FA 1J7QA 2K60A 2Q4UA 1PVBA 5GQQC 3I5FC 1IJ5A 4AOMA 2D8NA 5FI7A 3FS7A 3DVMA 3KF9A 1QV1A 1OMDA 4WRIA 4PCWA 1Y1AA 3O6BA 4PDZA 2L51A 1CFDA 3BJHA 1OSAA 1IRJA 1UHNA 1QV0A 4OCIA 1YUSA 3IF7A 5DKRA 2CT9A 1CDNA 1Y6WA 3CR5X 2AUCA 1TRFA 2KI6C 2WC5A 1CTRA 1CKKA 1AUIB 3TS5B 2LVKA 2B1UA 3GK2A 1SL8A 1SR6B 4ORBB 3TS5C 1GGZA 3F45A 2ERBA 2F33A 2QPTA 2BCBA 2KBIA 2KI6D 2I94A 1S5GY 3PATA 5F6TA 1K8UA 1F71A 5HLOA 3PM2A 3SS5A 2BE4A 3VRPA 2KLEA 1TNQA 1KQVA 3CYZA 2KHNA 3RLZA 1CMGA 1YUUA 1DC1A 4PE1A 2JOJA 1CDLA 3S0FA 3B88A 1B8LA 5DKQA 4AQJA 1QLKA 3VRNA 4ICBA 1K2HA 1QATA 2F3ZA 3BUNB 2G9BA 3GK4X 2ZN9A 4NDDA 2LM5A 1UURA 2JT0A 3CWGA 3S0AA 2CCMA 1C7WA 4OV2A 1DJWA 4MLWA 5D69A 2FCDA 4PE7A 5KSZA 4JD9A 3CLNA 1QTXA 1J7OA 1UHKA 3D78A 2WCLA 3PLFB 5G08A 2EC6C 2LLTA 3JTDC 1LXFC 1OW4A 1NP8A 3PALA 1BJFA 2MA2A 2MBXA 1C07A 3QRXA 2BCAA 1CM1A 2SCPA 2ZNDA 4P5OE 1XK4C 2Y1NA 3I5GC 2JTTA 2LP3A 5FI6A 4NQGA 3AAKA 2PYQA 3BYAA 4BY5A 2H61A 1KSMA 1KQMC 2WCFA 1PVAA 1XFZO 1J7RA 1OZSA 3SS4A 1F4QA 1PULA 3LCPC 1BU3A 3DVKA 1RWYA 1UP5A 3OHMB 1QJTA 2QEVA 4GNKB 3K1EA 4MEWA 1YX7A 1FF1A 4FQOA 1LVCD 4PE4A 1TWOA 1CLLA 1NCYA 2BAPA 2NCOA 1H8BA 2GGZA 2QACA 3JVTB 1ZFSA 3RM1A 5CSIA 1EXRA 3O4YA 4YI9A 1ZOTB 1YRTB 2BE6A 3EK7A 3CTNA 1UWOA 1DJHA 3D10A 2NCPA 4OKHA 2M49B 3JVTC 1VRKA 3OX6A 1BOCA 1SCMB 4GGNA 1NCZA 5DKNA 3TDUA 1JUOA 2AAOA 1SL7A 1ALWA 3R1OA 1UHJA 1SCMC 2LUCA 3EKHA 3BUWB 1K9KA 3V2LA 1CM4A 1B8RA 4OVNF 1ZUZA 2LMVA 2EHBA 1B47A 1WLZA 1AJ4A 1OOHA 1J1DA 2I18A 4C0LA 3CZTX 4HSZA 1TTXA 2GGMA 2PRUA 2WOSA 2L0PA 5BPJA 2L4HA 4YGCB 2LVVA 1P28A 2L5XB 2PSRA 2LMUA 5KTYA 3I5IB 1TOPA 3NXAA 1J7PA 3IQQA 2MHHA 1NX0A 1A29A 1M39A 2KQYA 4N1FA 3VRQA 1MR8A 2BECA 2O60A 3M0WA 5CSJA 2LHLA 2JPTA 2M97A 3I5IC 1BF5A 1QIVA 2JULA 3BFBA 1SSEB 4MBEA 2LLUA 1F4OA 2AMIA 2KAXA 2OPOA 1ALVA 3D0YB 1SY9A
chains in the Genus database with same CATH topology
3AKAA 1K93D 2F2PA 2WCEA 3WXAA 2HPSA 3SIAA 2OS8C 1CLBA 2KGBC 5CPVA 1OE9B 3BUMB 1BMOA 1MQ1A 2LLSA 5I2OA 1SCVA 4P2YB 2VRGA 1AVSA 2RGIA 4QJ5B 2ZRSA 1UUSA 5CSNA 1NWDA 1FW4A 2L4IA 1DVIA 2FJUB 1S6IA 2BKIB 4IL1A 4MZJA 1K9PA 5ER4X 5AERA 2L2EA 1KWOB 1HT9A 2KI4C 3H4SE 2JT3A 1S6JA 2F2OA 1WY9A 1KWOC 5HLVA 1TNPA 1U5IB 2KSPA 1TIZA 3SG4A 4WQ3A 1JFJA 4PALA 5AANA 1SYMA 4BY4A 2M9GA 3HCMA 1K95A 1W7IB 2GV5A 1IQ5A 4GFTA 5K89A 1XFWO 1DTLA 2ZN8A 3LK0A 4A4BA 1M63B 1BODA 4M2PA 4ZCUA 1LA0A 1Y1XA 4CFRA 1C7VA 2CNPA 4CFQA 1IH0A 3AKBA 1M31A 3PN7C 2K7CA 2O5GA 3NSKA 1OMRA 3VROA 1B4CA 2JC2A 4YGEB 1KCYA 2SASA 4E68A 3DVEA 1AHRA 5I8NA 2EC6B 1KK7Z 2KNEA 2BCXA 3JTDB 2H61C 3DF0B 2WCBA 2FOTA 4MRYA 3BUXB 4N1GA 1LA3A 2I7AA 2NLNA 2PASA 3VGOA 2LVIA 2HQ8A 1DJXA 2K7DA 2JT8A 1IWQA 1YX8A 1DJIA 3I5GB 5KU1A 1WRLA 1JSAA 4MVFA 4F0ZB 1M46A 3PSRA 3OP0A 1SBJA 1L2OB 4GBAA 1KQMB 1U5IA 1J55A 4GGFC 4M2OA 4PHMA 1V1FA 1NX2A 1L2OC 2JXLA 1TN4A 3E3RA 1L7ZA 5B8IB 2K2AA 5IBWA 2KAVA 2LMTA 1S1EA 4DUQA 4PE0A 2LCPA 5JOLA 2PMYA 3K21A 2JWWA 4MZLA 4QJ3B 1QX2A 1QX7A 2P6BB 3CS1A 1BLQA 1TNXA 1XO5A 2ZNEA 1MWNA 1B8CA 1TNWA 1GQMA 3BXKA 3FWCA 2JU0A 1S26D 2BL0C 1PRWA 3CGAA 1G33A 3AAJA 4PHNA 2ISDA 3LLEA 2I2RE 3KO0A 1OQPA 1TCFA 1WDCC 2MAZA 4YRUA 3OB1B 2H2KA 2MLFC 3DF0A 3A4UB 1IG5A 1DF0B 2LANA 1DJGA 2BBMA 5PALA 1NX3A 1XK4A 3TDZA 4DCKA 2MJWB 1D1OA 5J3XA 1CFCA 2LE9B 4L9MA 1DGVA 1E8AA 1S5GZ 1SL9A 2BKHB 4PHJA 2K0JA 2CXJA 4ETOA 1SMGA 1NYAA 4M2QA 1DMOA 2FCEA 1A03A 1B7TZ 1CFFA 1F8HA 1NUBA 3FIAA 1KK7Y 1QXPA 4YI8A 1NSHA 4JWQA 3EVVA 1EG3A 2L50A 1YVLA 2OS8B 1RJVA 1NCXA 2F3YA 3I5HB 4CLNA 1IJ6A 2TN4A 2R2IA 2Y4QA 1RK9A 4JPZB 1SPYA 5I2QA 1WRZA 3FWBA 1R2UA 3TUYC 1SKTA 1CNPA 3I5HC 4MZKA 2LP2A 3EVRA 1OOJA 3TDIA 4U8DA 4N5XA 2Y1MA 1CDMA 1EJ3A 4YGDB 3PFVA 4HREE 1Y0VH 2KI4B 3OB2B 2KOTA 5JJGA 2HQWA 3MSEB 1ZMZA 1QS7A 4TNCA 2KFFA 2MLEC 2ZKMX 1QIWA 2M3WA 2HETA 4GPLB 3OX5A 2MRDA 2E30A 1JF2A 2OTGC 2DOQA 2LC5A 1MXEA 3EK4A 2WC8A 4I5JA 3WNXB 1KK8B 4MN0A 1X02A 2LUXA 1JF0A 2K7BA 4ORCB 5ER5A 2JTZA 3ZWHA 3SJSA 4AQIA 3BOWB 2KQ6A 1KK8C 2NZ0A 1B9AA 3PM8A 1BT6A 3HX4A 4UPGA 1A75B 1A2XA 1JFKA 1S3PA 1IQ3A 1GJYA 1XA5A 3A8RA 2JZIA 3KPXA 1WRKA 3PN7B 4A4CA 2ZFDA 2JQ6A 4C0KA 1SRAA 4ORAB 1N0YA 1QVIZ 2WNDA 2LV7A 3D0YA 1G8IA 2NXQA 1B1GA 3LL8B 5CSFA 1J1EA 1RECA 1BG1A 1PSRA 1KFUS 1XFVO 4GUKA 1YR5A 4JQ0D 4NDCA 4XYNA 1UHIA 1FI6A 1YVHA 1SR6C 1UHHA 1NX1A 4HRGA 4YGAA 2M1UA 1S36A 1AK8A 2K8MB 5TNCA 2L98A 1XFUO 1BR4B 1B7TY 2KFGA 1CLMA 4I5LB 1FBVA 1K94A 4DS7A 2KGRA 2Y5IA 2G2BA 3O2PA 2ZRTA 5HKWA 1K90D 1JC2A 1K9UA 4DRWA 1SNLA 1YTZC 4PHKA 5AXIA 3VRRA 3CR2A 5AFPA 1Q80A 1N65A 2JRFA 3BOWA 3SG3A 2PALA 1MXLC 3EVUA 1RTP1 3KEVA 3SG6A 2M0RA 1A75A 4I5KA 1LINA 3EK8A 2M8UA 1Y1UA 2KFHA 3WHUB 4Q04A 2BL0B 1RFJA 3DVJA 1KFXS 4USLA 3GOFA 1XYDA 1AP4A 1YRUB 4FTGA 3GK1A 3SG5A 1CDPA 5FYXA 4MRXA 3O78A 4MSPA 1JBAA 1TCOB 1F54A 1WDCB 1NIWA 1A4PA 2M29A 4I5NB 3LK1A 2KBMA 3WHTB 1YUTA 2K61A 5AEQA 4XJKB 1OMVA 4C0JA 3BUOB 3NSIA 1CB1A 1QASA 1IKUA 1XFXO 1F55A 2F8PA 1MF8B 2Q91A 1FI5A 1JWDA 3NSOA 1CMFA 2M1KB 4OR9B 2M7LA 3NSLA 1K96A 1ZACA 5HKYA 2JNFA 2K7OA 4YBHB 3IQOA 1N2DA 1QVIY 1AJ5A 3BQ3A 4GGFA 1DT7B 1F70A 4CPVA 1BR1B 1S6CA 3TZ1A 3CR4X 1KFUL 2CTNA 1CFPA 5I2LA 3EKJA 1DJYA 1DJZA 1HQVA 1FPWA 4R1EA 4NDBA 4GAOA 1MUXA 1V1GA 1NPQA 2BBNA 2JNXA 1LKJA 2V53A 4ZCVA 4WQ2A 1QLSA 1XFYO 2M7NA 1ODBA 2IS9A 2EGDA 4HRHA 1PALA 2E6WA 1SK6D 3TUYB 1G4YR 3SG2A 4CIDA 3DD4A 2LHIA 1W7JB 1OZOA 2LAPA 3ICBA 1RROA 1EH2A 1QX5B 2K2FA 2KDHA 3SIBA 2HF5A 2PVBA 2COLB 1KSOA 1GGWA 2A4JA 2KAYA 1DGUA 4YGBB 3C1VA 2CBLA 1WLMA 1M45A 1PK0D 5HKZA 2LNKA 4XJKA 4DIRA 1EL4A 2LVJA 5HYDA 2KYCA 1EG4A 3SG7A 3ZNIA 1YURA 1PSBA 2JXCA 3KHEA 2KYFA 1SW8A 2OTGB 3I5FB 4D1EA 1DF0A 1H4BA 2WORA 1IGVA 1KFXL 1XVJA 4QJ4B 1MHOA 1R6PA 5D7FA 1J7QA 2Q4UA 1PVBA 5GQQC 3I5FC 1IJ5A 4AOMA 2D8NA 3FS7A 3DVMA 3KF9A 1QV1A 1OMDA 4WRIA 4PCWA 1Y1AA 3O6BA 4PDZA 2L51A 1CFDA 1OSAA 1IRJA 1UHNA 1QV0A 4OCIA 1YUSA 3IF7A 5DKRA 2CT9A 1CDNA 1Y6WA 3CR5X 2AUCA 1TRFA 2KI6C 1CTRA 1CKKA 1AUIB 3TS5B 2LVKA 2B1UA 3GK2A 1SL8A 1SR6B 4ORBB 3TS5C 1GGZA 3F45A 2F33A 2QPTA 2BCBA 2KBIA 2KI6D 2I94A 1S5GY 3PATA 5F6TA 1K8UA 1F71A 5HLOA 2BE4A 3VRPA 1TNQA 1KQVA 2KHNA 3RLZA 1CMGA 1YUUA 4PE1A 2JOJA 1CDLA 1B8LA 5DKQA 4AQJA 1QLKA 3VRNA 4ICBA 1K2HA 1QATA 2F3ZA 3BUNB 2G9BA 3GK4X 2ZN9A 4NDDA 2LM5A 1UURA 2JT0A 3CWGA 2CCMA 1C7WA 4OV2A 1DJWA 4MLWA 5D69A 2FCDA 4PE7A 5KSZA 3CLNA 1QTXA 1J7OA 1UHKA 5G08A 3PLFB 2EC6C 2LLTA 3JTDC 1LXFC 1NP8A 3PALA 1BJFA 2MA2A 2MBXA 1C07A 3QRXA 2BCAA 1CM1A 2SCPA 2ZNDA 4P5OE 1XK4C 2Y1NA 3I5GC 2JTTA 2LP3A 4NQGA 3AAKA 4BY5A 3BYAA 2H61A 1KSMA 1KQMC 2WCFA 1PVAA 1XFZO 1J7RA 1OZSA 1F4QA 1PULA 3LCPC 1BU3A 3DVKA 1RWYA 1UP5A 3OHMB 1QJTA 4GNKB 4MEWA 1YX7A 1FF1A 4FQOA 1LVCD 4PE4A 1CLLA 1NCYA 2NCOA 1H8BA 2GGZA 2QACA 3JVTB 1ZFSA 3RM1A 5CSIA 1EXRA 3O4YA 4YI9A 1ZOTB 1YRTB 2BE6A 3EK7A 3CTNA 1UWOA 1DJHA 3D10A 2NCPA 4OKHA 2M49B 3JVTC 1VRKA 3OX6A 1BOCA 1SCMB 4GGNA 1NCZA 5DKNA 3TDUA 1JUOA 2AAOA 1SL7A 1ALWA 1UHJA 1SCMC 2LUCA 3EKHA 3BUWB 1K9KA 1CM4A 1B8RA 4OVNF 1ZUZA 2LMVA 2EHBA 1B47A 1WLZA 1AJ4A 1J1DA 2I18A 4C0LA 3CZTX 4HSZA 1TTXA 2GGMA 2PRUA 2WOSA 2L0PA 5BPJA 2L4HA 4YGCB 2LVVA 2L5XB 2PSRA 2LMUA 5KTYA 3I5IB 1TOPA 3NXAA 1J7PA 3IQQA 2MHHA 1NX0A 1A29A 1M39A 2KQYA 4N1FA 3VRQA 1MR8A 2BECA 2O60A 3M0WA 5CSJA 2LHLA 2JPTA 2M97A 3I5IC 1BF5A 1QIVA 2JULA 4MBEA 2LLUA 1F4OA 2AMIA 2KAXA 2OPOA 1ALVA 3D0YB 1SY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AKA A;  1K93 D;  2F2P A;  2WCE A;  3WXA A;  2HPS A;  3SIA A;  2OS8 C;  1CLB A;  2KGB C;  5CPV A;  1OE9 B;  3BUM B;  1BMO A;  1MQ1 A;  2LLS A;  5I2O A;  1SCV A;  4P2Y B;  2VRG A;  1AVS A;  2RGI A;  4QJ5 B;  2ZRS A;  1UUS A;  5CSN A;  1NWD A;  1FW4 A;  2L4I A;  1DVI A;  2FJU B;  1S6I A;  2BKI B;  4IL1 A;  4MZJ A;  1K9P A;  5ER4 X;  5AER A;  2L2E A;  1KWO B;  1HT9 A;  2KI4 C;  3H4S E;  2JT3 A;  1S6J A;  2F2O A;  1WY9 A;  1KWO C;  5HLV A;  1TNP A;  1U5I B;  2KSP A;  1TIZ A;  3SG4 A;  4WQ3 A;  1JFJ A;  4PAL A;  5AAN A;  1SYM A;  4BY4 A;  2M9G A;  3HCM A;  1K95 A;  1W7I B;  2GV5 A;  1IQ5 A;  4GFT A;  5K89 A;  1XFW O;  1DTL A;  2ZN8 A;  3LK0 A;  4A4B A;  1M63 B;  1BOD A;  4M2P A;  4ZCU A;  1LA0 A;  1Y1X A;  4CFR A;  1C7V A;  2CNP A;  4CFQ A;  1IH0 A;  3AKB A;  1M31 A;  3PN7 C;  2K7C A;  2O5G A;  3NSK A;  1OMR A;  3VRO A;  1B4C A;  2JC2 A;  4YGE B;  1KCY A;  2SAS A;  4E68 A;  3DVE A;  1AHR A;  5I8N A;  2EC6 B;  1KK7 Z;  2KNE A;  2BCX A;  3JTD B;  2H61 C;  3DF0 B;  2WCB A;  2FOT A;  4MRY A;  3BUX B;  4N1G A;  1LA3 A;  2I7A A;  2NLN A;  2PAS A;  3VGO A;  2LVI A;  2HQ8 A;  1DJX A;  2K7D A;  2JT8 A;  1IWQ A;  1YX8 A;  1DJI A;  3I5G B;  5KU1 A;  1WRL A;  1JSA A;  4MVF A;  4F0Z B;  1M46 A;  3PSR A;  3OP0 A;  1SBJ A;  1L2O B;  4GBA A;  1KQM B;  1U5I A;  1J55 A;  4GGF C;  4M2O A;  4PHM A;  1V1F A;  1NX2 A;  1L2O C;  2JXL A;  1TN4 A;  3E3R A;  1L7Z A;  5B8I B;  2K2A A;  5IBW A;  2KAV A;  2LMT A;  1S1E A;  4DUQ A;  4PE0 A;  2LCP A;  5JOL A;  2PMY A;  3K21 A;  2JWW A;  4MZL A;  4QJ3 B;  1QX2 A;  1QX7 A;  2P6B B;  3CS1 A;  1BLQ A;  1TNX A;  1XO5 A;  2ZNE A;  1MWN A;  1B8C A;  1TNW A;  1GQM A;  3BXK A;  3FWC A;  2JU0 A;  1S26 D;  2BL0 C;  1PRW A;  3CGA A;  1G33 A;  3AAJ A;  4PHN A;  2ISD A;  3LLE A;  2I2R E;  3KO0 A;  1OQP A;  1TCF A;  1WDC C;  2MAZ A;  4YRU A;  3OB1 B;  2H2K A;  2MLF C;  3DF0 A;  3A4U B;  1IG5 A;  1DF0 B;  2LAN A;  1DJG A;  2BBM A;  5PAL A;  1NX3 A;  1XK4 A;  3TDZ A;  4DCK A;  2MJW B;  1D1O A;  5J3X A;  1CFC A;  2LE9 B;  4L9M A;  1DGV A;  1E8A A;  1S5G Z;  1SL9 A;  2BKH B;  4PHJ A;  2K0J A;  2CXJ A;  4ETO A;  1SMG A;  1NYA A;  4M2Q A;  1DMO A;  2FCE A;  1A03 A;  1B7T Z;  1CFF A;  1F8H A;  1NUB A;  3FIA A;  1KK7 Y;  1QXP A;  4YI8 A;  1NSH A;  4JWQ A;  3EVV A;  1EG3 A;  2L50 A;  1YVL A;  2OS8 B;  1RJV A;  1NCX A;  2F3Y A;  3I5H B;  4CLN A;  1IJ6 A;  2TN4 A;  2R2I A;  2Y4Q A;  1RK9 A;  4JPZ B;  1SPY A;  5I2Q A;  1WRZ A;  3FWB A;  1R2U A;  3TUY C;  1SKT A;  1CNP A;  3I5H C;  4MZK A;  2LP2 A;  3EVR A;  1OOJ A;  3TDI A;  4U8D A;  4N5X A;  2Y1M A;  1CDM A;  1EJ3 A;  4YGD B;  3PFV A;  4HRE E;  1Y0V H;  2KI4 B;  3OB2 B;  2KOT A;  5JJG A;  2HQW A;  3MSE B;  1ZMZ A;  1QS7 A;  4TNC A;  2KFF A;  2MLE C;  2ZKM X;  1QIW A;  2M3W A;  2HET A;  4GPL B;  3OX5 A;  2MRD A;  2E30 A;  1JF2 A;  2OTG C;  2DOQ A;  2LC5 A;  1MXE A;  3EK4 A;  2WC8 A;  4I5J A;  3WNX B;  1KK8 B;  4MN0 A;  1X02 A;  2LUX A;  1JF0 A;  2K7B A;  4ORC B;  5ER5 A;  2JTZ A;  3ZWH A;  3SJS A;  4AQI A;  3BOW B;  2KQ6 A;  1KK8 C;  2NZ0 A;  1B9A A;  3PM8 A;  1BT6 A;  3HX4 A;  4UPG A;  1A75 B;  1A2X A;  1JFK A;  1S3P A;  1IQ3 A;  1GJY A;  1XA5 A;  3A8R A;  2JZI A;  3KPX A;  1WRK A;  3PN7 B;  4A4C A;  2ZFD A;  2JQ6 A;  4C0K A;  1SRA A;  4ORA B;  1N0Y A;  1QVI Z;  2WND A;  2LV7 A;  3D0Y A;  1G8I A;  2NXQ A;  1B1G A;  3LL8 B;  5CSF A;  1J1E A;  1REC A;  1BG1 A;  1PSR A;  1KFU S;  1XFV O;  4GUK A;  1YR5 A;  4JQ0 D;  4NDC A;  4XYN A;  1UHI A;  1FI6 A;  1YVH A;  1SR6 C;  1UHH A;  1NX1 A;  4HRG A;  4YGA A;  2M1U A;  1S36 A;  1AK8 A;  2K8M B;  5TNC A;  2L98 A;  1XFU O;  1BR4 B;  1B7T Y;  2KFG A;  1CLM A;  4I5L B;  1FBV A;  1K94 A;  4DS7 A;  2KGR A;  2Y5I A;  2G2B A;  3O2P A;  2ZRT A;  5HKW A;  1K90 D;  1JC2 A;  1K9U A;  4DRW A;  1SNL A;  1YTZ C;  4PHK A;  5AXI A;  3VRR A;  3CR2 A;  5AFP A;  1Q80 A;  1N65 A;  2JRF A;  3BOW A;  3SG3 A;  2PAL A;  1MXL C;  3EVU A;  1RTP 1;  3KEV A;  3SG6 A;  2M0R A;  1A75 A;  4I5K A;  1LIN A;  3EK8 A;  2M8U A;  1Y1U A;  2KFH A;  3WHU B;  4Q04 A;  2BL0 B;  1RFJ A;  3DVJ A;  1KFX S;  4USL A;  3GOF A;  1XYD A;  1AP4 A;  1YRU B;  4FTG A;  3GK1 A;  3SG5 A;  1CDP A;  5FYX A;  4MRX A;  3O78 A;  4MSP A;  1JBA A;  1TCO B;  1F54 A;  1WDC B;  1NIW A;  1A4P A;  2M29 A;  4I5N B;  3LK1 A;  2KBM A;  3WHT B;  1YUT A;  2K61 A;  5AEQ A;  4XJK B;  1OMV A;  4C0J A;  3BUO B;  3NSI A;  1CB1 A;  1QAS A;  1IKU A;  1XFX O;  1F55 A;  2F8P A;  1MF8 B;  2Q91 A;  1FI5 A;  1JWD A;  3NSO A;  1CMF A;  2M1K B;  4OR9 B;  2M7L A;  3NSL A;  1K96 A;  1ZAC A;  5HKY A;  2JNF A;  2K7O A;  4YBH B;  3IQO A;  1N2D A;  1QVI Y;  1AJ5 A;  3BQ3 A;  4GGF A;  1DT7 B;  1F70 A;  4CPV A;  1BR1 B;  1S6C A;  3TZ1 A;  3CR4 X;  1KFU L;  2CTN A;  1CFP A;  5I2L A;  3EKJ A;  1DJY A;  1DJZ A;  1HQV A;  1FPW A;  4R1E A;  4NDB A;  4GAO A;  1MUX A;  1V1G A;  1NPQ A;  2BBN A;  2JNX A;  1LKJ A;  2V53 A;  4ZCV A;  4WQ2 A;  1QLS A;  1XFY O;  2M7N A;  1ODB A;  2IS9 A;  2EGD A;  4HRH A;  1PAL A;  2E6W A;  1SK6 D;  3TUY B;  1G4Y R;  3SG2 A;  4CID A;  3DD4 A;  2LHI A;  1W7J B;  1OZO A;  2LAP A;  3ICB A;  1RRO A;  1EH2 A;  1QX5 B;  2K2F A;  2KDH A;  3SIB A;  2HF5 A;  2PVB A;  2COL B;  1KSO A;  1GGW A;  2A4J A;  2KAY A;  1DGU A;  4YGB B;  3C1V A;  2CBL A;  1WLM A;  1M45 A;  1PK0 D;  5HKZ A;  2LNK A;  4XJK A;  4DIR A;  1EL4 A;  2LVJ A;  5HYD A;  2KYC A;  1EG4 A;  3SG7 A;  3ZNI A;  1YUR A;  1PSB A;  2JXC A;  3KHE A;  2KYF A;  1SW8 A;  2OTG B;  3I5F B;  4D1E A;  1DF0 A;  1H4B A;  2WOR A;  1IGV A;  1KFX L;  1XVJ A;  4QJ4 B;  1MHO A;  1R6P A;  5D7F A;  1J7Q A;  2Q4U A;  1PVB A;  5GQQ C;  3I5F C;  1IJ5 A;  4AOM A;  2D8N A;  3FS7 A;  3DVM A;  3KF9 A;  1QV1 A;  1OMD A;  4WRI A;  4PCW A;  1Y1A A;  3O6B A;  4PDZ A;  2L51 A;  1CFD A;  1OSA A;  1IRJ A;  1UHN A;  1QV0 A;  4OCI A;  1YUS A;  3IF7 A;  5DKR A;  2CT9 A;  1CDN A;  1Y6W A;  3CR5 X;  2AUC A;  1TRF A;  2KI6 C;  1CTR A;  1CKK A;  1AUI B;  3TS5 B;  2LVK A;  2B1U A;  3GK2 A;  1SL8 A;  1SR6 B;  4ORB B;  3TS5 C;  1GGZ A;  3F45 A;  2F33 A;  2QPT A;  2BCB A;  2KBI A;  2KI6 D;  2I94 A;  1S5G Y;  3PAT A;  5F6T A;  1K8U A;  1F71 A;  5HLO A;  2BE4 A;  3VRP A;  1TNQ A;  1KQV A;  2KHN A;  3RLZ A;  1CMG A;  1YUU A;  4PE1 A;  2JOJ A;  1CDL A;  1B8L A;  5DKQ A;  4AQJ A;  1QLK A;  3VRN A;  4ICB A;  1K2H A;  1QAT A;  2F3Z A;  3BUN B;  2G9B A;  3GK4 X;  2ZN9 A;  4NDD A;  2LM5 A;  1UUR A;  2JT0 A;  3CWG A;  2CCM A;  1C7W A;  4OV2 A;  1DJW A;  4MLW A;  5D69 A;  2FCD A;  4PE7 A;  5KSZ A;  3CLN A;  1QTX A;  1J7O A;  1UHK A;  5G08 A;  3PLF B;  2EC6 C;  2LLT A;  3JTD C;  1LXF C;  1NP8 A;  3PAL A;  1BJF A;  2MA2 A;  2MBX A;  1C07 A;  3QRX A;  2BCA A;  1CM1 A;  2SCP A;  2ZND A;  4P5O E;  1XK4 C;  2Y1N A;  3I5G C;  2JTT A;  2LP3 A;  4NQG A;  3AAK A;  4BY5 A;  3BYA A;  2H61 A;  1KSM A;  1KQM C;  2WCF A;  1PVA A;  1XFZ O;  1J7R A;  1OZS A;  1F4Q A;  1PUL A;  3LCP C;  1BU3 A;  3DVK A;  1RWY A;  1UP5 A;  3OHM B;  1QJT A;  4GNK B;  4MEW A;  1YX7 A;  1FF1 A;  4FQO A;  1LVC D;  4PE4 A;  1CLL A;  1NCY A;  2NCO A;  1H8B A;  2GGZ A;  2QAC A;  3JVT B;  1ZFS A;  3RM1 A;  5CSI A;  1EXR A;  3O4Y A;  4YI9 A;  1ZOT B;  1YRT B;  2BE6 A;  3EK7 A;  3CTN A;  1UWO A;  1DJH A;  3D10 A;  2NCP A;  4OKH A;  2M49 B;  3JVT C;  1VRK A;  3OX6 A;  1BOC A;  1SCM B;  4GGN A;  1NCZ A;  5DKN A;  3TDU A;  1JUO A;  2AAO A;  1SL7 A;  1ALW A;  1UHJ A;  1SCM C;  2LUC A;  3EKH A;  3BUW B;  1K9K A;  1CM4 A;  1B8R A;  4OVN F;  1ZUZ A;  2LMV A;  2EHB A;  1B47 A;  1WLZ A;  1AJ4 A;  1J1D A;  2I18 A;  4C0L A;  3CZT X;  4HSZ A;  1TTX A;  2GGM A;  2PRU A;  2WOS A;  2L0P A;  5BPJ A;  2L4H A;  4YGC B;  2LVV A;  2L5X B;  2PSR A;  2LMU A;  5KTY A;  3I5I B;  1TOP A;  3NXA A;  1J7P A;  3IQQ A;  2MHH A;  1NX0 A;  1A29 A;  1M39 A;  2KQY A;  4N1F A;  3VRQ A;  1MR8 A;  2BEC A;  2O60 A;  3M0W A;  5CSJ A;  2LHL A;  2JPT A;  2M97 A;  3I5I C;  1BF5 A;  1QIV A;  2JUL A;  4MBE A;  2LLU A;  1F4O A;  2AMI A;  2KAX A;  2OPO A;  1ALV A;  3D0Y B;  1SY9 A; 
#chains in the Genus database with same CATH topology
 3AKA A;  1K93 D;  2F2P A;  2WCE A;  3DZT A;  3IVT A;  3WXA A;  2HPS A;  3SIA A;  2OS8 C;  1CLB A;  2KGB C;  5CPV A;  1OE9 B;  3BUM B;  1BMO A;  1MQ1 A;  2LLS A;  5I2O A;  1SCV A;  4P2Y B;  2VRG A;  2YGU A;  1AVS A;  3RZS A;  2RGI A;  4QJ5 B;  2ZRS A;  1UUS A;  5CSN A;  1NWD A;  1FW4 A;  2BNX A;  2L4I A;  3R72 A;  1DVI A;  2FJU B;  1S6I A;  2BKI B;  4IL1 A;  4MZJ A;  1K9P A;  5ER4 X;  5AER A;  2L2E A;  1KWO B;  2QDI A;  3Q8I A;  1HT9 A;  2KI4 C;  3H4S E;  2JT3 A;  1S6J A;  2F2O A;  1WY9 A;  1KWO C;  3DY9 A;  5HLV A;  1TNP A;  1U5I B;  2KSP A;  1TIZ A;  3SG4 A;  2GTE A;  4WQ3 A;  4PAL A;  1JFJ A;  1C3Z A;  5AAN A;  1SYM A;  4BY4 A;  2M9G A;  3HCM A;  1OOF A;  1K95 A;  1W7I B;  3D75 A;  2GV5 A;  3B86 A;  1OOG A;  1IQ5 A;  4GFT A;  3L4A A;  5K89 A;  3FE8 A;  1XFW O;  1DTL A;  2ZN8 A;  3LK0 A;  4A4B A;  1M63 B;  3B7A A;  1BOD A;  4M2P A;  4ZCU A;  1LA0 A;  1Y1X A;  4CFR A;  1C7V A;  3S0B A;  2CNP A;  4CFQ A;  1IH0 A;  3AKB A;  1M31 A;  3PN7 C;  2K7C A;  2O5G A;  3NSK A;  1OMR A;  3VRO A;  1B4C A;  2JC2 A;  2QEB A;  4YGE B;  3CDN A;  3B6X A;  2SAS A;  1KCY A;  4E68 A;  5HL1 A;  3DVE A;  1AHR A;  5I8N A;  2EC6 B;  1KK7 Z;  2KNE A;  2BCX A;  2WCJ A;  3JTD B;  2H61 C;  3DF0 B;  4INX A;  2WCB A;  2FOT A;  4MRY A;  3BUX B;  4N1G A;  1LA3 A;  2I7A A;  2NLN A;  2PAS A;  3FE9 A;  3VGO A;  2LVI A;  2HQ8 A;  1DJX A;  2K7D A;  2JT8 A;  1IWQ A;  1YX8 A;  1DJI A;  3I5G B;  5KU1 A;  2QEH A;  1WRL A;  1JSA A;  4MVF A;  4F0Z B;  1M46 A;  3PSR A;  3OP0 A;  1SBJ A;  1L2O B;  3NHT A;  4GBA A;  1KQM B;  1U5I A;  1QWV A;  1J55 A;  4GGF C;  4M2O A;  3B87 A;  4PHM A;  1V1F A;  1NX2 A;  1L2O C;  2JXL A;  1TN4 A;  3E3R A;  3N7H A;  4OZD A;  1L7Z A;  5B8I B;  2K2A A;  2H8V A;  5IBW A;  2KAV A;  2LMT A;  1S1E A;  4DUQ A;  4PE0 A;  1T14 A;  2LCP A;  5JOL A;  2PMY A;  3K21 A;  2JWW A;  3CAB A;  3D77 A;  4MZL A;  4QJ3 B;  1QX2 A;  1QX7 A;  2P6B B;  3CS1 A;  3SS3 A;  1BLQ A;  1TNX A;  1XO5 A;  1Z2C B;  2ZNE A;  1MWN A;  1B8C A;  1TNW A;  1GQM A;  3BXK A;  3FWC A;  2JU0 A;  1S26 D;  2BL0 C;  1PRW A;  3CGA A;  1G33 A;  3AAJ A;  4PHN A;  2ISD A;  3LLE A;  2I2R E;  3KO0 A;  1OQP A;  1TCF A;  1WDC C;  2MAZ A;  4YRU A;  3OB1 B;  2H2K A;  4KYN A;  2MLF C;  3DF0 A;  3A4U B;  1IG5 A;  5EL2 A;  1DF0 B;  2LAN A;  1DJG A;  2BBM A;  5PAL A;  1NX3 A;  1XK4 A;  3TDZ A;  4DCK A;  2MJW B;  1D1O A;  5J3X A;  1CFC A;  2LE9 B;  4L9M A;  1DGV A;  1E8A A;  1S5G Z;  1SL9 A;  2BKH B;  4PHJ A;  2K0J A;  2CXJ A;  4ETO A;  1SMG A;  1NYA A;  4M2Q A;  1DMO A;  2FCE A;  3S0D A;  1B7T Z;  1A03 A;  1CFF A;  1F8H A;  3BFA A;  1NUB A;  3UNW A;  3FIA A;  3EG5 B;  1KK7 Y;  1QXP A;  4YI8 A;  1NSH A;  3S0E A;  4JWQ A;  1DQE A;  3DXL A;  3EVV A;  1EG3 A;  2L50 A;  1YVL A;  2OS8 B;  1RJV A;  2QEO A;  1NCX A;  2F3Y A;  3I5H B;  4CLN A;  1IJ6 A;  2TN4 A;  2KLD A;  2R2I A;  2Y4Q A;  1RK9 A;  4JPZ B;  1SPY A;  1LS8 A;  1WRZ A;  3FWB A;  5I2Q A;  1R2U A;  3TUY C;  1SKT A;  1CNP A;  3I5H C;  4MZK A;  2LP2 A;  3EVR A;  1OOJ A;  3TDI A;  3CZ0 A;  4U8D A;  4N5X A;  2Y1M A;  1CDM A;  1EJ3 A;  1TUZ A;  4YGD B;  3BFH A;  3PFV A;  3DYE A;  4HRE E;  1Y0V H;  2KI4 B;  3OB2 B;  2KOT A;  5JJG A;  2HQW A;  1ORG A;  3OGN A;  3MSE B;  1ZMZ A;  1QS7 A;  4TNC A;  2KFF A;  2MLE C;  2ZKM X;  1QIW A;  3NGV A;  2M3W A;  2HET A;  2JPO A;  4GPL B;  3OX5 A;  2MRD A;  2E30 A;  3OBV A;  5DIC A;  1JF2 A;  2OTG C;  2DOQ A;  2LC5 A;  1MXE A;  3EK4 A;  2WC8 A;  4I5J A;  3WNX B;  1KK8 B;  2WC6 A;  1IIO A;  4MN0 A;  1X02 A;  4F7F A;  2LUX A;  1JF0 A;  2K7B A;  4ORC B;  5ER5 A;  2JTZ A;  3ZWH A;  3SJS A;  4AQI A;  3BOW B;  2KQ6 A;  1KK8 C;  2NZ0 A;  2P70 A;  1B9A A;  3PM8 A;  1BT6 A;  3HX4 A;  4UPG A;  1A75 B;  1A2X A;  1JFK A;  1S3P A;  3VB1 A;  1IQ3 A;  1GJY A;  1XA5 A;  3A8R A;  2JZI A;  3KPX A;  1WRK A;  3PN7 B;  4A4C A;  2ZFD A;  2JQ6 A;  4C0K A;  5I94 A;  1SRA A;  2WCH A;  4ORA B;  1N0Y A;  1QVI Z;  2WND A;  2LV7 A;  3D0Y A;  1G8I A;  2NXQ A;  3D73 A;  1B1G A;  3LL8 B;  5CSF A;  1J1E A;  1REC A;  2P71 A;  1BG1 A;  1PSR A;  1KFU S;  1XFV O;  3CZ1 A;  1YR5 A;  4GUK A;  1C3Y A;  4JQ0 D;  4NDC A;  4XYN A;  1UHI A;  2L2C A;  4JKT A;  3UO9 A;  1GM0 A;  1DEK A;  1FI6 A;  1YVH A;  1SR6 C;  1UHH A;  1NX1 A;  4HRG A;  4YGA A;  2M1U A;  1S36 A;  1AK8 A;  2K8M B;  5TNC A;  2L98 A;  1XFU O;  1BR4 B;  1B7T Y;  2KFG A;  1CLM A;  4I5L B;  1FBV A;  1K94 A;  4DS7 A;  2KGR A;  2Y5I A;  2G2B A;  1W9Z A;  3O2P A;  2ZRT A;  5HKW A;  1K90 D;  1JC2 A;  1K9U A;  1XFR A;  2WCM A;  1SNL A;  1YTZ C;  2WCK A;  4PHK A;  5AXI A;  3CR2 A;  3VRR A;  5AFP A;  1Q80 A;  1N65 A;  2JRF A;  5FI2 A;  3PJI A;  3BOW A;  3FE6 A;  2PAL A;  3SG3 A;  1MXL C;  3EVU A;  1RTP 1;  3KEV A;  3SG6 A;  2M0R A;  1A75 A;  4I5K A;  1LIN A;  3EK8 A;  2M8U A;  1Y1U A;  2KFH A;  3CZ2 A;  3WHU B;  2L5Y A;  4Q04 A;  3NHI A;  2BL0 B;  1RFJ A;  5D3O A;  4FQT A;  3DVJ A;  1KFX S;  4USL A;  3GOF A;  1XYD A;  1AP4 A;  1YRU B;  4FTG A;  4DRW A;  3GK1 A;  3SG5 A;  1CDP A;  5FYX A;  4MRX A;  3O78 A;  4MSP A;  1JBA A;  1TCO B;  1F54 A;  1WDC B;  1NIW A;  1A4P A;  2M29 A;  4I5N B;  3LK1 A;  2KBM A;  3WHT B;  1YUT A;  1Z4H A;  2K61 A;  4XJK B;  5AEQ A;  1OMV A;  3D74 A;  4C0J A;  3BUO B;  3NSI A;  1CB1 A;  1QAS A;  1IKU A;  1DEL A;  1XFX O;  1F55 A;  2F8P A;  1MF8 B;  2Q91 A;  1FI5 A;  2PQL A;  3NSO A;  1CMF A;  1JWD A;  2M1K B;  4OR9 B;  3R1V A;  2M7L A;  3NSL A;  1K96 A;  1ZAC A;  5HKY A;  2JNF A;  2K7O A;  4YBH B;  3IQO A;  1N2D A;  4INW A;  1QVI Y;  1AJ5 A;  3BQ3 A;  4GGF A;  1DT7 B;  1F70 A;  4PT1 A;  4CPV A;  1BR1 B;  1S6C A;  3O4X A;  3CR4 X;  1KFU L;  3TZ1 A;  2KPH A;  1OOI X;  2CTN A;  1CFP A;  5I2L A;  3EKJ A;  1DJY A;  1DJZ A;  1HQV A;  1FPW A;  4R1E A;  3L47 A;  4NDB A;  4GAO A;  1MUX A;  1V1G A;  1NPQ A;  2BBN A;  2FJY A;  1LKJ A;  2JNX A;  2V53 A;  4ZCV A;  4WQ2 A;  1QLS A;  1XFY O;  2M7N A;  1ODB A;  2IS9 A;  2EGD A;  4HRH A;  1PAL A;  2E6W A;  3R1P A;  1SK6 D;  3TUY B;  1G4Y R;  3SG2 A;  3S0G A;  4IJ7 A;  3DD4 A;  4CID A;  2LHI A;  1W7J B;  1OZO A;  2LAP A;  3D76 A;  3QME A;  3ICB A;  1RRO A;  1EH2 A;  1QX5 B;  2K2F A;  2KDH A;  3SIB A;  2HF5 A;  3L4L A;  2PVB A;  2COL B;  1KSO A;  1GGW A;  2A4J A;  2KAY A;  1DGU A;  4YGB B;  3C1V A;  2CBL A;  1WLM A;  1M45 A;  1PK0 D;  5HKZ A;  2LNK A;  4XJK A;  4DIR A;  1EL4 A;  2LVJ A;  5HYD A;  2KYC A;  1EG4 A;  3SG7 A;  3ZNI A;  1YUR A;  1PSB A;  2JXC A;  3KHE A;  2KYF A;  1SW8 A;  2OTG B;  3I5F B;  1TUJ A;  4D1E A;  1DF0 A;  1H4B A;  2WOR A;  1IGV A;  1KFX L;  1XVJ A;  4QJ4 B;  1MHO A;  1R6P A;  5D7F A;  1J7Q A;  2K60 A;  2Q4U A;  1PVB A;  5GQQ C;  3I5F C;  1IJ5 A;  4AOM A;  2D8N A;  5FI7 A;  3FS7 A;  3DVM A;  3KF9 A;  1QV1 A;  1OMD A;  4WRI A;  4PCW A;  1Y1A A;  3O6B A;  4PDZ A;  2L51 A;  1CFD A;  3BJH A;  1OSA A;  1IRJ A;  1UHN A;  1QV0 A;  4OCI A;  1YUS A;  3IF7 A;  5DKR A;  2CT9 A;  1CDN A;  1Y6W A;  3CR5 X;  2AUC A;  1TRF A;  2KI6 C;  2WC5 A;  1CTR A;  1CKK A;  1AUI B;  3TS5 B;  2LVK A;  2B1U A;  3GK2 A;  1SL8 A;  1SR6 B;  4ORB B;  3TS5 C;  1GGZ A;  3F45 A;  2ERB A;  2F33 A;  2QPT A;  2BCB A;  2KBI A;  2KI6 D;  2I94 A;  1S5G Y;  3PAT A;  5F6T A;  1K8U A;  1F71 A;  5HLO A;  3PM2 A;  3SS5 A;  2BE4 A;  3VRP A;  2KLE A;  1TNQ A;  1KQV A;  3CYZ A;  2KHN A;  3RLZ A;  1CMG A;  1YUU A;  1DC1 A;  4PE1 A;  2JOJ A;  1CDL A;  3S0F A;  3B88 A;  1B8L A;  5DKQ A;  4AQJ A;  1QLK A;  3VRN A;  4ICB A;  1K2H A;  1QAT A;  2F3Z A;  3BUN B;  2G9B A;  3GK4 X;  2ZN9 A;  4NDD A;  2LM5 A;  1UUR A;  2JT0 A;  3CWG A;  3S0A A;  2CCM A;  1C7W A;  4OV2 A;  1DJW A;  4MLW A;  5D69 A;  2FCD A;  4PE7 A;  5KSZ A;  4JD9 A;  3CLN A;  1QTX A;  1J7O A;  1UHK A;  3D78 A;  2WCL A;  3PLF B;  5G08 A;  2EC6 C;  2LLT A;  3JTD C;  1LXF C;  1OW4 A;  1NP8 A;  3PAL A;  1BJF A;  2MA2 A;  2MBX A;  1C07 A;  3QRX A;  2BCA A;  1CM1 A;  2SCP A;  2ZND A;  4P5O E;  1XK4 C;  2Y1N A;  3I5G C;  2JTT A;  2LP3 A;  5FI6 A;  4NQG A;  3AAK A;  2PYQ A;  3BYA A;  4BY5 A;  2H61 A;  1KSM A;  1KQM C;  2WCF A;  1PVA A;  1XFZ O;  1J7R A;  1OZS A;  3SS4 A;  1F4Q A;  1PUL A;  3LCP C;  1BU3 A;  3DVK A;  1RWY A;  1UP5 A;  3OHM B;  1QJT A;  2QEV A;  4GNK B;  3K1E A;  4MEW A;  1YX7 A;  1FF1 A;  4FQO A;  1LVC D;  4PE4 A;  1TWO A;  1CLL A;  1NCY A;  2BAP A;  2NCO A;  1H8B A;  2GGZ A;  2QAC A;  3JVT B;  1ZFS A;  3RM1 A;  5CSI A;  1EXR A;  3O4Y A;  4YI9 A;  1ZOT B;  1YRT B;  2BE6 A;  3EK7 A;  3CTN A;  1UWO A;  1DJH A;  3D10 A;  2NCP A;  4OKH A;  2M49 B;  3JVT C;  1VRK A;  3OX6 A;  1BOC A;  1SCM B;  4GGN A;  1NCZ A;  5DKN A;  3TDU A;  1JUO A;  2AAO A;  1SL7 A;  1ALW A;  3R1O A;  1UHJ A;  1SCM C;  2LUC A;  3EKH A;  3BUW B;  1K9K A;  3V2L A;  1CM4 A;  1B8R A;  4OVN F;  1ZUZ A;  2LMV A;  2EHB A;  1B47 A;  1WLZ A;  1AJ4 A;  1OOH A;  1J1D A;  2I18 A;  4C0L A;  3CZT X;  4HSZ A;  1TTX A;  2GGM A;  2PRU A;  2WOS A;  2L0P A;  5BPJ A;  2L4H A;  4YGC B;  2LVV A;  1P28 A;  2L5X B;  2PSR A;  2LMU A;  5KTY A;  3I5I B;  1TOP A;  3NXA A;  1J7P A;  3IQQ A;  2MHH A;  1NX0 A;  1A29 A;  1M39 A;  2KQY A;  4N1F A;  3VRQ A;  1MR8 A;  2BEC A;  2O60 A;  3M0W A;  5CSJ A;  2LHL A;  2JPT A;  2M97 A;  3I5I C;  1BF5 A;  1QIV A;  2JUL A;  3BFB A;  1SSE B;  4MBE A;  2LLU A;  1F4O A;  2AMI A;  2KAX A;  2OPO A;  1ALV A;  3D0Y B;  1SY9 A; 
#chains in the Genus database with same CATH homology
 3AKA A;  1K93 D;  2F2P A;  2WCE A;  3WXA A;  2HPS A;  3SIA A;  2OS8 C;  1CLB A;  2KGB C;  5CPV A;  1OE9 B;  3BUM B;  1BMO A;  1MQ1 A;  2LLS A;  5I2O A;  1SCV A;  4P2Y B;  2VRG A;  1AVS A;  2RGI A;  4QJ5 B;  2ZRS A;  1UUS A;  5CSN A;  1NWD A;  1FW4 A;  2L4I A;  1DVI A;  2FJU B;  1S6I A;  2BKI B;  4IL1 A;  4MZJ A;  1K9P A;  5ER4 X;  5AER A;  2L2E A;  1KWO B;  1HT9 A;  2KI4 C;  3H4S E;  2JT3 A;  1S6J A;  2F2O A;  1WY9 A;  1KWO C;  5HLV A;  1TNP A;  1U5I B;  2KSP A;  1TIZ A;  3SG4 A;  4WQ3 A;  1JFJ A;  4PAL A;  5AAN A;  1SYM A;  4BY4 A;  2M9G A;  3HCM A;  1K95 A;  1W7I B;  2GV5 A;  1IQ5 A;  4GFT A;  5K89 A;  1XFW O;  1DTL A;  2ZN8 A;  3LK0 A;  4A4B A;  1M63 B;  1BOD A;  4M2P A;  4ZCU A;  1LA0 A;  1Y1X A;  4CFR A;  1C7V A;  2CNP A;  4CFQ A;  1IH0 A;  3AKB A;  1M31 A;  3PN7 C;  2K7C A;  2O5G A;  3NSK A;  1OMR A;  3VRO A;  1B4C A;  2JC2 A;  4YGE B;  1KCY A;  2SAS A;  4E68 A;  3DVE A;  1AHR A;  5I8N A;  2EC6 B;  1KK7 Z;  2KNE A;  2BCX A;  3JTD B;  2H61 C;  3DF0 B;  2WCB A;  2FOT A;  4MRY A;  3BUX B;  4N1G A;  1LA3 A;  2I7A A;  2NLN A;  2PAS A;  3VGO A;  2LVI A;  2HQ8 A;  1DJX A;  2K7D A;  2JT8 A;  1IWQ A;  1YX8 A;  1DJI A;  3I5G B;  5KU1 A;  1WRL A;  1JSA A;  4MVF A;  4F0Z B;  1M46 A;  3PSR A;  3OP0 A;  1SBJ A;  1L2O B;  4GBA A;  1KQM B;  1U5I A;  1J55 A;  4GGF C;  4M2O A;  4PHM A;  1V1F A;  1NX2 A;  1L2O C;  2JXL A;  1TN4 A;  3E3R A;  1L7Z A;  5B8I B;  2K2A A;  5IBW A;  2KAV A;  2LMT A;  1S1E A;  4DUQ A;  4PE0 A;  2LCP A;  5JOL A;  2PMY A;  3K21 A;  2JWW A;  4MZL A;  4QJ3 B;  1QX2 A;  1QX7 A;  2P6B B;  3CS1 A;  1BLQ A;  1TNX A;  1XO5 A;  2ZNE A;  1MWN A;  1B8C A;  1TNW A;  1GQM A;  3BXK A;  3FWC A;  2JU0 A;  1S26 D;  2BL0 C;  1PRW A;  3CGA A;  1G33 A;  3AAJ A;  4PHN A;  2ISD A;  3LLE A;  2I2R E;  3KO0 A;  1OQP A;  1TCF A;  1WDC C;  2MAZ A;  4YRU A;  3OB1 B;  2H2K A;  2MLF C;  3DF0 A;  3A4U B;  1IG5 A;  1DF0 B;  2LAN A;  1DJG A;  2BBM A;  5PAL A;  1NX3 A;  1XK4 A;  3TDZ A;  4DCK A;  2MJW B;  1D1O A;  5J3X A;  1CFC A;  2LE9 B;  4L9M A;  1DGV A;  1E8A A;  1S5G Z;  1SL9 A;  2BKH B;  4PHJ A;  2K0J A;  2CXJ A;  4ETO A;  1SMG A;  1NYA A;  4M2Q A;  1DMO A;  2FCE A;  1A03 A;  1B7T Z;  1CFF A;  1F8H A;  1NUB A;  3FIA A;  1KK7 Y;  1QXP A;  4YI8 A;  1NSH A;  4JWQ A;  3EVV A;  1EG3 A;  2L50 A;  1YVL A;  2OS8 B;  1RJV A;  1NCX A;  2F3Y A;  3I5H B;  4CLN A;  1IJ6 A;  2TN4 A;  2R2I A;  2Y4Q A;  1RK9 A;  4JPZ B;  1SPY A;  5I2Q A;  1WRZ A;  3FWB A;  1R2U A;  3TUY C;  1SKT A;  1CNP A;  3I5H C;  4MZK A;  2LP2 A;  3EVR A;  1OOJ A;  3TDI A;  4U8D A;  4N5X A;  2Y1M A;  1CDM A;  1EJ3 A;  4YGD B;  3PFV A;  4HRE E;  1Y0V H;  2KI4 B;  3OB2 B;  2KOT A;  5JJG A;  2HQW A;  3MSE B;  1ZMZ A;  1QS7 A;  4TNC A;  2KFF A;  2MLE C;  2ZKM X;  1QIW A;  2M3W A;  2HET A;  4GPL B;  3OX5 A;  2MRD A;  2E30 A;  1JF2 A;  2OTG C;  2DOQ A;  2LC5 A;  1MXE A;  3EK4 A;  2WC8 A;  4I5J A;  3WNX B;  1KK8 B;  4MN0 A;  1X02 A;  2LUX A;  1JF0 A;  2K7B A;  4ORC B;  5ER5 A;  2JTZ A;  3ZWH A;  3SJS A;  4AQI A;  3BOW B;  2KQ6 A;  1KK8 C;  2NZ0 A;  1B9A A;  3PM8 A;  1BT6 A;  3HX4 A;  4UPG A;  1A75 B;  1A2X A;  1JFK A;  1S3P A;  1IQ3 A;  1GJY A;  1XA5 A;  3A8R A;  2JZI A;  3KPX A;  1WRK A;  3PN7 B;  4A4C A;  2ZFD A;  2JQ6 A;  4C0K A;  1SRA A;  4ORA B;  1N0Y A;  1QVI Z;  2WND A;  2LV7 A;  3D0Y A;  1G8I A;  2NXQ A;  1B1G A;  3LL8 B;  5CSF A;  1J1E A;  1REC A;  1BG1 A;  1PSR A;  1KFU S;  1XFV O;  4GUK A;  1YR5 A;  4JQ0 D;  4NDC A;  4XYN A;  1UHI A;  1FI6 A;  1YVH A;  1SR6 C;  1UHH A;  1NX1 A;  4HRG A;  4YGA A;  2M1U A;  1S36 A;  1AK8 A;  2K8M B;  5TNC A;  2L98 A;  1XFU O;  1BR4 B;  1B7T Y;  2KFG A;  1CLM A;  4I5L B;  1FBV A;  1K94 A;  4DS7 A;  2KGR A;  2Y5I A;  2G2B A;  3O2P A;  2ZRT A;  5HKW A;  1K90 D;  1JC2 A;  1K9U A;  4DRW A;  1SNL A;  1YTZ C;  4PHK A;  5AXI A;  3VRR A;  3CR2 A;  5AFP A;  1Q80 A;  1N65 A;  2JRF A;  3BOW A;  3SG3 A;  2PAL A;  1MXL C;  3EVU A;  1RTP 1;  3KEV A;  3SG6 A;  2M0R A;  1A75 A;  4I5K A;  1LIN A;  3EK8 A;  2M8U A;  1Y1U A;  2KFH A;  3WHU B;  4Q04 A;  2BL0 B;  1RFJ A;  3DVJ A;  1KFX S;  4USL A;  3GOF A;  1XYD A;  1AP4 A;  1YRU B;  4FTG A;  3GK1 A;  3SG5 A;  1CDP A;  5FYX A;  4MRX A;  3O78 A;  4MSP A;  1JBA A;  1TCO B;  1F54 A;  1WDC B;  1NIW A;  1A4P A;  2M29 A;  4I5N B;  3LK1 A;  2KBM A;  3WHT B;  1YUT A;  2K61 A;  5AEQ A;  4XJK B;  1OMV A;  4C0J A;  3BUO B;  3NSI A;  1CB1 A;  1QAS A;  1IKU A;  1XFX O;  1F55 A;  2F8P A;  1MF8 B;  2Q91 A;  1FI5 A;  1JWD A;  3NSO A;  1CMF A;  2M1K B;  4OR9 B;  2M7L A;  3NSL A;  1K96 A;  1ZAC A;  5HKY A;  2JNF A;  2K7O A;  4YBH B;  3IQO A;  1N2D A;  1QVI Y;  1AJ5 A;  3BQ3 A;  4GGF A;  1DT7 B;  1F70 A;  4CPV A;  1BR1 B;  1S6C A;  3TZ1 A;  3CR4 X;  1KFU L;  2CTN A;  1CFP A;  5I2L A;  3EKJ A;  1DJY A;  1DJZ A;  1HQV A;  1FPW A;  4R1E A;  4NDB A;  4GAO A;  1MUX A;  1V1G A;  1NPQ A;  2BBN A;  2JNX A;  1LKJ A;  2V53 A;  4ZCV A;  4WQ2 A;  1QLS A;  1XFY O;  2M7N A;  1ODB A;  2IS9 A;  2EGD A;  4HRH A;  1PAL A;  2E6W A;  1SK6 D;  3TUY B;  1G4Y R;  3SG2 A;  4CID A;  3DD4 A;  2LHI A;  1W7J B;  1OZO A;  2LAP A;  3ICB A;  1RRO A;  1EH2 A;  1QX5 B;  2K2F A;  2KDH A;  3SIB A;  2HF5 A;  2PVB A;  2COL B;  1KSO A;  1GGW A;  2A4J A;  2KAY A;  1DGU A;  4YGB B;  3C1V A;  2CBL A;  1WLM A;  1M45 A;  1PK0 D;  5HKZ A;  2LNK A;  4XJK A;  4DIR A;  1EL4 A;  2LVJ A;  5HYD A;  2KYC A;  1EG4 A;  3SG7 A;  3ZNI A;  1YUR A;  1PSB A;  2JXC A;  3KHE A;  2KYF A;  1SW8 A;  2OTG B;  3I5F B;  4D1E A;  1DF0 A;  1H4B A;  2WOR A;  1IGV A;  1KFX L;  1XVJ A;  4QJ4 B;  1MHO A;  1R6P A;  5D7F A;  1J7Q A;  2Q4U A;  1PVB A;  5GQQ C;  3I5F C;  1IJ5 A;  4AOM A;  2D8N A;  3FS7 A;  3DVM A;  3KF9 A;  1QV1 A;  1OMD A;  4WRI A;  4PCW A;  1Y1A A;  3O6B A;  4PDZ A;  2L51 A;  1CFD A;  1OSA A;  1IRJ A;  1UHN A;  1QV0 A;  4OCI A;  1YUS A;  3IF7 A;  5DKR A;  2CT9 A;  1CDN A;  1Y6W A;  3CR5 X;  2AUC A;  1TRF A;  2KI6 C;  1CTR A;  1CKK A;  1AUI B;  3TS5 B;  2LVK A;  2B1U A;  3GK2 A;  1SL8 A;  1SR6 B;  4ORB B;  3TS5 C;  1GGZ A;  3F45 A;  2F33 A;  2QPT A;  2BCB A;  2KBI A;  2KI6 D;  2I94 A;  1S5G Y;  3PAT A;  5F6T A;  1K8U A;  1F71 A;  5HLO A;  2BE4 A;  3VRP A;  1TNQ A;  1KQV A;  2KHN A;  3RLZ A;  1CMG A;  1YUU A;  4PE1 A;  2JOJ A;  1CDL A;  1B8L A;  5DKQ A;  4AQJ A;  1QLK A;  3VRN A;  4ICB A;  1K2H A;  1QAT A;  2F3Z A;  3BUN B;  2G9B A;  3GK4 X;  2ZN9 A;  4NDD A;  2LM5 A;  1UUR A;  2JT0 A;  3CWG A;  2CCM A;  1C7W A;  4OV2 A;  1DJW A;  4MLW A;  5D69 A;  2FCD A;  4PE7 A;  5KSZ A;  3CLN A;  1QTX A;  1J7O A;  1UHK A;  5G08 A;  3PLF B;  2EC6 C;  2LLT A;  3JTD C;  1LXF C;  1NP8 A;  3PAL A;  1BJF A;  2MA2 A;  2MBX A;  1C07 A;  3QRX A;  2BCA A;  1CM1 A;  2SCP A;  2ZND A;  4P5O E;  1XK4 C;  2Y1N A;  3I5G C;  2JTT A;  2LP3 A;  4NQG A;  3AAK A;  4BY5 A;  3BYA A;  2H61 A;  1KSM A;  1KQM C;  2WCF A;  1PVA A;  1XFZ O;  1J7R A;  1OZS A;  1F4Q A;  1PUL A;  3LCP C;  1BU3 A;  3DVK A;  1RWY A;  1UP5 A;  3OHM B;  1QJT A;  4GNK B;  4MEW A;  1YX7 A;  1FF1 A;  4FQO A;  1LVC D;  4PE4 A;  1CLL A;  1NCY A;  2NCO A;  1H8B A;  2GGZ A;  2QAC A;  3JVT B;  1ZFS A;  3RM1 A;  5CSI A;  1EXR A;  3O4Y A;  4YI9 A;  1ZOT B;  1YRT B;  2BE6 A;  3EK7 A;  3CTN A;  1UWO A;  1DJH A;  3D10 A;  2NCP A;  4OKH A;  2M49 B;  3JVT C;  1VRK A;  3OX6 A;  1BOC A;  1SCM B;  4GGN A;  1NCZ A;  5DKN A;  3TDU A;  1JUO A;  2AAO A;  1SL7 A;  1ALW A;  1UHJ A;  1SCM C;  2LUC A;  3EKH A;  3BUW B;  1K9K A;  1CM4 A;  1B8R A;  4OVN F;  1ZUZ A;  2LMV A;  2EHB A;  1B47 A;  1WLZ A;  1AJ4 A;  1J1D A;  2I18 A;  4C0L A;  3CZT X;  4HSZ A;  1TTX A;  2GGM A;  2PRU A;  2WOS A;  2L0P A;  5BPJ A;  2L4H A;  4YGC B;  2LVV A;  2L5X B;  2PSR A;  2LMU A;  5KTY A;  3I5I B;  1TOP A;  3NXA A;  1J7P A;  3IQQ A;  2MHH A;  1NX0 A;  1A29 A;  1M39 A;  2KQY A;  4N1F A;  3VRQ A;  1MR8 A;  2BEC A;  2O60 A;  3M0W A;  5CSJ A;  2LHL A;  2JPT A;  2M97 A;  3I5I C;  1BF5 A;  1QIV A;  2JUL A;  4MBE A;  2LLU A;  1F4O A;  2AMI A;  2KAX A;  2OPO A;  1ALV A;  3D0Y B;  1SY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...