3TDUA

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-acetylated ubc12n complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
GSRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCN1-like protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/protein binding
total genus 66
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3tduA01
1JF2A 1IJ6A 2BE6A 3NSIA 3NXAA 1DJIA 2L50A 3PLFB 4PCWA 1A75A 5BPJA 1HQVA 3WNXB 2MBXA 3JVTC 1KQMB 2KDHA 1EH2A 3SIBA 1LINA 1AHRA 1W7IB 3TDZA 5KU1A 1CMFA 5I8NA 1CB1A 2MAZA 1QS7A 5HKWA 1QASA 1FPWA 1G8IA 1DJZA 1EL4A 2OS8C 2CTNA 3I5GC 4L9MA 4HRGA 1OOJA 2JZIA 1CDPA 1AVSA 1J1EA 1Y1AA 1YUSA 2BKHB 3IF7A 4GNKB 1G4YR 1B8CA 3CR5X 2KI4B 1CLBA 2FCDA 2ISDA 1FBVA 4XJKA 3PM8A 3PATA 3RLZA 1DT7B 1KK7Z 1M45A 2HETA 1QTXA 1K94A 2F3ZA 2P6BB 4CLNA 2LNKA 3TDUA 3VRQA 1C07A 2COLB 2SASA 1Q80A 2OTGB 3EVUA 1QLSA 5DKQA 1XFWO 4ZCVA 2BCAA 5PALA 4OVNF 1EG4A 3DF0B 1DJXA 3GK2A 4HRHA 3GK4X 2ZNDA 1YURA 3LL8B 1SW8A 2K8MB 1ALWA 2JOJA 2KQYA 1B7TZ 1GJYA 1S5GZ 1NX1A 3O4YA 1SPYA 1NCXA 1AUIB 2JULA 1DTLA 3GOFA 1CKKA 1SMGA 1WDCC 1M46A 2ZNEA 2GGMA 1A75B 4YI9A 3FWBA 3O78A 2BL0C 4DCKA 4I5NB 1NCZA 2MLFC 4GUKA 1DF0A 1A2XA 2LP3A 2FJUB 1BF5A 1MHOA 1UP5A 2KOTA 1TRFA 2EHBA 3ZNIA 2PSRA 2OPOA 4I5JA 3CGAA 1YUUA 4MSPA 4A4CA 1X02A 1KFXL 4DS7A 3ZWHA 2F33A 2KGRA 5HKYA 1B8RA 3JTDB 3E3RA 2L51A 5CSFA 1W7JB 5HLVA 1ZACA 4AOMA 1CLMA 3AKBA 4XJKB 2KNEA 4P5OE 5HLOA 4ICBA 2JU0A 1XO5A 1EJ3A 1BOCA 1AJ5A 1NP8A 3BUWB 4Q04A 2M0RA 3K21A 1KFXS 2JT0A 2R2IA 1BG1A 1JWDA 1NYAA 1YUTA 2KYFA 1KK7Y 3BUOB 1AJ4A 5J3XA 1MWNA 3IQQA 3SG2A 3OX6A 1DJYA 4MVFA 1DMOA 4ZCUA 2H2KA 2LAPA 3DVMA 3SG5A 1QLKA 3OB1B 4UPGA 1HT9A 1SY9A 3SG4A 4F0ZB 4GGFC 5JOLA 4CPVA 3PFVA 3CS1A 3KEVA 1YX8A 1CDLA 3PN7B 5D7FA 2KAXA 2L0PA 3EK4A 1XFXO 1B7TY 3I5HB 1S5GY 3KO0A 4IL1A 5CSJA 1TCFA 1F70A 2JRFA 4MZJA 2I94A 2JTTA 1QIVA 2WCFA 1DF0B 1TTXA 2KHNA 4AQJA 4QJ5B 1CLLA 2M1KB 4YI8A 1UUSA 1CFPA 1OMDA 2Y5IA 4GFTA 1KK8C 3AKAA 1N0YA 1TCOB 1S26D 2NXQA 3PSRA 1JC2A 1K8UA 4N5XA 2M7LA 1OZOA 3CR2A 3SG7A 3OB2B 2K7DA 3I5IC 2K7CA 4FQOA 1J7QA 4GPLB 2LVJA 3TS5C 4BY5A 2F3YA 4MRXA 3C1VA 4PHNA 2M3WA 2GGZA 1SNLA 1TNWA 3CWGA 1M39A 2WC8A 1Y1UA 1BLQA 4MLWA 1IQ5A 2NCPA 4OCIA 1N65A 1UWOA 1DGUA 1OMRA 1KWOC 1K95A 1KSMA 4HREE 4QJ4B 1NX0A 1ZUZA 2V53A 3VRNA 1FI5A 1UHJA 2Y1MA 4NDDA 2ZN9A 1UHKA 5JJGA 3VRRA 1KQVA 1TNPA 1YX7A 2MLEC 2RGIA 1GGWA 5ER5A 1QXPA 4ORAB 2LUCA 3CZTX 3JVTB 2LLUA 2PRUA 3BOWB 4PHMA 1CDMA 3SJSA 1V1GA 1CFDA 3WHTB 1S6IA 1WRZA 3FS7A 3A4UB 5I2OA 4MZKA 1SCMC 2KI4C 1BR4B 2SCPA 2OS8B 1XFYO 3I5GB 4YGDB 1SYMA 1AK8A 4OV2A 3KF9A 4N1GA 2MHHA 1S6CA 5GQQC 3DVKA 5I2QA 1ODBA 4YGBB 4XYNA 1R6PA 1A29A 3EK7A 2KI6C 2L2EA 3DVEA 1K9PA 1Y1XA 2EC6C 2JQ6A 4AQIA 3SIAA 3BYAA 3KHEA 3WHUB 1Y0VH 1SR6C 2JNFA 1WRLA 4WQ2A 3MSEB 3I5FC 2EGDA 4FTGA 2Y1NA 1Y6WA 4C0JA 4M2PA 2BKIB 2KBMA 2WNDA 3LLEA 1YR5A 2Q91A 2JXCA 1FF1A 1KSOA 1MR8A 1ALVA 1SL8A 1PVAA 1M63B 4M2OA 1N2DA 3TDIA 2E6WA 2LUXA 5KTYA 5K89A 2KYCA 1BJFA 2WORA 2L4IA 2E30A 4I5LB 4GGFA 1B4CA 2ZN8A 1DVIA 3DVJA 1WDCB 2LM5A 1LXFC 2QACA 1J1DA 3TUYC 2KGBC 4MN0A 1PVBA 1CNPA 1A03A 2L5XB 2I2RE 3EVRA 2LHIA 4HSZA 2G9BA 1UHNA 1UURA 2KI6D 2LANA 1BT6A 1XA5A 1C7WA 2BCXA 2PMYA 3OX5A 3FWCA 1H4BA 3VGOA 2KAVA 5AANA 2L4HA 1GGZA 1JUOA 1QJTA 1RK9A 1XVJA 2TN4A 4PHKA 4U8DA 1QVIZ 5FYXA 1VRKA 4M2QA 3EVVA 2LMTA 4CFQA 1L2OC 4GGNA 3OP0A 1XFUO 1BODA 1NWDA 2ZFDA 1GQMA 2CNPA 1U5IA 1IH0A 2M1UA 2QPTA 4DRWA 3NSKA 3CR4X 3A8RA 5F6TA 1KFUL 1LA3A 1LA0A 1PK0D 1QV1A 1UHIA 4ETOA 2JPTA 4OR9B 1QV0A 1J7OA 4USLA 1IJ5A 2F2OA 1OZSA 1UHHA 2BECA 3DD4A 3D0YA 1SCVA 2PALA 1YRUB 3AAKA 2LC5A 3D10A 2I7AA 1DJWA 1SL7A 1CFCA 1KFUS 2CT9A 4NDCA 3OHMB 2AMIA 1PSBA 2F8PA 2LCPA 1RJVA 1XK4C 4GAOA 1TNQA 1RFJA 2DOQA 4DUQA 1BMOA 1JF0A 1QATA 1MF8B 2LV7A 2PASA 1S1EA 1F4QA 1TIZA 1PALA 2WCEA 3LK1A 1SL9A 4R1EA 1WY9A 1KK8B 2KFFA 4PALA 3BXKA 1WLZA 1NIWA 2H61C 5AXIA 3SG6A 1KQMC 2NCOA 2LLTA 3I5IB 3VRPA 2KFHA 3CTNA 2FCEA 2D8NA 3TS5B 1XFZO 4CFRA 5DKRA 4PE4A 5IBWA 3LK0A 4OKHA 1QVIY 3BUNB 1DJHA 1XYDA 1CFFA 3VROA 1OE9B 1U5IB 1KWOB 2JC2A 2JXLA 1IQ3A 2LMUA 1SBJA 1CM4A 1NX2A 4C0LA 1IWQA 4ORBB 3SG3A 2KBIA 2JT8A 5TNCA 1DGVA 4YGEB 5AERA 1YTZC 3PALA 4MEWA 1NCYA 4N1FA 4PE1A 5KSZA 1LVCD 2LP2A 1C7VA 2WCBA 1K9KA 3LCPC 4YGCB 2CXJA 3D0YB 2M7NA 5CPVA 2HQ8A 4PDZA 2PVBA 2LE9B 2ZKMX 2VRGA 4CIDA 2OTGC 1IKUA 2B1UA 2MRDA 1B1GA 3HX4A 1IRJA 1SCMB 5G08A 1ZOTB 3HCMA 1EG3A 2M49B 2HQWA 2AUCA 2NZ0A 1IG5A 3EKHA 3IQOA 4JWQA 2HF5A 2LLSA 3EKJA 4MBEA 1TN4A 4QJ3B 4A4BA 4BY4A 1L7ZA 1EXRA 3RM1A 1H8BA 1LKJA 1PRWA 1WLMA 2AAOA 1IGVA 5ER4X 5B8IB 1SRAA 2M8UA 1QIWA 1OQPA 2K7OA 2LMVA 1CDNA 3AAJA 2EC6B 2I18A 2LHLA 4NDBA 2K0JA 1M31A 1SR6B 1K9UA 2KAYA 1K90D 3CLNA 3I5FB 2MJWB 5AEQA 2FOTA 1F4OA 4YGAA 1J7PA 4P2YB 1ZFSA 1WRKA 1E8AA 1RTP1 2G2BA 1YRTB 1FW4A 2BL0B 1S36A 1YVHA 1BR1B 1JBAA 2K2FA 1TOPA 4YBHB 3O6BA 2M9GA 2KSPA 1OSAA 3JTDC 1FI6A 2F2PA 2JNXA 5HKZA 1NUBA 3BUMB 1MUXA 1OMVA 2LVVA 1CTRA 1PSRA 2BBNA 4PE7A 3TUYB 3EK8A 2K61A 1XFVO 1XK4A 4MZLA 1K2HA 2KQ6A 1BU3A 1RROA 3TZ1A 1S6JA 1K96A 2O5GA 1SK6D 1NPQA 1YVLA 2BBMA 1MQ1A 3O2PA 5CSIA 1JSAA 2KFGA 1RECA 1ZMZA 1NX3A 1NSHA 2CCMA 1J7RA 2H61A 1V1FA 4YRUA 1J55A 2JTZA 2IS9A 3BQ3A 5CSNA 1QX5B 3PN7C 4TNCA 4E68A 3GK1A 1R2UA 4JPZB 2MA2A 3NSLA 2LVIA 1L2OB 4PE0A 3I5HC 1MXEA 2HPSA 2GV5A 1JFJA 2CBLA 2ZRTA 1B47A 2JWWA 5DKNA 1QX7A 3ICBA 2Q4UA 2WOSA 1DJGA 2ZRSA 1TNXA 4MRYA 3BOWA 3F45A 5I2LA 1CMGA 4WRIA 3WXAA 1B8LA 5HYDA 2K2AA 1F71A 2Y4QA 1PULA 4ORCB 1KCYA 1F8HA 4WQ3A 3KPXA 1MXLC 5D69A 1SKTA 2BCBA 1K93D 2L98A 3FIAA 4DIRA 2LVKA 1G33A 1QX2A 4I5KA 1A4PA 2M97A 1B9AA 2K7BA 4NQGA 3NSOA 2JT3A 3DF0A 4D1EA 1RWYA 2A4JA 1F54A 1F55A 1CM1A 1D1OA 3QRXA 2O60A 4PHJA 2BE4A 4JQ0D 3M0WA 1S3PA 1JFKA 2M29A 2NLNA 4GBAA 4C0KA 1AP4A 5AFPA 3BUXB 3H4SE
chains in the Genus database with same CATH superfamily
4JD9A 1JF2A 1IJ6A 2BE6A 3NSIA 3NXAA 1DJIA 2L50A 3PLFB 4PCWA 1A75A 5BPJA 1HQVA 3WNXB 3EG5B 2MBXA 3JVTC 4INXA 1KQMB 2KDHA 1EH2A 3SIBA 1LINA 3CABA 1AHRA 1W7IB 3BFHA 3TDZA 5KU1A 1CMFA 5I8NA 1CB1A 2MAZA 1QS7A 5HKWA 1QASA 1FPWA 1G8IA 1DJZA 1EL4A 2OS8C 2QEVA 2CTNA 3I5GC 4L9MA 4HRGA 1OOJA 3V2LA 2JZIA 1CDPA 1AVSA 1J1EA 1Y1AA 1YUSA 2BKHB 3IF7A 5FI2A 4GNKB 1G4YR 1B8CA 3CR5X 3B7AA 5D3OA 2BAPA 1IIOA 2KI4B 3L4LA 1CLBA 2FCDA 2ISDA 1FBVA 4XJKA 3PM8A 3PATA 3RLZA 1DT7B 1KK7Z 1M45A 2HETA 1QTXA 1K94A 2F3ZA 2P6BB 4CLNA 2LNKA 3TDUA 3VRQA 1C07A 1DEKA 2COLB 2SASA 3R1VA 1Q80A 2OTGB 3EVUA 1QLSA 5DKQA 1XFWO 4ZCVA 2BCAA 1W9ZA 4OVNF 5PALA 1EG4A 3DF0B 3S0BA 1DJXA 2WCMA 3GK2A 3SS4A 4HRHA 2L2CA 3GK4X 2ZNDA 1YURA 3LL8B 3D74A 1SW8A 2K8MB 1ALWA 2JOJA 2KQYA 1B7TZ 1GJYA 1S5GZ 3CZ2A 1NX1A 3O4YA 1SPYA 5DICA 1NCXA 1AUIB 2JULA 1DTLA 3GOFA 1CKKA 1SMGA 1WDCC 1M46A 2ZNEA 2GGMA 4JKTA 1A75B 3UNWA 4YI9A 3FWBA 3O78A 3BJHA 2BL0C 4DCKA 4I5NB 1NCZA 2MLFC 4GUKA 3RZSA 1DF0A 1Z2CB 1A2XA 2LP3A 2FJUB 1BF5A 1MHOA 1UP5A 2KOTA 1TRFA 2QEBA 2EHBA 3ZNIA 2PSRA 2OPOA 4I5JA 3CGAA 1YUUA 4F7FA 4MSPA 4A4CA 2P70A 1X02A 1KFXL 4DS7A 3ZWHA 2F33A 2KGRA 5HKYA 1B8RA 3JTDB 3E3RA 3S0AA 2L51A 5CSFA 1W7JB 5HLVA 1ZACA 4INWA 3DXLA 4AOMA 1CLMA 3AKBA 4XJKB 2KNEA 4P5OE 5HLOA 4ICBA 2JU0A 1XO5A 1EJ3A 1BOCA 1AJ5A 1NP8A 3BUWB 4Q04A 2M0RA 3K21A 1KFXS 2JT0A 2R2IA 1BG1A 1JWDA 1NYAA 1YUTA 2KYFA 1KK7Y 3BUOB 1AJ4A 5J3XA 1MWNA 3NGVA 3IQQA 3SG2A 3OX6A 1DJYA 4MVFA 1DMOA 4ZCUA 2H2KA 2LAPA 3DVMA 3SG5A 1QLKA 3OB1B 4UPGA 1HT9A 1SY9A 3SG4A 4F0ZB 4GGFC 5JOLA 4CPVA 3PFVA 3CS1A 3KEVA 1YX8A 3UO9A 1CDLA 3PN7B 5D7FA 2KAXA 5I94A 2WCHA 2L0PA 2WCJA 3EK4A 1OOFA 1XFXO 1B7TY 3I5HB 1S5GY 3KO0A 4IL1A 5CSJA 1TCFA 1F70A 2JRFA 4MZJA 3S0GA 4FQTA 2I94A 2JTTA 1QIVA 2WCFA 1DF0B 1TTXA 2KHNA 4AQJA 4QJ5B 1CLLA 2M1KB 4YI8A 1UUSA 1CFPA 1OMDA 2Y5IA 4GFTA 1KK8C 3AKAA 1N0YA 1TCOB 1S26D 2NXQA 3PSRA 1JC2A 1K8UA 4N5XA 2M7LA 1OZOA 3CR2A 3SG7A 3OB2B 2K7DA 3I5IC 2K7CA 4FQOA 1J7QA 4GPLB 2LVJA 3TS5C 4BY5A 2F3YA 4MRXA 3C1VA 4PHNA 2M3WA 2GGZA 1SNLA 1TNWA 3CWGA 1M39A 2WC8A 2BNXA 1Y1UA 1BLQA 4MLWA 1IQ5A 1P28A 2NCPA 1N65A 1UWOA 4OCIA 1T14A 1DGUA 1OMRA 3B88A 1KWOC 1K95A 1KSMA 4HREE 4IJ7A 4QJ4B 1NX0A 1ZUZA 2V53A 3CYZA 3SS3A 1UHJA 3VRNA 2Y1MA 1FI5A 4NDDA 2ZN9A 1UHKA 5JJGA 3VRRA 1KQVA 1TNPA 1YX7A 2MLEC 2RGIA 3OGNA 1GGWA 5ER5A 1QXPA 4ORAB 2LUCA 3CZTX 1TUJA 2LLUA 2PRUA 3BOWB 3JVTB 4PHMA 1CDMA 3SJSA 1V1GA 1CFDA 3WHTB 1S6IA 1WRZA 3FS7A 3A4UB 5I2OA 4MZKA 1SCMC 2KI4C 1BR4B 3PM2A 2SCPA 3OBVA 2OS8B 1XFYO 3I5GB 4YGDB 1SYMA 1AK8A 4OV2A 3KF9A 4N1GA 2MHHA 1S6CA 5GQQC 3DVKA 5I2QA 1ODBA 3FE8A 4YGBB 3R72A 4XYNA 1R6PA 1A29A 3EK7A 3S0EA 2KI6C 2L2EA 3DVEA 1K9PA 1Y1XA 3FE9A 2EC6C 2JQ6A 4AQIA 3SIAA 3BYAA 3KHEA 3WHUB 1Y0VH 1SR6C 2JNFA 1WRLA 4WQ2A 3MSEB 3I5FC 2EGDA 4FTGA 2WCLA 2Y1NA 1Y6WA 4C0JA 2QEHA 4M2PA 2BKIB 2KBMA 2WNDA 3LLEA 1YR5A 2Q91A 2JXCA 1FF1A 1KSOA 1MR8A 2PYQA 3D75A 1ALVA 1SL8A 1PVAA 1M63B 4M2OA 1N2DA 3D76A 2E6WA 2LUXA 3TDIA 5KTYA 5K89A 2KYCA 1BJFA 2WORA 2L4IA 2E30A 4I5LB 1DELA 4GGFA 1B4CA 2ZN8A 1SSEB 1DVIA 3DVJA 3Q8IA 1WDCB 2LM5A 1LXFC 2QACA 1J1DA 3TUYC 2KGBC 4MN0A 5HL1A 2KPHA 1PVBA 3L47A 1CNPA 1A03A 2L5XB 2I2RE 3EVRA 2LHIA 4HSZA 1XFRA 2G9BA 1UHNA 1UURA 2KI6D 2LANA 1BT6A 1XA5A 1C7WA 2BCXA 2PMYA 3OX5A 3SS5A 3FWCA 1H4BA 3VGOA 2KAVA 5AANA 2L4HA 1DC1A 1GGZA 1JUOA 1QJTA 1RK9A 1XVJA 2QEOA 2TN4A 4PHKA 1QVIZ 4U8DA 1C3YA 5FYXA 1VRKA 4M2QA 3EVVA 3PJIA 2LMTA 4CFQA 1L2OC 4GGNA 3OP0A 1XFUO 1BODA 1NWDA 2ZFDA 1GQMA 2CNPA 1U5IA 1IH0A 4PT1A 2M1UA 5FI7A 2QPTA 4DRWA 3NSKA 3CR4X 3A8RA 5F6TA 1KFUL 1LA3A 1LA0A 1PK0D 1QV1A 1UHIA 3B86A 2JPTA 4ETOA 4OR9B 1QV0A 1J7OA 4USLA 1IJ5A 2KLEA 2F2OA 1OZSA 1UHHA 2BECA 3DD4A 3D0YA 1SCVA 2PALA 1YRUB 3AAKA 2LC5A 3D10A 3S0DA 2I7AA 1DJWA 1SL7A 1GM0A 1CFCA 1KFUS 2CT9A 4NDCA 2ERBA 3O4XA 3OHMB 2AMIA 1PSBA 2F8PA 2LCPA 1RJVA 1XK4C 4GAOA 1ORGA 1TNQA 1RFJA 2DOQA 4DUQA 1BMOA 1JF0A 1QATA 1MF8B 2LV7A 2PASA 1S1EA 1F4QA 1TIZA 1PALA 2WCEA 3LK1A 1SL9A 4R1EA 1WY9A 1KK8B 2KFFA 2GTEA 4PALA 3BXKA 1WLZA 3D77A 1NIWA 3QMEA 5FI6A 2H61C 5AXIA 3SG6A 1KQMC 2NCOA 2LLTA 3I5IB 3VRPA 2KFHA 3CTNA 2FCEA 2WCKA 2D8NA 3TS5B 2P71A 3R1OA 1XFZO 4CFRA 5DKRA 4PE4A 5IBWA 1Z4HA 3LK0A 4OKHA 1QVIY 3BUNB 3B6XA 1DJHA 4KYNA 1XYDA 1TWOA 1CFFA 3VROA 1OE9B 1U5IB 1KWOB 2JC2A 2JXLA 1IQ3A 2LMUA 1SBJA 1CM4A 1NX2A 4C0LA 3D73A 1IWQA 4ORBB 1TUZA 3SG3A 2KBIA 2JT8A 5TNCA 1DGVA 4YGEB 5AERA 1YTZC 3PALA 4MEWA 1NCYA 3L4AA 4N1FA 4PE1A 5KSZA 1LVCD 2L5YA 2LP2A 1C7VA 2WCBA 1K9KA 3LCPC 4YGCB 2CXJA 3D0YB 2M7NA 5CPVA 2HQ8A 4PDZA 1OOIX 2PVBA 2LE9B 2ZKMX 2VRGA 4CIDA 2OTGC 1IKUA 2B1UA 2MRDA 1B1GA 3HX4A 1IRJA 3VB1A 1SCMB 5G08A 1ZOTB 3HCMA 1EG3A 2M49B 3CZ1A 2HQWA 2AUCA 2NZ0A 1IG5A 3EKHA 3IQOA 4JWQA 2HF5A 2LLSA 3EKJA 4MBEA 1TN4A 4QJ3B 4A4BA 4BY4A 1L7ZA 1EXRA 3RM1A 1H8BA 1LKJA 1PRWA 1WLMA 2AAOA 1IGVA 5ER4X 5B8IB 1SRAA 4OZDA 2M8UA 1QIWA 1OQPA 2K7OA 2LMVA 3D78A 1CDNA 3AAJA 2EC6B 2I18A 2LHLA 4NDBA 2K0JA 1M31A 1SR6B 1K9UA 2KAYA 1K90D 3CLNA 3I5FB 2MJWB 5AEQA 2FOTA 1F4OA 3S0FA 4YGAA 1J7PA 2KLDA 4P2YB 1ZFSA 1WRKA 1E8AA 1RTP1 3N7HA 1OW4A 2G2BA 2WC6A 1YRTB 1FW4A 2BL0B 1S36A 1OOGA 1YVHA 1BR1B 1JBAA 2QDIA 2K2FA 1TOPA 4YBHB 3O6BA 2M9GA 2KSPA 1OSAA 3JTDC 1FI6A 2F2PA 2JNXA 5HKZA 1NUBA 3BUMB 1MUXA 1OMVA 2FJYA 1CTRA 1PSRA 2BBNA 2LVVA 4PE7A 3EK8A 2K61A 3TUYB 1XFVO 3BFAA 1XK4A 4MZLA 3CZ0A 1K2HA 2KQ6A 1BU3A 1RROA 3TZ1A 1S6JA 1K96A 2O5GA 1SK6D 1NPQA 1YVLA 2BBMA 1MQ1A 2JPOA 3BFBA 3NHIA 3O2PA 1QWVA 5CSIA 3R1PA 1JSAA 2KFGA 1RECA 1ZMZA 1NX3A 1NSHA 1LS8A 2CCMA 3FE6A 1J7RA 2H61A 1V1FA 1OOHA 4YRUA 3K1EA 1J55A 2JTZA 2IS9A 3BQ3A 3IVTA 5CSNA 1QX5B 3PN7C 4TNCA 1DQEA 4E68A 3GK1A 1R2UA 4JPZB 2MA2A 2YGUA 2K60A 3NSLA 2LVIA 1L2OB 2H8VA 4PE0A 3I5HC 1MXEA 3NHTA 2HPSA 2GV5A 1JFJA 2CBLA 2ZRTA 1B47A 2JWWA 5DKNA 1QX7A 3ICBA 2Q4UA 2WOSA 1DJGA 5EL2A 2ZRSA 1TNXA 4MRYA 3BOWA 3DYEA 3F45A 5I2LA 1CMGA 4WRIA 3WXAA 1B8LA 5HYDA 2K2AA 1F71A 2Y4QA 1PULA 4ORCB 1KCYA 1F8HA 4WQ3A 3KPXA 1MXLC 5D69A 1SKTA 3CDNA 2BCBA 1K93D 2L98A 3FIAA 4DIRA 2WC5A 3DY9A 2LVKA 1G33A 1QX2A 4I5KA 1A4PA 2M97A 1B9AA 2K7BA 4NQGA 3NSOA 1C3ZA 2JT3A 2PQLA 3DF0A 4D1EA 1RWYA 2A4JA 1F54A 1F55A 1CM1A 1D1OA 3QRXA 2O60A 3B87A 4PHJA 2BE4A 4JQ0D 3M0WA 1S3PA 3DZTA 1JFKA 2M29A 2NLNA 4GBAA 4C0KA 1AP4A 5AFPA 3BUXB 3H4SE
chains in the Genus database with same CATH topology
1JF2A 1IJ6A 2BE6A 3NSIA 3NXAA 1DJIA 2L50A 3PLFB 4PCWA 1A75A 5BPJA 1HQVA 3WNXB 2MBXA 3JVTC 1KQMB 2KDHA 1EH2A 3SIBA 1LINA 1AHRA 1W7IB 3TDZA 5KU1A 1CMFA 5I8NA 1CB1A 2MAZA 1QS7A 5HKWA 1QASA 1FPWA 1G8IA 1DJZA 1EL4A 2OS8C 2CTNA 3I5GC 4L9MA 4HRGA 1OOJA 2JZIA 1CDPA 1AVSA 1J1EA 1Y1AA 1YUSA 2BKHB 3IF7A 4GNKB 1G4YR 1B8CA 3CR5X 2KI4B 1CLBA 2FCDA 2ISDA 1FBVA 4XJKA 3PM8A 3PATA 3RLZA 1DT7B 1KK7Z 1M45A 2HETA 1QTXA 1K94A 2F3ZA 2P6BB 4CLNA 2LNKA 3TDUA 3VRQA 1C07A 2COLB 2SASA 1Q80A 2OTGB 3EVUA 1QLSA 5DKQA 1XFWO 4ZCVA 2BCAA 5PALA 4OVNF 1EG4A 3DF0B 1DJXA 3GK2A 4HRHA 3GK4X 2ZNDA 1YURA 3LL8B 1SW8A 2K8MB 1ALWA 2JOJA 2KQYA 1B7TZ 1GJYA 1S5GZ 1NX1A 3O4YA 1SPYA 1NCXA 1AUIB 2JULA 1DTLA 3GOFA 1CKKA 1SMGA 1WDCC 1M46A 2ZNEA 2GGMA 1A75B 4YI9A 3FWBA 3O78A 2BL0C 4DCKA 4I5NB 1NCZA 2MLFC 4GUKA 1DF0A 1A2XA 2LP3A 2FJUB 1BF5A 1MHOA 1UP5A 2KOTA 1TRFA 2EHBA 3ZNIA 2PSRA 2OPOA 4I5JA 3CGAA 1YUUA 4MSPA 4A4CA 1X02A 1KFXL 4DS7A 3ZWHA 2F33A 2KGRA 5HKYA 1B8RA 3JTDB 3E3RA 2L51A 5CSFA 1W7JB 5HLVA 1ZACA 4AOMA 1CLMA 3AKBA 4XJKB 2KNEA 4P5OE 5HLOA 4ICBA 2JU0A 1XO5A 1EJ3A 1BOCA 1AJ5A 1NP8A 3BUWB 4Q04A 2M0RA 3K21A 1KFXS 2JT0A 2R2IA 1BG1A 1JWDA 1NYAA 1YUTA 2KYFA 1KK7Y 3BUOB 1AJ4A 5J3XA 1MWNA 3IQQA 3SG2A 3OX6A 1DJYA 4MVFA 1DMOA 4ZCUA 2H2KA 2LAPA 3DVMA 3SG5A 1QLKA 3OB1B 4UPGA 1HT9A 1SY9A 3SG4A 4F0ZB 4GGFC 5JOLA 4CPVA 3PFVA 3CS1A 3KEVA 1YX8A 1CDLA 3PN7B 5D7FA 2KAXA 2L0PA 3EK4A 1XFXO 1B7TY 3I5HB 1S5GY 3KO0A 4IL1A 5CSJA 1TCFA 1F70A 2JRFA 4MZJA 2I94A 2JTTA 1QIVA 2WCFA 1DF0B 1TTXA 2KHNA 4AQJA 4QJ5B 1CLLA 2M1KB 4YI8A 1UUSA 1CFPA 1OMDA 2Y5IA 4GFTA 1KK8C 3AKAA 1N0YA 1TCOB 1S26D 2NXQA 3PSRA 1JC2A 1K8UA 4N5XA 2M7LA 1OZOA 3CR2A 3SG7A 3OB2B 2K7DA 3I5IC 2K7CA 4FQOA 1J7QA 4GPLB 2LVJA 3TS5C 4BY5A 2F3YA 4MRXA 3C1VA 4PHNA 2M3WA 2GGZA 1SNLA 1TNWA 3CWGA 1M39A 2WC8A 1Y1UA 1BLQA 4MLWA 1IQ5A 2NCPA 4OCIA 1N65A 1UWOA 1DGUA 1OMRA 1KWOC 1K95A 1KSMA 4HREE 4QJ4B 1NX0A 1ZUZA 2V53A 3VRNA 1FI5A 1UHJA 2Y1MA 4NDDA 2ZN9A 1UHKA 5JJGA 3VRRA 1KQVA 1TNPA 1YX7A 2MLEC 2RGIA 1GGWA 5ER5A 1QXPA 4ORAB 2LUCA 3CZTX 3JVTB 2LLUA 2PRUA 3BOWB 4PHMA 1CDMA 3SJSA 1V1GA 1CFDA 3WHTB 1S6IA 1WRZA 3FS7A 3A4UB 5I2OA 4MZKA 1SCMC 2KI4C 1BR4B 2SCPA 2OS8B 1XFYO 3I5GB 4YGDB 1SYMA 1AK8A 4OV2A 3KF9A 4N1GA 2MHHA 1S6CA 5GQQC 3DVKA 5I2QA 1ODBA 4YGBB 4XYNA 1R6PA 1A29A 3EK7A 2KI6C 2L2EA 3DVEA 1K9PA 1Y1XA 2EC6C 2JQ6A 4AQIA 3SIAA 3BYAA 3KHEA 3WHUB 1Y0VH 1SR6C 2JNFA 1WRLA 4WQ2A 3MSEB 3I5FC 2EGDA 4FTGA 2Y1NA 1Y6WA 4C0JA 4M2PA 2BKIB 2KBMA 2WNDA 3LLEA 1YR5A 2Q91A 2JXCA 1FF1A 1KSOA 1MR8A 1ALVA 1SL8A 1PVAA 1M63B 4M2OA 1N2DA 3TDIA 2E6WA 2LUXA 5KTYA 5K89A 2KYCA 1BJFA 2WORA 2L4IA 2E30A 4I5LB 4GGFA 1B4CA 2ZN8A 1DVIA 3DVJA 1WDCB 2LM5A 1LXFC 2QACA 1J1DA 3TUYC 2KGBC 4MN0A 1PVBA 1CNPA 1A03A 2L5XB 2I2RE 3EVRA 2LHIA 4HSZA 2G9BA 1UHNA 1UURA 2KI6D 2LANA 1BT6A 1XA5A 1C7WA 2BCXA 2PMYA 3OX5A 3FWCA 1H4BA 3VGOA 2KAVA 5AANA 2L4HA 1GGZA 1JUOA 1QJTA 1RK9A 1XVJA 2TN4A 4PHKA 4U8DA 1QVIZ 5FYXA 1VRKA 4M2QA 3EVVA 2LMTA 4CFQA 1L2OC 4GGNA 3OP0A 1XFUO 1BODA 1NWDA 2ZFDA 1GQMA 2CNPA 1U5IA 1IH0A 2M1UA 2QPTA 4DRWA 3NSKA 3CR4X 3A8RA 5F6TA 1KFUL 1LA3A 1LA0A 1PK0D 1QV1A 1UHIA 4ETOA 2JPTA 4OR9B 1QV0A 1J7OA 4USLA 1IJ5A 2F2OA 1OZSA 1UHHA 2BECA 3DD4A 3D0YA 1SCVA 2PALA 1YRUB 3AAKA 2LC5A 3D10A 2I7AA 1DJWA 1SL7A 1CFCA 1KFUS 2CT9A 4NDCA 3OHMB 2AMIA 1PSBA 2F8PA 2LCPA 1RJVA 1XK4C 4GAOA 1TNQA 1RFJA 2DOQA 4DUQA 1BMOA 1JF0A 1QATA 1MF8B 2LV7A 2PASA 1S1EA 1F4QA 1TIZA 1PALA 2WCEA 3LK1A 1SL9A 4R1EA 1WY9A 1KK8B 2KFFA 4PALA 3BXKA 1WLZA 1NIWA 2H61C 5AXIA 3SG6A 1KQMC 2NCOA 2LLTA 3I5IB 3VRPA 2KFHA 3CTNA 2FCEA 2D8NA 3TS5B 1XFZO 4CFRA 5DKRA 4PE4A 5IBWA 3LK0A 4OKHA 1QVIY 3BUNB 1DJHA 1XYDA 1CFFA 3VROA 1OE9B 1U5IB 1KWOB 2JC2A 2JXLA 1IQ3A 2LMUA 1SBJA 1CM4A 1NX2A 4C0LA 1IWQA 4ORBB 3SG3A 2KBIA 2JT8A 5TNCA 1DGVA 4YGEB 5AERA 1YTZC 3PALA 4MEWA 1NCYA 4N1FA 4PE1A 5KSZA 1LVCD 2LP2A 1C7VA 2WCBA 1K9KA 3LCPC 4YGCB 2CXJA 3D0YB 2M7NA 5CPVA 2HQ8A 4PDZA 2PVBA 2LE9B 2ZKMX 2VRGA 4CIDA 2OTGC 1IKUA 2B1UA 2MRDA 1B1GA 3HX4A 1IRJA 1SCMB 5G08A 1ZOTB 3HCMA 1EG3A 2M49B 2HQWA 2AUCA 2NZ0A 1IG5A 3EKHA 3IQOA 4JWQA 2HF5A 2LLSA 3EKJA 4MBEA 1TN4A 4QJ3B 4A4BA 4BY4A 1L7ZA 1EXRA 3RM1A 1H8BA 1LKJA 1PRWA 1WLMA 2AAOA 1IGVA 5ER4X 5B8IB 1SRAA 2M8UA 1QIWA 1OQPA 2K7OA 2LMVA 1CDNA 3AAJA 2EC6B 2I18A 2LHLA 4NDBA 2K0JA 1M31A 1SR6B 1K9UA 2KAYA 1K90D 3CLNA 3I5FB 2MJWB 5AEQA 2FOTA 1F4OA 4YGAA 1J7PA 4P2YB 1ZFSA 1WRKA 1E8AA 1RTP1 2G2BA 1YRTB 1FW4A 2BL0B 1S36A 1YVHA 1BR1B 1JBAA 2K2FA 1TOPA 4YBHB 3O6BA 2M9GA 2KSPA 1OSAA 3JTDC 1FI6A 2F2PA 2JNXA 5HKZA 1NUBA 3BUMB 1MUXA 1OMVA 2LVVA 1CTRA 1PSRA 2BBNA 4PE7A 3TUYB 3EK8A 2K61A 1XFVO 1XK4A 4MZLA 1K2HA 2KQ6A 1BU3A 1RROA 3TZ1A 1S6JA 1K96A 2O5GA 1SK6D 1NPQA 1YVLA 2BBMA 1MQ1A 3O2PA 5CSIA 1JSAA 2KFGA 1RECA 1ZMZA 1NX3A 1NSHA 2CCMA 1J7RA 2H61A 1V1FA 4YRUA 1J55A 2JTZA 2IS9A 3BQ3A 5CSNA 1QX5B 3PN7C 4TNCA 4E68A 3GK1A 1R2UA 4JPZB 2MA2A 3NSLA 2LVIA 1L2OB 4PE0A 3I5HC 1MXEA 2HPSA 2GV5A 1JFJA 2CBLA 2ZRTA 1B47A 2JWWA 5DKNA 1QX7A 3ICBA 2Q4UA 2WOSA 1DJGA 2ZRSA 1TNXA 4MRYA 3BOWA 3F45A 5I2LA 1CMGA 4WRIA 3WXAA 1B8LA 5HYDA 2K2AA 1F71A 2Y4QA 1PULA 4ORCB 1KCYA 1F8HA 4WQ3A 3KPXA 1MXLC 5D69A 1SKTA 2BCBA 1K93D 2L98A 3FIAA 4DIRA 2LVKA 1G33A 1QX2A 4I5KA 1A4PA 2M97A 1B9AA 2K7BA 4NQGA 3NSOA 2JT3A 3DF0A 4D1EA 1RWYA 2A4JA 1F54A 1F55A 1CM1A 1D1OA 3QRXA 2O60A 4PHJA 2BE4A 4JQ0D 3M0WA 1S3PA 1JFKA 2M29A 2NLNA 4GBAA 4C0KA 1AP4A 5AFPA 3BUXB 3H4SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JF2 A;  1IJ6 A;  2BE6 A;  3NSI A;  3NXA A;  1DJI A;  2L50 A;  3PLF B;  4PCW A;  1A75 A;  5BPJ A;  1HQV A;  3WNX B;  2MBX A;  3JVT C;  1KQM B;  2KDH A;  1EH2 A;  3SIB A;  1LIN A;  1AHR A;  1W7I B;  3TDZ A;  5KU1 A;  1CMF A;  5I8N A;  1CB1 A;  2MAZ A;  1QS7 A;  5HKW A;  1QAS A;  1FPW A;  1G8I A;  1DJZ A;  1EL4 A;  2OS8 C;  2CTN A;  3I5G C;  4L9M A;  4HRG A;  1OOJ A;  2JZI A;  1CDP A;  1AVS A;  1J1E A;  1Y1A A;  1YUS A;  2BKH B;  3IF7 A;  4GNK B;  1G4Y R;  1B8C A;  3CR5 X;  2KI4 B;  1CLB A;  2FCD A;  2ISD A;  1FBV A;  4XJK A;  3PM8 A;  3PAT A;  3RLZ A;  1DT7 B;  1KK7 Z;  1M45 A;  2HET A;  1QTX A;  1K94 A;  2F3Z A;  2P6B B;  4CLN A;  2LNK A;  3TDU A;  3VRQ A;  1C07 A;  2COL B;  2SAS A;  1Q80 A;  2OTG B;  3EVU A;  1QLS A;  5DKQ A;  1XFW O;  4ZCV A;  2BCA A;  5PAL A;  4OVN F;  1EG4 A;  3DF0 B;  1DJX A;  3GK2 A;  4HRH A;  3GK4 X;  2ZND A;  1YUR A;  3LL8 B;  1SW8 A;  2K8M B;  1ALW A;  2JOJ A;  2KQY A;  1B7T Z;  1GJY A;  1S5G Z;  1NX1 A;  3O4Y A;  1SPY A;  1NCX A;  1AUI B;  2JUL A;  1DTL A;  3GOF A;  1CKK A;  1SMG A;  1WDC C;  1M46 A;  2ZNE A;  2GGM A;  1A75 B;  4YI9 A;  3FWB A;  3O78 A;  2BL0 C;  4DCK A;  4I5N B;  1NCZ A;  2MLF C;  4GUK A;  1DF0 A;  1A2X A;  2LP3 A;  2FJU B;  1BF5 A;  1MHO A;  1UP5 A;  2KOT A;  1TRF A;  2EHB A;  3ZNI A;  2PSR A;  2OPO A;  4I5J A;  3CGA A;  1YUU A;  4MSP A;  4A4C A;  1X02 A;  1KFX L;  4DS7 A;  3ZWH A;  2F33 A;  2KGR A;  5HKY A;  1B8R A;  3JTD B;  3E3R A;  2L51 A;  5CSF A;  1W7J B;  5HLV A;  1ZAC A;  4AOM A;  1CLM A;  3AKB A;  4XJK B;  2KNE A;  4P5O E;  5HLO A;  4ICB A;  2JU0 A;  1XO5 A;  1EJ3 A;  1BOC A;  1AJ5 A;  1NP8 A;  3BUW B;  4Q04 A;  2M0R A;  3K21 A;  1KFX S;  2JT0 A;  2R2I A;  1BG1 A;  1JWD A;  1NYA A;  1YUT A;  2KYF A;  1KK7 Y;  3BUO B;  1AJ4 A;  5J3X A;  1MWN A;  3IQQ A;  3SG2 A;  3OX6 A;  1DJY A;  4MVF A;  1DMO A;  4ZCU A;  2H2K A;  2LAP A;  3DVM A;  3SG5 A;  1QLK A;  3OB1 B;  4UPG A;  1HT9 A;  1SY9 A;  3SG4 A;  4F0Z B;  4GGF C;  5JOL A;  4CPV A;  3PFV A;  3CS1 A;  3KEV A;  1YX8 A;  1CDL A;  3PN7 B;  5D7F A;  2KAX A;  2L0P A;  3EK4 A;  1XFX O;  1B7T Y;  3I5H B;  1S5G Y;  3KO0 A;  4IL1 A;  5CSJ A;  1TCF A;  1F70 A;  2JRF A;  4MZJ A;  2I94 A;  2JTT A;  1QIV A;  2WCF A;  1DF0 B;  1TTX A;  2KHN A;  4AQJ A;  4QJ5 B;  1CLL A;  2M1K B;  4YI8 A;  1UUS A;  1CFP A;  1OMD A;  2Y5I A;  4GFT A;  1KK8 C;  3AKA A;  1N0Y A;  1TCO B;  1S26 D;  2NXQ A;  3PSR A;  1JC2 A;  1K8U A;  4N5X A;  2M7L A;  1OZO A;  3CR2 A;  3SG7 A;  3OB2 B;  2K7D A;  3I5I C;  2K7C A;  4FQO A;  1J7Q A;  4GPL B;  2LVJ A;  3TS5 C;  4BY5 A;  2F3Y A;  4MRX A;  3C1V A;  4PHN A;  2M3W A;  2GGZ A;  1SNL A;  1TNW A;  3CWG A;  1M39 A;  2WC8 A;  1Y1U A;  1BLQ A;  4MLW A;  1IQ5 A;  2NCP A;  4OCI A;  1N65 A;  1UWO A;  1DGU A;  1OMR A;  1KWO C;  1K95 A;  1KSM A;  4HRE E;  4QJ4 B;  1NX0 A;  1ZUZ A;  2V53 A;  3VRN A;  1FI5 A;  1UHJ A;  2Y1M A;  4NDD A;  2ZN9 A;  1UHK A;  5JJG A;  3VRR A;  1KQV A;  1TNP A;  1YX7 A;  2MLE C;  2RGI A;  1GGW A;  5ER5 A;  1QXP A;  4ORA B;  2LUC A;  3CZT X;  3JVT B;  2LLU A;  2PRU A;  3BOW B;  4PHM A;  1CDM A;  3SJS A;  1V1G A;  1CFD A;  3WHT B;  1S6I A;  1WRZ A;  3FS7 A;  3A4U B;  5I2O A;  4MZK A;  1SCM C;  2KI4 C;  1BR4 B;  2SCP A;  2OS8 B;  1XFY O;  3I5G B;  4YGD B;  1SYM A;  1AK8 A;  4OV2 A;  3KF9 A;  4N1G A;  2MHH A;  1S6C A;  5GQQ C;  3DVK A;  5I2Q A;  1ODB A;  4YGB B;  4XYN A;  1R6P A;  1A29 A;  3EK7 A;  2KI6 C;  2L2E A;  3DVE A;  1K9P A;  1Y1X A;  2EC6 C;  2JQ6 A;  4AQI A;  3SIA A;  3BYA A;  3KHE A;  3WHU B;  1Y0V H;  1SR6 C;  2JNF A;  1WRL A;  4WQ2 A;  3MSE B;  3I5F C;  2EGD A;  4FTG A;  2Y1N A;  1Y6W A;  4C0J A;  4M2P A;  2BKI B;  2KBM A;  2WND A;  3LLE A;  1YR5 A;  2Q91 A;  2JXC A;  1FF1 A;  1KSO A;  1MR8 A;  1ALV A;  1SL8 A;  1PVA A;  1M63 B;  4M2O A;  1N2D A;  3TDI A;  2E6W A;  2LUX A;  5KTY A;  5K89 A;  2KYC A;  1BJF A;  2WOR A;  2L4I A;  2E30 A;  4I5L B;  4GGF A;  1B4C A;  2ZN8 A;  1DVI A;  3DVJ A;  1WDC B;  2LM5 A;  1LXF C;  2QAC A;  1J1D A;  3TUY C;  2KGB C;  4MN0 A;  1PVB A;  1CNP A;  1A03 A;  2L5X B;  2I2R E;  3EVR A;  2LHI A;  4HSZ A;  2G9B A;  1UHN A;  1UUR A;  2KI6 D;  2LAN A;  1BT6 A;  1XA5 A;  1C7W A;  2BCX A;  2PMY A;  3OX5 A;  3FWC A;  1H4B A;  3VGO A;  2KAV A;  5AAN A;  2L4H A;  1GGZ A;  1JUO A;  1QJT A;  1RK9 A;  1XVJ A;  2TN4 A;  4PHK A;  4U8D A;  1QVI Z;  5FYX A;  1VRK A;  4M2Q A;  3EVV A;  2LMT A;  4CFQ A;  1L2O C;  4GGN A;  3OP0 A;  1XFU O;  1BOD A;  1NWD A;  2ZFD A;  1GQM A;  2CNP A;  1U5I A;  1IH0 A;  2M1U A;  2QPT A;  4DRW A;  3NSK A;  3CR4 X;  3A8R A;  5F6T A;  1KFU L;  1LA3 A;  1LA0 A;  1PK0 D;  1QV1 A;  1UHI A;  4ETO A;  2JPT A;  4OR9 B;  1QV0 A;  1J7O A;  4USL A;  1IJ5 A;  2F2O A;  1OZS A;  1UHH A;  2BEC A;  3DD4 A;  3D0Y A;  1SCV A;  2PAL A;  1YRU B;  3AAK A;  2LC5 A;  3D10 A;  2I7A A;  1DJW A;  1SL7 A;  1CFC A;  1KFU S;  2CT9 A;  4NDC A;  3OHM B;  2AMI A;  1PSB A;  2F8P A;  2LCP A;  1RJV A;  1XK4 C;  4GAO A;  1TNQ A;  1RFJ A;  2DOQ A;  4DUQ A;  1BMO A;  1JF0 A;  1QAT A;  1MF8 B;  2LV7 A;  2PAS A;  1S1E A;  1F4Q A;  1TIZ A;  1PAL A;  2WCE A;  3LK1 A;  1SL9 A;  4R1E A;  1WY9 A;  1KK8 B;  2KFF A;  4PAL A;  3BXK A;  1WLZ A;  1NIW A;  2H61 C;  5AXI A;  3SG6 A;  1KQM C;  2NCO A;  2LLT A;  3I5I B;  3VRP A;  2KFH A;  3CTN A;  2FCE A;  2D8N A;  3TS5 B;  1XFZ O;  4CFR A;  5DKR A;  4PE4 A;  5IBW A;  3LK0 A;  4OKH A;  1QVI Y;  3BUN B;  1DJH A;  1XYD A;  1CFF A;  3VRO A;  1OE9 B;  1U5I B;  1KWO B;  2JC2 A;  2JXL A;  1IQ3 A;  2LMU A;  1SBJ A;  1CM4 A;  1NX2 A;  4C0L A;  1IWQ A;  4ORB B;  3SG3 A;  2KBI A;  2JT8 A;  5TNC A;  1DGV A;  4YGE B;  5AER A;  1YTZ C;  3PAL A;  4MEW A;  1NCY A;  4N1F A;  4PE1 A;  5KSZ A;  1LVC D;  2LP2 A;  1C7V A;  2WCB A;  1K9K A;  3LCP C;  4YGC B;  2CXJ A;  3D0Y B;  2M7N A;  5CPV A;  2HQ8 A;  4PDZ A;  2PVB A;  2LE9 B;  2ZKM X;  2VRG A;  4CID A;  2OTG C;  1IKU A;  2B1U A;  2MRD A;  1B1G A;  3HX4 A;  1IRJ A;  1SCM B;  5G08 A;  1ZOT B;  3HCM A;  1EG3 A;  2M49 B;  2HQW A;  2AUC A;  2NZ0 A;  1IG5 A;  3EKH A;  3IQO A;  4JWQ A;  2HF5 A;  2LLS A;  3EKJ A;  4MBE A;  1TN4 A;  4QJ3 B;  4A4B A;  4BY4 A;  1L7Z A;  1EXR A;  3RM1 A;  1H8B A;  1LKJ A;  1PRW A;  1WLM A;  2AAO A;  1IGV A;  5ER4 X;  5B8I B;  1SRA A;  2M8U A;  1QIW A;  1OQP A;  2K7O A;  2LMV A;  1CDN A;  3AAJ A;  2EC6 B;  2I18 A;  2LHL A;  4NDB A;  2K0J A;  1M31 A;  1SR6 B;  1K9U A;  2KAY A;  1K90 D;  3CLN A;  3I5F B;  2MJW B;  5AEQ A;  2FOT A;  1F4O A;  4YGA A;  1J7P A;  4P2Y B;  1ZFS A;  1WRK A;  1E8A A;  1RTP 1;  2G2B A;  1YRT B;  1FW4 A;  2BL0 B;  1S36 A;  1YVH A;  1BR1 B;  1JBA A;  2K2F A;  1TOP A;  4YBH B;  3O6B A;  2M9G A;  2KSP A;  1OSA A;  3JTD C;  1FI6 A;  2F2P A;  2JNX A;  5HKZ A;  1NUB A;  3BUM B;  1MUX A;  1OMV A;  2LVV A;  1CTR A;  1PSR A;  2BBN A;  4PE7 A;  3TUY B;  3EK8 A;  2K61 A;  1XFV O;  1XK4 A;  4MZL A;  1K2H A;  2KQ6 A;  1BU3 A;  1RRO A;  3TZ1 A;  1S6J A;  1K96 A;  2O5G A;  1SK6 D;  1NPQ A;  1YVL A;  2BBM A;  1MQ1 A;  3O2P A;  5CSI A;  1JSA A;  2KFG A;  1REC A;  1ZMZ A;  1NX3 A;  1NSH A;  2CCM A;  1J7R A;  2H61 A;  1V1F A;  4YRU A;  1J55 A;  2JTZ A;  2IS9 A;  3BQ3 A;  5CSN A;  1QX5 B;  3PN7 C;  4TNC A;  4E68 A;  3GK1 A;  1R2U A;  4JPZ B;  2MA2 A;  3NSL A;  2LVI A;  1L2O B;  4PE0 A;  3I5H C;  1MXE A;  2HPS A;  2GV5 A;  1JFJ A;  2CBL A;  2ZRT A;  1B47 A;  2JWW A;  5DKN A;  1QX7 A;  3ICB A;  2Q4U A;  2WOS A;  1DJG A;  2ZRS A;  1TNX A;  4MRY A;  3BOW A;  3F45 A;  5I2L A;  1CMG A;  4WRI A;  3WXA A;  1B8L A;  5HYD A;  2K2A A;  1F71 A;  2Y4Q A;  1PUL A;  4ORC B;  1KCY A;  1F8H A;  4WQ3 A;  3KPX A;  1MXL C;  5D69 A;  1SKT A;  2BCB A;  1K93 D;  2L98 A;  3FIA A;  4DIR A;  2LVK A;  1G33 A;  1QX2 A;  4I5K A;  1A4P A;  2M97 A;  1B9A A;  2K7B A;  4NQG A;  3NSO A;  2JT3 A;  3DF0 A;  4D1E A;  1RWY A;  2A4J A;  1F54 A;  1F55 A;  1CM1 A;  1D1O A;  3QRX A;  2O60 A;  4PHJ A;  2BE4 A;  4JQ0 D;  3M0W A;  1S3P A;  1JFK A;  2M29 A;  2NLN A;  4GBA A;  4C0K A;  1AP4 A;  5AFP A;  3BUX B;  3H4S E; 
#chains in the Genus database with same CATH topology
 4JD9 A;  1JF2 A;  1IJ6 A;  2BE6 A;  3NSI A;  3NXA A;  1DJI A;  2L50 A;  3PLF B;  4PCW A;  1A75 A;  5BPJ A;  1HQV A;  3WNX B;  3EG5 B;  2MBX A;  3JVT C;  4INX A;  1KQM B;  2KDH A;  1EH2 A;  3SIB A;  1LIN A;  3CAB A;  1AHR A;  1W7I B;  3BFH A;  3TDZ A;  5KU1 A;  1CMF A;  5I8N A;  1CB1 A;  2MAZ A;  1QS7 A;  5HKW A;  1QAS A;  1FPW A;  1G8I A;  1DJZ A;  1EL4 A;  2OS8 C;  2QEV A;  2CTN A;  3I5G C;  4L9M A;  4HRG A;  1OOJ A;  3V2L A;  2JZI A;  1CDP A;  1AVS A;  1J1E A;  1Y1A A;  1YUS A;  2BKH B;  3IF7 A;  5FI2 A;  4GNK B;  1G4Y R;  1B8C A;  3CR5 X;  3B7A A;  5D3O A;  2BAP A;  1IIO A;  2KI4 B;  3L4L A;  1CLB A;  2FCD A;  2ISD A;  1FBV A;  4XJK A;  3PM8 A;  3PAT A;  3RLZ A;  1DT7 B;  1KK7 Z;  1M45 A;  2HET A;  1QTX A;  1K94 A;  2F3Z A;  2P6B B;  4CLN A;  2LNK A;  3TDU A;  3VRQ A;  1C07 A;  1DEK A;  2COL B;  2SAS A;  3R1V A;  1Q80 A;  2OTG B;  3EVU A;  1QLS A;  5DKQ A;  1XFW O;  4ZCV A;  2BCA A;  1W9Z A;  4OVN F;  5PAL A;  1EG4 A;  3DF0 B;  3S0B A;  1DJX A;  2WCM A;  3GK2 A;  3SS4 A;  4HRH A;  2L2C A;  3GK4 X;  2ZND A;  1YUR A;  3LL8 B;  3D74 A;  1SW8 A;  2K8M B;  1ALW A;  2JOJ A;  2KQY A;  1B7T Z;  1GJY A;  1S5G Z;  3CZ2 A;  1NX1 A;  3O4Y A;  1SPY A;  5DIC A;  1NCX A;  1AUI B;  2JUL A;  1DTL A;  3GOF A;  1CKK A;  1SMG A;  1WDC C;  1M46 A;  2ZNE A;  2GGM A;  4JKT A;  1A75 B;  3UNW A;  4YI9 A;  3FWB A;  3O78 A;  3BJH A;  2BL0 C;  4DCK A;  4I5N B;  1NCZ A;  2MLF C;  4GUK A;  3RZS A;  1DF0 A;  1Z2C B;  1A2X A;  2LP3 A;  2FJU B;  1BF5 A;  1MHO A;  1UP5 A;  2KOT A;  1TRF A;  2QEB A;  2EHB A;  3ZNI A;  2PSR A;  2OPO A;  4I5J A;  3CGA A;  1YUU A;  4F7F A;  4MSP A;  4A4C A;  2P70 A;  1X02 A;  1KFX L;  4DS7 A;  3ZWH A;  2F33 A;  2KGR A;  5HKY A;  1B8R A;  3JTD B;  3E3R A;  3S0A A;  2L51 A;  5CSF A;  1W7J B;  5HLV A;  1ZAC A;  4INW A;  3DXL A;  4AOM A;  1CLM A;  3AKB A;  4XJK B;  2KNE A;  4P5O E;  5HLO A;  4ICB A;  2JU0 A;  1XO5 A;  1EJ3 A;  1BOC A;  1AJ5 A;  1NP8 A;  3BUW B;  4Q04 A;  2M0R A;  3K21 A;  1KFX S;  2JT0 A;  2R2I A;  1BG1 A;  1JWD A;  1NYA A;  1YUT A;  2KYF A;  1KK7 Y;  3BUO B;  1AJ4 A;  5J3X A;  1MWN A;  3NGV A;  3IQQ A;  3SG2 A;  3OX6 A;  1DJY A;  4MVF A;  1DMO A;  4ZCU A;  2H2K A;  2LAP A;  3DVM A;  3SG5 A;  1QLK A;  3OB1 B;  4UPG A;  1HT9 A;  1SY9 A;  3SG4 A;  4F0Z B;  4GGF C;  5JOL A;  4CPV A;  3PFV A;  3CS1 A;  3KEV A;  1YX8 A;  3UO9 A;  1CDL A;  3PN7 B;  5D7F A;  2KAX A;  5I94 A;  2WCH A;  2L0P A;  2WCJ A;  3EK4 A;  1OOF A;  1XFX O;  1B7T Y;  3I5H B;  1S5G Y;  3KO0 A;  4IL1 A;  5CSJ A;  1TCF A;  1F70 A;  2JRF A;  4MZJ A;  3S0G A;  4FQT A;  2I94 A;  2JTT A;  1QIV A;  2WCF A;  1DF0 B;  1TTX A;  2KHN A;  4AQJ A;  4QJ5 B;  1CLL A;  2M1K B;  4YI8 A;  1UUS A;  1CFP A;  1OMD A;  2Y5I A;  4GFT A;  1KK8 C;  3AKA A;  1N0Y A;  1TCO B;  1S26 D;  2NXQ A;  3PSR A;  1JC2 A;  1K8U A;  4N5X A;  2M7L A;  1OZO A;  3CR2 A;  3SG7 A;  3OB2 B;  2K7D A;  3I5I C;  2K7C A;  4FQO A;  1J7Q A;  4GPL B;  2LVJ A;  3TS5 C;  4BY5 A;  2F3Y A;  4MRX A;  3C1V A;  4PHN A;  2M3W A;  2GGZ A;  1SNL A;  1TNW A;  3CWG A;  1M39 A;  2WC8 A;  2BNX A;  1Y1U A;  1BLQ A;  4MLW A;  1IQ5 A;  1P28 A;  2NCP A;  1N65 A;  1UWO A;  4OCI A;  1T14 A;  1DGU A;  1OMR A;  3B88 A;  1KWO C;  1K95 A;  1KSM A;  4HRE E;  4IJ7 A;  4QJ4 B;  1NX0 A;  1ZUZ A;  2V53 A;  3CYZ A;  3SS3 A;  1UHJ A;  3VRN A;  2Y1M A;  1FI5 A;  4NDD A;  2ZN9 A;  1UHK A;  5JJG A;  3VRR A;  1KQV A;  1TNP A;  1YX7 A;  2MLE C;  2RGI A;  3OGN A;  1GGW A;  5ER5 A;  1QXP A;  4ORA B;  2LUC A;  3CZT X;  1TUJ A;  2LLU A;  2PRU A;  3BOW B;  3JVT B;  4PHM A;  1CDM A;  3SJS A;  1V1G A;  1CFD A;  3WHT B;  1S6I A;  1WRZ A;  3FS7 A;  3A4U B;  5I2O A;  4MZK A;  1SCM C;  2KI4 C;  1BR4 B;  3PM2 A;  2SCP A;  3OBV A;  2OS8 B;  1XFY O;  3I5G B;  4YGD B;  1SYM A;  1AK8 A;  4OV2 A;  3KF9 A;  4N1G A;  2MHH A;  1S6C A;  5GQQ C;  3DVK A;  5I2Q A;  1ODB A;  3FE8 A;  4YGB B;  3R72 A;  4XYN A;  1R6P A;  1A29 A;  3EK7 A;  3S0E A;  2KI6 C;  2L2E A;  3DVE A;  1K9P A;  1Y1X A;  3FE9 A;  2EC6 C;  2JQ6 A;  4AQI A;  3SIA A;  3BYA A;  3KHE A;  3WHU B;  1Y0V H;  1SR6 C;  2JNF A;  1WRL A;  4WQ2 A;  3MSE B;  3I5F C;  2EGD A;  4FTG A;  2WCL A;  2Y1N A;  1Y6W A;  4C0J A;  2QEH A;  4M2P A;  2BKI B;  2KBM A;  2WND A;  3LLE A;  1YR5 A;  2Q91 A;  2JXC A;  1FF1 A;  1KSO A;  1MR8 A;  2PYQ A;  3D75 A;  1ALV A;  1SL8 A;  1PVA A;  1M63 B;  4M2O A;  1N2D A;  3D76 A;  2E6W A;  2LUX A;  3TDI A;  5KTY A;  5K89 A;  2KYC A;  1BJF A;  2WOR A;  2L4I A;  2E30 A;  4I5L B;  1DEL A;  4GGF A;  1B4C A;  2ZN8 A;  1SSE B;  1DVI A;  3DVJ A;  3Q8I A;  1WDC B;  2LM5 A;  1LXF C;  2QAC A;  1J1D A;  3TUY C;  2KGB C;  4MN0 A;  5HL1 A;  2KPH A;  1PVB A;  3L47 A;  1CNP A;  1A03 A;  2L5X B;  2I2R E;  3EVR A;  2LHI A;  4HSZ A;  1XFR A;  2G9B A;  1UHN A;  1UUR A;  2KI6 D;  2LAN A;  1BT6 A;  1XA5 A;  1C7W A;  2BCX A;  2PMY A;  3OX5 A;  3SS5 A;  3FWC A;  1H4B A;  3VGO A;  2KAV A;  5AAN A;  2L4H A;  1DC1 A;  1GGZ A;  1JUO A;  1QJT A;  1RK9 A;  1XVJ A;  2QEO A;  2TN4 A;  4PHK A;  1QVI Z;  4U8D A;  1C3Y A;  5FYX A;  1VRK A;  4M2Q A;  3EVV A;  3PJI A;  2LMT A;  4CFQ A;  1L2O C;  4GGN A;  3OP0 A;  1XFU O;  1BOD A;  1NWD A;  2ZFD A;  1GQM A;  2CNP A;  1U5I A;  1IH0 A;  4PT1 A;  2M1U A;  5FI7 A;  2QPT A;  4DRW A;  3NSK A;  3CR4 X;  3A8R A;  5F6T A;  1KFU L;  1LA3 A;  1LA0 A;  1PK0 D;  1QV1 A;  1UHI A;  3B86 A;  2JPT A;  4ETO A;  4OR9 B;  1QV0 A;  1J7O A;  4USL A;  1IJ5 A;  2KLE A;  2F2O A;  1OZS A;  1UHH A;  2BEC A;  3DD4 A;  3D0Y A;  1SCV A;  2PAL A;  1YRU B;  3AAK A;  2LC5 A;  3D10 A;  3S0D A;  2I7A A;  1DJW A;  1SL7 A;  1GM0 A;  1CFC A;  1KFU S;  2CT9 A;  4NDC A;  2ERB A;  3O4X A;  3OHM B;  2AMI A;  1PSB A;  2F8P A;  2LCP A;  1RJV A;  1XK4 C;  4GAO A;  1ORG A;  1TNQ A;  1RFJ A;  2DOQ A;  4DUQ A;  1BMO A;  1JF0 A;  1QAT A;  1MF8 B;  2LV7 A;  2PAS A;  1S1E A;  1F4Q A;  1TIZ A;  1PAL A;  2WCE A;  3LK1 A;  1SL9 A;  4R1E A;  1WY9 A;  1KK8 B;  2KFF A;  2GTE A;  4PAL A;  3BXK A;  1WLZ A;  3D77 A;  1NIW A;  3QME A;  5FI6 A;  2H61 C;  5AXI A;  3SG6 A;  1KQM C;  2NCO A;  2LLT A;  3I5I B;  3VRP A;  2KFH A;  3CTN A;  2FCE A;  2WCK A;  2D8N A;  3TS5 B;  2P71 A;  3R1O A;  1XFZ O;  4CFR A;  5DKR A;  4PE4 A;  5IBW A;  1Z4H A;  3LK0 A;  4OKH A;  1QVI Y;  3BUN B;  3B6X A;  1DJH A;  4KYN A;  1XYD A;  1TWO A;  1CFF A;  3VRO A;  1OE9 B;  1U5I B;  1KWO B;  2JC2 A;  2JXL A;  1IQ3 A;  2LMU A;  1SBJ A;  1CM4 A;  1NX2 A;  4C0L A;  3D73 A;  1IWQ A;  4ORB B;  1TUZ A;  3SG3 A;  2KBI A;  2JT8 A;  5TNC A;  1DGV A;  4YGE B;  5AER A;  1YTZ C;  3PAL A;  4MEW A;  1NCY A;  3L4A A;  4N1F A;  4PE1 A;  5KSZ A;  1LVC D;  2L5Y A;  2LP2 A;  1C7V A;  2WCB A;  1K9K A;  3LCP C;  4YGC B;  2CXJ A;  3D0Y B;  2M7N A;  5CPV A;  2HQ8 A;  4PDZ A;  1OOI X;  2PVB A;  2LE9 B;  2ZKM X;  2VRG A;  4CID A;  2OTG C;  1IKU A;  2B1U A;  2MRD A;  1B1G A;  3HX4 A;  1IRJ A;  3VB1 A;  1SCM B;  5G08 A;  1ZOT B;  3HCM A;  1EG3 A;  2M49 B;  3CZ1 A;  2HQW A;  2AUC A;  2NZ0 A;  1IG5 A;  3EKH A;  3IQO A;  4JWQ A;  2HF5 A;  2LLS A;  3EKJ A;  4MBE A;  1TN4 A;  4QJ3 B;  4A4B A;  4BY4 A;  1L7Z A;  1EXR A;  3RM1 A;  1H8B A;  1LKJ A;  1PRW A;  1WLM A;  2AAO A;  1IGV A;  5ER4 X;  5B8I B;  1SRA A;  4OZD A;  2M8U A;  1QIW A;  1OQP A;  2K7O A;  2LMV A;  3D78 A;  1CDN A;  3AAJ A;  2EC6 B;  2I18 A;  2LHL A;  4NDB A;  2K0J A;  1M31 A;  1SR6 B;  1K9U A;  2KAY A;  1K90 D;  3CLN A;  3I5F B;  2MJW B;  5AEQ A;  2FOT A;  1F4O A;  3S0F A;  4YGA A;  1J7P A;  2KLD A;  4P2Y B;  1ZFS A;  1WRK A;  1E8A A;  1RTP 1;  3N7H A;  1OW4 A;  2G2B A;  2WC6 A;  1YRT B;  1FW4 A;  2BL0 B;  1S36 A;  1OOG A;  1YVH A;  1BR1 B;  1JBA A;  2QDI A;  2K2F A;  1TOP A;  4YBH B;  3O6B A;  2M9G A;  2KSP A;  1OSA A;  3JTD C;  1FI6 A;  2F2P A;  2JNX A;  5HKZ A;  1NUB A;  3BUM B;  1MUX A;  1OMV A;  2FJY A;  1CTR A;  1PSR A;  2BBN A;  2LVV A;  4PE7 A;  3EK8 A;  2K61 A;  3TUY B;  1XFV O;  3BFA A;  1XK4 A;  4MZL A;  3CZ0 A;  1K2H A;  2KQ6 A;  1BU3 A;  1RRO A;  3TZ1 A;  1S6J A;  1K96 A;  2O5G A;  1SK6 D;  1NPQ A;  1YVL A;  2BBM A;  1MQ1 A;  2JPO A;  3BFB A;  3NHI A;  3O2P A;  1QWV A;  5CSI A;  3R1P A;  1JSA A;  2KFG A;  1REC A;  1ZMZ A;  1NX3 A;  1NSH A;  1LS8 A;  2CCM A;  3FE6 A;  1J7R A;  2H61 A;  1V1F A;  1OOH A;  4YRU A;  3K1E A;  1J55 A;  2JTZ A;  2IS9 A;  3BQ3 A;  3IVT A;  5CSN A;  1QX5 B;  3PN7 C;  4TNC A;  1DQE A;  4E68 A;  3GK1 A;  1R2U A;  4JPZ B;  2MA2 A;  2YGU A;  2K60 A;  3NSL A;  2LVI A;  1L2O B;  2H8V A;  4PE0 A;  3I5H C;  1MXE A;  3NHT A;  2HPS A;  2GV5 A;  1JFJ A;  2CBL A;  2ZRT A;  1B47 A;  2JWW A;  5DKN A;  1QX7 A;  3ICB A;  2Q4U A;  2WOS A;  1DJG A;  5EL2 A;  2ZRS A;  1TNX A;  4MRY A;  3BOW A;  3DYE A;  3F45 A;  5I2L A;  1CMG A;  4WRI A;  3WXA A;  1B8L A;  5HYD A;  2K2A A;  1F71 A;  2Y4Q A;  1PUL A;  4ORC B;  1KCY A;  1F8H A;  4WQ3 A;  3KPX A;  1MXL C;  5D69 A;  1SKT A;  3CDN A;  2BCB A;  1K93 D;  2L98 A;  3FIA A;  4DIR A;  2WC5 A;  3DY9 A;  2LVK A;  1G33 A;  1QX2 A;  4I5K A;  1A4P A;  2M97 A;  1B9A A;  2K7B A;  4NQG A;  3NSO A;  1C3Z A;  2JT3 A;  2PQL A;  3DF0 A;  4D1E A;  1RWY A;  2A4J A;  1F54 A;  1F55 A;  1CM1 A;  1D1O A;  3QRX A;  2O60 A;  3B87 A;  4PHJ A;  2BE4 A;  4JQ0 D;  3M0W A;  1S3P A;  3DZT A;  1JFK A;  2M29 A;  2NLN A;  4GBA A;  4C0K A;  1AP4 A;  5AFP A;  3BUX B;  3H4S E; 
#chains in the Genus database with same CATH homology
 1JF2 A;  1IJ6 A;  2BE6 A;  3NSI A;  3NXA A;  1DJI A;  2L50 A;  3PLF B;  4PCW A;  1A75 A;  5BPJ A;  1HQV A;  3WNX B;  2MBX A;  3JVT C;  1KQM B;  2KDH A;  1EH2 A;  3SIB A;  1LIN A;  1AHR A;  1W7I B;  3TDZ A;  5KU1 A;  1CMF A;  5I8N A;  1CB1 A;  2MAZ A;  1QS7 A;  5HKW A;  1QAS A;  1FPW A;  1G8I A;  1DJZ A;  1EL4 A;  2OS8 C;  2CTN A;  3I5G C;  4L9M A;  4HRG A;  1OOJ A;  2JZI A;  1CDP A;  1AVS A;  1J1E A;  1Y1A A;  1YUS A;  2BKH B;  3IF7 A;  4GNK B;  1G4Y R;  1B8C A;  3CR5 X;  2KI4 B;  1CLB A;  2FCD A;  2ISD A;  1FBV A;  4XJK A;  3PM8 A;  3PAT A;  3RLZ A;  1DT7 B;  1KK7 Z;  1M45 A;  2HET A;  1QTX A;  1K94 A;  2F3Z A;  2P6B B;  4CLN A;  2LNK A;  3TDU A;  3VRQ A;  1C07 A;  2COL B;  2SAS A;  1Q80 A;  2OTG B;  3EVU A;  1QLS A;  5DKQ A;  1XFW O;  4ZCV A;  2BCA A;  5PAL A;  4OVN F;  1EG4 A;  3DF0 B;  1DJX A;  3GK2 A;  4HRH A;  3GK4 X;  2ZND A;  1YUR A;  3LL8 B;  1SW8 A;  2K8M B;  1ALW A;  2JOJ A;  2KQY A;  1B7T Z;  1GJY A;  1S5G Z;  1NX1 A;  3O4Y A;  1SPY A;  1NCX A;  1AUI B;  2JUL A;  1DTL A;  3GOF A;  1CKK A;  1SMG A;  1WDC C;  1M46 A;  2ZNE A;  2GGM A;  1A75 B;  4YI9 A;  3FWB A;  3O78 A;  2BL0 C;  4DCK A;  4I5N B;  1NCZ A;  2MLF C;  4GUK A;  1DF0 A;  1A2X A;  2LP3 A;  2FJU B;  1BF5 A;  1MHO A;  1UP5 A;  2KOT A;  1TRF A;  2EHB A;  3ZNI A;  2PSR A;  2OPO A;  4I5J A;  3CGA A;  1YUU A;  4MSP A;  4A4C A;  1X02 A;  1KFX L;  4DS7 A;  3ZWH A;  2F33 A;  2KGR A;  5HKY A;  1B8R A;  3JTD B;  3E3R A;  2L51 A;  5CSF A;  1W7J B;  5HLV A;  1ZAC A;  4AOM A;  1CLM A;  3AKB A;  4XJK B;  2KNE A;  4P5O E;  5HLO A;  4ICB A;  2JU0 A;  1XO5 A;  1EJ3 A;  1BOC A;  1AJ5 A;  1NP8 A;  3BUW B;  4Q04 A;  2M0R A;  3K21 A;  1KFX S;  2JT0 A;  2R2I A;  1BG1 A;  1JWD A;  1NYA A;  1YUT A;  2KYF A;  1KK7 Y;  3BUO B;  1AJ4 A;  5J3X A;  1MWN A;  3IQQ A;  3SG2 A;  3OX6 A;  1DJY A;  4MVF A;  1DMO A;  4ZCU A;  2H2K A;  2LAP A;  3DVM A;  3SG5 A;  1QLK A;  3OB1 B;  4UPG A;  1HT9 A;  1SY9 A;  3SG4 A;  4F0Z B;  4GGF C;  5JOL A;  4CPV A;  3PFV A;  3CS1 A;  3KEV A;  1YX8 A;  1CDL A;  3PN7 B;  5D7F A;  2KAX A;  2L0P A;  3EK4 A;  1XFX O;  1B7T Y;  3I5H B;  1S5G Y;  3KO0 A;  4IL1 A;  5CSJ A;  1TCF A;  1F70 A;  2JRF A;  4MZJ A;  2I94 A;  2JTT A;  1QIV A;  2WCF A;  1DF0 B;  1TTX A;  2KHN A;  4AQJ A;  4QJ5 B;  1CLL A;  2M1K B;  4YI8 A;  1UUS A;  1CFP A;  1OMD A;  2Y5I A;  4GFT A;  1KK8 C;  3AKA A;  1N0Y A;  1TCO B;  1S26 D;  2NXQ A;  3PSR A;  1JC2 A;  1K8U A;  4N5X A;  2M7L A;  1OZO A;  3CR2 A;  3SG7 A;  3OB2 B;  2K7D A;  3I5I C;  2K7C A;  4FQO A;  1J7Q A;  4GPL B;  2LVJ A;  3TS5 C;  4BY5 A;  2F3Y A;  4MRX A;  3C1V A;  4PHN A;  2M3W A;  2GGZ A;  1SNL A;  1TNW A;  3CWG A;  1M39 A;  2WC8 A;  1Y1U A;  1BLQ A;  4MLW A;  1IQ5 A;  2NCP A;  4OCI A;  1N65 A;  1UWO A;  1DGU A;  1OMR A;  1KWO C;  1K95 A;  1KSM A;  4HRE E;  4QJ4 B;  1NX0 A;  1ZUZ A;  2V53 A;  3VRN A;  1FI5 A;  1UHJ A;  2Y1M A;  4NDD A;  2ZN9 A;  1UHK A;  5JJG A;  3VRR A;  1KQV A;  1TNP A;  1YX7 A;  2MLE C;  2RGI A;  1GGW A;  5ER5 A;  1QXP A;  4ORA B;  2LUC A;  3CZT X;  3JVT B;  2LLU A;  2PRU A;  3BOW B;  4PHM A;  1CDM A;  3SJS A;  1V1G A;  1CFD A;  3WHT B;  1S6I A;  1WRZ A;  3FS7 A;  3A4U B;  5I2O A;  4MZK A;  1SCM C;  2KI4 C;  1BR4 B;  2SCP A;  2OS8 B;  1XFY O;  3I5G B;  4YGD B;  1SYM A;  1AK8 A;  4OV2 A;  3KF9 A;  4N1G A;  2MHH A;  1S6C A;  5GQQ C;  3DVK A;  5I2Q A;  1ODB A;  4YGB B;  4XYN A;  1R6P A;  1A29 A;  3EK7 A;  2KI6 C;  2L2E A;  3DVE A;  1K9P A;  1Y1X A;  2EC6 C;  2JQ6 A;  4AQI A;  3SIA A;  3BYA A;  3KHE A;  3WHU B;  1Y0V H;  1SR6 C;  2JNF A;  1WRL A;  4WQ2 A;  3MSE B;  3I5F C;  2EGD A;  4FTG A;  2Y1N A;  1Y6W A;  4C0J A;  4M2P A;  2BKI B;  2KBM A;  2WND A;  3LLE A;  1YR5 A;  2Q91 A;  2JXC A;  1FF1 A;  1KSO A;  1MR8 A;  1ALV A;  1SL8 A;  1PVA A;  1M63 B;  4M2O A;  1N2D A;  3TDI A;  2E6W A;  2LUX A;  5KTY A;  5K89 A;  2KYC A;  1BJF A;  2WOR A;  2L4I A;  2E30 A;  4I5L B;  4GGF A;  1B4C A;  2ZN8 A;  1DVI A;  3DVJ A;  1WDC B;  2LM5 A;  1LXF C;  2QAC A;  1J1D A;  3TUY C;  2KGB C;  4MN0 A;  1PVB A;  1CNP A;  1A03 A;  2L5X B;  2I2R E;  3EVR A;  2LHI A;  4HSZ A;  2G9B A;  1UHN A;  1UUR A;  2KI6 D;  2LAN A;  1BT6 A;  1XA5 A;  1C7W A;  2BCX A;  2PMY A;  3OX5 A;  3FWC A;  1H4B A;  3VGO A;  2KAV A;  5AAN A;  2L4H A;  1GGZ A;  1JUO A;  1QJT A;  1RK9 A;  1XVJ A;  2TN4 A;  4PHK A;  4U8D A;  1QVI Z;  5FYX A;  1VRK A;  4M2Q A;  3EVV A;  2LMT A;  4CFQ A;  1L2O C;  4GGN A;  3OP0 A;  1XFU O;  1BOD A;  1NWD A;  2ZFD A;  1GQM A;  2CNP A;  1U5I A;  1IH0 A;  2M1U A;  2QPT A;  4DRW A;  3NSK A;  3CR4 X;  3A8R A;  5F6T A;  1KFU L;  1LA3 A;  1LA0 A;  1PK0 D;  1QV1 A;  1UHI A;  4ETO A;  2JPT A;  4OR9 B;  1QV0 A;  1J7O A;  4USL A;  1IJ5 A;  2F2O A;  1OZS A;  1UHH A;  2BEC A;  3DD4 A;  3D0Y A;  1SCV A;  2PAL A;  1YRU B;  3AAK A;  2LC5 A;  3D10 A;  2I7A A;  1DJW A;  1SL7 A;  1CFC A;  1KFU S;  2CT9 A;  4NDC A;  3OHM B;  2AMI A;  1PSB A;  2F8P A;  2LCP A;  1RJV A;  1XK4 C;  4GAO A;  1TNQ A;  1RFJ A;  2DOQ A;  4DUQ A;  1BMO A;  1JF0 A;  1QAT A;  1MF8 B;  2LV7 A;  2PAS A;  1S1E A;  1F4Q A;  1TIZ A;  1PAL A;  2WCE A;  3LK1 A;  1SL9 A;  4R1E A;  1WY9 A;  1KK8 B;  2KFF A;  4PAL A;  3BXK A;  1WLZ A;  1NIW A;  2H61 C;  5AXI A;  3SG6 A;  1KQM C;  2NCO A;  2LLT A;  3I5I B;  3VRP A;  2KFH A;  3CTN A;  2FCE A;  2D8N A;  3TS5 B;  1XFZ O;  4CFR A;  5DKR A;  4PE4 A;  5IBW A;  3LK0 A;  4OKH A;  1QVI Y;  3BUN B;  1DJH A;  1XYD A;  1CFF A;  3VRO A;  1OE9 B;  1U5I B;  1KWO B;  2JC2 A;  2JXL A;  1IQ3 A;  2LMU A;  1SBJ A;  1CM4 A;  1NX2 A;  4C0L A;  1IWQ A;  4ORB B;  3SG3 A;  2KBI A;  2JT8 A;  5TNC A;  1DGV A;  4YGE B;  5AER A;  1YTZ C;  3PAL A;  4MEW A;  1NCY A;  4N1F A;  4PE1 A;  5KSZ A;  1LVC D;  2LP2 A;  1C7V A;  2WCB A;  1K9K A;  3LCP C;  4YGC B;  2CXJ A;  3D0Y B;  2M7N A;  5CPV A;  2HQ8 A;  4PDZ A;  2PVB A;  2LE9 B;  2ZKM X;  2VRG A;  4CID A;  2OTG C;  1IKU A;  2B1U A;  2MRD A;  1B1G A;  3HX4 A;  1IRJ A;  1SCM B;  5G08 A;  1ZOT B;  3HCM A;  1EG3 A;  2M49 B;  2HQW A;  2AUC A;  2NZ0 A;  1IG5 A;  3EKH A;  3IQO A;  4JWQ A;  2HF5 A;  2LLS A;  3EKJ A;  4MBE A;  1TN4 A;  4QJ3 B;  4A4B A;  4BY4 A;  1L7Z A;  1EXR A;  3RM1 A;  1H8B A;  1LKJ A;  1PRW A;  1WLM A;  2AAO A;  1IGV A;  5ER4 X;  5B8I B;  1SRA A;  2M8U A;  1QIW A;  1OQP A;  2K7O A;  2LMV A;  1CDN A;  3AAJ A;  2EC6 B;  2I18 A;  2LHL A;  4NDB A;  2K0J A;  1M31 A;  1SR6 B;  1K9U A;  2KAY A;  1K90 D;  3CLN A;  3I5F B;  2MJW B;  5AEQ A;  2FOT A;  1F4O A;  4YGA A;  1J7P A;  4P2Y B;  1ZFS A;  1WRK A;  1E8A A;  1RTP 1;  2G2B A;  1YRT B;  1FW4 A;  2BL0 B;  1S36 A;  1YVH A;  1BR1 B;  1JBA A;  2K2F A;  1TOP A;  4YBH B;  3O6B A;  2M9G A;  2KSP A;  1OSA A;  3JTD C;  1FI6 A;  2F2P A;  2JNX A;  5HKZ A;  1NUB A;  3BUM B;  1MUX A;  1OMV A;  2LVV A;  1CTR A;  1PSR A;  2BBN A;  4PE7 A;  3TUY B;  3EK8 A;  2K61 A;  1XFV O;  1XK4 A;  4MZL A;  1K2H A;  2KQ6 A;  1BU3 A;  1RRO A;  3TZ1 A;  1S6J A;  1K96 A;  2O5G A;  1SK6 D;  1NPQ A;  1YVL A;  2BBM A;  1MQ1 A;  3O2P A;  5CSI A;  1JSA A;  2KFG A;  1REC A;  1ZMZ A;  1NX3 A;  1NSH A;  2CCM A;  1J7R A;  2H61 A;  1V1F A;  4YRU A;  1J55 A;  2JTZ A;  2IS9 A;  3BQ3 A;  5CSN A;  1QX5 B;  3PN7 C;  4TNC A;  4E68 A;  3GK1 A;  1R2U A;  4JPZ B;  2MA2 A;  3NSL A;  2LVI A;  1L2O B;  4PE0 A;  3I5H C;  1MXE A;  2HPS A;  2GV5 A;  1JFJ A;  2CBL A;  2ZRT A;  1B47 A;  2JWW A;  5DKN A;  1QX7 A;  3ICB A;  2Q4U A;  2WOS A;  1DJG A;  2ZRS A;  1TNX A;  4MRY A;  3BOW A;  3F45 A;  5I2L A;  1CMG A;  4WRI A;  3WXA A;  1B8L A;  5HYD A;  2K2A A;  1F71 A;  2Y4Q A;  1PUL A;  4ORC B;  1KCY A;  1F8H A;  4WQ3 A;  3KPX A;  1MXL C;  5D69 A;  1SKT A;  2BCB A;  1K93 D;  2L98 A;  3FIA A;  4DIR A;  2LVK A;  1G33 A;  1QX2 A;  4I5K A;  1A4P A;  2M97 A;  1B9A A;  2K7B A;  4NQG A;  3NSO A;  2JT3 A;  3DF0 A;  4D1E A;  1RWY A;  2A4J A;  1F54 A;  1F55 A;  1CM1 A;  1D1O A;  3QRX A;  2O60 A;  4PHJ A;  2BE4 A;  4JQ0 D;  3M0W A;  1S3P A;  1JFK A;  2M29 A;  2NLN A;  4GBA A;  4C0K A;  1AP4 A;  5AFP A;  3BUX B;  3H4S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...