1K9UA

Crystal structure of the calcium-binding pollen allergen phl p 7 (polcalcin) at 1.75 angstroem
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
DDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polcalcin Phl p 7
publication title The cross-reactive calcium-binding pollen allergen, Phl p 7, reveals a novel dimer assembly
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 29
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9uA00
1YURA 1QV0A 1SCVA 1XK4C 2F33A 2GGZA 5IBWA 2SCPA 5FYXA 1S5GZ 1S5GY 4A4CA 4GGNA 3I5FB 1CFCA 1YVLA 2JPTA 2BE6A 1WRZA 1ZACA 1U5IA 2KAVA 3CZTX 1XFWO 3DD4A 4QJ5B 1MR8A 3BUXB 1C7VA 1R6PA 2F3YA 1JFJA 1R2UA 1DTLA 2LP3A 4MSPA 3PFVA 2ZNEA 2L5XB 1K8UA 1LA3A 1EH2A 1BT6A 1PVAA 1YTZC 1CLMA 1AJ5A 1OMVA 2LNKA 4YI9A 2M9GA 1M39A 2K7OA 4DRWA 2JXLA 2WCBA 2KGRA 4M2OA 2KAYA 4MZJA 2LVIA 1XK4A 1SR6C 1J1DA 1TTXA 2MLFC 1EXRA 2K2FA 3PLFB 1UURA 1F54A 1B47A 4P5OE 1A4PA 1CTRA 1MF8B 1DF0A 4N1FA 1ALVA 4HRGA 1IKUA 2JU0A 2K0JA 4YBHB 4ZCUA 1JF2A 1RROA 4ETOA 2VRGA 2LLSA 2F8PA 4PE4A 1B1GA 1A75A 2G2BA 4MRYA 1N65A 1QXPA 3QRXA 3ZNIA 2KDHA 2E30A 4MVFA 3LK1A 4U8DA 2LC5A 4CIDA 3FWBA 1V1FA 1K93D 1UHKA 2LVJA 1AJ4A 4NDCA 1L7ZA 1KQMB 1Y6WA 2KI4C 1BF5A 3O78A 3WXAA 3HCMA 1KWOC 3I5HB 1QX5B 1G33A 2F2OA 2GV5A 3CWGA 1B8RA 2JNXA 3KEVA 1AUIB 2LLTA 4N1GA 5AERA 2JRFA 1NCYA 1NPQA 1YUSA 1PVBA 4GPLB 1K9PA 1GJYA 4YI8A 1BU3A 1XFYO 2JNFA 1Y1XA 3RLZA 4A4BA 5ER4X 4HREE 3A8RA 2Q4UA 1UHNA 4YGEB 1PK0D 2ZRSA 4AQJA 1F4OA 5HLOA 2KYCA 1JC2A 1KFUS 2V53A 4YGCB 2I94A 4ICBA 4P2YB 1DJZA 1IG5A 1QTXA 2JZIA 4GUKA 3TZ1A 4GBAA 4NDBA 1K95A 2FCEA 2PSRA 4PE7A 2LV7A 2EHBA 3GOFA 1MQ1A 2HQWA 4IL1A 2HQ8A 3OB1B 3I5IB 1OZOA 3C1VA 3MSEB 2JT8A 1QIWA 2K61A 3BXKA 2NCOA 4XJKA 2HPSA 1TOPA 3NSKA 1CM4A 2ISDA 1TNWA 4FQOA 1OMDA 2BCXA 2NCPA 5GQQC 1GGZA 2A4JA 3DF0B 2AUCA 1PULA 3BUMB 3SG2A 4D1EA 2HETA 1NUBA 1KSOA 1UHHA 1QIVA 3WHTB 5AANA 1CLBA 1KSMA 1JBAA 1A29A 4QJ4B 4R1EA 1OZSA 3KHEA 1CDMA 1CFFA 1SCMB 1F71A 2JTTA 3PATA 1CMGA 1KQVA 1EJ3A 3DVJA 4WQ2A 2BL0C 2PRUA 4GGFC 5CSIA 4C0KA 2M8UA 1BOCA 1SRAA 1AP4A 3TUYC 5CSFA 1W7IB 1H8BA 4AOMA 2WCFA 2KI6C 1UWOA 1B8LA 1F55A 2PASA 5HYDA 2KBMA 2K2AA 2K7CA 5K89A 1DVIA 2JQ6A 2LE9B 4NQGA 3EVVA 3JVTB 4PHJA 1AHRA 2EC6B 3PSRA 1XFZO 1B4CA 4MRXA 1RJVA 2L0PA 4XYNA 3FIAA 2BKIB 2M49B 2OTGB 3TDZA 4CLNA 5I2LA 2L50A 1IJ5A 5KU1A 3A4UB 4YGBB 3TS5B 1PALA 1U5IB 1K9KA 4GGFA 4PCWA 1EL4A 5CSNA 1EG3A 1GQMA 5KSZA 2M1UA 2KAXA 4GAOA 1QVIZ 3SG3A 1QVIY 5JOLA 1TNPA 3EK8A 3VROA 1PRWA 2DOQA 1SMGA 3I5GB 4DS7A 2BCAA 2LMTA 3JTDB 1CKKA 5CPVA 4OCIA 4WRIA 3HX4A 1QS7A 1B9AA 1LXFC 3BOWA 2AAOA 4USLA 1NX3A 2JULA 2FCDA 2M1KB 3EK7A 2PALA 2LHIA 1YRUB 1VRKA 2MRDA 3GK2A 1SKTA 3K21A 3IQOA 3KO0A 4MZKA 1IGVA 5AEQA 1DF0B 2I7AA 2KI6D 1CFDA 3BUOB 1K2HA 3EVRA 5DKRA 3O6BA 3DVMA 1QLKA 1WY9A 3OP0A 2MA2A 1A75B 1V1GA 1YX7A 3AAJA 5D7FA 1YUTA 1LINA 2F3ZA 3CR4X 4JWQA 2COLB 1MXLC 5I8NA 2BECA 3AKBA 3VRPA 1IQ3A 2GGMA 3D0YA 5HKWA 1C07A 3KF9A 1H4BA 1LKJA 1J7QA 1L2OC 1RECA 1BMOA 1DJIA 2F2PA 2KGBC 2H61C 3SIBA 3RM1A 1CMFA 2RGIA 4PDZA 1TIZA 1J7PA 1X02A 2O5GA 2MBXA 1XYDA 1OQPA 1QX7A 2OS8B 5B8IB 2ZRTA 1K96A 1KK8B 2NZ0A 3CS1A 3PN7C 2Y1MA 2ZKMX 5AFPA 4AQIA 3CLNA 1QLSA 4TNCA 2BBMA 3OB2B 1DJGA 2NXQA 4I5JA 5I2OA 1J1EA 4JPZB 1J55A 2LAPA 1NYAA 2L98A 1C7WA 3OHMB 5I2QA 1A2XA 3VGOA 1YVHA 1KWOB 2O60A 1Y1UA 4MEWA 1D1OA 2KFHA 1KFUL 2H61A 4HRHA 4L9MA 1IRJA 4I5LB 5BPJA 1J7RA 4I5KA 5ER5A 4WQ3A 1FW4A 5G08A 2QPTA 5TNCA 1MWNA 3PM8A 2IS9A 1WRLA 3H4SE 3SG4A 1YR5A 1K94A 3GK1A 4XJKB 4OR9B 1BLQA 4NDDA 1WLMA 1YUUA 1NWDA 2MAZA 4ORAB 1CNPA 1KFXS 2HF5A 2KHNA 3DVEA 3LL8B 4QJ3B 2G9BA 2WC8A 3DVKA 3SIAA 2EGDA 2FJUB 1NX2A 1DJXA 1TNXA 1B8CA 2LP2A 2CBLA 2M29A 1CLLA 2K7BA 1M31A 1WDCB 5CSJA 1OMRA 3LCPC 2JXCA 2AMIA 1CDNA 2PMYA 1DGVA 3D10A 1SL7A 2KSPA 2L2EA 4PE0A 3BUWB 1CDLA 3TDUA 1SL9A 2H2KA 4CFRA 4GFTA 2Q91A 3EVUA 3O2PA 4MN0A 3ZWHA 1BG1A 3EK4A 1DGUA 1M46A 2EC6C 4OV2A 2OPOA 1QX2A 3BUNB 2TN4A 3FS7A 3I5FC 1G8IA 1LVCD 2BCBA 2JT3A 3EKJA 1IWQA 1KK7Z 1KK7Y 3WHUB 4M2QA 1N2DA 1UHIA 2LM5A 1SPYA 2KOTA 2LMVA 3ICBA 3LK0A 1S26D 4F0ZB 1JUOA 2KBIA 1BODA 1K9UA 2M0RA 4PHNA 1ZUZA 2JT0A 1XFXO 2L4IA 2LVKA 1F8HA 1IH0A 1XO5A 2KNEA 1Y1AA 1SY9A 1AK8A 4BY4A 1TNQA 2PVBA 3NSLA 2LLUA 4I5NB 4N5XA 2LANA 3SG5A 5DKNA 1SYMA 5AXIA 3BOWB 5DKQA 1TCOB 1QATA 1ZOTB 2QACA 4GNKB 2ZFDA 3VRRA 3IF7A 1NP8A 2Y1NA 4OVNF 4DCKA 4FTGA 4Q04A 1K90D 3VRNA 5F6TA 1NSHA 2LUCA 1NX1A 4HSZA 1ZFSA 2KFFA 3OX5A 1ALWA 1F4QA 3PALA 4CPVA 2I2RE 3CGAA 4BY5A 3IQQA 2M7NA 5KTYA 1SK6D 1KQMC 3NSOA 3BYAA 4MBEA 4DIRA 2CCMA 1Y0VH 3I5HC 4OKHA 4ORBB 2P6BB 1DJHA 1SR6B 3TDIA 2L51A 1DMOA 3D0YB 3NXAA 4ZCVA 2M3WA 1MHOA 1RK9A 1JWDA 4YGDB 1FBVA 2OS8C 1TCFA 2SASA 5HKZA 1FF1A 3F45A 3GK4X 4YRUA 1JSAA 2LHLA 1KK8C 1MUXA 1A03A 2BBNA 4ORCB 1BR1B 2Y4QA 1WLZA 2L4HA 5HKYA 2MJWB 3SG6A 2BE4A 2JWWA 2WCEA 1SL8A 1G4YR 2D8NA 2LUXA 1KCYA 2KI4B 3WNXB 2LMUA 4CFQA 3BQ3A 4MZLA 4MLWA 2CXJA 1DJYA 1M63B 1N0YA 1FI6A 2CT9A 1L2OB 2FOTA 1HQVA 1S1EA 3I5IC 1F70A 1PSRA 1ZMZA 1CFPA 1OSAA 2E6WA 1XA5A 2WNDA 3VRQA 2KQ6A 2JOJA 2ZN9A 1UHJA 1SBJA 1QV1A 4UPGA 1RWYA 4PHKA 3PN7B 1S6JA 2KFGA 2MLEC 1CB1A 1YX8A 2K8MB 1B7TZ 1B7TY 2R2IA 1GGWA 2ZNDA 2KQYA 3FWCA 1SCMC 3NSIA 1RTP1 1CM1A 5J3XA 1W7JB 1KFXL 1PSBA 1DJWA 1WDCC 4M2PA 2KYFA 1S6CA 1JFKA 1ODBA 4JQ0D 1S6IA 4DUQA 1DT7B 3SJSA 4E68A 2B1UA 3LLEA 1Q80A 1UP5A 1WRKA 2CNPA 1TRFA 1IQ5A 1OE9B 3E3RA 1J7OA 3DF0A 1CDPA 3EKHA 1BJFA 1E8AA 1AVSA 1NCZA 4PHMA 4C0JA 1UUSA 2BKHB 1XFUO 1BR4B 1SNLA 1XVJA 3JVTC 3CR2A 2WOSA 1FI5A 5HLVA 2CTNA 2LCPA 2I18A 1M45A 4PALA 2M97A 3AAKA 1S36A 2M7LA 2OTGC 2Y5IA 1FPWA 1MXEA 2WORA 4YGAA 2ZN8A 1JF0A 5D69A 3TS5C 3CTNA 5JJGA 1LA0A 3O4YA 1EG4A 4PE1A 1QJTA 3KPXA 1TN4A 1NX0A 1SW8A 1QASA 2NLNA 2LVVA 1OOJA 2BL0B 2MHHA 3M0WA 1RFJA 1S3PA 1HT9A 1NCXA 1YRTB 3I5GC 3SG7A 2JTZA 3TUYB 3JTDC 3OX6A 1NIWA 2K7DA 5PALA 1IJ6A 4C0LA 1XFVO 2JC2A 3AKAA 3CR5X
chains in the Genus database with same CATH superfamily
1YURA 1QV0A 1SCVA 1XK4C 2F33A 2GGZA 5IBWA 2SCPA 5FYXA 1S5GZ 1S5GY 4A4CA 4GGNA 3I5FB 1CFCA 1YVLA 2JPTA 2BE6A 1WRZA 1ZACA 1U5IA 2KAVA 3CZTX 1XFWO 3DD4A 4QJ5B 1MR8A 4FQTA 3UNWA 3BUXB 1C7VA 1DEKA 1R6PA 2F3YA 2QEOA 1JFJA 1R2UA 1DTLA 2LP3A 2WCHA 4MSPA 3PFVA 2ZNEA 2L5XB 1K8UA 1LA3A 1EH2A 1BT6A 1PVAA 1YTZC 1CLMA 1AJ5A 1QWVA 1OMVA 2LNKA 4YI9A 2M9GA 1M39A 2K7OA 4DRWA 2JXLA 2WCBA 2KGRA 4M2OA 2KAYA 4MZJA 2LVIA 1XK4A 1SR6C 1J1DA 3S0FA 1TTXA 2MLFC 4INXA 1EXRA 2K2FA 3PLFB 1UURA 2P71A 1F54A 3FE6A 1B47A 4P5OE 1A4PA 1CTRA 3N7HA 1MF8B 3CZ0A 1DF0A 4N1FA 1ALVA 4HRGA 1IKUA 3PJIA 2JU0A 2K0JA 3NHTA 4YBHB 1JF2A 1RROA 4ZCUA 2WC6A 2VRGA 4ETOA 2LLSA 2F8PA 4PE4A 1B1GA 1A75A 2G2BA 4MRYA 1N65A 1P28A 1QXPA 3QRXA 3ZNIA 2KDHA 2E30A 4MVFA 3LK1A 4U8DA 2LC5A 4INWA 3FWBA 4CIDA 3L4AA 1V1FA 1K93D 1UHKA 2LVJA 1DQEA 1AJ4A 4NDCA 1L7ZA 1KQMB 1Y6WA 2KI4C 1BF5A 3O78A 3WXAA 2L2CA 3HCMA 1KWOC 3I5HB 1QX5B 1G33A 2F2OA 2GV5A 3CWGA 1B8RA 2JNXA 3KEVA 1AUIB 2LLTA 4N1GA 5AERA 2JRFA 1TWOA 5D3OA 1NCYA 1NPQA 4JD9A 1YUSA 3BFAA 1PVBA 4GPLB 3RZSA 1K9PA 1GJYA 4YI8A 1BU3A 1XFYO 2JNFA 1Y1XA 3RLZA 4A4BA 5ER4X 4HREE 3A8RA 2Q4UA 1UHNA 4YGEB 1PK0D 2ZRSA 4AQJA 1W9ZA 1F4OA 5HLOA 2KYCA 4OZDA 1JC2A 1KFUS 2V53A 4YGCB 2I94A 4ICBA 4P2YB 1DJZA 1IG5A 1QTXA 2JZIA 4GUKA 3TZ1A 4GBAA 4NDBA 1ORGA 3D75A 1K95A 2FCEA 2PSRA 4PE7A 2LV7A 2EHBA 3GOFA 2YGUA 1MQ1A 2HQWA 4IL1A 2HQ8A 3OB1B 3I5IB 1OZOA 3C1VA 3MSEB 2JT8A 1QIWA 1Z2CB 2K61A 3BXKA 2NCOA 4XJKA 1Z4HA 1TOPA 2HPSA 1CM4A 3NSKA 2ISDA 1TNWA 4FQOA 1OMDA 2BCXA 2NCPA 5GQQC 1GGZA 2A4JA 3DF0B 2AUCA 1PULA 3BUMB 3SG2A 4D1EA 2HETA 1NUBA 1KSOA 1UHHA 1QIVA 2QDIA 3WHTB 5AANA 1TUJA 1CLBA 1KSMA 1JBAA 1A29A 4QJ4B 4R1EA 1OZSA 3KHEA 1CDMA 2WCMA 1CFFA 1SCMB 1F71A 2JTTA 2KLDA 3NHIA 3PATA 1DC1A 1CMGA 1KQVA 1EJ3A 3DVJA 4WQ2A 2BL0C 2PRUA 3D77A 4GGFC 5CSIA 2M8UA 4C0KA 1BOCA 1SRAA 1AP4A 3TUYC 2WC5A 5CSFA 1W7IB 1H8BA 3DZTA 2WCFA 4AOMA 2KI6C 1UWOA 1B8LA 1F55A 2PASA 5HYDA 2KBMA 2K2AA 2K7CA 3S0BA 5K89A 1DVIA 2JQ6A 2LE9B 3Q8IA 3EVVA 4NQGA 3JVTB 4PHJA 1AHRA 2EC6B 3PSRA 1XFZO 1B4CA 2QEVA 1RJVA 4MRXA 2L0PA 4XYNA 3FIAA 3FE8A 2BKIB 2M49B 2OTGB 3TDZA 4CLNA 5I2LA 2L50A 2WCKA 1IJ5A 5KU1A 3A4UB 4YGBB 3D73A 3QMEA 3TS5B 1PALA 1U5IB 1K9KA 4GGFA 4KYNA 4PCWA 2ERBA 1EL4A 5CSNA 1EG3A 1GQMA 5KSZA 2M1UA 2KAXA 4GAOA 5FI7A 1QVIZ 3SG3A 1QVIY 5JOLA 1TNPA 3EK8A 3VROA 1PRWA 3S0GA 2DOQA 1SMGA 3I5GB 4DS7A 2BCAA 2LMTA 3JTDB 5FI6A 5CPVA 4OCIA 1CKKA 4WRIA 3HX4A 1QS7A 1B9AA 1LXFC 3BOWA 2AAOA 4USLA 1GM0A 1NX3A 2JULA 2FCDA 2M1KB 3EK7A 2PALA 2LHIA 1YRUB 1VRKA 2MRDA 3FE9A 3GK2A 1SKTA 3K21A 3IQOA 3KO0A 4MZKA 1IGVA 5AEQA 1DF0B 1OOFA 2I7AA 2KI6D 1CFDA 3BUOB 1K2HA 3EVRA 3DY9A 5DKRA 2BNXA 3R72A 3B88A 3O6BA 3DVMA 1IIOA 1QLKA 1WY9A 3OP0A 2MA2A 1A75B 3B7AA 1V1GA 1YX7A 3AAJA 5D7FA 1YUTA 1LINA 2F3ZA 3CR4X 4JWQA 2COLB 1MXLC 2P70A 3NGVA 5I8NA 2BECA 3AKBA 3VRPA 1IQ3A 2GGMA 3D0YA 5HKWA 1C07A 3KF9A 1H4BA 1LKJA 1J7QA 1L2OC 1RECA 1BMOA 1DJIA 2F2PA 2KGBC 2H61C 5HL1A 3SIBA 3RM1A 1CMFA 2RGIA 4PDZA 1TIZA 1J7PA 1X02A 2O5GA 3B6XA 3SS4A 2GTEA 2MBXA 1XYDA 1OQPA 1QX7A 2OS8B 3D78A 5B8IB 2L5YA 1OOIX 2KLEA 2ZRTA 1K96A 1KK8B 2NZ0A 3CS1A 3PN7C 2Y1MA 2ZKMX 5AFPA 4AQIA 3CLNA 3CDNA 1QLSA 3S0EA 4TNCA 2K60A 2BBMA 3OB2B 1DJGA 2NXQA 4I5JA 5I2OA 1J1EA 4JPZB 1J55A 2LAPA 1NYAA 2L98A 1C7WA 3OHMB 5I2QA 1A2XA 3VGOA 1YVHA 1KWOB 2O60A 1Y1UA 4MEWA 1D1OA 2KFHA 1KFUL 2H61A 1T14A 4HRHA 1IRJA 4L9MA 4I5LB 5BPJA 1J7RA 4I5KA 5ER5A 4WQ3A 1FW4A 5G08A 2QPTA 5TNCA 1MWNA 3PM8A 2FJYA 1WRLA 2IS9A 3H4SE 3SG4A 1YR5A 3EG5B 1K94A 3GK1A 4XJKB 4OR9B 5DICA 1BLQA 4NDDA 1WLMA 1YUUA 1NWDA 3CYZA 2MAZA 1C3ZA 1OOGA 4ORAB 1CNPA 1KFXS 2BAPA 3O4XA 2HF5A 2KHNA 3DVEA 3LL8B 4QJ3B 2G9BA 2WC8A 3DVKA 3SIAA 2EGDA 2FJUB 1NX2A 1DJXA 1TNXA 1B8CA 2LP2A 1LS8A 2H8VA 2CBLA 2M29A 1CLLA 2K7BA 1M31A 4F7FA 3K1EA 1WDCB 5CSJA 1OMRA 3S0DA 3LCPC 2JXCA 2AMIA 1CDNA 2PMYA 1DGVA 3D10A 1SL7A 1SSEB 2KSPA 2L2EA 3B87A 3V2LA 4PE0A 3BUWB 1CDLA 3TDUA 1SL9A 2H2KA 4CFRA 4GFTA 2Q91A 3EVUA 3O2PA 4MN0A 3ZWHA 1BG1A 3EK4A 3PM2A 3OGNA 3VB1A 1DGUA 1M46A 2EC6C 4OV2A 2OPOA 1QX2A 3BUNB 2TN4A 2PQLA 3FS7A 3I5FC 1DELA 1G8IA 1LVCD 2BCBA 2WCJA 2JT3A 3EKJA 1IWQA 1KK7Z 1KK7Y 3WHUB 4M2QA 1N2DA 1UHIA 4IJ7A 2LM5A 1SPYA 5I94A 2KOTA 2LMVA 3R1PA 3S0AA 3ICBA 3LK0A 1S26D 3R1OA 4F0ZB 1JUOA 2KBIA 1BODA 1K9UA 2M0RA 4PHNA 1ZUZA 4PT1A 2JT0A 1XFXO 2L4IA 2LVKA 1F8HA 1IH0A 1XO5A 2KNEA 1Y1AA 1SY9A 1AK8A 4BY4A 1TNQA 2PVBA 3NSLA 2LLUA 4I5NB 3D74A 4N5XA 2LANA 3SG5A 5DKNA 1SYMA 5AXIA 3BOWB 5DKQA 1TCOB 1QATA 1ZOTB 2QACA 4GNKB 2ZFDA 3VRRA 3IF7A 1NP8A 2Y1NA 4OVNF 4DCKA 4FTGA 4Q04A 1K90D 3VRNA 5F6TA 1NSHA 3CABA 2LUCA 1NX1A 4HSZA 5FI2A 1ZFSA 2KFFA 3CZ1A 3OX5A 1ALWA 1F4QA 3PALA 2WCLA 4CPVA 3BJHA 2I2RE 3CGAA 4BY5A 3IQQA 2M7NA 5KTYA 1SK6D 1KQMC 3NSOA 3BYAA 4MBEA 4JKTA 4DIRA 2QEBA 2CCMA 1Y0VH 3I5HC 4OKHA 3CZ2A 4ORBB 2P6BB 1DJHA 1SR6B 3TDIA 2L51A 2KPHA 1DMOA 3D0YB 3NXAA 4ZCVA 2M3WA 1MHOA 1RK9A 1JWDA 4YGDB 1FBVA 2OS8C 1TCFA 2SASA 5HKZA 1FF1A 2JPOA 3F45A 3GK4X 4YRUA 1JSAA 2LHLA 1KK8C 1MUXA 1A03A 2BBNA 2PYQA 4ORCB 1BR1B 2Y4QA 1WLZA 2L4HA 5HKYA 2MJWB 3D76A 3R1VA 3SG6A 2BE4A 2JWWA 2WCEA 1SL8A 1G4YR 2D8NA 3SS5A 2LUXA 1KCYA 2KI4B 3WNXB 2LMUA 4CFQA 3BQ3A 4MZLA 4MLWA 2CXJA 1DJYA 1M63B 3BFHA 1N0YA 1FI6A 2CT9A 2QEHA 1L2OB 2FOTA 1HQVA 1S1EA 3I5IC 1F70A 1PSRA 1ZMZA 1CFPA 1OSAA 1OW4A 2E6WA 1XA5A 2WNDA 3VRQA 2KQ6A 2JOJA 2ZN9A 1UHJA 1SBJA 1QV1A 4UPGA 3OBVA 1RWYA 3DYEA 4PHKA 3PN7B 1S6JA 2KFGA 2MLEC 1CB1A 1YX8A 2K8MB 1B7TZ 1B7TY 2R2IA 1GGWA 2ZNDA 1OOHA 2KQYA 3FWCA 1SCMC 3NSIA 1RTP1 1CM1A 5J3XA 3L47A 1W7JB 1KFXL 1PSBA 1DJWA 1WDCC 3IVTA 2KYFA 1S6CA 3L4LA 4M2PA 3B86A 1JFKA 1ODBA 4JQ0D 3DXLA 1S6IA 4DUQA 1DT7B 3SJSA 4E68A 2B1UA 3LLEA 1Q80A 1XFRA 1UP5A 1WRKA 2CNPA 1TRFA 3BFBA 1IQ5A 1OE9B 3E3RA 1J7OA 3DF0A 1CDPA 3EKHA 3SS3A 1BJFA 1E8AA 3UO9A 1AVSA 1NCZA 4PHMA 4C0JA 1UUSA 1XFUO 2BKHB 1BR4B 1SNLA 1TUZA 1XVJA 3JVTC 3CR2A 2WOSA 1FI5A 5HLVA 2CTNA 2LCPA 2I18A 1M45A 4PALA 2M97A 3AAKA 1S36A 2M7LA 2OTGC 2Y5IA 1FPWA 1MXEA 2WORA 4YGAA 2ZN8A 1JF0A 5D69A 3TS5C 3CTNA 5JJGA 1LA0A 3O4YA 1EG4A 4PE1A 1QJTA 3KPXA 1TN4A 1NX0A 1SW8A 1QASA 2NLNA 2LVVA 1OOJA 2BL0B 2MHHA 3M0WA 1RFJA 1S3PA 1HT9A 1NCXA 1C3YA 1YRTB 3I5GC 3SG7A 2JTZA 3TUYB 3JTDC 3OX6A 1NIWA 2K7DA 5PALA 1IJ6A 5EL2A 4C0LA 1XFVO 2JC2A 3AKAA 3CR5X
chains in the Genus database with same CATH topology
1YURA 1QV0A 1SCVA 1XK4C 2F33A 2GGZA 5IBWA 2SCPA 5FYXA 1S5GZ 1S5GY 4A4CA 4GGNA 3I5FB 1CFCA 1YVLA 2JPTA 2BE6A 1WRZA 1ZACA 1U5IA 2KAVA 3CZTX 1XFWO 3DD4A 4QJ5B 1MR8A 3BUXB 1C7VA 1R6PA 2F3YA 1JFJA 1R2UA 1DTLA 2LP3A 4MSPA 3PFVA 2ZNEA 2L5XB 1K8UA 1LA3A 1EH2A 1BT6A 1PVAA 1YTZC 1CLMA 1AJ5A 1OMVA 2LNKA 4YI9A 2M9GA 1M39A 2K7OA 4DRWA 2JXLA 2WCBA 2KGRA 4M2OA 2KAYA 4MZJA 2LVIA 1XK4A 1SR6C 1J1DA 1TTXA 2MLFC 1EXRA 2K2FA 3PLFB 1UURA 1F54A 1B47A 4P5OE 1A4PA 1CTRA 1MF8B 1DF0A 4N1FA 1ALVA 4HRGA 1IKUA 2JU0A 2K0JA 4YBHB 4ZCUA 1JF2A 1RROA 4ETOA 2VRGA 2LLSA 2F8PA 4PE4A 1B1GA 1A75A 2G2BA 4MRYA 1N65A 1QXPA 3QRXA 3ZNIA 2KDHA 2E30A 4MVFA 3LK1A 4U8DA 2LC5A 4CIDA 3FWBA 1V1FA 1K93D 1UHKA 2LVJA 1AJ4A 4NDCA 1L7ZA 1KQMB 1Y6WA 2KI4C 1BF5A 3O78A 3WXAA 3HCMA 1KWOC 3I5HB 1QX5B 1G33A 2F2OA 2GV5A 3CWGA 1B8RA 2JNXA 3KEVA 1AUIB 2LLTA 4N1GA 5AERA 2JRFA 1NCYA 1NPQA 1YUSA 1PVBA 4GPLB 1K9PA 1GJYA 4YI8A 1BU3A 1XFYO 2JNFA 1Y1XA 3RLZA 4A4BA 5ER4X 4HREE 3A8RA 2Q4UA 1UHNA 4YGEB 1PK0D 2ZRSA 4AQJA 1F4OA 5HLOA 2KYCA 1JC2A 1KFUS 2V53A 4YGCB 2I94A 4ICBA 4P2YB 1DJZA 1IG5A 1QTXA 2JZIA 4GUKA 3TZ1A 4GBAA 4NDBA 1K95A 2FCEA 2PSRA 4PE7A 2LV7A 2EHBA 3GOFA 1MQ1A 2HQWA 4IL1A 2HQ8A 3OB1B 3I5IB 1OZOA 3C1VA 3MSEB 2JT8A 1QIWA 2K61A 3BXKA 2NCOA 4XJKA 2HPSA 1TOPA 3NSKA 1CM4A 2ISDA 1TNWA 4FQOA 1OMDA 2BCXA 2NCPA 5GQQC 1GGZA 2A4JA 3DF0B 2AUCA 1PULA 3BUMB 3SG2A 4D1EA 2HETA 1NUBA 1KSOA 1UHHA 1QIVA 3WHTB 5AANA 1CLBA 1KSMA 1JBAA 1A29A 4QJ4B 4R1EA 1OZSA 3KHEA 1CDMA 1CFFA 1SCMB 1F71A 2JTTA 3PATA 1CMGA 1KQVA 1EJ3A 3DVJA 4WQ2A 2BL0C 2PRUA 4GGFC 5CSIA 4C0KA 2M8UA 1BOCA 1SRAA 1AP4A 3TUYC 5CSFA 1W7IB 1H8BA 4AOMA 2WCFA 2KI6C 1UWOA 1B8LA 1F55A 2PASA 5HYDA 2KBMA 2K2AA 2K7CA 5K89A 1DVIA 2JQ6A 2LE9B 4NQGA 3EVVA 3JVTB 4PHJA 1AHRA 2EC6B 3PSRA 1XFZO 1B4CA 4MRXA 1RJVA 2L0PA 4XYNA 3FIAA 2BKIB 2M49B 2OTGB 3TDZA 4CLNA 5I2LA 2L50A 1IJ5A 5KU1A 3A4UB 4YGBB 3TS5B 1PALA 1U5IB 1K9KA 4GGFA 4PCWA 1EL4A 5CSNA 1EG3A 1GQMA 5KSZA 2M1UA 2KAXA 4GAOA 1QVIZ 3SG3A 1QVIY 5JOLA 1TNPA 3EK8A 3VROA 1PRWA 2DOQA 1SMGA 3I5GB 4DS7A 2BCAA 2LMTA 3JTDB 1CKKA 5CPVA 4OCIA 4WRIA 3HX4A 1QS7A 1B9AA 1LXFC 3BOWA 2AAOA 4USLA 1NX3A 2JULA 2FCDA 2M1KB 3EK7A 2PALA 2LHIA 1YRUB 1VRKA 2MRDA 3GK2A 1SKTA 3K21A 3IQOA 3KO0A 4MZKA 1IGVA 5AEQA 1DF0B 2I7AA 2KI6D 1CFDA 3BUOB 1K2HA 3EVRA 5DKRA 3O6BA 3DVMA 1QLKA 1WY9A 3OP0A 2MA2A 1A75B 1V1GA 1YX7A 3AAJA 5D7FA 1YUTA 1LINA 2F3ZA 3CR4X 4JWQA 2COLB 1MXLC 5I8NA 2BECA 3AKBA 3VRPA 1IQ3A 2GGMA 3D0YA 5HKWA 1C07A 3KF9A 1H4BA 1LKJA 1J7QA 1L2OC 1RECA 1BMOA 1DJIA 2F2PA 2KGBC 2H61C 3SIBA 3RM1A 1CMFA 2RGIA 4PDZA 1TIZA 1J7PA 1X02A 2O5GA 2MBXA 1XYDA 1OQPA 1QX7A 2OS8B 5B8IB 2ZRTA 1K96A 1KK8B 2NZ0A 3CS1A 3PN7C 2Y1MA 2ZKMX 5AFPA 4AQIA 3CLNA 1QLSA 4TNCA 2BBMA 3OB2B 1DJGA 2NXQA 4I5JA 5I2OA 1J1EA 4JPZB 1J55A 2LAPA 1NYAA 2L98A 1C7WA 3OHMB 5I2QA 1A2XA 3VGOA 1YVHA 1KWOB 2O60A 1Y1UA 4MEWA 1D1OA 2KFHA 1KFUL 2H61A 4HRHA 4L9MA 1IRJA 4I5LB 5BPJA 1J7RA 4I5KA 5ER5A 4WQ3A 1FW4A 5G08A 2QPTA 5TNCA 1MWNA 3PM8A 2IS9A 1WRLA 3H4SE 3SG4A 1YR5A 1K94A 3GK1A 4XJKB 4OR9B 1BLQA 4NDDA 1WLMA 1YUUA 1NWDA 2MAZA 4ORAB 1CNPA 1KFXS 2HF5A 2KHNA 3DVEA 3LL8B 4QJ3B 2G9BA 2WC8A 3DVKA 3SIAA 2EGDA 2FJUB 1NX2A 1DJXA 1TNXA 1B8CA 2LP2A 2CBLA 2M29A 1CLLA 2K7BA 1M31A 1WDCB 5CSJA 1OMRA 3LCPC 2JXCA 2AMIA 1CDNA 2PMYA 1DGVA 3D10A 1SL7A 2KSPA 2L2EA 4PE0A 3BUWB 1CDLA 3TDUA 1SL9A 2H2KA 4CFRA 4GFTA 2Q91A 3EVUA 3O2PA 4MN0A 3ZWHA 1BG1A 3EK4A 1DGUA 1M46A 2EC6C 4OV2A 2OPOA 1QX2A 3BUNB 2TN4A 3FS7A 3I5FC 1G8IA 1LVCD 2BCBA 2JT3A 3EKJA 1IWQA 1KK7Z 1KK7Y 3WHUB 4M2QA 1N2DA 1UHIA 2LM5A 1SPYA 2KOTA 2LMVA 3ICBA 3LK0A 1S26D 4F0ZB 1JUOA 2KBIA 1BODA 1K9UA 2M0RA 4PHNA 1ZUZA 2JT0A 1XFXO 2L4IA 2LVKA 1F8HA 1IH0A 1XO5A 2KNEA 1Y1AA 1SY9A 1AK8A 4BY4A 1TNQA 2PVBA 3NSLA 2LLUA 4I5NB 4N5XA 2LANA 3SG5A 5DKNA 1SYMA 5AXIA 3BOWB 5DKQA 1TCOB 1QATA 1ZOTB 2QACA 4GNKB 2ZFDA 3VRRA 3IF7A 1NP8A 2Y1NA 4OVNF 4DCKA 4FTGA 4Q04A 1K90D 3VRNA 5F6TA 1NSHA 2LUCA 1NX1A 4HSZA 1ZFSA 2KFFA 3OX5A 1ALWA 1F4QA 3PALA 4CPVA 2I2RE 3CGAA 4BY5A 3IQQA 2M7NA 5KTYA 1SK6D 1KQMC 3NSOA 3BYAA 4MBEA 4DIRA 2CCMA 1Y0VH 3I5HC 4OKHA 4ORBB 2P6BB 1DJHA 1SR6B 3TDIA 2L51A 1DMOA 3D0YB 3NXAA 4ZCVA 2M3WA 1MHOA 1RK9A 1JWDA 4YGDB 1FBVA 2OS8C 1TCFA 2SASA 5HKZA 1FF1A 3F45A 3GK4X 4YRUA 1JSAA 2LHLA 1KK8C 1MUXA 1A03A 2BBNA 4ORCB 1BR1B 2Y4QA 1WLZA 2L4HA 5HKYA 2MJWB 3SG6A 2BE4A 2JWWA 2WCEA 1SL8A 1G4YR 2D8NA 2LUXA 1KCYA 2KI4B 3WNXB 2LMUA 4CFQA 3BQ3A 4MZLA 4MLWA 2CXJA 1DJYA 1M63B 1N0YA 1FI6A 2CT9A 1L2OB 2FOTA 1HQVA 1S1EA 3I5IC 1F70A 1PSRA 1ZMZA 1CFPA 1OSAA 2E6WA 1XA5A 2WNDA 3VRQA 2KQ6A 2JOJA 2ZN9A 1UHJA 1SBJA 1QV1A 4UPGA 1RWYA 4PHKA 3PN7B 1S6JA 2KFGA 2MLEC 1CB1A 1YX8A 2K8MB 1B7TZ 1B7TY 2R2IA 1GGWA 2ZNDA 2KQYA 3FWCA 1SCMC 3NSIA 1RTP1 1CM1A 5J3XA 1W7JB 1KFXL 1PSBA 1DJWA 1WDCC 4M2PA 2KYFA 1S6CA 1JFKA 1ODBA 4JQ0D 1S6IA 4DUQA 1DT7B 3SJSA 4E68A 2B1UA 3LLEA 1Q80A 1UP5A 1WRKA 2CNPA 1TRFA 1IQ5A 1OE9B 3E3RA 1J7OA 3DF0A 1CDPA 3EKHA 1BJFA 1E8AA 1AVSA 1NCZA 4PHMA 4C0JA 1UUSA 2BKHB 1XFUO 1BR4B 1SNLA 1XVJA 3JVTC 3CR2A 2WOSA 1FI5A 5HLVA 2CTNA 2LCPA 2I18A 1M45A 4PALA 2M97A 3AAKA 1S36A 2M7LA 2OTGC 2Y5IA 1FPWA 1MXEA 2WORA 4YGAA 2ZN8A 1JF0A 5D69A 3TS5C 3CTNA 5JJGA 1LA0A 3O4YA 1EG4A 4PE1A 1QJTA 3KPXA 1TN4A 1NX0A 1SW8A 1QASA 2NLNA 2LVVA 1OOJA 2BL0B 2MHHA 3M0WA 1RFJA 1S3PA 1HT9A 1NCXA 1YRTB 3I5GC 3SG7A 2JTZA 3TUYB 3JTDC 3OX6A 1NIWA 2K7DA 5PALA 1IJ6A 4C0LA 1XFVO 2JC2A 3AKAA 3CR5X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUR A;  1QV0 A;  1SCV A;  1XK4 C;  2F33 A;  2GGZ A;  5IBW A;  2SCP A;  5FYX A;  1S5G Z;  1S5G Y;  4A4C A;  4GGN A;  3I5F B;  1CFC A;  1YVL A;  2JPT A;  2BE6 A;  1WRZ A;  1ZAC A;  1U5I A;  2KAV A;  3CZT X;  1XFW O;  3DD4 A;  4QJ5 B;  1MR8 A;  3BUX B;  1C7V A;  1R6P A;  2F3Y A;  1JFJ A;  1R2U A;  1DTL A;  2LP3 A;  4MSP A;  3PFV A;  2ZNE A;  2L5X B;  1K8U A;  1LA3 A;  1EH2 A;  1BT6 A;  1PVA A;  1YTZ C;  1CLM A;  1AJ5 A;  1OMV A;  2LNK A;  4YI9 A;  2M9G A;  1M39 A;  2K7O A;  4DRW A;  2JXL A;  2WCB A;  2KGR A;  4M2O A;  2KAY A;  4MZJ A;  2LVI A;  1XK4 A;  1SR6 C;  1J1D A;  1TTX A;  2MLF C;  1EXR A;  2K2F A;  3PLF B;  1UUR A;  1F54 A;  1B47 A;  4P5O E;  1A4P A;  1CTR A;  1MF8 B;  1DF0 A;  4N1F A;  1ALV A;  4HRG A;  1IKU A;  2JU0 A;  2K0J A;  4YBH B;  4ZCU A;  1JF2 A;  1RRO A;  4ETO A;  2VRG A;  2LLS A;  2F8P A;  4PE4 A;  1B1G A;  1A75 A;  2G2B A;  4MRY A;  1N65 A;  1QXP A;  3QRX A;  3ZNI A;  2KDH A;  2E30 A;  4MVF A;  3LK1 A;  4U8D A;  2LC5 A;  4CID A;  3FWB A;  1V1F A;  1K93 D;  1UHK A;  2LVJ A;  1AJ4 A;  4NDC A;  1L7Z A;  1KQM B;  1Y6W A;  2KI4 C;  1BF5 A;  3O78 A;  3WXA A;  3HCM A;  1KWO C;  3I5H B;  1QX5 B;  1G33 A;  2F2O A;  2GV5 A;  3CWG A;  1B8R A;  2JNX A;  3KEV A;  1AUI B;  2LLT A;  4N1G A;  5AER A;  2JRF A;  1NCY A;  1NPQ A;  1YUS A;  1PVB A;  4GPL B;  1K9P A;  1GJY A;  4YI8 A;  1BU3 A;  1XFY O;  2JNF A;  1Y1X A;  3RLZ A;  4A4B A;  5ER4 X;  4HRE E;  3A8R A;  2Q4U A;  1UHN A;  4YGE B;  1PK0 D;  2ZRS A;  4AQJ A;  1F4O A;  5HLO A;  2KYC A;  1JC2 A;  1KFU S;  2V53 A;  4YGC B;  2I94 A;  4ICB A;  4P2Y B;  1DJZ A;  1IG5 A;  1QTX A;  2JZI A;  4GUK A;  3TZ1 A;  4GBA A;  4NDB A;  1K95 A;  2FCE A;  2PSR A;  4PE7 A;  2LV7 A;  2EHB A;  3GOF A;  1MQ1 A;  2HQW A;  4IL1 A;  2HQ8 A;  3OB1 B;  3I5I B;  1OZO A;  3C1V A;  3MSE B;  2JT8 A;  1QIW A;  2K61 A;  3BXK A;  2NCO A;  4XJK A;  2HPS A;  1TOP A;  3NSK A;  1CM4 A;  2ISD A;  1TNW A;  4FQO A;  1OMD A;  2BCX A;  2NCP A;  5GQQ C;  1GGZ A;  2A4J A;  3DF0 B;  2AUC A;  1PUL A;  3BUM B;  3SG2 A;  4D1E A;  2HET A;  1NUB A;  1KSO A;  1UHH A;  1QIV A;  3WHT B;  5AAN A;  1CLB A;  1KSM A;  1JBA A;  1A29 A;  4QJ4 B;  4R1E A;  1OZS A;  3KHE A;  1CDM A;  1CFF A;  1SCM B;  1F71 A;  2JTT A;  3PAT A;  1CMG A;  1KQV A;  1EJ3 A;  3DVJ A;  4WQ2 A;  2BL0 C;  2PRU A;  4GGF C;  5CSI A;  4C0K A;  2M8U A;  1BOC A;  1SRA A;  1AP4 A;  3TUY C;  5CSF A;  1W7I B;  1H8B A;  4AOM A;  2WCF A;  2KI6 C;  1UWO A;  1B8L A;  1F55 A;  2PAS A;  5HYD A;  2KBM A;  2K2A A;  2K7C A;  5K89 A;  1DVI A;  2JQ6 A;  2LE9 B;  4NQG A;  3EVV A;  3JVT B;  4PHJ A;  1AHR A;  2EC6 B;  3PSR A;  1XFZ O;  1B4C A;  4MRX A;  1RJV A;  2L0P A;  4XYN A;  3FIA A;  2BKI B;  2M49 B;  2OTG B;  3TDZ A;  4CLN A;  5I2L A;  2L50 A;  1IJ5 A;  5KU1 A;  3A4U B;  4YGB B;  3TS5 B;  1PAL A;  1U5I B;  1K9K A;  4GGF A;  4PCW A;  1EL4 A;  5CSN A;  1EG3 A;  1GQM A;  5KSZ A;  2M1U A;  2KAX A;  4GAO A;  1QVI Z;  3SG3 A;  1QVI Y;  5JOL A;  1TNP A;  3EK8 A;  3VRO A;  1PRW A;  2DOQ A;  1SMG A;  3I5G B;  4DS7 A;  2BCA A;  2LMT A;  3JTD B;  1CKK A;  5CPV A;  4OCI A;  4WRI A;  3HX4 A;  1QS7 A;  1B9A A;  1LXF C;  3BOW A;  2AAO A;  4USL A;  1NX3 A;  2JUL A;  2FCD A;  2M1K B;  3EK7 A;  2PAL A;  2LHI A;  1YRU B;  1VRK A;  2MRD A;  3GK2 A;  1SKT A;  3K21 A;  3IQO A;  3KO0 A;  4MZK A;  1IGV A;  5AEQ A;  1DF0 B;  2I7A A;  2KI6 D;  1CFD A;  3BUO B;  1K2H A;  3EVR A;  5DKR A;  3O6B A;  3DVM A;  1QLK A;  1WY9 A;  3OP0 A;  2MA2 A;  1A75 B;  1V1G A;  1YX7 A;  3AAJ A;  5D7F A;  1YUT A;  1LIN A;  2F3Z A;  3CR4 X;  4JWQ A;  2COL B;  1MXL C;  5I8N A;  2BEC A;  3AKB A;  3VRP A;  1IQ3 A;  2GGM A;  3D0Y A;  5HKW A;  1C07 A;  3KF9 A;  1H4B A;  1LKJ A;  1J7Q A;  1L2O C;  1REC A;  1BMO A;  1DJI A;  2F2P A;  2KGB C;  2H61 C;  3SIB A;  3RM1 A;  1CMF A;  2RGI A;  4PDZ A;  1TIZ A;  1J7P A;  1X02 A;  2O5G A;  2MBX A;  1XYD A;  1OQP A;  1QX7 A;  2OS8 B;  5B8I B;  2ZRT A;  1K96 A;  1KK8 B;  2NZ0 A;  3CS1 A;  3PN7 C;  2Y1M A;  2ZKM X;  5AFP A;  4AQI A;  3CLN A;  1QLS A;  4TNC A;  2BBM A;  3OB2 B;  1DJG A;  2NXQ A;  4I5J A;  5I2O A;  1J1E A;  4JPZ B;  1J55 A;  2LAP A;  1NYA A;  2L98 A;  1C7W A;  3OHM B;  5I2Q A;  1A2X A;  3VGO A;  1YVH A;  1KWO B;  2O60 A;  1Y1U A;  4MEW A;  1D1O A;  2KFH A;  1KFU L;  2H61 A;  4HRH A;  4L9M A;  1IRJ A;  4I5L B;  5BPJ A;  1J7R A;  4I5K A;  5ER5 A;  4WQ3 A;  1FW4 A;  5G08 A;  2QPT A;  5TNC A;  1MWN A;  3PM8 A;  2IS9 A;  1WRL A;  3H4S E;  3SG4 A;  1YR5 A;  1K94 A;  3GK1 A;  4XJK B;  4OR9 B;  1BLQ A;  4NDD A;  1WLM A;  1YUU A;  1NWD A;  2MAZ A;  4ORA B;  1CNP A;  1KFX S;  2HF5 A;  2KHN A;  3DVE A;  3LL8 B;  4QJ3 B;  2G9B A;  2WC8 A;  3DVK A;  3SIA A;  2EGD A;  2FJU B;  1NX2 A;  1DJX A;  1TNX A;  1B8C A;  2LP2 A;  2CBL A;  2M29 A;  1CLL A;  2K7B A;  1M31 A;  1WDC B;  5CSJ A;  1OMR A;  3LCP C;  2JXC A;  2AMI A;  1CDN A;  2PMY A;  1DGV A;  3D10 A;  1SL7 A;  2KSP A;  2L2E A;  4PE0 A;  3BUW B;  1CDL A;  3TDU A;  1SL9 A;  2H2K A;  4CFR A;  4GFT A;  2Q91 A;  3EVU A;  3O2P A;  4MN0 A;  3ZWH A;  1BG1 A;  3EK4 A;  1DGU A;  1M46 A;  2EC6 C;  4OV2 A;  2OPO A;  1QX2 A;  3BUN B;  2TN4 A;  3FS7 A;  3I5F C;  1G8I A;  1LVC D;  2BCB A;  2JT3 A;  3EKJ A;  1IWQ A;  1KK7 Z;  1KK7 Y;  3WHU B;  4M2Q A;  1N2D A;  1UHI A;  2LM5 A;  1SPY A;  2KOT A;  2LMV A;  3ICB A;  3LK0 A;  1S26 D;  4F0Z B;  1JUO A;  2KBI A;  1BOD A;  1K9U A;  2M0R A;  4PHN A;  1ZUZ A;  2JT0 A;  1XFX O;  2L4I A;  2LVK A;  1F8H A;  1IH0 A;  1XO5 A;  2KNE A;  1Y1A A;  1SY9 A;  1AK8 A;  4BY4 A;  1TNQ A;  2PVB A;  3NSL A;  2LLU A;  4I5N B;  4N5X A;  2LAN A;  3SG5 A;  5DKN A;  1SYM A;  5AXI A;  3BOW B;  5DKQ A;  1TCO B;  1QAT A;  1ZOT B;  2QAC A;  4GNK B;  2ZFD A;  3VRR A;  3IF7 A;  1NP8 A;  2Y1N A;  4OVN F;  4DCK A;  4FTG A;  4Q04 A;  1K90 D;  3VRN A;  5F6T A;  1NSH A;  2LUC A;  1NX1 A;  4HSZ A;  1ZFS A;  2KFF A;  3OX5 A;  1ALW A;  1F4Q A;  3PAL A;  4CPV A;  2I2R E;  3CGA A;  4BY5 A;  3IQQ A;  2M7N A;  5KTY A;  1SK6 D;  1KQM C;  3NSO A;  3BYA A;  4MBE A;  4DIR A;  2CCM A;  1Y0V H;  3I5H C;  4OKH A;  4ORB B;  2P6B B;  1DJH A;  1SR6 B;  3TDI A;  2L51 A;  1DMO A;  3D0Y B;  3NXA A;  4ZCV A;  2M3W A;  1MHO A;  1RK9 A;  1JWD A;  4YGD B;  1FBV A;  2OS8 C;  1TCF A;  2SAS A;  5HKZ A;  1FF1 A;  3F45 A;  3GK4 X;  4YRU A;  1JSA A;  2LHL A;  1KK8 C;  1MUX A;  1A03 A;  2BBN A;  4ORC B;  1BR1 B;  2Y4Q A;  1WLZ A;  2L4H A;  5HKY A;  2MJW B;  3SG6 A;  2BE4 A;  2JWW A;  2WCE A;  1SL8 A;  1G4Y R;  2D8N A;  2LUX A;  1KCY A;  2KI4 B;  3WNX B;  2LMU A;  4CFQ A;  3BQ3 A;  4MZL A;  4MLW A;  2CXJ A;  1DJY A;  1M63 B;  1N0Y A;  1FI6 A;  2CT9 A;  1L2O B;  2FOT A;  1HQV A;  1S1E A;  3I5I C;  1F70 A;  1PSR A;  1ZMZ A;  1CFP A;  1OSA A;  2E6W A;  1XA5 A;  2WND A;  3VRQ A;  2KQ6 A;  2JOJ A;  2ZN9 A;  1UHJ A;  1SBJ A;  1QV1 A;  4UPG A;  1RWY A;  4PHK A;  3PN7 B;  1S6J A;  2KFG A;  2MLE C;  1CB1 A;  1YX8 A;  2K8M B;  1B7T Z;  1B7T Y;  2R2I A;  1GGW A;  2ZND A;  2KQY A;  3FWC A;  1SCM C;  3NSI A;  1RTP 1;  1CM1 A;  5J3X A;  1W7J B;  1KFX L;  1PSB A;  1DJW A;  1WDC C;  4M2P A;  2KYF A;  1S6C A;  1JFK A;  1ODB A;  4JQ0 D;  1S6I A;  4DUQ A;  1DT7 B;  3SJS A;  4E68 A;  2B1U A;  3LLE A;  1Q80 A;  1UP5 A;  1WRK A;  2CNP A;  1TRF A;  1IQ5 A;  1OE9 B;  3E3R A;  1J7O A;  3DF0 A;  1CDP A;  3EKH A;  1BJF A;  1E8A A;  1AVS A;  1NCZ A;  4PHM A;  4C0J A;  1UUS A;  2BKH B;  1XFU O;  1BR4 B;  1SNL A;  1XVJ A;  3JVT C;  3CR2 A;  2WOS A;  1FI5 A;  5HLV A;  2CTN A;  2LCP A;  2I18 A;  1M45 A;  4PAL A;  2M97 A;  3AAK A;  1S36 A;  2M7L A;  2OTG C;  2Y5I A;  1FPW A;  1MXE A;  2WOR A;  4YGA A;  2ZN8 A;  1JF0 A;  5D69 A;  3TS5 C;  3CTN A;  5JJG A;  1LA0 A;  3O4Y A;  1EG4 A;  4PE1 A;  1QJT A;  3KPX A;  1TN4 A;  1NX0 A;  1SW8 A;  1QAS A;  2NLN A;  2LVV A;  1OOJ A;  2BL0 B;  2MHH A;  3M0W A;  1RFJ A;  1S3P A;  1HT9 A;  1NCX A;  1YRT B;  3I5G C;  3SG7 A;  2JTZ A;  3TUY B;  3JTD C;  3OX6 A;  1NIW A;  2K7D A;  5PAL A;  1IJ6 A;  4C0L A;  1XFV O;  2JC2 A;  3AKA A;  3CR5 X; 
#chains in the Genus database with same CATH topology
 1YUR A;  1QV0 A;  1SCV A;  1XK4 C;  2F33 A;  2GGZ A;  5IBW A;  2SCP A;  5FYX A;  1S5G Z;  1S5G Y;  4A4C A;  4GGN A;  3I5F B;  1CFC A;  1YVL A;  2JPT A;  2BE6 A;  1WRZ A;  1ZAC A;  1U5I A;  2KAV A;  3CZT X;  1XFW O;  3DD4 A;  4QJ5 B;  1MR8 A;  4FQT A;  3UNW A;  3BUX B;  1C7V A;  1DEK A;  1R6P A;  2F3Y A;  2QEO A;  1JFJ A;  1R2U A;  1DTL A;  2LP3 A;  2WCH A;  4MSP A;  3PFV A;  2ZNE A;  2L5X B;  1K8U A;  1LA3 A;  1EH2 A;  1BT6 A;  1PVA A;  1YTZ C;  1CLM A;  1AJ5 A;  1QWV A;  1OMV A;  2LNK A;  4YI9 A;  2M9G A;  1M39 A;  2K7O A;  4DRW A;  2JXL A;  2WCB A;  2KGR A;  4M2O A;  2KAY A;  4MZJ A;  2LVI A;  1XK4 A;  1SR6 C;  1J1D A;  3S0F A;  1TTX A;  2MLF C;  4INX A;  1EXR A;  2K2F A;  3PLF B;  1UUR A;  2P71 A;  1F54 A;  3FE6 A;  1B47 A;  4P5O E;  1A4P A;  1CTR A;  3N7H A;  1MF8 B;  3CZ0 A;  1DF0 A;  4N1F A;  1ALV A;  4HRG A;  1IKU A;  3PJI A;  2JU0 A;  2K0J A;  3NHT A;  4YBH B;  1JF2 A;  1RRO A;  4ZCU A;  2WC6 A;  2VRG A;  4ETO A;  2LLS A;  2F8P A;  4PE4 A;  1B1G A;  1A75 A;  2G2B A;  4MRY A;  1N65 A;  1P28 A;  1QXP A;  3QRX A;  3ZNI A;  2KDH A;  2E30 A;  4MVF A;  3LK1 A;  4U8D A;  2LC5 A;  4INW A;  3FWB A;  4CID A;  3L4A A;  1V1F A;  1K93 D;  1UHK A;  2LVJ A;  1DQE A;  1AJ4 A;  4NDC A;  1L7Z A;  1KQM B;  1Y6W A;  2KI4 C;  1BF5 A;  3O78 A;  3WXA A;  2L2C A;  3HCM A;  1KWO C;  3I5H B;  1QX5 B;  1G33 A;  2F2O A;  2GV5 A;  3CWG A;  1B8R A;  2JNX A;  3KEV A;  1AUI B;  2LLT A;  4N1G A;  5AER A;  2JRF A;  1TWO A;  5D3O A;  1NCY A;  1NPQ A;  4JD9 A;  1YUS A;  3BFA A;  1PVB A;  4GPL B;  3RZS A;  1K9P A;  1GJY A;  4YI8 A;  1BU3 A;  1XFY O;  2JNF A;  1Y1X A;  3RLZ A;  4A4B A;  5ER4 X;  4HRE E;  3A8R A;  2Q4U A;  1UHN A;  4YGE B;  1PK0 D;  2ZRS A;  4AQJ A;  1W9Z A;  1F4O A;  5HLO A;  2KYC A;  4OZD A;  1JC2 A;  1KFU S;  2V53 A;  4YGC B;  2I94 A;  4ICB A;  4P2Y B;  1DJZ A;  1IG5 A;  1QTX A;  2JZI A;  4GUK A;  3TZ1 A;  4GBA A;  4NDB A;  1ORG A;  3D75 A;  1K95 A;  2FCE A;  2PSR A;  4PE7 A;  2LV7 A;  2EHB A;  3GOF A;  2YGU A;  1MQ1 A;  2HQW A;  4IL1 A;  2HQ8 A;  3OB1 B;  3I5I B;  1OZO A;  3C1V A;  3MSE B;  2JT8 A;  1QIW A;  1Z2C B;  2K61 A;  3BXK A;  2NCO A;  4XJK A;  1Z4H A;  1TOP A;  2HPS A;  1CM4 A;  3NSK A;  2ISD A;  1TNW A;  4FQO A;  1OMD A;  2BCX A;  2NCP A;  5GQQ C;  1GGZ A;  2A4J A;  3DF0 B;  2AUC A;  1PUL A;  3BUM B;  3SG2 A;  4D1E A;  2HET A;  1NUB A;  1KSO A;  1UHH A;  1QIV A;  2QDI A;  3WHT B;  5AAN A;  1TUJ A;  1CLB A;  1KSM A;  1JBA A;  1A29 A;  4QJ4 B;  4R1E A;  1OZS A;  3KHE A;  1CDM A;  2WCM A;  1CFF A;  1SCM B;  1F71 A;  2JTT A;  2KLD A;  3NHI A;  3PAT A;  1DC1 A;  1CMG A;  1KQV A;  1EJ3 A;  3DVJ A;  4WQ2 A;  2BL0 C;  2PRU A;  3D77 A;  4GGF C;  5CSI A;  2M8U A;  4C0K A;  1BOC A;  1SRA A;  1AP4 A;  3TUY C;  2WC5 A;  5CSF A;  1W7I B;  1H8B A;  3DZT A;  2WCF A;  4AOM A;  2KI6 C;  1UWO A;  1B8L A;  1F55 A;  2PAS A;  5HYD A;  2KBM A;  2K2A A;  2K7C A;  3S0B A;  5K89 A;  1DVI A;  2JQ6 A;  2LE9 B;  3Q8I A;  3EVV A;  4NQG A;  3JVT B;  4PHJ A;  1AHR A;  2EC6 B;  3PSR A;  1XFZ O;  1B4C A;  2QEV A;  1RJV A;  4MRX A;  2L0P A;  4XYN A;  3FIA A;  3FE8 A;  2BKI B;  2M49 B;  2OTG B;  3TDZ A;  4CLN A;  5I2L A;  2L50 A;  2WCK A;  1IJ5 A;  5KU1 A;  3A4U B;  4YGB B;  3D73 A;  3QME A;  3TS5 B;  1PAL A;  1U5I B;  1K9K A;  4GGF A;  4KYN A;  4PCW A;  2ERB A;  1EL4 A;  5CSN A;  1EG3 A;  1GQM A;  5KSZ A;  2M1U A;  2KAX A;  4GAO A;  5FI7 A;  1QVI Z;  3SG3 A;  1QVI Y;  5JOL A;  1TNP A;  3EK8 A;  3VRO A;  1PRW A;  3S0G A;  2DOQ A;  1SMG A;  3I5G B;  4DS7 A;  2BCA A;  2LMT A;  3JTD B;  5FI6 A;  5CPV A;  4OCI A;  1CKK A;  4WRI A;  3HX4 A;  1QS7 A;  1B9A A;  1LXF C;  3BOW A;  2AAO A;  4USL A;  1GM0 A;  1NX3 A;  2JUL A;  2FCD A;  2M1K B;  3EK7 A;  2PAL A;  2LHI A;  1YRU B;  1VRK A;  2MRD A;  3FE9 A;  3GK2 A;  1SKT A;  3K21 A;  3IQO A;  3KO0 A;  4MZK A;  1IGV A;  5AEQ A;  1DF0 B;  1OOF A;  2I7A A;  2KI6 D;  1CFD A;  3BUO B;  1K2H A;  3EVR A;  3DY9 A;  5DKR A;  2BNX A;  3R72 A;  3B88 A;  3O6B A;  3DVM A;  1IIO A;  1QLK A;  1WY9 A;  3OP0 A;  2MA2 A;  1A75 B;  3B7A A;  1V1G A;  1YX7 A;  3AAJ A;  5D7F A;  1YUT A;  1LIN A;  2F3Z A;  3CR4 X;  4JWQ A;  2COL B;  1MXL C;  2P70 A;  3NGV A;  5I8N A;  2BEC A;  3AKB A;  3VRP A;  1IQ3 A;  2GGM A;  3D0Y A;  5HKW A;  1C07 A;  3KF9 A;  1H4B A;  1LKJ A;  1J7Q A;  1L2O C;  1REC A;  1BMO A;  1DJI A;  2F2P A;  2KGB C;  2H61 C;  5HL1 A;  3SIB A;  3RM1 A;  1CMF A;  2RGI A;  4PDZ A;  1TIZ A;  1J7P A;  1X02 A;  2O5G A;  3B6X A;  3SS4 A;  2GTE A;  2MBX A;  1XYD A;  1OQP A;  1QX7 A;  2OS8 B;  3D78 A;  5B8I B;  2L5Y A;  1OOI X;  2KLE A;  2ZRT A;  1K96 A;  1KK8 B;  2NZ0 A;  3CS1 A;  3PN7 C;  2Y1M A;  2ZKM X;  5AFP A;  4AQI A;  3CLN A;  3CDN A;  1QLS A;  3S0E A;  4TNC A;  2K60 A;  2BBM A;  3OB2 B;  1DJG A;  2NXQ A;  4I5J A;  5I2O A;  1J1E A;  4JPZ B;  1J55 A;  2LAP A;  1NYA A;  2L98 A;  1C7W A;  3OHM B;  5I2Q A;  1A2X A;  3VGO A;  1YVH A;  1KWO B;  2O60 A;  1Y1U A;  4MEW A;  1D1O A;  2KFH A;  1KFU L;  2H61 A;  1T14 A;  4HRH A;  1IRJ A;  4L9M A;  4I5L B;  5BPJ A;  1J7R A;  4I5K A;  5ER5 A;  4WQ3 A;  1FW4 A;  5G08 A;  2QPT A;  5TNC A;  1MWN A;  3PM8 A;  2FJY A;  1WRL A;  2IS9 A;  3H4S E;  3SG4 A;  1YR5 A;  3EG5 B;  1K94 A;  3GK1 A;  4XJK B;  4OR9 B;  5DIC A;  1BLQ A;  4NDD A;  1WLM A;  1YUU A;  1NWD A;  3CYZ A;  2MAZ A;  1C3Z A;  1OOG A;  4ORA B;  1CNP A;  1KFX S;  2BAP A;  3O4X A;  2HF5 A;  2KHN A;  3DVE A;  3LL8 B;  4QJ3 B;  2G9B A;  2WC8 A;  3DVK A;  3SIA A;  2EGD A;  2FJU B;  1NX2 A;  1DJX A;  1TNX A;  1B8C A;  2LP2 A;  1LS8 A;  2H8V A;  2CBL A;  2M29 A;  1CLL A;  2K7B A;  1M31 A;  4F7F A;  3K1E A;  1WDC B;  5CSJ A;  1OMR A;  3S0D A;  3LCP C;  2JXC A;  2AMI A;  1CDN A;  2PMY A;  1DGV A;  3D10 A;  1SL7 A;  1SSE B;  2KSP A;  2L2E A;  3B87 A;  3V2L A;  4PE0 A;  3BUW B;  1CDL A;  3TDU A;  1SL9 A;  2H2K A;  4CFR A;  4GFT A;  2Q91 A;  3EVU A;  3O2P A;  4MN0 A;  3ZWH A;  1BG1 A;  3EK4 A;  3PM2 A;  3OGN A;  3VB1 A;  1DGU A;  1M46 A;  2EC6 C;  4OV2 A;  2OPO A;  1QX2 A;  3BUN B;  2TN4 A;  2PQL A;  3FS7 A;  3I5F C;  1DEL A;  1G8I A;  1LVC D;  2BCB A;  2WCJ A;  2JT3 A;  3EKJ A;  1IWQ A;  1KK7 Z;  1KK7 Y;  3WHU B;  4M2Q A;  1N2D A;  1UHI A;  4IJ7 A;  2LM5 A;  1SPY A;  5I94 A;  2KOT A;  2LMV A;  3R1P A;  3S0A A;  3ICB A;  3LK0 A;  1S26 D;  3R1O A;  4F0Z B;  1JUO A;  2KBI A;  1BOD A;  1K9U A;  2M0R A;  4PHN A;  1ZUZ A;  4PT1 A;  2JT0 A;  1XFX O;  2L4I A;  2LVK A;  1F8H A;  1IH0 A;  1XO5 A;  2KNE A;  1Y1A A;  1SY9 A;  1AK8 A;  4BY4 A;  1TNQ A;  2PVB A;  3NSL A;  2LLU A;  4I5N B;  3D74 A;  4N5X A;  2LAN A;  3SG5 A;  5DKN A;  1SYM A;  5AXI A;  3BOW B;  5DKQ A;  1TCO B;  1QAT A;  1ZOT B;  2QAC A;  4GNK B;  2ZFD A;  3VRR A;  3IF7 A;  1NP8 A;  2Y1N A;  4OVN F;  4DCK A;  4FTG A;  4Q04 A;  1K90 D;  3VRN A;  5F6T A;  1NSH A;  3CAB A;  2LUC A;  1NX1 A;  4HSZ A;  5FI2 A;  1ZFS A;  2KFF A;  3CZ1 A;  3OX5 A;  1ALW A;  1F4Q A;  3PAL A;  2WCL A;  4CPV A;  3BJH A;  2I2R E;  3CGA A;  4BY5 A;  3IQQ A;  2M7N A;  5KTY A;  1SK6 D;  1KQM C;  3NSO A;  3BYA A;  4MBE A;  4JKT A;  4DIR A;  2QEB A;  2CCM A;  1Y0V H;  3I5H C;  4OKH A;  3CZ2 A;  4ORB B;  2P6B B;  1DJH A;  1SR6 B;  3TDI A;  2L51 A;  2KPH A;  1DMO A;  3D0Y B;  3NXA A;  4ZCV A;  2M3W A;  1MHO A;  1RK9 A;  1JWD A;  4YGD B;  1FBV A;  2OS8 C;  1TCF A;  2SAS A;  5HKZ A;  1FF1 A;  2JPO A;  3F45 A;  3GK4 X;  4YRU A;  1JSA A;  2LHL A;  1KK8 C;  1MUX A;  1A03 A;  2BBN A;  2PYQ A;  4ORC B;  1BR1 B;  2Y4Q A;  1WLZ A;  2L4H A;  5HKY A;  2MJW B;  3D76 A;  3R1V A;  3SG6 A;  2BE4 A;  2JWW A;  2WCE A;  1SL8 A;  1G4Y R;  2D8N A;  3SS5 A;  2LUX A;  1KCY A;  2KI4 B;  3WNX B;  2LMU A;  4CFQ A;  3BQ3 A;  4MZL A;  4MLW A;  2CXJ A;  1DJY A;  1M63 B;  3BFH A;  1N0Y A;  1FI6 A;  2CT9 A;  2QEH A;  1L2O B;  2FOT A;  1HQV A;  1S1E A;  3I5I C;  1F70 A;  1PSR A;  1ZMZ A;  1CFP A;  1OSA A;  1OW4 A;  2E6W A;  1XA5 A;  2WND A;  3VRQ A;  2KQ6 A;  2JOJ A;  2ZN9 A;  1UHJ A;  1SBJ A;  1QV1 A;  4UPG A;  3OBV A;  1RWY A;  3DYE A;  4PHK A;  3PN7 B;  1S6J A;  2KFG A;  2MLE C;  1CB1 A;  1YX8 A;  2K8M B;  1B7T Z;  1B7T Y;  2R2I A;  1GGW A;  2ZND A;  1OOH A;  2KQY A;  3FWC A;  1SCM C;  3NSI A;  1RTP 1;  1CM1 A;  5J3X A;  3L47 A;  1W7J B;  1KFX L;  1PSB A;  1DJW A;  1WDC C;  3IVT A;  2KYF A;  1S6C A;  3L4L A;  4M2P A;  3B86 A;  1JFK A;  1ODB A;  4JQ0 D;  3DXL A;  1S6I A;  4DUQ A;  1DT7 B;  3SJS A;  4E68 A;  2B1U A;  3LLE A;  1Q80 A;  1XFR A;  1UP5 A;  1WRK A;  2CNP A;  1TRF A;  3BFB A;  1IQ5 A;  1OE9 B;  3E3R A;  1J7O A;  3DF0 A;  1CDP A;  3EKH A;  3SS3 A;  1BJF A;  1E8A A;  3UO9 A;  1AVS A;  1NCZ A;  4PHM A;  4C0J A;  1UUS A;  1XFU O;  2BKH B;  1BR4 B;  1SNL A;  1TUZ A;  1XVJ A;  3JVT C;  3CR2 A;  2WOS A;  1FI5 A;  5HLV A;  2CTN A;  2LCP A;  2I18 A;  1M45 A;  4PAL A;  2M97 A;  3AAK A;  1S36 A;  2M7L A;  2OTG C;  2Y5I A;  1FPW A;  1MXE A;  2WOR A;  4YGA A;  2ZN8 A;  1JF0 A;  5D69 A;  3TS5 C;  3CTN A;  5JJG A;  1LA0 A;  3O4Y A;  1EG4 A;  4PE1 A;  1QJT A;  3KPX A;  1TN4 A;  1NX0 A;  1SW8 A;  1QAS A;  2NLN A;  2LVV A;  1OOJ A;  2BL0 B;  2MHH A;  3M0W A;  1RFJ A;  1S3P A;  1HT9 A;  1NCX A;  1C3Y A;  1YRT B;  3I5G C;  3SG7 A;  2JTZ A;  3TUY B;  3JTD C;  3OX6 A;  1NIW A;  2K7D A;  5PAL A;  1IJ6 A;  5EL2 A;  4C0L A;  1XFV O;  2JC2 A;  3AKA A;  3CR5 X; 
#chains in the Genus database with same CATH homology
 1YUR A;  1QV0 A;  1SCV A;  1XK4 C;  2F33 A;  2GGZ A;  5IBW A;  2SCP A;  5FYX A;  1S5G Z;  1S5G Y;  4A4C A;  4GGN A;  3I5F B;  1CFC A;  1YVL A;  2JPT A;  2BE6 A;  1WRZ A;  1ZAC A;  1U5I A;  2KAV A;  3CZT X;  1XFW O;  3DD4 A;  4QJ5 B;  1MR8 A;  3BUX B;  1C7V A;  1R6P A;  2F3Y A;  1JFJ A;  1R2U A;  1DTL A;  2LP3 A;  4MSP A;  3PFV A;  2ZNE A;  2L5X B;  1K8U A;  1LA3 A;  1EH2 A;  1BT6 A;  1PVA A;  1YTZ C;  1CLM A;  1AJ5 A;  1OMV A;  2LNK A;  4YI9 A;  2M9G A;  1M39 A;  2K7O A;  4DRW A;  2JXL A;  2WCB A;  2KGR A;  4M2O A;  2KAY A;  4MZJ A;  2LVI A;  1XK4 A;  1SR6 C;  1J1D A;  1TTX A;  2MLF C;  1EXR A;  2K2F A;  3PLF B;  1UUR A;  1F54 A;  1B47 A;  4P5O E;  1A4P A;  1CTR A;  1MF8 B;  1DF0 A;  4N1F A;  1ALV A;  4HRG A;  1IKU A;  2JU0 A;  2K0J A;  4YBH B;  4ZCU A;  1JF2 A;  1RRO A;  4ETO A;  2VRG A;  2LLS A;  2F8P A;  4PE4 A;  1B1G A;  1A75 A;  2G2B A;  4MRY A;  1N65 A;  1QXP A;  3QRX A;  3ZNI A;  2KDH A;  2E30 A;  4MVF A;  3LK1 A;  4U8D A;  2LC5 A;  4CID A;  3FWB A;  1V1F A;  1K93 D;  1UHK A;  2LVJ A;  1AJ4 A;  4NDC A;  1L7Z A;  1KQM B;  1Y6W A;  2KI4 C;  1BF5 A;  3O78 A;  3WXA A;  3HCM A;  1KWO C;  3I5H B;  1QX5 B;  1G33 A;  2F2O A;  2GV5 A;  3CWG A;  1B8R A;  2JNX A;  3KEV A;  1AUI B;  2LLT A;  4N1G A;  5AER A;  2JRF A;  1NCY A;  1NPQ A;  1YUS A;  1PVB A;  4GPL B;  1K9P A;  1GJY A;  4YI8 A;  1BU3 A;  1XFY O;  2JNF A;  1Y1X A;  3RLZ A;  4A4B A;  5ER4 X;  4HRE E;  3A8R A;  2Q4U A;  1UHN A;  4YGE B;  1PK0 D;  2ZRS A;  4AQJ A;  1F4O A;  5HLO A;  2KYC A;  1JC2 A;  1KFU S;  2V53 A;  4YGC B;  2I94 A;  4ICB A;  4P2Y B;  1DJZ A;  1IG5 A;  1QTX A;  2JZI A;  4GUK A;  3TZ1 A;  4GBA A;  4NDB A;  1K95 A;  2FCE A;  2PSR A;  4PE7 A;  2LV7 A;  2EHB A;  3GOF A;  1MQ1 A;  2HQW A;  4IL1 A;  2HQ8 A;  3OB1 B;  3I5I B;  1OZO A;  3C1V A;  3MSE B;  2JT8 A;  1QIW A;  2K61 A;  3BXK A;  2NCO A;  4XJK A;  2HPS A;  1TOP A;  3NSK A;  1CM4 A;  2ISD A;  1TNW A;  4FQO A;  1OMD A;  2BCX A;  2NCP A;  5GQQ C;  1GGZ A;  2A4J A;  3DF0 B;  2AUC A;  1PUL A;  3BUM B;  3SG2 A;  4D1E A;  2HET A;  1NUB A;  1KSO A;  1UHH A;  1QIV A;  3WHT B;  5AAN A;  1CLB A;  1KSM A;  1JBA A;  1A29 A;  4QJ4 B;  4R1E A;  1OZS A;  3KHE A;  1CDM A;  1CFF A;  1SCM B;  1F71 A;  2JTT A;  3PAT A;  1CMG A;  1KQV A;  1EJ3 A;  3DVJ A;  4WQ2 A;  2BL0 C;  2PRU A;  4GGF C;  5CSI A;  4C0K A;  2M8U A;  1BOC A;  1SRA A;  1AP4 A;  3TUY C;  5CSF A;  1W7I B;  1H8B A;  4AOM A;  2WCF A;  2KI6 C;  1UWO A;  1B8L A;  1F55 A;  2PAS A;  5HYD A;  2KBM A;  2K2A A;  2K7C A;  5K89 A;  1DVI A;  2JQ6 A;  2LE9 B;  4NQG A;  3EVV A;  3JVT B;  4PHJ A;  1AHR A;  2EC6 B;  3PSR A;  1XFZ O;  1B4C A;  4MRX A;  1RJV A;  2L0P A;  4XYN A;  3FIA A;  2BKI B;  2M49 B;  2OTG B;  3TDZ A;  4CLN A;  5I2L A;  2L50 A;  1IJ5 A;  5KU1 A;  3A4U B;  4YGB B;  3TS5 B;  1PAL A;  1U5I B;  1K9K A;  4GGF A;  4PCW A;  1EL4 A;  5CSN A;  1EG3 A;  1GQM A;  5KSZ A;  2M1U A;  2KAX A;  4GAO A;  1QVI Z;  3SG3 A;  1QVI Y;  5JOL A;  1TNP A;  3EK8 A;  3VRO A;  1PRW A;  2DOQ A;  1SMG A;  3I5G B;  4DS7 A;  2BCA A;  2LMT A;  3JTD B;  1CKK A;  5CPV A;  4OCI A;  4WRI A;  3HX4 A;  1QS7 A;  1B9A A;  1LXF C;  3BOW A;  2AAO A;  4USL A;  1NX3 A;  2JUL A;  2FCD A;  2M1K B;  3EK7 A;  2PAL A;  2LHI A;  1YRU B;  1VRK A;  2MRD A;  3GK2 A;  1SKT A;  3K21 A;  3IQO A;  3KO0 A;  4MZK A;  1IGV A;  5AEQ A;  1DF0 B;  2I7A A;  2KI6 D;  1CFD A;  3BUO B;  1K2H A;  3EVR A;  5DKR A;  3O6B A;  3DVM A;  1QLK A;  1WY9 A;  3OP0 A;  2MA2 A;  1A75 B;  1V1G A;  1YX7 A;  3AAJ A;  5D7F A;  1YUT A;  1LIN A;  2F3Z A;  3CR4 X;  4JWQ A;  2COL B;  1MXL C;  5I8N A;  2BEC A;  3AKB A;  3VRP A;  1IQ3 A;  2GGM A;  3D0Y A;  5HKW A;  1C07 A;  3KF9 A;  1H4B A;  1LKJ A;  1J7Q A;  1L2O C;  1REC A;  1BMO A;  1DJI A;  2F2P A;  2KGB C;  2H61 C;  3SIB A;  3RM1 A;  1CMF A;  2RGI A;  4PDZ A;  1TIZ A;  1J7P A;  1X02 A;  2O5G A;  2MBX A;  1XYD A;  1OQP A;  1QX7 A;  2OS8 B;  5B8I B;  2ZRT A;  1K96 A;  1KK8 B;  2NZ0 A;  3CS1 A;  3PN7 C;  2Y1M A;  2ZKM X;  5AFP A;  4AQI A;  3CLN A;  1QLS A;  4TNC A;  2BBM A;  3OB2 B;  1DJG A;  2NXQ A;  4I5J A;  5I2O A;  1J1E A;  4JPZ B;  1J55 A;  2LAP A;  1NYA A;  2L98 A;  1C7W A;  3OHM B;  5I2Q A;  1A2X A;  3VGO A;  1YVH A;  1KWO B;  2O60 A;  1Y1U A;  4MEW A;  1D1O A;  2KFH A;  1KFU L;  2H61 A;  4HRH A;  4L9M A;  1IRJ A;  4I5L B;  5BPJ A;  1J7R A;  4I5K A;  5ER5 A;  4WQ3 A;  1FW4 A;  5G08 A;  2QPT A;  5TNC A;  1MWN A;  3PM8 A;  2IS9 A;  1WRL A;  3H4S E;  3SG4 A;  1YR5 A;  1K94 A;  3GK1 A;  4XJK B;  4OR9 B;  1BLQ A;  4NDD A;  1WLM A;  1YUU A;  1NWD A;  2MAZ A;  4ORA B;  1CNP A;  1KFX S;  2HF5 A;  2KHN A;  3DVE A;  3LL8 B;  4QJ3 B;  2G9B A;  2WC8 A;  3DVK A;  3SIA A;  2EGD A;  2FJU B;  1NX2 A;  1DJX A;  1TNX A;  1B8C A;  2LP2 A;  2CBL A;  2M29 A;  1CLL A;  2K7B A;  1M31 A;  1WDC B;  5CSJ A;  1OMR A;  3LCP C;  2JXC A;  2AMI A;  1CDN A;  2PMY A;  1DGV A;  3D10 A;  1SL7 A;  2KSP A;  2L2E A;  4PE0 A;  3BUW B;  1CDL A;  3TDU A;  1SL9 A;  2H2K A;  4CFR A;  4GFT A;  2Q91 A;  3EVU A;  3O2P A;  4MN0 A;  3ZWH A;  1BG1 A;  3EK4 A;  1DGU A;  1M46 A;  2EC6 C;  4OV2 A;  2OPO A;  1QX2 A;  3BUN B;  2TN4 A;  3FS7 A;  3I5F C;  1G8I A;  1LVC D;  2BCB A;  2JT3 A;  3EKJ A;  1IWQ A;  1KK7 Z;  1KK7 Y;  3WHU B;  4M2Q A;  1N2D A;  1UHI A;  2LM5 A;  1SPY A;  2KOT A;  2LMV A;  3ICB A;  3LK0 A;  1S26 D;  4F0Z B;  1JUO A;  2KBI A;  1BOD A;  1K9U A;  2M0R A;  4PHN A;  1ZUZ A;  2JT0 A;  1XFX O;  2L4I A;  2LVK A;  1F8H A;  1IH0 A;  1XO5 A;  2KNE A;  1Y1A A;  1SY9 A;  1AK8 A;  4BY4 A;  1TNQ A;  2PVB A;  3NSL A;  2LLU A;  4I5N B;  4N5X A;  2LAN A;  3SG5 A;  5DKN A;  1SYM A;  5AXI A;  3BOW B;  5DKQ A;  1TCO B;  1QAT A;  1ZOT B;  2QAC A;  4GNK B;  2ZFD A;  3VRR A;  3IF7 A;  1NP8 A;  2Y1N A;  4OVN F;  4DCK A;  4FTG A;  4Q04 A;  1K90 D;  3VRN A;  5F6T A;  1NSH A;  2LUC A;  1NX1 A;  4HSZ A;  1ZFS A;  2KFF A;  3OX5 A;  1ALW A;  1F4Q A;  3PAL A;  4CPV A;  2I2R E;  3CGA A;  4BY5 A;  3IQQ A;  2M7N A;  5KTY A;  1SK6 D;  1KQM C;  3NSO A;  3BYA A;  4MBE A;  4DIR A;  2CCM A;  1Y0V H;  3I5H C;  4OKH A;  4ORB B;  2P6B B;  1DJH A;  1SR6 B;  3TDI A;  2L51 A;  1DMO A;  3D0Y B;  3NXA A;  4ZCV A;  2M3W A;  1MHO A;  1RK9 A;  1JWD A;  4YGD B;  1FBV A;  2OS8 C;  1TCF A;  2SAS A;  5HKZ A;  1FF1 A;  3F45 A;  3GK4 X;  4YRU A;  1JSA A;  2LHL A;  1KK8 C;  1MUX A;  1A03 A;  2BBN A;  4ORC B;  1BR1 B;  2Y4Q A;  1WLZ A;  2L4H A;  5HKY A;  2MJW B;  3SG6 A;  2BE4 A;  2JWW A;  2WCE A;  1SL8 A;  1G4Y R;  2D8N A;  2LUX A;  1KCY A;  2KI4 B;  3WNX B;  2LMU A;  4CFQ A;  3BQ3 A;  4MZL A;  4MLW A;  2CXJ A;  1DJY A;  1M63 B;  1N0Y A;  1FI6 A;  2CT9 A;  1L2O B;  2FOT A;  1HQV A;  1S1E A;  3I5I C;  1F70 A;  1PSR A;  1ZMZ A;  1CFP A;  1OSA A;  2E6W A;  1XA5 A;  2WND A;  3VRQ A;  2KQ6 A;  2JOJ A;  2ZN9 A;  1UHJ A;  1SBJ A;  1QV1 A;  4UPG A;  1RWY A;  4PHK A;  3PN7 B;  1S6J A;  2KFG A;  2MLE C;  1CB1 A;  1YX8 A;  2K8M B;  1B7T Z;  1B7T Y;  2R2I A;  1GGW A;  2ZND A;  2KQY A;  3FWC A;  1SCM C;  3NSI A;  1RTP 1;  1CM1 A;  5J3X A;  1W7J B;  1KFX L;  1PSB A;  1DJW A;  1WDC C;  4M2P A;  2KYF A;  1S6C A;  1JFK A;  1ODB A;  4JQ0 D;  1S6I A;  4DUQ A;  1DT7 B;  3SJS A;  4E68 A;  2B1U A;  3LLE A;  1Q80 A;  1UP5 A;  1WRK A;  2CNP A;  1TRF A;  1IQ5 A;  1OE9 B;  3E3R A;  1J7O A;  3DF0 A;  1CDP A;  3EKH A;  1BJF A;  1E8A A;  1AVS A;  1NCZ A;  4PHM A;  4C0J A;  1UUS A;  2BKH B;  1XFU O;  1BR4 B;  1SNL A;  1XVJ A;  3JVT C;  3CR2 A;  2WOS A;  1FI5 A;  5HLV A;  2CTN A;  2LCP A;  2I18 A;  1M45 A;  4PAL A;  2M97 A;  3AAK A;  1S36 A;  2M7L A;  2OTG C;  2Y5I A;  1FPW A;  1MXE A;  2WOR A;  4YGA A;  2ZN8 A;  1JF0 A;  5D69 A;  3TS5 C;  3CTN A;  5JJG A;  1LA0 A;  3O4Y A;  1EG4 A;  4PE1 A;  1QJT A;  3KPX A;  1TN4 A;  1NX0 A;  1SW8 A;  1QAS A;  2NLN A;  2LVV A;  1OOJ A;  2BL0 B;  2MHH A;  3M0W A;  1RFJ A;  1S3P A;  1HT9 A;  1NCX A;  1YRT B;  3I5G C;  3SG7 A;  2JTZ A;  3TUY B;  3JTD C;  3OX6 A;  1NIW A;  2K7D A;  5PAL A;  1IJ6 A;  4C0L A;  1XFV O;  2JC2 A;  3AKA A;  3CR5 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...