1K9UA

Crystal structure of the calcium-binding pollen allergen phl p 7 (polcalcin) at 1.75 angstroem
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
76
structure length
76
Chain Sequence
DDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Polcalcin Phl p 7
publication title The cross-reactive calcium-binding pollen allergen, Phl p 7, reveals a novel dimer assembly
pubmed doi rcsb
source organism Phleum pratense
total genus 29
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k9uA00
1DF0B 2MJWB 5HLVA 3JVTB 1AP4A 3HCMA 3O6BA 2JULA 1R6PA 1B7TZ 1XYDA 2OS8B 3SG2A 1IQ5A 4JQ0D 2QACA 3AAKA 1IH0A 1B7TY 1XFXO 4YI9A 4JPZB 2LHIA 2Q91A 2KYCA 3LK1A 2F8PA 4FTGA 1B1GA 1WDCB 2BKIB 1F55A 1SNLA 2KGBC 4YGAA 2ZRTA 5CSFA 1F54A 1Y1XA 1NSHA 3DVMA 1NX1A 1CFDA 4R1EA 2K7DA 1Y1AA 1NP8A 5TNCA 1AUIB 1L7ZA 4YGBB 4MRXA 1EL4A 1KFXL 2JXLA 4FQOA 5DKNA 2LVVA 1BR1B 1JUOA 3DF0B 1ALVA 1RTP1 2K7BA 1XFZO 2CXJA 2IS9A 2PRUA 1ALWA 1B8RA 1WLMA 1G8IA 2KQ6A 1BODA 1JWDA 4YI8A 2KDHA 1NX2A 2JTZA 1W7IB 2EHBA 2LLSA 3TDUA 1J1DA 4AOMA 1SCVA 4OCIA 1SRAA 4OVNF 4M2OA 3SG7A 4GAOA 3OX5A 1GGZA 2SCPA 5HLOA 3ZWHA 3SG3A 1QXPA 1JBAA 3PN7C 3BQ3A 5AEQA 4GGNA 5D7FA 5F6TA 4AQIA 3SG4A 4N1GA 3HX4A 3OP0A 2JNXA 1IG5A 1DJGA 2NCOA 1Y1UA 2JOJA 1TN4A 5DKRA 4GBAA 4MBEA 4DCKA 1WRKA 2I7AA 1A75A 1JFJA 1A4PA 2LM5A 3H4SE 1ODBA 1KSMA 2BL0B 4TNCA 1N65A 2LV7A 2HETA 5G08A 3SG6A 1A75B 1EH2A 2KFHA 1UHKA 2GGZA 3CR4X 3LK0A 1SPYA 2CCMA 4JWQA 1ZACA 1E8AA 1BF5A 1F8HA 5JOLA 1ZMZA 2HQ8A 1CM4A 4QJ3B 1DJWA 4DS7A 4I5LB 3NSOA 2JPTA 2LE9B 1M63B 1L2OC 3GOFA 1EG3A 3EVRA 2HF5A 4HRGA 1CKKA 2KI4C 1N0YA 2K8MB 5FYXA 3SIAA 1B47A 1CMFA 1LINA 1DJZA 2JZIA 2LNKA 4XJKA 3WNXB 1C7VA 4ORBB 1OSAA 3NSKA 2WOSA 2L51A 1PRWA 1IJ5A 3SIBA 3TUYC 1A2XA 1K94A 4XJKB 3EVUA 2BCBA 2WCBA 1KWOC 2WCFA 5ER5A 3NSLA 1WRZA 1BG1A 3JTDC 1S5GZ 3WHUB 4C0KA 1N2DA 1YX8A 2PALA 4DRWA 2FJUB 1D1OA 2OTGC 1SY9A 1B4CA 1NCZA 1BJFA 2F2OA 4CIDA 4HRHA 4OV2A 3E3RA 1YUSA 5HKZA 3GK4X 3O2PA 2KOTA 1IGVA 1R2UA 2LUCA 1FW4A 1DJXA 3BUXB 2CBLA 1H8BA 1QVIZ 5KSZA 3I5IC 3I5HB 4YBHB 1MR8A 1XO5A 4I5JA 1QVIY 1CTRA 2KI6C 3ICBA 5B8IB 1SBJA 1JSAA 2G9BA 1XFUO 2RGIA 3DVEA 2D8NA 1DVIA 1K96A 2KAVA 1BOCA 2KI6D 1SK6D 1KQMB 2PSRA 2L2EA 3MSEB 4U8DA 1OMVA 1QIWA 1YVLA 1DT7B 1SL9A 1AJ4A 1QASA 5CSNA 1TNXA 2BCAA 2NXQA 1FPWA 2MLEC 3A4UB 3PFVA 1M31A 1YUTA 3FWCA 2KAYA 2Q4UA 2GGMA 2WNDA 4GUKA 1CDPA 2ISDA 1GQMA 4NDDA 1VRKA 1WY9A 2K61A 3TS5B 4PE7A 1B8LA 3JVTC 1LA0A 1QX7A 1S6JA 1XK4C 4DUQA 4WRIA 2ZN8A 2PVBA 4A4BA 4M2PA 4PHKA 3FS7A 2OS8C 4YGEB 1F70A 4MEWA 3O78A 1AJ5A 3GK2A 5IBWA 1OMDA 4PHMA 2LC5A 2COLB 1C7WA 1DJIA 1M46A 1Q80A 2L98A 1K90D 1WDCC 2FCDA 2H2KA 1TOPA 1QLSA 3FWBA 2LAPA 3BOWA 4AQJA 1SKTA 4HSZA 2L5XB 2LP2A 3EK7A 3D0YA 2LMTA 1DTLA 2QPTA 2K0JA 4MZJA 4NDCA 3RLZA 2LMVA 1K95A 1QTXA 2GV5A 2JXCA 2ZFDA 5JJGA 1UHIA 1V1FA 4XYNA 1XA5A 2FOTA 2Y5IA 3SJSA 5K89A 1K9PA 2O5GA 3IQOA 4PCWA 1NPQA 1ZOTB 1UHJA 3IQQA 3KHEA 4PE0A 1PSRA 4ORAB 5AFPA 3BUMB 2M7NA 2BECA 2CT9A 4WQ3A 2KFGA 1YRUB 1QX2A 2F2PA 3PN7B 1J7QA 1YURA 5AXIA 4QJ4B 4ETOA 1YTZC 4PDZA 1DJYA 1IWQA 2P6BB 1KFUS 3BXKA 1BLQA 1BT6A 1JFKA 4PALA 2LP3A 1X02A 2M8UA 1H4BA 3A8RA 1CLLA 2M3WA 5HKWA 2NLNA 1OE9B 3TDZA 3CGAA 1XVJA 1JF2A 2JC2A 4USLA 3VRNA 1SR6C 4OKHA 4CFQA 1PSBA 2KQYA 2KFFA 1NUBA 5J3XA 1XFVO 2BL0C 2CNPA 1TTXA 1MXLC 2L50A 3NXAA 4P5OE 1SMGA 1XFYO 2EC6C 2KBIA 3CZTX 3OB1B 2DOQA 3BUNB 1Y0VH 3OB2B 5CSIA 1YRTB 2F3YA 4PHNA 1TRFA 1B9AA 2R2IA 1MQ1A 3CLNA 3ZNIA 1L2OB 5I2QA 1JF0A 2KAXA 2WORA 4D1EA 2KI4B 1Y6WA 2JU0A 1CLBA 1KK8B 1IRJA 2KYFA 2Y1MA 2M7LA 2K7OA 3WHTB 1XFWO 1BR4B 3DD4A 1RK9A 1S3PA 4I5KA 1MF8B 5GQQC 2BE4A 1CNPA 3C1VA 1SW8A 1UURA 2L4HA 2ZRSA 1KK7Z 1FF1A 1NX3A 3F45A 5PALA 3WXAA 3LLEA 1KK7Y 4QJ5B 4GPLB 4YRUA 1J7RA 2B1UA 2EGDA 4NDBA 2AAOA 1OQPA 2OTGB 1QV1A 1QV0A 1GJYA 1F4QA 1NYAA 3CTNA 3CR2A 3BYAA 5ER4X 2WC8A 2JT3A 3DVKA 3I5FC 4MSPA 1UWOA 2KHNA 4ICBA 4C0JA 1CLMA 1F4OA 1QIVA 3QRXA 1HT9A 1F71A 1TNQA 3BUWB 2M97A 4E68A 2ZNDA 3DVJA 4N5XA 1NIWA 2H61C 1W7JB 5KU1A 2LVKA 2JT0A 4MVFA 1U5IA 3EKJA 4IL1A 2I2RE 2E30A 1CFPA 4OR9B 3OHMB 3I5HC 4GGFC 2LVIA 1MUXA 2MLFC 1DJHA 4PHJA 1S1EA 2WCEA 4Q04A 1MWNA 1LXFC 1TIZA 5HYDA 3I5GC 1SCMC 3GK1A 3TZ1A 4UPGA 1KQMC 1EG4A 1ZUZA 4MLWA 1DF0A 2JQ6A 2HQWA 5CPVA 1TNPA 1XK4A 3D10A 1J55A 5KTYA 2KSPA 1QJTA 1BU3A 4WQ2A 3KEVA 3VROA 5CSJA 1UP5A 5BPJA 1QX5B 3BUOB 4MZLA 1CMGA 2M49B 2Y1NA 3TS5C 1DMOA 2M1KB 2M1UA 1RJVA 2KGRA 2O60A 2F33A 2BE6A 1HQVA 2LHLA 1S26D 2AMIA 1KFUL 1AVSA 1DGUA 3LCPC 3TDIA 1PULA 1AHRA 1G4YR 3PM8A 2OPOA 3BOWB 1QATA 4N1FA 1OZOA 2F3ZA 4PE1A 3D0YB 3AAJA 4F0ZB 1V1GA 2PMYA 3DF0A 3PATA 4CLNA 2TN4A 2ZNEA 1CM1A 2NZ0A 3EK8A 4ZCVA 5I2OA 3VGOA 3O4YA 2MBXA 1NCXA 2Y4QA 1CFFA 2JRFA 4BY4A 1EJ3A 3LL8B 1WLZA 2G2BA 3CS1A 2LVJA 1FBVA 1K8UA 3RM1A 1WRLA 1FI6A 4CPVA 3NSIA 2MA2A 2JNFA 2MAZA 2K2AA 4ORCB 1A03A 1JC2A 1J7OA 4CFRA 1LVCD 3FIAA 1RWYA 1UUSA 5DKQA 2M9GA 3EK4A 3PSRA 2JT8A 1J1EA 2BBMA 4YGCB 1KCYA 1PALA 1KQVA 1MHOA 1ZFSA 2MHHA 1EXRA 3EKHA 1A29A 4NQGA 1AK8A 1RECA 3AKAA 1IJ6A 1KFXS 1K2HA 1GGWA 2PASA 4MZKA 1PVBA 2I94A 1TCOB 2LMUA 2VRGA 1SR6B 2BCXA 1MXEA 2ZKMX 1J7PA 1S6IA 1LKJA 3KO0A 2LCPA 2EC6B 5D69A 4C0LA 1NCYA 2AUCA 3VRQA 1K93D 4HREE 1S36A 1UHHA 1IKUA 1G33A 2A4JA 1PVAA 3CR5X 3TUYB 3AKBA 1SL7A 1KSOA 1IQ3A 4L9MA 1TCFA 1KWOB 3K21A 3JTDB 1QS7A 4ZCUA 2L0PA 1CDNA 2I18A 1KK8C 2NCPA 5AERA 1C07A 2BBNA 2BKHB 2L4IA 1CDMA 5I2LA 4DIRA 1K9UA 1YVHA 1OMRA 2ZN9A 4MRYA 4BY5A 4GNKB 5AANA 2K7CA 4P2YB 2M0RA 1B8CA 1UHNA 2K2FA 1YX7A 3KF9A 3SG5A 1YR5A 2LANA 3PLFB 1S5GY 2JWWA 4M2QA 3I5IB 1NWDA 4A4CA 3I5FB 3VRRA 1RROA 1QLKA 2H61A 2SASA 1SL8A 1SYMA 2LLTA 5I8NA 4GFTA 1CDLA 1CFCA 2M29A 1U5IB 1OZSA 1RFJA 4GGFA 1BMOA 1DGVA 2V53A 2LUXA 2HPSA 3OX6A 1FI5A 1OOJA 3VRPA 1K9KA 2KBMA 2LLUA 1M39A 1LA3A 2FCEA 3M0WA 1PK0D 3CWGA 3PALA 4YGDB 1YUUA 5HKYA 1TNWA 2MRDA 1M45A 3KPXA 3I5GB 1SCMB 1NX0A 1S6CA 2CTNA 2KNEA 3IF7A 4I5NB 4MN0A 3EVVA 4PE4A 2E6WA 1CB1A 2JTTA
chains in the Genus database with same CATH superfamily
1DF0B 2MJWB 5HLVA 3JVTB 1AP4A 3HCMA 3O6BA 2JULA 1R6PA 1B7TZ 1XYDA 1C3YA 2OS8B 3SG2A 1IQ5A 4JQ0D 2QACA 3AAKA 1IH0A 1B7TY 1XFXO 4YI9A 4JPZB 2LHIA 2Q91A 2KYCA 3LK1A 2F8PA 4FTGA 1B1GA 3DZTA 1WDCB 2BKIB 1F55A 1SNLA 2KGBC 4YGAA 2ZRTA 5CSFA 1F54A 1Y1XA 1NSHA 3DVMA 1NX1A 1CFDA 3R1PA 4R1EA 2K7DA 1Y1AA 1NP8A 5TNCA 1AUIB 1L7ZA 4YGBB 4MRXA 1EL4A 1KFXL 2JXLA 4FQOA 5DKNA 3RZSA 2LVVA 1BR1B 1JUOA 3DF0B 1ALVA 1RTP1 2K7BA 1XFZO 1Z2CB 1OOIX 2CXJA 2IS9A 2PRUA 1ALWA 1B8RA 1WLMA 1G8IA 2KQ6A 1BODA 1JWDA 4YI8A 2KDHA 1NX2A 4JKTA 2JTZA 1W7IB 5I94A 2EHBA 2KLDA 2LLSA 1DQEA 3TDUA 1J1DA 4AOMA 1SCVA 4OCIA 1SRAA 4OVNF 4M2OA 3SG7A 3V2LA 4GAOA 3OX5A 1GGZA 2SCPA 5HLOA 3ZWHA 3SG3A 1QXPA 1JBAA 3CZ1A 3PN7C 3BQ3A 5AEQA 4GGNA 5D7FA 5F6TA 4AQIA 3SG4A 4N1GA 3HX4A 3OP0A 2QEVA 1Z4HA 2JNXA 1IG5A 1DJGA 2NCOA 1Y1UA 2JOJA 1TN4A 5DKRA 3UO9A 4GBAA 4MBEA 4DCKA 1WRKA 3Q8IA 2I7AA 1A75A 3BFAA 3K1EA 1A4PA 2LM5A 1JFJA 3H4SE 1ODBA 1KSMA 2BL0B 4TNCA 1N65A 2LV7A 2HETA 5G08A 3FE6A 3SG6A 1A75B 1EH2A 2KFHA 1UHKA 2GGZA 3CR4X 3LK0A 1SPYA 2CCMA 2JPOA 4JWQA 1ZACA 1E8AA 1BF5A 1F8HA 5JOLA 1ZMZA 2HQ8A 3B88A 1CM4A 4QJ3B 1DJWA 4DS7A 4I5LB 3NSOA 1DEKA 2WCJA 2JPTA 3OGNA 2LE9B 1M63B 5FI2A 1L2OC 3GOFA 1EG3A 3EVRA 2HF5A 4HRGA 1CKKA 2KI4C 1N0YA 2K8MB 5FYXA 2PYQA 2KPHA 1B47A 3SIAA 1CMFA 1LINA 1DJZA 2JZIA 2LNKA 3B87A 4XJKA 3WNXB 1C7VA 4ORBB 1OSAA 3NSKA 2WOSA 2L51A 1PRWA 1IJ5A 3SIBA 3TUYC 1A2XA 1K94A 4XJKB 3SS5A 3EVUA 2BCBA 2WCBA 1KWOC 2WCFA 5ER5A 3NSLA 1WRZA 1BG1A 3JTDC 3CABA 1S5GZ 3WHUB 4C0KA 3D75A 1N2DA 1YX8A 2PALA 4DRWA 2FJUB 1D1OA 2OTGC 1SY9A 1B4CA 1NCZA 1BJFA 2F2OA 4CIDA 4HRHA 4OV2A 3E3RA 1YUSA 5HKZA 3L4AA 3GK4X 3B7AA 3O2PA 2KOTA 2WC6A 1IGVA 3S0EA 1R2UA 2LUCA 1FW4A 1DJXA 3BUXB 2CBLA 1H8BA 1QVIZ 5KSZA 3I5IC 3I5HB 4YBHB 1MR8A 1XO5A 4I5JA 1QVIY 2QEBA 3EG5B 1CTRA 2KI6C 3ICBA 5B8IB 1SBJA 1JSAA 2G9BA 1XFUO 2RGIA 3S0FA 3DVEA 2D8NA 1DVIA 1K96A 2KAVA 3IVTA 2KI6D 1SK6D 1BOCA 1KQMB 2PSRA 2L2EA 3MSEB 4U8DA 3CZ2A 1OMVA 1QIWA 1YVLA 1DT7B 1SL9A 3S0GA 1AJ4A 1QASA 5CSNA 1TNXA 2BCAA 2NXQA 1FPWA 2MLEC 3A4UB 3D78A 3PFVA 1M31A 1YUTA 3FWCA 2KAYA 2Q4UA 2GGMA 2WNDA 4GUKA 1CDPA 1TUZA 3BJHA 1GQMA 4NDDA 1VRKA 1WY9A 2K61A 2ISDA 3TS5B 4PE7A 1B8LA 2H8VA 3JVTC 1LA0A 1QX7A 1S6JA 1XK4C 4DUQA 4F7FA 4WRIA 2ZN8A 2PVBA 4A4BA 4M2PA 4PHKA 3FS7A 2OS8C 4YGEB 1F70A 4MEWA 3O78A 1AJ5A 3GK2A 5IBWA 1OMDA 4PHMA 3BFBA 2LC5A 2COLB 1C7WA 1DJIA 1M46A 1Q80A 2L98A 1K90D 1WDCC 2FCDA 2H2KA 1TOPA 1QLSA 3FWBA 2LAPA 3BOWA 3SS3A 4AQJA 1SKTA 4HSZA 2L5XB 2LP2A 3NGVA 3EK7A 3D0YA 2LMTA 1DTLA 2QPTA 2K0JA 4MZJA 4NDCA 3RLZA 2LMVA 1K95A 1QTXA 2GV5A 2JXCA 2ZFDA 1C3ZA 1UHIA 3R72A 5JJGA 1V1FA 4XYNA 1XA5A 2FOTA 2Y5IA 3SJSA 5K89A 1K9PA 2O5GA 3IQOA 4OZDA 1NPQA 1ZOTB 4PCWA 1UHJA 3IQQA 3KHEA 4PE0A 1PSRA 4KYNA 3OBVA 4ORAB 5AFPA 3BUMB 2M7NA 4IJ7A 2BECA 2CT9A 4WQ3A 2KFGA 1YRUB 1QX2A 2K60A 2F2PA 3PN7B 4INWA 1J7QA 1YURA 5AXIA 2P71A 4QJ4B 4ETOA 1YTZC 4PDZA 1DJYA 1IWQA 2P6BB 1KFUS 3BXKA 1BLQA 1BT6A 1JFKA 4PALA 2LP3A 3B6XA 1X02A 2M8UA 1H4BA 3A8RA 1CLLA 2M3WA 5HKWA 2WCMA 2NLNA 1OE9B 3TDZA 3CGAA 1XVJA 1JF2A 2JC2A 4USLA 3B86A 1SR6C 4OKHA 3VRNA 4CFQA 1PSBA 2QEHA 2KQYA 2KFFA 1NUBA 5J3XA 2ERBA 1XFVO 2BL0C 2CNPA 1TTXA 1MXLC 2L50A 3NXAA 4P5OE 1SMGA 1XFYO 2EC6C 2KBIA 3CZTX 3OB1B 2DOQA 3BUNB 1Y0VH 3OB2B 3N7HA 1YRTB 2F3YA 2PQLA 1TRFA 3PM2A 4PHNA 5CSIA 1B9AA 2R2IA 1MQ1A 3CLNA 3ZNIA 1L2OB 5I2QA 1JF0A 2KAXA 2WORA 4D1EA 2KI4B 1Y6WA 3DYEA 2JU0A 1CLBA 1KK8B 1IRJA 2KYFA 2Y1MA 2M7LA 2K7OA 3WHTB 1XFWO 1BR4B 3DD4A 1RK9A 1S3PA 1SSEB 4I5KA 1MF8B 1XFRA 2BE4A 5GQQC 1CNPA 3C1VA 1SW8A 1UURA 2L4HA 2ZRSA 1KK7Z 1FF1A 1NX3A 3F45A 5PALA 3WXAA 3LLEA 1KK7Y 4QJ5B 4GPLB 2QDIA 4YRUA 1J7RA 2B1UA 2EGDA 4NDBA 1OOHA 2AAOA 1OQPA 1OW4A 2OTGB 1QV1A 1QV0A 1GJYA 1F4QA 1NYAA 2WCLA 3CTNA 3CR2A 3BYAA 5ER4X 2WC8A 3FE8A 2JT3A 3DVKA 3I5FC 4MSPA 1UWOA 2KHNA 4ICBA 4C0JA 1CLMA 1DELA 1F4OA 1QIVA 3D73A 3QRXA 1HT9A 1F71A 1TNQA 3BUWB 3S0DA 2M97A 4E68A 2ZNDA 3DVJA 4N5XA 1NIWA 2H61C 1W7JB 5KU1A 2LVKA 1TUJA 2JT0A 4MVFA 1OOFA 1U5IA 3EKJA 4IL1A 2I2RE 2E30A 1CFPA 3CDNA 4OR9B 4FQTA 3OHMB 3I5HC 4GGFC 2LVIA 1MUXA 2MLFC 1DJHA 3R1VA 4PHJA 1ORGA 1S1EA 2WCEA 4Q04A 3D74A 3R1OA 1QWVA 1MWNA 1LXFC 1TIZA 3UNWA 1T14A 5HYDA 3I5GC 1SCMC 2L5YA 3GK1A 3TZ1A 3O4XA 4UPGA 1KQMC 1EG4A 1ZUZA 4MLWA 1DF0A 2JQ6A 2HQWA 3QMEA 5CPVA 1TNPA 1XK4A 3D10A 1J55A 5KTYA 2KSPA 1QJTA 1BU3A 4WQ2A 3KEVA 3VROA 5CSJA 1UP5A 5BPJA 1QX5B 3BUOB 4MZLA 1CMGA 2M49B 2Y1NA 3TS5C 1DMOA 2M1KB 2M1UA 1RJVA 2WCHA 5FI7A 2KGRA 2O60A 2F33A 2BE6A 1HQVA 5EL2A 2LHLA 1S26D 2AMIA 4JD9A 1W9ZA 1KFUL 1AVSA 1DGUA 2BNXA 3LCPC 3TDIA 3SS4A 1PULA 1AHRA 1G4YR 3PM8A 2OPOA 2YGUA 3BOWB 1QATA 4N1FA 1OZOA 2F3ZA 4PE1A 3D0YB 3AAJA 4F0ZB 1V1GA 2PMYA 1TWOA 3DF0A 3PATA 4CLNA 2TN4A 2ZNEA 1CM1A 2NZ0A 3EK8A 1LS8A 4ZCVA 5I2OA 3VGOA 3O4YA 2MBXA 2FJYA 1NCXA 3NHIA 2Y4QA 1CFFA 4INXA 2JRFA 4BY4A 5FI6A 1EJ3A 3LL8B 1WLZA 2KLEA 2G2BA 3CS1A 2LVJA 1GM0A 1FBVA 1K8UA 3RM1A 1WRLA 1FI6A 1OOGA 4CPVA 3NSIA 2MA2A 2JNFA 2MAZA 2K2AA 4ORCB 1A03A 1JC2A 1IIOA 1J7OA 4CFRA 1LVCD 3FIAA 1RWYA 1UUSA 5DKQA 2M9GA 3EK4A 3PSRA 2JT8A 1J1EA 2BBMA 4YGCB 1KCYA 1PALA 1KQVA 1MHOA 1ZFSA 2MHHA 1EXRA 3EKHA 1DC1A 5DICA 1A29A 2WC5A 3DY9A 4NQGA 1RECA 3AKAA 1IJ6A 1KFXS 1AK8A 1K2HA 1GGWA 2PASA 4MZKA 1PVBA 3L47A 2I94A 1TCOB 3FE9A 2GTEA 2LMUA 2VRGA 1P28A 1SR6B 2BCXA 1MXEA 2ZKMX 1J7PA 1S6IA 1LKJA 3KO0A 2LCPA 2EC6B 5D69A 4C0LA 1NCYA 3BFHA 2AUCA 3VRQA 1K93D 4HREE 2P70A 1S36A 1UHHA 1IKUA 1G33A 2A4JA 1PVAA 3CR5X 3CYZA 3TUYB 3AKBA 1SL7A 1KSOA 3NHTA 1IQ3A 4L9MA 1TCFA 1KWOB 3DXLA 3K21A 3L4LA 3JTDB 1QS7A 4ZCUA 2L0PA 1CDNA 3D76A 2I18A 4PT1A 1KK8C 2NCPA 5AERA 1C07A 2BBNA 2BKHB 2L4IA 1CDMA 5D3OA 5I2LA 4DIRA 2WCKA 1K9UA 1YVHA 1OMRA 2ZN9A 4MRYA 4BY5A 4GNKB 5AANA 2K7CA 4P2YB 2M0RA 1B8CA 1UHNA 2K2FA 1YX7A 3KF9A 3SG5A 2QEOA 1YR5A 2LANA 3PLFB 1S5GY 3S0BA 2JWWA 4M2QA 3S0AA 3I5IB 1NWDA 4A4CA 3I5FB 2L2CA 3VRRA 1RROA 1QLKA 2H61A 2SASA 1SL8A 1SYMA 2LLTA 5I8NA 4GFTA 1CDLA 1CFCA 2M29A 1U5IB 1OZSA 1RFJA 4GGFA 3D77A 1BMOA 1DGVA 2V53A 2LUXA 2HPSA 3OX6A 3PJIA 3CZ0A 1FI5A 1OOJA 3VRPA 1K9KA 2KBMA 2LLUA 1M39A 1LA3A 2FCEA 3M0WA 1PK0D 3CWGA 3PALA 4YGDB 1YUUA 5HKYA 5HL1A 1TNWA 2MRDA 1M45A 3KPXA 3I5GB 1SCMB 1NX0A 1S6CA 2CTNA 2KNEA 3IF7A 4I5NB 4MN0A 3EVVA 4PE4A 2E6WA 3VB1A 1CB1A 2JTTA 2BAPA
chains in the Genus database with same CATH topology
1DF0B 2MJWB 5HLVA 3JVTB 1AP4A 3HCMA 3O6BA 2JULA 1R6PA 1B7TZ 1XYDA 2OS8B 3SG2A 1IQ5A 4JQ0D 2QACA 3AAKA 1IH0A 1B7TY 1XFXO 4YI9A 4JPZB 2LHIA 2Q91A 2KYCA 3LK1A 2F8PA 4FTGA 1B1GA 1WDCB 2BKIB 1F55A 1SNLA 2KGBC 4YGAA 2ZRTA 5CSFA 1F54A 1Y1XA 1NSHA 3DVMA 1NX1A 1CFDA 4R1EA 2K7DA 1Y1AA 1NP8A 5TNCA 1AUIB 1L7ZA 4YGBB 4MRXA 1EL4A 1KFXL 2JXLA 4FQOA 5DKNA 2LVVA 1BR1B 1JUOA 3DF0B 1ALVA 1RTP1 2K7BA 1XFZO 2CXJA 2IS9A 2PRUA 1ALWA 1B8RA 1WLMA 1G8IA 2KQ6A 1BODA 1JWDA 4YI8A 2KDHA 1NX2A 2JTZA 1W7IB 2EHBA 2LLSA 3TDUA 1J1DA 4AOMA 1SCVA 4OCIA 1SRAA 4OVNF 4M2OA 3SG7A 4GAOA 3OX5A 1GGZA 2SCPA 5HLOA 3ZWHA 3SG3A 1QXPA 1JBAA 3PN7C 3BQ3A 5AEQA 4GGNA 5D7FA 5F6TA 4AQIA 3SG4A 4N1GA 3HX4A 3OP0A 2JNXA 1IG5A 1DJGA 2NCOA 1Y1UA 2JOJA 1TN4A 5DKRA 4GBAA 4MBEA 4DCKA 1WRKA 2I7AA 1A75A 1JFJA 1A4PA 2LM5A 3H4SE 1ODBA 1KSMA 2BL0B 4TNCA 1N65A 2LV7A 2HETA 5G08A 3SG6A 1A75B 1EH2A 2KFHA 1UHKA 2GGZA 3CR4X 3LK0A 1SPYA 2CCMA 4JWQA 1ZACA 1E8AA 1BF5A 1F8HA 5JOLA 1ZMZA 2HQ8A 1CM4A 4QJ3B 1DJWA 4DS7A 4I5LB 3NSOA 2JPTA 2LE9B 1M63B 1L2OC 3GOFA 1EG3A 3EVRA 2HF5A 4HRGA 1CKKA 2KI4C 1N0YA 2K8MB 5FYXA 3SIAA 1B47A 1CMFA 1LINA 1DJZA 2JZIA 2LNKA 4XJKA 3WNXB 1C7VA 4ORBB 1OSAA 3NSKA 2WOSA 2L51A 1PRWA 1IJ5A 3SIBA 3TUYC 1A2XA 1K94A 4XJKB 3EVUA 2BCBA 2WCBA 1KWOC 2WCFA 5ER5A 3NSLA 1WRZA 1BG1A 3JTDC 1S5GZ 3WHUB 4C0KA 1N2DA 1YX8A 2PALA 4DRWA 2FJUB 1D1OA 2OTGC 1SY9A 1B4CA 1NCZA 1BJFA 2F2OA 4CIDA 4HRHA 4OV2A 3E3RA 1YUSA 5HKZA 3GK4X 3O2PA 2KOTA 1IGVA 1R2UA 2LUCA 1FW4A 1DJXA 3BUXB 2CBLA 1H8BA 1QVIZ 5KSZA 3I5IC 3I5HB 4YBHB 1MR8A 1XO5A 4I5JA 1QVIY 1CTRA 2KI6C 3ICBA 5B8IB 1SBJA 1JSAA 2G9BA 1XFUO 2RGIA 3DVEA 2D8NA 1DVIA 1K96A 2KAVA 1BOCA 2KI6D 1SK6D 1KQMB 2PSRA 2L2EA 3MSEB 4U8DA 1OMVA 1QIWA 1YVLA 1DT7B 1SL9A 1AJ4A 1QASA 5CSNA 1TNXA 2BCAA 2NXQA 1FPWA 2MLEC 3A4UB 3PFVA 1M31A 1YUTA 3FWCA 2KAYA 2Q4UA 2GGMA 2WNDA 4GUKA 1CDPA 2ISDA 1GQMA 4NDDA 1VRKA 1WY9A 2K61A 3TS5B 4PE7A 1B8LA 3JVTC 1LA0A 1QX7A 1S6JA 1XK4C 4DUQA 4WRIA 2ZN8A 2PVBA 4A4BA 4M2PA 4PHKA 3FS7A 2OS8C 4YGEB 1F70A 4MEWA 3O78A 1AJ5A 3GK2A 5IBWA 1OMDA 4PHMA 2LC5A 2COLB 1C7WA 1DJIA 1M46A 1Q80A 2L98A 1K90D 1WDCC 2FCDA 2H2KA 1TOPA 1QLSA 3FWBA 2LAPA 3BOWA 4AQJA 1SKTA 4HSZA 2L5XB 2LP2A 3EK7A 3D0YA 2LMTA 1DTLA 2QPTA 2K0JA 4MZJA 4NDCA 3RLZA 2LMVA 1K95A 1QTXA 2GV5A 2JXCA 2ZFDA 5JJGA 1UHIA 1V1FA 4XYNA 1XA5A 2FOTA 2Y5IA 3SJSA 5K89A 1K9PA 2O5GA 3IQOA 4PCWA 1NPQA 1ZOTB 1UHJA 3IQQA 3KHEA 4PE0A 1PSRA 4ORAB 5AFPA 3BUMB 2M7NA 2BECA 2CT9A 4WQ3A 2KFGA 1YRUB 1QX2A 2F2PA 3PN7B 1J7QA 1YURA 5AXIA 4QJ4B 4ETOA 1YTZC 4PDZA 1DJYA 1IWQA 2P6BB 1KFUS 3BXKA 1BLQA 1BT6A 1JFKA 4PALA 2LP3A 1X02A 2M8UA 1H4BA 3A8RA 1CLLA 2M3WA 5HKWA 2NLNA 1OE9B 3TDZA 3CGAA 1XVJA 1JF2A 2JC2A 4USLA 3VRNA 1SR6C 4OKHA 4CFQA 1PSBA 2KQYA 2KFFA 1NUBA 5J3XA 1XFVO 2BL0C 2CNPA 1TTXA 1MXLC 2L50A 3NXAA 4P5OE 1SMGA 1XFYO 2EC6C 2KBIA 3CZTX 3OB1B 2DOQA 3BUNB 1Y0VH 3OB2B 5CSIA 1YRTB 2F3YA 4PHNA 1TRFA 1B9AA 2R2IA 1MQ1A 3CLNA 3ZNIA 1L2OB 5I2QA 1JF0A 2KAXA 2WORA 4D1EA 2KI4B 1Y6WA 2JU0A 1CLBA 1KK8B 1IRJA 2KYFA 2Y1MA 2M7LA 2K7OA 3WHTB 1XFWO 1BR4B 3DD4A 1RK9A 1S3PA 4I5KA 1MF8B 5GQQC 2BE4A 1CNPA 3C1VA 1SW8A 1UURA 2L4HA 2ZRSA 1KK7Z 1FF1A 1NX3A 3F45A 5PALA 3WXAA 3LLEA 1KK7Y 4QJ5B 4GPLB 4YRUA 1J7RA 2B1UA 2EGDA 4NDBA 2AAOA 1OQPA 2OTGB 1QV1A 1QV0A 1GJYA 1F4QA 1NYAA 3CTNA 3CR2A 3BYAA 5ER4X 2WC8A 2JT3A 3DVKA 3I5FC 4MSPA 1UWOA 2KHNA 4ICBA 4C0JA 1CLMA 1F4OA 1QIVA 3QRXA 1HT9A 1F71A 1TNQA 3BUWB 2M97A 4E68A 2ZNDA 3DVJA 4N5XA 1NIWA 2H61C 1W7JB 5KU1A 2LVKA 2JT0A 4MVFA 1U5IA 3EKJA 4IL1A 2I2RE 2E30A 1CFPA 4OR9B 3OHMB 3I5HC 4GGFC 2LVIA 1MUXA 2MLFC 1DJHA 4PHJA 1S1EA 2WCEA 4Q04A 1MWNA 1LXFC 1TIZA 5HYDA 3I5GC 1SCMC 3GK1A 3TZ1A 4UPGA 1KQMC 1EG4A 1ZUZA 4MLWA 1DF0A 2JQ6A 2HQWA 5CPVA 1TNPA 1XK4A 3D10A 1J55A 5KTYA 2KSPA 1QJTA 1BU3A 4WQ2A 3KEVA 3VROA 5CSJA 1UP5A 5BPJA 1QX5B 3BUOB 4MZLA 1CMGA 2M49B 2Y1NA 3TS5C 1DMOA 2M1KB 2M1UA 1RJVA 2KGRA 2O60A 2F33A 2BE6A 1HQVA 2LHLA 1S26D 2AMIA 1KFUL 1AVSA 1DGUA 3LCPC 3TDIA 1PULA 1AHRA 1G4YR 3PM8A 2OPOA 3BOWB 1QATA 4N1FA 1OZOA 2F3ZA 4PE1A 3D0YB 3AAJA 4F0ZB 1V1GA 2PMYA 3DF0A 3PATA 4CLNA 2TN4A 2ZNEA 1CM1A 2NZ0A 3EK8A 4ZCVA 5I2OA 3VGOA 3O4YA 2MBXA 1NCXA 2Y4QA 1CFFA 2JRFA 4BY4A 1EJ3A 3LL8B 1WLZA 2G2BA 3CS1A 2LVJA 1FBVA 1K8UA 3RM1A 1WRLA 1FI6A 4CPVA 3NSIA 2MA2A 2JNFA 2MAZA 2K2AA 4ORCB 1A03A 1JC2A 1J7OA 4CFRA 1LVCD 3FIAA 1RWYA 1UUSA 5DKQA 2M9GA 3EK4A 3PSRA 2JT8A 1J1EA 2BBMA 4YGCB 1KCYA 1PALA 1KQVA 1MHOA 1ZFSA 2MHHA 1EXRA 3EKHA 1A29A 4NQGA 1AK8A 1RECA 3AKAA 1IJ6A 1KFXS 1K2HA 1GGWA 2PASA 4MZKA 1PVBA 2I94A 1TCOB 2LMUA 2VRGA 1SR6B 2BCXA 1MXEA 2ZKMX 1J7PA 1S6IA 1LKJA 3KO0A 2LCPA 2EC6B 5D69A 4C0LA 1NCYA 2AUCA 3VRQA 1K93D 4HREE 1S36A 1UHHA 1IKUA 1G33A 2A4JA 1PVAA 3CR5X 3TUYB 3AKBA 1SL7A 1KSOA 1IQ3A 4L9MA 1TCFA 1KWOB 3K21A 3JTDB 1QS7A 4ZCUA 2L0PA 1CDNA 2I18A 1KK8C 2NCPA 5AERA 1C07A 2BBNA 2BKHB 2L4IA 1CDMA 5I2LA 4DIRA 1K9UA 1YVHA 1OMRA 2ZN9A 4MRYA 4BY5A 4GNKB 5AANA 2K7CA 4P2YB 2M0RA 1B8CA 1UHNA 2K2FA 1YX7A 3KF9A 3SG5A 1YR5A 2LANA 3PLFB 1S5GY 2JWWA 4M2QA 3I5IB 1NWDA 4A4CA 3I5FB 3VRRA 1RROA 1QLKA 2H61A 2SASA 1SL8A 1SYMA 2LLTA 5I8NA 4GFTA 1CDLA 1CFCA 2M29A 1U5IB 1OZSA 1RFJA 4GGFA 1BMOA 1DGVA 2V53A 2LUXA 2HPSA 3OX6A 1FI5A 1OOJA 3VRPA 1K9KA 2KBMA 2LLUA 1M39A 1LA3A 2FCEA 3M0WA 1PK0D 3CWGA 3PALA 4YGDB 1YUUA 5HKYA 1TNWA 2MRDA 1M45A 3KPXA 3I5GB 1SCMB 1NX0A 1S6CA 2CTNA 2KNEA 3IF7A 4I5NB 4MN0A 3EVVA 4PE4A 2E6WA 1CB1A 2JTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF0 B;  2MJW B;  5HLV A;  3JVT B;  1AP4 A;  3HCM A;  3O6B A;  2JUL A;  1R6P A;  1B7T Z;  1XYD A;  2OS8 B;  3SG2 A;  1IQ5 A;  4JQ0 D;  2QAC A;  3AAK A;  1IH0 A;  1B7T Y;  1XFX O;  4YI9 A;  4JPZ B;  2LHI A;  2Q91 A;  2KYC A;  3LK1 A;  2F8P A;  4FTG A;  1B1G A;  1WDC B;  2BKI B;  1F55 A;  1SNL A;  2KGB C;  4YGA A;  2ZRT A;  5CSF A;  1F54 A;  1Y1X A;  1NSH A;  3DVM A;  1NX1 A;  1CFD A;  4R1E A;  2K7D A;  1Y1A A;  1NP8 A;  5TNC A;  1AUI B;  1L7Z A;  4YGB B;  4MRX A;  1EL4 A;  1KFX L;  2JXL A;  4FQO A;  5DKN A;  2LVV A;  1BR1 B;  1JUO A;  3DF0 B;  1ALV A;  1RTP 1;  2K7B A;  1XFZ O;  2CXJ A;  2IS9 A;  2PRU A;  1ALW A;  1B8R A;  1WLM A;  1G8I A;  2KQ6 A;  1BOD A;  1JWD A;  4YI8 A;  2KDH A;  1NX2 A;  2JTZ A;  1W7I B;  2EHB A;  2LLS A;  3TDU A;  1J1D A;  4AOM A;  1SCV A;  4OCI A;  1SRA A;  4OVN F;  4M2O A;  3SG7 A;  4GAO A;  3OX5 A;  1GGZ A;  2SCP A;  5HLO A;  3ZWH A;  3SG3 A;  1QXP A;  1JBA A;  3PN7 C;  3BQ3 A;  5AEQ A;  4GGN A;  5D7F A;  5F6T A;  4AQI A;  3SG4 A;  4N1G A;  3HX4 A;  3OP0 A;  2JNX A;  1IG5 A;  1DJG A;  2NCO A;  1Y1U A;  2JOJ A;  1TN4 A;  5DKR A;  4GBA A;  4MBE A;  4DCK A;  1WRK A;  2I7A A;  1A75 A;  1JFJ A;  1A4P A;  2LM5 A;  3H4S E;  1ODB A;  1KSM A;  2BL0 B;  4TNC A;  1N65 A;  2LV7 A;  2HET A;  5G08 A;  3SG6 A;  1A75 B;  1EH2 A;  2KFH A;  1UHK A;  2GGZ A;  3CR4 X;  3LK0 A;  1SPY A;  2CCM A;  4JWQ A;  1ZAC A;  1E8A A;  1BF5 A;  1F8H A;  5JOL A;  1ZMZ A;  2HQ8 A;  1CM4 A;  4QJ3 B;  1DJW A;  4DS7 A;  4I5L B;  3NSO A;  2JPT A;  2LE9 B;  1M63 B;  1L2O C;  3GOF A;  1EG3 A;  3EVR A;  2HF5 A;  4HRG A;  1CKK A;  2KI4 C;  1N0Y A;  2K8M B;  5FYX A;  3SIA A;  1B47 A;  1CMF A;  1LIN A;  1DJZ A;  2JZI A;  2LNK A;  4XJK A;  3WNX B;  1C7V A;  4ORB B;  1OSA A;  3NSK A;  2WOS A;  2L51 A;  1PRW A;  1IJ5 A;  3SIB A;  3TUY C;  1A2X A;  1K94 A;  4XJK B;  3EVU A;  2BCB A;  2WCB A;  1KWO C;  2WCF A;  5ER5 A;  3NSL A;  1WRZ A;  1BG1 A;  3JTD C;  1S5G Z;  3WHU B;  4C0K A;  1N2D A;  1YX8 A;  2PAL A;  4DRW A;  2FJU B;  1D1O A;  2OTG C;  1SY9 A;  1B4C A;  1NCZ A;  1BJF A;  2F2O A;  4CID A;  4HRH A;  4OV2 A;  3E3R A;  1YUS A;  5HKZ A;  3GK4 X;  3O2P A;  2KOT A;  1IGV A;  1R2U A;  2LUC A;  1FW4 A;  1DJX A;  3BUX B;  2CBL A;  1H8B A;  1QVI Z;  5KSZ A;  3I5I C;  3I5H B;  4YBH B;  1MR8 A;  1XO5 A;  4I5J A;  1QVI Y;  1CTR A;  2KI6 C;  3ICB A;  5B8I B;  1SBJ A;  1JSA A;  2G9B A;  1XFU O;  2RGI A;  3DVE A;  2D8N A;  1DVI A;  1K96 A;  2KAV A;  1BOC A;  2KI6 D;  1SK6 D;  1KQM B;  2PSR A;  2L2E A;  3MSE B;  4U8D A;  1OMV A;  1QIW A;  1YVL A;  1DT7 B;  1SL9 A;  1AJ4 A;  1QAS A;  5CSN A;  1TNX A;  2BCA A;  2NXQ A;  1FPW A;  2MLE C;  3A4U B;  3PFV A;  1M31 A;  1YUT A;  3FWC A;  2KAY A;  2Q4U A;  2GGM A;  2WND A;  4GUK A;  1CDP A;  2ISD A;  1GQM A;  4NDD A;  1VRK A;  1WY9 A;  2K61 A;  3TS5 B;  4PE7 A;  1B8L A;  3JVT C;  1LA0 A;  1QX7 A;  1S6J A;  1XK4 C;  4DUQ A;  4WRI A;  2ZN8 A;  2PVB A;  4A4B A;  4M2P A;  4PHK A;  3FS7 A;  2OS8 C;  4YGE B;  1F70 A;  4MEW A;  3O78 A;  1AJ5 A;  3GK2 A;  5IBW A;  1OMD A;  4PHM A;  2LC5 A;  2COL B;  1C7W A;  1DJI A;  1M46 A;  1Q80 A;  2L98 A;  1K90 D;  1WDC C;  2FCD A;  2H2K A;  1TOP A;  1QLS A;  3FWB A;  2LAP A;  3BOW A;  4AQJ A;  1SKT A;  4HSZ A;  2L5X B;  2LP2 A;  3EK7 A;  3D0Y A;  2LMT A;  1DTL A;  2QPT A;  2K0J A;  4MZJ A;  4NDC A;  3RLZ A;  2LMV A;  1K95 A;  1QTX A;  2GV5 A;  2JXC A;  2ZFD A;  5JJG A;  1UHI A;  1V1F A;  4XYN A;  1XA5 A;  2FOT A;  2Y5I A;  3SJS A;  5K89 A;  1K9P A;  2O5G A;  3IQO A;  4PCW A;  1NPQ A;  1ZOT B;  1UHJ A;  3IQQ A;  3KHE A;  4PE0 A;  1PSR A;  4ORA B;  5AFP A;  3BUM B;  2M7N A;  2BEC A;  2CT9 A;  4WQ3 A;  2KFG A;  1YRU B;  1QX2 A;  2F2P A;  3PN7 B;  1J7Q A;  1YUR A;  5AXI A;  4QJ4 B;  4ETO A;  1YTZ C;  4PDZ A;  1DJY A;  1IWQ A;  2P6B B;  1KFU S;  3BXK A;  1BLQ A;  1BT6 A;  1JFK A;  4PAL A;  2LP3 A;  1X02 A;  2M8U A;  1H4B A;  3A8R A;  1CLL A;  2M3W A;  5HKW A;  2NLN A;  1OE9 B;  3TDZ A;  3CGA A;  1XVJ A;  1JF2 A;  2JC2 A;  4USL A;  3VRN A;  1SR6 C;  4OKH A;  4CFQ A;  1PSB A;  2KQY A;  2KFF A;  1NUB A;  5J3X A;  1XFV O;  2BL0 C;  2CNP A;  1TTX A;  1MXL C;  2L50 A;  3NXA A;  4P5O E;  1SMG A;  1XFY O;  2EC6 C;  2KBI A;  3CZT X;  3OB1 B;  2DOQ A;  3BUN B;  1Y0V H;  3OB2 B;  5CSI A;  1YRT B;  2F3Y A;  4PHN A;  1TRF A;  1B9A A;  2R2I A;  1MQ1 A;  3CLN A;  3ZNI A;  1L2O B;  5I2Q A;  1JF0 A;  2KAX A;  2WOR A;  4D1E A;  2KI4 B;  1Y6W A;  2JU0 A;  1CLB A;  1KK8 B;  1IRJ A;  2KYF A;  2Y1M A;  2M7L A;  2K7O A;  3WHT B;  1XFW O;  1BR4 B;  3DD4 A;  1RK9 A;  1S3P A;  4I5K A;  1MF8 B;  5GQQ C;  2BE4 A;  1CNP A;  3C1V A;  1SW8 A;  1UUR A;  2L4H A;  2ZRS A;  1KK7 Z;  1FF1 A;  1NX3 A;  3F45 A;  5PAL A;  3WXA A;  3LLE A;  1KK7 Y;  4QJ5 B;  4GPL B;  4YRU A;  1J7R A;  2B1U A;  2EGD A;  4NDB A;  2AAO A;  1OQP A;  2OTG B;  1QV1 A;  1QV0 A;  1GJY A;  1F4Q A;  1NYA A;  3CTN A;  3CR2 A;  3BYA A;  5ER4 X;  2WC8 A;  2JT3 A;  3DVK A;  3I5F C;  4MSP A;  1UWO A;  2KHN A;  4ICB A;  4C0J A;  1CLM A;  1F4O A;  1QIV A;  3QRX A;  1HT9 A;  1F71 A;  1TNQ A;  3BUW B;  2M97 A;  4E68 A;  2ZND A;  3DVJ A;  4N5X A;  1NIW A;  2H61 C;  1W7J B;  5KU1 A;  2LVK A;  2JT0 A;  4MVF A;  1U5I A;  3EKJ A;  4IL1 A;  2I2R E;  2E30 A;  1CFP A;  4OR9 B;  3OHM B;  3I5H C;  4GGF C;  2LVI A;  1MUX A;  2MLF C;  1DJH A;  4PHJ A;  1S1E A;  2WCE A;  4Q04 A;  1MWN A;  1LXF C;  1TIZ A;  5HYD A;  3I5G C;  1SCM C;  3GK1 A;  3TZ1 A;  4UPG A;  1KQM C;  1EG4 A;  1ZUZ A;  4MLW A;  1DF0 A;  2JQ6 A;  2HQW A;  5CPV A;  1TNP A;  1XK4 A;  3D10 A;  1J55 A;  5KTY A;  2KSP A;  1QJT A;  1BU3 A;  4WQ2 A;  3KEV A;  3VRO A;  5CSJ A;  1UP5 A;  5BPJ A;  1QX5 B;  3BUO B;  4MZL A;  1CMG A;  2M49 B;  2Y1N A;  3TS5 C;  1DMO A;  2M1K B;  2M1U A;  1RJV A;  2KGR A;  2O60 A;  2F33 A;  2BE6 A;  1HQV A;  2LHL A;  1S26 D;  2AMI A;  1KFU L;  1AVS A;  1DGU A;  3LCP C;  3TDI A;  1PUL A;  1AHR A;  1G4Y R;  3PM8 A;  2OPO A;  3BOW B;  1QAT A;  4N1F A;  1OZO A;  2F3Z A;  4PE1 A;  3D0Y B;  3AAJ A;  4F0Z B;  1V1G A;  2PMY A;  3DF0 A;  3PAT A;  4CLN A;  2TN4 A;  2ZNE A;  1CM1 A;  2NZ0 A;  3EK8 A;  4ZCV A;  5I2O A;  3VGO A;  3O4Y A;  2MBX A;  1NCX A;  2Y4Q A;  1CFF A;  2JRF A;  4BY4 A;  1EJ3 A;  3LL8 B;  1WLZ A;  2G2B A;  3CS1 A;  2LVJ A;  1FBV A;  1K8U A;  3RM1 A;  1WRL A;  1FI6 A;  4CPV A;  3NSI A;  2MA2 A;  2JNF A;  2MAZ A;  2K2A A;  4ORC B;  1A03 A;  1JC2 A;  1J7O A;  4CFR A;  1LVC D;  3FIA A;  1RWY A;  1UUS A;  5DKQ A;  2M9G A;  3EK4 A;  3PSR A;  2JT8 A;  1J1E A;  2BBM A;  4YGC B;  1KCY A;  1PAL A;  1KQV A;  1MHO A;  1ZFS A;  2MHH A;  1EXR A;  3EKH A;  1A29 A;  4NQG A;  1AK8 A;  1REC A;  3AKA A;  1IJ6 A;  1KFX S;  1K2H A;  1GGW A;  2PAS A;  4MZK A;  1PVB A;  2I94 A;  1TCO B;  2LMU A;  2VRG A;  1SR6 B;  2BCX A;  1MXE A;  2ZKM X;  1J7P A;  1S6I A;  1LKJ A;  3KO0 A;  2LCP A;  2EC6 B;  5D69 A;  4C0L A;  1NCY A;  2AUC A;  3VRQ A;  1K93 D;  4HRE E;  1S36 A;  1UHH A;  1IKU A;  1G33 A;  2A4J A;  1PVA A;  3CR5 X;  3TUY B;  3AKB A;  1SL7 A;  1KSO A;  1IQ3 A;  4L9M A;  1TCF A;  1KWO B;  3K21 A;  3JTD B;  1QS7 A;  4ZCU A;  2L0P A;  1CDN A;  2I18 A;  1KK8 C;  2NCP A;  5AER A;  1C07 A;  2BBN A;  2BKH B;  2L4I A;  1CDM A;  5I2L A;  4DIR A;  1K9U A;  1YVH A;  1OMR A;  2ZN9 A;  4MRY A;  4BY5 A;  4GNK B;  5AAN A;  2K7C A;  4P2Y B;  2M0R A;  1B8C A;  1UHN A;  2K2F A;  1YX7 A;  3KF9 A;  3SG5 A;  1YR5 A;  2LAN A;  3PLF B;  1S5G Y;  2JWW A;  4M2Q A;  3I5I B;  1NWD A;  4A4C A;  3I5F B;  3VRR A;  1RRO A;  1QLK A;  2H61 A;  2SAS A;  1SL8 A;  1SYM A;  2LLT A;  5I8N A;  4GFT A;  1CDL A;  1CFC A;  2M29 A;  1U5I B;  1OZS A;  1RFJ A;  4GGF A;  1BMO A;  1DGV A;  2V53 A;  2LUX A;  2HPS A;  3OX6 A;  1FI5 A;  1OOJ A;  3VRP A;  1K9K A;  2KBM A;  2LLU A;  1M39 A;  1LA3 A;  2FCE A;  3M0W A;  1PK0 D;  3CWG A;  3PAL A;  4YGD B;  1YUU A;  5HKY A;  1TNW A;  2MRD A;  1M45 A;  3KPX A;  3I5G B;  1SCM B;  1NX0 A;  1S6C A;  2CTN A;  2KNE A;  3IF7 A;  4I5N B;  4MN0 A;  3EVV A;  4PE4 A;  2E6W A;  1CB1 A;  2JTT A; 
#chains in the Genus database with same CATH topology
 1DF0 B;  2MJW B;  5HLV A;  3JVT B;  1AP4 A;  3HCM A;  3O6B A;  2JUL A;  1R6P A;  1B7T Z;  1XYD A;  1C3Y A;  2OS8 B;  3SG2 A;  1IQ5 A;  4JQ0 D;  2QAC A;  3AAK A;  1IH0 A;  1B7T Y;  1XFX O;  4YI9 A;  4JPZ B;  2LHI A;  2Q91 A;  2KYC A;  3LK1 A;  2F8P A;  4FTG A;  1B1G A;  3DZT A;  1WDC B;  2BKI B;  1F55 A;  1SNL A;  2KGB C;  4YGA A;  2ZRT A;  5CSF A;  1F54 A;  1Y1X A;  1NSH A;  3DVM A;  1NX1 A;  1CFD A;  3R1P A;  4R1E A;  2K7D A;  1Y1A A;  1NP8 A;  5TNC A;  1AUI B;  1L7Z A;  4YGB B;  4MRX A;  1EL4 A;  1KFX L;  2JXL A;  4FQO A;  5DKN A;  3RZS A;  2LVV A;  1BR1 B;  1JUO A;  3DF0 B;  1ALV A;  1RTP 1;  2K7B A;  1XFZ O;  1Z2C B;  1OOI X;  2CXJ A;  2IS9 A;  2PRU A;  1ALW A;  1B8R A;  1WLM A;  1G8I A;  2KQ6 A;  1BOD A;  1JWD A;  4YI8 A;  2KDH A;  1NX2 A;  4JKT A;  2JTZ A;  1W7I B;  5I94 A;  2EHB A;  2KLD A;  2LLS A;  1DQE A;  3TDU A;  1J1D A;  4AOM A;  1SCV A;  4OCI A;  1SRA A;  4OVN F;  4M2O A;  3SG7 A;  3V2L A;  4GAO A;  3OX5 A;  1GGZ A;  2SCP A;  5HLO A;  3ZWH A;  3SG3 A;  1QXP A;  1JBA A;  3CZ1 A;  3PN7 C;  3BQ3 A;  5AEQ A;  4GGN A;  5D7F A;  5F6T A;  4AQI A;  3SG4 A;  4N1G A;  3HX4 A;  3OP0 A;  2QEV A;  1Z4H A;  2JNX A;  1IG5 A;  1DJG A;  2NCO A;  1Y1U A;  2JOJ A;  1TN4 A;  5DKR A;  3UO9 A;  4GBA A;  4MBE A;  4DCK A;  1WRK A;  3Q8I A;  2I7A A;  1A75 A;  3BFA A;  3K1E A;  1A4P A;  2LM5 A;  1JFJ A;  3H4S E;  1ODB A;  1KSM A;  2BL0 B;  4TNC A;  1N65 A;  2LV7 A;  2HET A;  5G08 A;  3FE6 A;  3SG6 A;  1A75 B;  1EH2 A;  2KFH A;  1UHK A;  2GGZ A;  3CR4 X;  3LK0 A;  1SPY A;  2CCM A;  2JPO A;  4JWQ A;  1ZAC A;  1E8A A;  1BF5 A;  1F8H A;  5JOL A;  1ZMZ A;  2HQ8 A;  3B88 A;  1CM4 A;  4QJ3 B;  1DJW A;  4DS7 A;  4I5L B;  3NSO A;  1DEK A;  2WCJ A;  2JPT A;  3OGN A;  2LE9 B;  1M63 B;  5FI2 A;  1L2O C;  3GOF A;  1EG3 A;  3EVR A;  2HF5 A;  4HRG A;  1CKK A;  2KI4 C;  1N0Y A;  2K8M B;  5FYX A;  2PYQ A;  2KPH A;  1B47 A;  3SIA A;  1CMF A;  1LIN A;  1DJZ A;  2JZI A;  2LNK A;  3B87 A;  4XJK A;  3WNX B;  1C7V A;  4ORB B;  1OSA A;  3NSK A;  2WOS A;  2L51 A;  1PRW A;  1IJ5 A;  3SIB A;  3TUY C;  1A2X A;  1K94 A;  4XJK B;  3SS5 A;  3EVU A;  2BCB A;  2WCB A;  1KWO C;  2WCF A;  5ER5 A;  3NSL A;  1WRZ A;  1BG1 A;  3JTD C;  3CAB A;  1S5G Z;  3WHU B;  4C0K A;  3D75 A;  1N2D A;  1YX8 A;  2PAL A;  4DRW A;  2FJU B;  1D1O A;  2OTG C;  1SY9 A;  1B4C A;  1NCZ A;  1BJF A;  2F2O A;  4CID A;  4HRH A;  4OV2 A;  3E3R A;  1YUS A;  5HKZ A;  3L4A A;  3GK4 X;  3B7A A;  3O2P A;  2KOT A;  2WC6 A;  1IGV A;  3S0E A;  1R2U A;  2LUC A;  1FW4 A;  1DJX A;  3BUX B;  2CBL A;  1H8B A;  1QVI Z;  5KSZ A;  3I5I C;  3I5H B;  4YBH B;  1MR8 A;  1XO5 A;  4I5J A;  1QVI Y;  2QEB A;  3EG5 B;  1CTR A;  2KI6 C;  3ICB A;  5B8I B;  1SBJ A;  1JSA A;  2G9B A;  1XFU O;  2RGI A;  3S0F A;  3DVE A;  2D8N A;  1DVI A;  1K96 A;  2KAV A;  3IVT A;  2KI6 D;  1SK6 D;  1BOC A;  1KQM B;  2PSR A;  2L2E A;  3MSE B;  4U8D A;  3CZ2 A;  1OMV A;  1QIW A;  1YVL A;  1DT7 B;  1SL9 A;  3S0G A;  1AJ4 A;  1QAS A;  5CSN A;  1TNX A;  2BCA A;  2NXQ A;  1FPW A;  2MLE C;  3A4U B;  3D78 A;  3PFV A;  1M31 A;  1YUT A;  3FWC A;  2KAY A;  2Q4U A;  2GGM A;  2WND A;  4GUK A;  1CDP A;  1TUZ A;  3BJH A;  1GQM A;  4NDD A;  1VRK A;  1WY9 A;  2K61 A;  2ISD A;  3TS5 B;  4PE7 A;  1B8L A;  2H8V A;  3JVT C;  1LA0 A;  1QX7 A;  1S6J A;  1XK4 C;  4DUQ A;  4F7F A;  4WRI A;  2ZN8 A;  2PVB A;  4A4B A;  4M2P A;  4PHK A;  3FS7 A;  2OS8 C;  4YGE B;  1F70 A;  4MEW A;  3O78 A;  1AJ5 A;  3GK2 A;  5IBW A;  1OMD A;  4PHM A;  3BFB A;  2LC5 A;  2COL B;  1C7W A;  1DJI A;  1M46 A;  1Q80 A;  2L98 A;  1K90 D;  1WDC C;  2FCD A;  2H2K A;  1TOP A;  1QLS A;  3FWB A;  2LAP A;  3BOW A;  3SS3 A;  4AQJ A;  1SKT A;  4HSZ A;  2L5X B;  2LP2 A;  3NGV A;  3EK7 A;  3D0Y A;  2LMT A;  1DTL A;  2QPT A;  2K0J A;  4MZJ A;  4NDC A;  3RLZ A;  2LMV A;  1K95 A;  1QTX A;  2GV5 A;  2JXC A;  2ZFD A;  1C3Z A;  1UHI A;  3R72 A;  5JJG A;  1V1F A;  4XYN A;  1XA5 A;  2FOT A;  2Y5I A;  3SJS A;  5K89 A;  1K9P A;  2O5G A;  3IQO A;  4OZD A;  1NPQ A;  1ZOT B;  4PCW A;  1UHJ A;  3IQQ A;  3KHE A;  4PE0 A;  1PSR A;  4KYN A;  3OBV A;  4ORA B;  5AFP A;  3BUM B;  2M7N A;  4IJ7 A;  2BEC A;  2CT9 A;  4WQ3 A;  2KFG A;  1YRU B;  1QX2 A;  2K60 A;  2F2P A;  3PN7 B;  4INW A;  1J7Q A;  1YUR A;  5AXI A;  2P71 A;  4QJ4 B;  4ETO A;  1YTZ C;  4PDZ A;  1DJY A;  1IWQ A;  2P6B B;  1KFU S;  3BXK A;  1BLQ A;  1BT6 A;  1JFK A;  4PAL A;  2LP3 A;  3B6X A;  1X02 A;  2M8U A;  1H4B A;  3A8R A;  1CLL A;  2M3W A;  5HKW A;  2WCM A;  2NLN A;  1OE9 B;  3TDZ A;  3CGA A;  1XVJ A;  1JF2 A;  2JC2 A;  4USL A;  3B86 A;  1SR6 C;  4OKH A;  3VRN A;  4CFQ A;  1PSB A;  2QEH A;  2KQY A;  2KFF A;  1NUB A;  5J3X A;  2ERB A;  1XFV O;  2BL0 C;  2CNP A;  1TTX A;  1MXL C;  2L50 A;  3NXA A;  4P5O E;  1SMG A;  1XFY O;  2EC6 C;  2KBI A;  3CZT X;  3OB1 B;  2DOQ A;  3BUN B;  1Y0V H;  3OB2 B;  3N7H A;  1YRT B;  2F3Y A;  2PQL A;  1TRF A;  3PM2 A;  4PHN A;  5CSI A;  1B9A A;  2R2I A;  1MQ1 A;  3CLN A;  3ZNI A;  1L2O B;  5I2Q A;  1JF0 A;  2KAX A;  2WOR A;  4D1E A;  2KI4 B;  1Y6W A;  3DYE A;  2JU0 A;  1CLB A;  1KK8 B;  1IRJ A;  2KYF A;  2Y1M A;  2M7L A;  2K7O A;  3WHT B;  1XFW O;  1BR4 B;  3DD4 A;  1RK9 A;  1S3P A;  1SSE B;  4I5K A;  1MF8 B;  1XFR A;  2BE4 A;  5GQQ C;  1CNP A;  3C1V A;  1SW8 A;  1UUR A;  2L4H A;  2ZRS A;  1KK7 Z;  1FF1 A;  1NX3 A;  3F45 A;  5PAL A;  3WXA A;  3LLE A;  1KK7 Y;  4QJ5 B;  4GPL B;  2QDI A;  4YRU A;  1J7R A;  2B1U A;  2EGD A;  4NDB A;  1OOH A;  2AAO A;  1OQP A;  1OW4 A;  2OTG B;  1QV1 A;  1QV0 A;  1GJY A;  1F4Q A;  1NYA A;  2WCL A;  3CTN A;  3CR2 A;  3BYA A;  5ER4 X;  2WC8 A;  3FE8 A;  2JT3 A;  3DVK A;  3I5F C;  4MSP A;  1UWO A;  2KHN A;  4ICB A;  4C0J A;  1CLM A;  1DEL A;  1F4O A;  1QIV A;  3D73 A;  3QRX A;  1HT9 A;  1F71 A;  1TNQ A;  3BUW B;  3S0D A;  2M97 A;  4E68 A;  2ZND A;  3DVJ A;  4N5X A;  1NIW A;  2H61 C;  1W7J B;  5KU1 A;  2LVK A;  1TUJ A;  2JT0 A;  4MVF A;  1OOF A;  1U5I A;  3EKJ A;  4IL1 A;  2I2R E;  2E30 A;  1CFP A;  3CDN A;  4OR9 B;  4FQT A;  3OHM B;  3I5H C;  4GGF C;  2LVI A;  1MUX A;  2MLF C;  1DJH A;  3R1V A;  4PHJ A;  1ORG A;  1S1E A;  2WCE A;  4Q04 A;  3D74 A;  3R1O A;  1QWV A;  1MWN A;  1LXF C;  1TIZ A;  3UNW A;  1T14 A;  5HYD A;  3I5G C;  1SCM C;  2L5Y A;  3GK1 A;  3TZ1 A;  3O4X A;  4UPG A;  1KQM C;  1EG4 A;  1ZUZ A;  4MLW A;  1DF0 A;  2JQ6 A;  2HQW A;  3QME A;  5CPV A;  1TNP A;  1XK4 A;  3D10 A;  1J55 A;  5KTY A;  2KSP A;  1QJT A;  1BU3 A;  4WQ2 A;  3KEV A;  3VRO A;  5CSJ A;  1UP5 A;  5BPJ A;  1QX5 B;  3BUO B;  4MZL A;  1CMG A;  2M49 B;  2Y1N A;  3TS5 C;  1DMO A;  2M1K B;  2M1U A;  1RJV A;  2WCH A;  5FI7 A;  2KGR A;  2O60 A;  2F33 A;  2BE6 A;  1HQV A;  5EL2 A;  2LHL A;  1S26 D;  2AMI A;  4JD9 A;  1W9Z A;  1KFU L;  1AVS A;  1DGU A;  2BNX A;  3LCP C;  3TDI A;  3SS4 A;  1PUL A;  1AHR A;  1G4Y R;  3PM8 A;  2OPO A;  2YGU A;  3BOW B;  1QAT A;  4N1F A;  1OZO A;  2F3Z A;  4PE1 A;  3D0Y B;  3AAJ A;  4F0Z B;  1V1G A;  2PMY A;  1TWO A;  3DF0 A;  3PAT A;  4CLN A;  2TN4 A;  2ZNE A;  1CM1 A;  2NZ0 A;  3EK8 A;  1LS8 A;  4ZCV A;  5I2O A;  3VGO A;  3O4Y A;  2MBX A;  2FJY A;  1NCX A;  3NHI A;  2Y4Q A;  1CFF A;  4INX A;  2JRF A;  4BY4 A;  5FI6 A;  1EJ3 A;  3LL8 B;  1WLZ A;  2KLE A;  2G2B A;  3CS1 A;  2LVJ A;  1GM0 A;  1FBV A;  1K8U A;  3RM1 A;  1WRL A;  1FI6 A;  1OOG A;  4CPV A;  3NSI A;  2MA2 A;  2JNF A;  2MAZ A;  2K2A A;  4ORC B;  1A03 A;  1JC2 A;  1IIO A;  1J7O A;  4CFR A;  1LVC D;  3FIA A;  1RWY A;  1UUS A;  5DKQ A;  2M9G A;  3EK4 A;  3PSR A;  2JT8 A;  1J1E A;  2BBM A;  4YGC B;  1KCY A;  1PAL A;  1KQV A;  1MHO A;  1ZFS A;  2MHH A;  1EXR A;  3EKH A;  1DC1 A;  5DIC A;  1A29 A;  2WC5 A;  3DY9 A;  4NQG A;  1REC A;  3AKA A;  1IJ6 A;  1KFX S;  1AK8 A;  1K2H A;  1GGW A;  2PAS A;  4MZK A;  1PVB A;  3L47 A;  2I94 A;  1TCO B;  3FE9 A;  2GTE A;  2LMU A;  2VRG A;  1P28 A;  1SR6 B;  2BCX A;  1MXE A;  2ZKM X;  1J7P A;  1S6I A;  1LKJ A;  3KO0 A;  2LCP A;  2EC6 B;  5D69 A;  4C0L A;  1NCY A;  3BFH A;  2AUC A;  3VRQ A;  1K93 D;  4HRE E;  2P70 A;  1S36 A;  1UHH A;  1IKU A;  1G33 A;  2A4J A;  1PVA A;  3CR5 X;  3CYZ A;  3TUY B;  3AKB A;  1SL7 A;  1KSO A;  3NHT A;  1IQ3 A;  4L9M A;  1TCF A;  1KWO B;  3DXL A;  3K21 A;  3L4L A;  3JTD B;  1QS7 A;  4ZCU A;  2L0P A;  1CDN A;  3D76 A;  2I18 A;  4PT1 A;  1KK8 C;  2NCP A;  5AER A;  1C07 A;  2BBN A;  2BKH B;  2L4I A;  1CDM A;  5D3O A;  5I2L A;  4DIR A;  2WCK A;  1K9U A;  1YVH A;  1OMR A;  2ZN9 A;  4MRY A;  4BY5 A;  4GNK B;  5AAN A;  2K7C A;  4P2Y B;  2M0R A;  1B8C A;  1UHN A;  2K2F A;  1YX7 A;  3KF9 A;  3SG5 A;  2QEO A;  1YR5 A;  2LAN A;  3PLF B;  1S5G Y;  3S0B A;  2JWW A;  4M2Q A;  3S0A A;  3I5I B;  1NWD A;  4A4C A;  3I5F B;  2L2C A;  3VRR A;  1RRO A;  1QLK A;  2H61 A;  2SAS A;  1SL8 A;  1SYM A;  2LLT A;  5I8N A;  4GFT A;  1CDL A;  1CFC A;  2M29 A;  1U5I B;  1OZS A;  1RFJ A;  4GGF A;  3D77 A;  1BMO A;  1DGV A;  2V53 A;  2LUX A;  2HPS A;  3OX6 A;  3PJI A;  3CZ0 A;  1FI5 A;  1OOJ A;  3VRP A;  1K9K A;  2KBM A;  2LLU A;  1M39 A;  1LA3 A;  2FCE A;  3M0W A;  1PK0 D;  3CWG A;  3PAL A;  4YGD B;  1YUU A;  5HKY A;  5HL1 A;  1TNW A;  2MRD A;  1M45 A;  3KPX A;  3I5G B;  1SCM B;  1NX0 A;  1S6C A;  2CTN A;  2KNE A;  3IF7 A;  4I5N B;  4MN0 A;  3EVV A;  4PE4 A;  2E6W A;  3VB1 A;  1CB1 A;  2JTT A;  2BAP A; 
#chains in the Genus database with same CATH homology
 1DF0 B;  2MJW B;  5HLV A;  3JVT B;  1AP4 A;  3HCM A;  3O6B A;  2JUL A;  1R6P A;  1B7T Z;  1XYD A;  2OS8 B;  3SG2 A;  1IQ5 A;  4JQ0 D;  2QAC A;  3AAK A;  1IH0 A;  1B7T Y;  1XFX O;  4YI9 A;  4JPZ B;  2LHI A;  2Q91 A;  2KYC A;  3LK1 A;  2F8P A;  4FTG A;  1B1G A;  1WDC B;  2BKI B;  1F55 A;  1SNL A;  2KGB C;  4YGA A;  2ZRT A;  5CSF A;  1F54 A;  1Y1X A;  1NSH A;  3DVM A;  1NX1 A;  1CFD A;  4R1E A;  2K7D A;  1Y1A A;  1NP8 A;  5TNC A;  1AUI B;  1L7Z A;  4YGB B;  4MRX A;  1EL4 A;  1KFX L;  2JXL A;  4FQO A;  5DKN A;  2LVV A;  1BR1 B;  1JUO A;  3DF0 B;  1ALV A;  1RTP 1;  2K7B A;  1XFZ O;  2CXJ A;  2IS9 A;  2PRU A;  1ALW A;  1B8R A;  1WLM A;  1G8I A;  2KQ6 A;  1BOD A;  1JWD A;  4YI8 A;  2KDH A;  1NX2 A;  2JTZ A;  1W7I B;  2EHB A;  2LLS A;  3TDU A;  1J1D A;  4AOM A;  1SCV A;  4OCI A;  1SRA A;  4OVN F;  4M2O A;  3SG7 A;  4GAO A;  3OX5 A;  1GGZ A;  2SCP A;  5HLO A;  3ZWH A;  3SG3 A;  1QXP A;  1JBA A;  3PN7 C;  3BQ3 A;  5AEQ A;  4GGN A;  5D7F A;  5F6T A;  4AQI A;  3SG4 A;  4N1G A;  3HX4 A;  3OP0 A;  2JNX A;  1IG5 A;  1DJG A;  2NCO A;  1Y1U A;  2JOJ A;  1TN4 A;  5DKR A;  4GBA A;  4MBE A;  4DCK A;  1WRK A;  2I7A A;  1A75 A;  1JFJ A;  1A4P A;  2LM5 A;  3H4S E;  1ODB A;  1KSM A;  2BL0 B;  4TNC A;  1N65 A;  2LV7 A;  2HET A;  5G08 A;  3SG6 A;  1A75 B;  1EH2 A;  2KFH A;  1UHK A;  2GGZ A;  3CR4 X;  3LK0 A;  1SPY A;  2CCM A;  4JWQ A;  1ZAC A;  1E8A A;  1BF5 A;  1F8H A;  5JOL A;  1ZMZ A;  2HQ8 A;  1CM4 A;  4QJ3 B;  1DJW A;  4DS7 A;  4I5L B;  3NSO A;  2JPT A;  2LE9 B;  1M63 B;  1L2O C;  3GOF A;  1EG3 A;  3EVR A;  2HF5 A;  4HRG A;  1CKK A;  2KI4 C;  1N0Y A;  2K8M B;  5FYX A;  3SIA A;  1B47 A;  1CMF A;  1LIN A;  1DJZ A;  2JZI A;  2LNK A;  4XJK A;  3WNX B;  1C7V A;  4ORB B;  1OSA A;  3NSK A;  2WOS A;  2L51 A;  1PRW A;  1IJ5 A;  3SIB A;  3TUY C;  1A2X A;  1K94 A;  4XJK B;  3EVU A;  2BCB A;  2WCB A;  1KWO C;  2WCF A;  5ER5 A;  3NSL A;  1WRZ A;  1BG1 A;  3JTD C;  1S5G Z;  3WHU B;  4C0K A;  1N2D A;  1YX8 A;  2PAL A;  4DRW A;  2FJU B;  1D1O A;  2OTG C;  1SY9 A;  1B4C A;  1NCZ A;  1BJF A;  2F2O A;  4CID A;  4HRH A;  4OV2 A;  3E3R A;  1YUS A;  5HKZ A;  3GK4 X;  3O2P A;  2KOT A;  1IGV A;  1R2U A;  2LUC A;  1FW4 A;  1DJX A;  3BUX B;  2CBL A;  1H8B A;  1QVI Z;  5KSZ A;  3I5I C;  3I5H B;  4YBH B;  1MR8 A;  1XO5 A;  4I5J A;  1QVI Y;  1CTR A;  2KI6 C;  3ICB A;  5B8I B;  1SBJ A;  1JSA A;  2G9B A;  1XFU O;  2RGI A;  3DVE A;  2D8N A;  1DVI A;  1K96 A;  2KAV A;  1BOC A;  2KI6 D;  1SK6 D;  1KQM B;  2PSR A;  2L2E A;  3MSE B;  4U8D A;  1OMV A;  1QIW A;  1YVL A;  1DT7 B;  1SL9 A;  1AJ4 A;  1QAS A;  5CSN A;  1TNX A;  2BCA A;  2NXQ A;  1FPW A;  2MLE C;  3A4U B;  3PFV A;  1M31 A;  1YUT A;  3FWC A;  2KAY A;  2Q4U A;  2GGM A;  2WND A;  4GUK A;  1CDP A;  2ISD A;  1GQM A;  4NDD A;  1VRK A;  1WY9 A;  2K61 A;  3TS5 B;  4PE7 A;  1B8L A;  3JVT C;  1LA0 A;  1QX7 A;  1S6J A;  1XK4 C;  4DUQ A;  4WRI A;  2ZN8 A;  2PVB A;  4A4B A;  4M2P A;  4PHK A;  3FS7 A;  2OS8 C;  4YGE B;  1F70 A;  4MEW A;  3O78 A;  1AJ5 A;  3GK2 A;  5IBW A;  1OMD A;  4PHM A;  2LC5 A;  2COL B;  1C7W A;  1DJI A;  1M46 A;  1Q80 A;  2L98 A;  1K90 D;  1WDC C;  2FCD A;  2H2K A;  1TOP A;  1QLS A;  3FWB A;  2LAP A;  3BOW A;  4AQJ A;  1SKT A;  4HSZ A;  2L5X B;  2LP2 A;  3EK7 A;  3D0Y A;  2LMT A;  1DTL A;  2QPT A;  2K0J A;  4MZJ A;  4NDC A;  3RLZ A;  2LMV A;  1K95 A;  1QTX A;  2GV5 A;  2JXC A;  2ZFD A;  5JJG A;  1UHI A;  1V1F A;  4XYN A;  1XA5 A;  2FOT A;  2Y5I A;  3SJS A;  5K89 A;  1K9P A;  2O5G A;  3IQO A;  4PCW A;  1NPQ A;  1ZOT B;  1UHJ A;  3IQQ A;  3KHE A;  4PE0 A;  1PSR A;  4ORA B;  5AFP A;  3BUM B;  2M7N A;  2BEC A;  2CT9 A;  4WQ3 A;  2KFG A;  1YRU B;  1QX2 A;  2F2P A;  3PN7 B;  1J7Q A;  1YUR A;  5AXI A;  4QJ4 B;  4ETO A;  1YTZ C;  4PDZ A;  1DJY A;  1IWQ A;  2P6B B;  1KFU S;  3BXK A;  1BLQ A;  1BT6 A;  1JFK A;  4PAL A;  2LP3 A;  1X02 A;  2M8U A;  1H4B A;  3A8R A;  1CLL A;  2M3W A;  5HKW A;  2NLN A;  1OE9 B;  3TDZ A;  3CGA A;  1XVJ A;  1JF2 A;  2JC2 A;  4USL A;  3VRN A;  1SR6 C;  4OKH A;  4CFQ A;  1PSB A;  2KQY A;  2KFF A;  1NUB A;  5J3X A;  1XFV O;  2BL0 C;  2CNP A;  1TTX A;  1MXL C;  2L50 A;  3NXA A;  4P5O E;  1SMG A;  1XFY O;  2EC6 C;  2KBI A;  3CZT X;  3OB1 B;  2DOQ A;  3BUN B;  1Y0V H;  3OB2 B;  5CSI A;  1YRT B;  2F3Y A;  4PHN A;  1TRF A;  1B9A A;  2R2I A;  1MQ1 A;  3CLN A;  3ZNI A;  1L2O B;  5I2Q A;  1JF0 A;  2KAX A;  2WOR A;  4D1E A;  2KI4 B;  1Y6W A;  2JU0 A;  1CLB A;  1KK8 B;  1IRJ A;  2KYF A;  2Y1M A;  2M7L A;  2K7O A;  3WHT B;  1XFW O;  1BR4 B;  3DD4 A;  1RK9 A;  1S3P A;  4I5K A;  1MF8 B;  5GQQ C;  2BE4 A;  1CNP A;  3C1V A;  1SW8 A;  1UUR A;  2L4H A;  2ZRS A;  1KK7 Z;  1FF1 A;  1NX3 A;  3F45 A;  5PAL A;  3WXA A;  3LLE A;  1KK7 Y;  4QJ5 B;  4GPL B;  4YRU A;  1J7R A;  2B1U A;  2EGD A;  4NDB A;  2AAO A;  1OQP A;  2OTG B;  1QV1 A;  1QV0 A;  1GJY A;  1F4Q A;  1NYA A;  3CTN A;  3CR2 A;  3BYA A;  5ER4 X;  2WC8 A;  2JT3 A;  3DVK A;  3I5F C;  4MSP A;  1UWO A;  2KHN A;  4ICB A;  4C0J A;  1CLM A;  1F4O A;  1QIV A;  3QRX A;  1HT9 A;  1F71 A;  1TNQ A;  3BUW B;  2M97 A;  4E68 A;  2ZND A;  3DVJ A;  4N5X A;  1NIW A;  2H61 C;  1W7J B;  5KU1 A;  2LVK A;  2JT0 A;  4MVF A;  1U5I A;  3EKJ A;  4IL1 A;  2I2R E;  2E30 A;  1CFP A;  4OR9 B;  3OHM B;  3I5H C;  4GGF C;  2LVI A;  1MUX A;  2MLF C;  1DJH A;  4PHJ A;  1S1E A;  2WCE A;  4Q04 A;  1MWN A;  1LXF C;  1TIZ A;  5HYD A;  3I5G C;  1SCM C;  3GK1 A;  3TZ1 A;  4UPG A;  1KQM C;  1EG4 A;  1ZUZ A;  4MLW A;  1DF0 A;  2JQ6 A;  2HQW A;  5CPV A;  1TNP A;  1XK4 A;  3D10 A;  1J55 A;  5KTY A;  2KSP A;  1QJT A;  1BU3 A;  4WQ2 A;  3KEV A;  3VRO A;  5CSJ A;  1UP5 A;  5BPJ A;  1QX5 B;  3BUO B;  4MZL A;  1CMG A;  2M49 B;  2Y1N A;  3TS5 C;  1DMO A;  2M1K B;  2M1U A;  1RJV A;  2KGR A;  2O60 A;  2F33 A;  2BE6 A;  1HQV A;  2LHL A;  1S26 D;  2AMI A;  1KFU L;  1AVS A;  1DGU A;  3LCP C;  3TDI A;  1PUL A;  1AHR A;  1G4Y R;  3PM8 A;  2OPO A;  3BOW B;  1QAT A;  4N1F A;  1OZO A;  2F3Z A;  4PE1 A;  3D0Y B;  3AAJ A;  4F0Z B;  1V1G A;  2PMY A;  3DF0 A;  3PAT A;  4CLN A;  2TN4 A;  2ZNE A;  1CM1 A;  2NZ0 A;  3EK8 A;  4ZCV A;  5I2O A;  3VGO A;  3O4Y A;  2MBX A;  1NCX A;  2Y4Q A;  1CFF A;  2JRF A;  4BY4 A;  1EJ3 A;  3LL8 B;  1WLZ A;  2G2B A;  3CS1 A;  2LVJ A;  1FBV A;  1K8U A;  3RM1 A;  1WRL A;  1FI6 A;  4CPV A;  3NSI A;  2MA2 A;  2JNF A;  2MAZ A;  2K2A A;  4ORC B;  1A03 A;  1JC2 A;  1J7O A;  4CFR A;  1LVC D;  3FIA A;  1RWY A;  1UUS A;  5DKQ A;  2M9G A;  3EK4 A;  3PSR A;  2JT8 A;  1J1E A;  2BBM A;  4YGC B;  1KCY A;  1PAL A;  1KQV A;  1MHO A;  1ZFS A;  2MHH A;  1EXR A;  3EKH A;  1A29 A;  4NQG A;  1AK8 A;  1REC A;  3AKA A;  1IJ6 A;  1KFX S;  1K2H A;  1GGW A;  2PAS A;  4MZK A;  1PVB A;  2I94 A;  1TCO B;  2LMU A;  2VRG A;  1SR6 B;  2BCX A;  1MXE A;  2ZKM X;  1J7P A;  1S6I A;  1LKJ A;  3KO0 A;  2LCP A;  2EC6 B;  5D69 A;  4C0L A;  1NCY A;  2AUC A;  3VRQ A;  1K93 D;  4HRE E;  1S36 A;  1UHH A;  1IKU A;  1G33 A;  2A4J A;  1PVA A;  3CR5 X;  3TUY B;  3AKB A;  1SL7 A;  1KSO A;  1IQ3 A;  4L9M A;  1TCF A;  1KWO B;  3K21 A;  3JTD B;  1QS7 A;  4ZCU A;  2L0P A;  1CDN A;  2I18 A;  1KK8 C;  2NCP A;  5AER A;  1C07 A;  2BBN A;  2BKH B;  2L4I A;  1CDM A;  5I2L A;  4DIR A;  1K9U A;  1YVH A;  1OMR A;  2ZN9 A;  4MRY A;  4BY5 A;  4GNK B;  5AAN A;  2K7C A;  4P2Y B;  2M0R A;  1B8C A;  1UHN A;  2K2F A;  1YX7 A;  3KF9 A;  3SG5 A;  1YR5 A;  2LAN A;  3PLF B;  1S5G Y;  2JWW A;  4M2Q A;  3I5I B;  1NWD A;  4A4C A;  3I5F B;  3VRR A;  1RRO A;  1QLK A;  2H61 A;  2SAS A;  1SL8 A;  1SYM A;  2LLT A;  5I8N A;  4GFT A;  1CDL A;  1CFC A;  2M29 A;  1U5I B;  1OZS A;  1RFJ A;  4GGF A;  1BMO A;  1DGV A;  2V53 A;  2LUX A;  2HPS A;  3OX6 A;  1FI5 A;  1OOJ A;  3VRP A;  1K9K A;  2KBM A;  2LLU A;  1M39 A;  1LA3 A;  2FCE A;  3M0W A;  1PK0 D;  3CWG A;  3PAL A;  4YGD B;  1YUU A;  5HKY A;  1TNW A;  2MRD A;  1M45 A;  3KPX A;  3I5G B;  1SCM B;  1NX0 A;  1S6C A;  2CTN A;  2KNE A;  3IF7 A;  4I5N B;  4MN0 A;  3EVV A;  4PE4 A;  2E6W A;  1CB1 A;  2JTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...