4KYNA

Crystal structure of odorant binding protein 48 from anopheles gambiae at 3.3 angstrom resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
172
structure length
172
Chain Sequence
GDNPCAAGPPVDTNPAECCPKPMLVDGTIMMDCYKKYGEQTKKQLQMDGIPRGCCIAECAMNATNMYADGMLKRDDLSKMFMDAVKDKPEWMSLVRDATNACFELAEKKMDEIEAGAKLEPSFEGEKICHPISGTILRCMGMMMFAQCPASVFNVNENCNKLREYGSICPMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Odorant binding protein-8
publication title Crystal and Solution Studies of the "Plus-C" Odorant-binding Protein 48 from Anopheles gambiae: CONTROL OF BINDING SPECIFICITY THROUGH THREE-DIMENSIONAL DOMAIN SWAPPING.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 45
structure length 172
sequence length 172
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.270 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4kynA00
3PM2A 4KYNA 4IJ7A
chains in the Genus database with same CATH superfamily
1YVLA 3BFAA 1JFKA 1LA0A 1XFZO 2JC2A 2QPTA 1S6JA 5KU1A 2BECA 2E6WA 4GNKB 4JPZB 3SS3A 1LKJA 1JUOA 2H61C 2AUCA 3JVTB 3ZWHA 4DS7A 5FYXA 2KQ6A 4MRYA 2LP2A 3VB1A 1SMGA 1G4YR 3NSLA 4YGAA 3HX4A 1DJXA 4F7FA 3TZ1A 3S0AA 2FCEA 1W7JB 2KPHA 1M45A 1NCXA 1D1OA 2QEOA 1UHNA 1MHOA 3D10A 2PVBA 2A4JA 1M39A 4GGNA 1SYMA 3SG5A 2CTNA 1OMDA 1BOCA 2LVKA 5ER4X 4HSZA 3EVUA 1K95A 1NUBA 4DCKA 1MXLC 1SSEB 3VRRA 1EL4A 1IG5A 2F3ZA 2LUCA 1KK7Y 4E68A 4FQOA 5FI2A 3TDIA 2M1UA 3O2PA 4MBEA 3CWGA 1IWQA 1CDNA 1YUSA 4OV2A 4USLA 1A75B 2COLB 1YVHA 1ZFSA 3I5IC 2JNFA 2LLSA 3CYZA 1B7TY 4IL1A 3EK7A 1TIZA 3OHMB 3WXAA 2LLTA 2BKHB 1SR6C 5CSNA 3D77A 1SNLA 2WCJA 1F4OA 2LM5A 5PALA 2M0RA 2V53A 1G33A 3GOFA 1DJIA 4GAOA 1C3YA 1CDMA 3L47A 1IJ5A 1Y1XA 1WDCB 1PVBA 3CABA 2F3YA 3A8RA 4ICBA 1C7VA 1CFFA 4ZCVA 2L2EA 2KI6C 4MSPA 3KF9A 4ZCUA 1TWOA 4PALA 5I8NA 5TNCA 2K7DA 3I5HC 2ZFDA 2L51A 3CZ0A 1F54A 3E3RA 5D7FA 4NQGA 5DKNA 3CR2A 2L2CA 3C1VA 2K0JA 3ICBA 1G8IA 2KBMA 1JSAA 1QJTA 1M46A 2PRUA 2NXQA 1DELA 2ZN8A 5JOLA 2LHLA 1FI5A 2BBNA 2K2AA 4YI9A 1KQMB 4I5LB 3FWBA 4ORCB 5K89A 4PDZA 1OE9B 4AQJA 3SG6A 3O4XA 1IIOA 2I94A 1LS8A 3DVJA 3CR5X 1SR6B 2LV7A 3DF0A 2HPSA 3IF7A 4GGFC 1U5IA 4XYNA 5JJGA 3D0YB 1QATA 3DVEA 1QV0A 1SBJA 3DYEA 3NSKA 2CXJA 2JT3A 1YUTA 1NYAA 2LVJA 5KSZA 3IVTA 1S26D 2AAOA 1F8HA 1OOHA 1IKUA 2LC5A 1LA3A 5F6TA 3EK4A 3AKAA 2EGDA 3SG3A 1YRUB 3NHIA 1NCZA 1SCVA 1A4PA 5I2OA 1K9PA 1QV1A 1CM1A 2LP3A 3JVTC 1ZUZA 2D8NA 1J7OA 4JD9A 5I94A 3OBVA 2MHHA 1TCOB 3EVRA 3OX6A 1XO5A 4GGFA 2JU0A 1Z2CB 2KHNA 2WC8A 4XJKB 1N0YA 3JTDB 5HLVA 3TDUA 4DUQA 4OKHA 2KFHA 1BG1A 1IH0A 1YR5A 1K94A 1MQ1A 3SS5A 1UURA 2CNPA 1B8LA 3LLEA 4MZKA 1N2DA 3PJIA 4YGCB 2CCMA 2MA2A 4GUKA 1CDLA 4TNCA 2Q4UA 1BLQA 1W7IB 4BY4A 2GGZA 5B8IB 1RROA 1QIWA 2NLNA 1SCMC 5HKZA 3S0DA 2I7AA 3BOWB 2NCOA 3O6BA 1CM4A 4OVNF 1DVIA 2L98A 4QJ4B 2G9BA 2JTZA 1UUSA 3I5GB 3SG7A 1BODA 2LANA 1F70A 3IQQA 2WCBA 1NX0A 1ZACA 1MXEA 2LMTA 4MLWA 5GQQC 1DEKA 1WRZA 1B9AA 2M97A 1QVIY 1K9UA 1MR8A 3BFBA 3OB2B 4N1FA 4N1GA 2LNKA 1WLMA 3TS5B 3WNXB 2IS9A 1S5GY 1WDCC 4MZJA 2L0PA 2MJWB 5IBWA 3OX5A 4QJ5B 2QEHA 5BPJA 2Q91A 4JQ0D 2KQYA 3BXKA 1FPWA 1DF0B 1TUJA 1XK4A 4HRHA 5DICA 4MRXA 1J7PA 1KQVA 1A75A 2K2FA 2O60A 3R1PA 1K8UA 2FCDA 1JF2A 4IJ7A 3K21A 5J3XA 1NX3A 3H4SE 5EL2A 2BCXA 5D69A 1C7WA 1XYDA 3SS4A 1OOGA 2FJYA 1AK8A 3D78A 3GK4X 3OGNA 2JULA 1XFWO 2JT8A 1UHHA 3AKBA 4M2QA 2LVIA 4DRWA 2H61A 3MSEB 1SCMB 4N5XA 5DKRA 2YGUA 3L4AA 3PATA 3UNWA 1KQMC 1NPQA 1EG3A 2M7NA 2WCLA 1DJGA 3EK8A 3VRQA 1LXFC 4MN0A 1EH2A 1KK8C 2O5GA 2H8VA 2LVVA 3IQOA 1SK6D 1S6IA 1QWVA 2I2RE 4FTGA 2NZ0A 1EG4A 1KFUL 4ORBB 4GPLB 2KNEA 3EVVA 1DC1A 1IQ5A 2JZIA 2SCPA 5D3OA 1VRKA 1XFXO 3R1VA 3WHUB 1BR1B 4AQIA 1N65A 5ER5A 2WCKA 1GGWA 1JF0A 3KHEA 1H8BA 1M63B 1GGZA 3I5FB 3S0GA 3ZNIA 2H2KA 1KCYA 1AP4A 5KTYA 1NIWA 3O4YA 4PCWA 1TRFA 1SRAA 1PULA 1W9ZA 2ZRTA 1RK9A 1DJWA 5HL1A 2LLUA 1J1EA 2I18A 3DY9A 1Y1UA 3N7HA 4GFTA 3PM2A 2BCAA 3D75A 1Y0VH 4C0JA 3Q8IA 2JOJA 3DVKA 1QASA 1FF1A 2LUXA 3JTDC 2M3WA 3D0YA 1EJ3A 3HCMA 4GBAA 2BKIB 3DVMA 4DIRA 3LCPC 1TNQA 3KPXA 1WY9A 1ALWA 1YX7A 3NSOA 1NSHA 1OMVA 2JXLA 4WQ3A 1KK8B 1UHKA 4P5OE 1QX7A 2LCPA 2HQWA 4YGEB 1OW4A 1P28A 5CSJA 3BUMB 2GGMA 1GQMA 3SIAA 1XFVO 2QEVA 1YX8A 2GV5A 2PQLA 1FI6A 3L4LA 4PE0A 1BJFA 2OPOA 4XJKA 1A2XA 2M9GA 3B6XA 3I5GC 4PE7A 1YTZC 2K7OA 3VRPA 3FS7A 1CFCA 3LL8B 1EXRA 4PE1A 2NCPA 1DT7B 1QX2A 4PHNA 5AANA 2B1UA 1J7RA 4NDBA 4WRIA 3OP0A 3R1OA 4R1EA 2BL0B 1SL7A 3TS5C 3F45A 1WLZA 5CSIA 4CPVA 3CDNA 1BMOA 1PALA 1ALVA 1KFUS 2BCBA 1PSRA 3SG4A 1UHJA 2BE6A 2ZNDA 3B88A 1PVAA 3PALA 4F0ZB 2JWWA 1AVSA 1L2OC 3BOWA 1RJVA 2Y1MA 3EKHA 3LK0A 4P2YB 3RLZA 3VRNA 5AERA 1KSMA 5AXIA 1AJ5A 2Y5IA 3B7AA 1NX1A 1SY9A 2F33A 3BUWB 1QX5B 2HQ8A 3LK1A 1QLKA 1CFPA 1CB1A 2M8UA 3CTNA 1F4QA 1QS7A 1DJZA 2LMVA 1NP8A 1RWYA 2KAYA 1J55A 2PSRA 2SASA 4PT1A 2F2OA 3V2LA 1B4CA 4OCIA 1FW4A 1A29A 2EC6C 2JPTA 2ZKMX 3NHTA 2M49B 3S0BA 4ORAB 4CFRA 1S3PA 2L4IA 4CFQA 4MEWA 2KYCA 1MWNA 3GK1A 2ERBA 2PASA 1PK0D 3D76A 3BUXB 2M29A 2EHBA 1CMGA 1OZSA 5DKQA 2KGBC 1K96A 1NX2A 2RGIA 2WCFA 1E8AA 3UO9A 2K61A 1NWDA 4NDCA 2KI4C 1CDPA 2MAZA 2WNDA 5HLOA 1KFXS 2KFFA 2K60A 3TUYB 1C07A 4INXA 3BQ3A 2WCMA 4PHMA 1CTRA 3I5FC 1R2UA 4A4BA 1KWOB 1AHRA 2CT9A 1IJ6A 1MUXA 3BYAA 3B86A 3CLNA 3PFVA 1IRJA 2L50A 4HRGA 4PHJA 3DZTA 1L2OB 2KYFA 2MBXA 3AAJA 1QLSA 4I5JA 1V1GA 1UP5A 1OZOA 4L9MA 1PSBA 3WHTB 3CZ1A 4OZDA 3FE8A 4C0KA 2L4HA 4JWQA 1XA5A 1KK7Z 2OTGB 1RECA 1HT9A 3FE6A 4I5KA 1S1EA 1JWDA 2KGRA 2EC6B 1J1DA 1H4BA 2FJUB 1UWOA 1B47A 2P6BB 1JFJA 4PHKA 1B7TZ 1R6PA 1ODBA 2Y4QA 2Y1NA 5HKYA 2R2IA 4FQTA 4PE4A 2PYQA 4WQ2A 2M7LA 2JT0A 2KOTA 3B87A 5CPVA 1B1GA 1OOIX 2LE9B 3PN7B 1DGVA 1OOFA 2QACA 5HKWA 4YGBB 2KI4B 1ZOTB 4Q04A 1C3ZA 2QEBA 1Q80A 3CZ2A 1B8RA 3KEVA 1QIVA 2KAVA 2K7BA 1YUUA 2L5YA 2QDIA 3CS1A 2OS8B 1BT6A 2LAPA 1TNPA 1CLMA 3FE9A 1CLBA 3CR4X 3CGAA 2DOQA 1AJ4A 3KO0A 1GM0A 1TN4A 2BL0C 1T14A 2F8PA 2JRFA 2MLFC 1WRKA 3EKJA 3QMEA 2E30A 2KBIA 2ISDA 4CIDA 1K2HA 2JPOA 1Y1AA 1K9KA 2JNXA 3NSIA 1TTXA 3O78A 4INWA 4A4CA 2KLDA 1K90D 4CLNA 1XFYO 3D73A 1XFRA 1DMOA 1K93D 1BR4B 2MLEC 2WC6A 1OSAA 2KDHA 4NDDA 1FBVA 5AEQA 2KSPA 4U8DA 1A03A 1KSOA 1SKTA 1B8CA 1KFXL 2F2PA 1OOJA 2LHIA 3CZTX 1ORGA 3PM8A 1DJHA 4JKTA 5CSFA 2WC5A 5FI6A 5FI7A 4BY5A 4ETOA 3FWCA 3SJSA 3SIBA 4M2PA 1F55A 3DD4A 5I2LA 2WOSA 4M2OA 2KFGA 1MF8B 2GTEA 5HYDA 2JTTA 2G2BA 3AAKA 3A4UB 1CMFA 1CKKA 2M1KB 2WCEA 5I2QA 5AFPA 1YURA 1TNWA 1DTLA 1L7ZA 4UPGA 1UHIA 3PLFB 3NXAA 3PSRA 1OMRA 2FOTA 1DGUA 1RFJA 1TNXA 4YRUA 3I5IB 1IQ3A 1QXPA 3S0FA 2TN4A 1SPYA 1OQPA 2CBLA 4HREE 1CNPA 1S6CA 2K8MB 3TUYC 1GJYA 2BNXA 2ZN9A 4MVFA 1TOPA 3S0EA 1SW8A 1XVJA 2BAPA 1J7QA 2WORA 1KWOC 1V1FA 3GK2A 4YGDB 1SL9A 1BU3A 1CLLA 2HF5A 2PALA 1Z4HA 3RZSA 2L5XB 3BFHA 3VGOA 1SL8A 2ZNEA 3M0WA 4OR9B 4AOMA 1ZMZA 3DF0B 1F71A 2JQ6A 2MRDA 1DQEA 3FIAA 2ZRSA 3I5HB 1U5IB 1TUZA 1JC2A 3EG5B 2OTGC 2KAXA 4YBHB 2BBMA 2VRGA 3TDZA 1TCFA 4QJ3B 1JBAA 1XFUO 2AMIA 3R72A 4MZLA 3NGVA 1Y6WA 5G08A 3SG2A 1IGVA 3BJHA 1M31A 4D1EA 1DF0A 3QRXA 1HQVA 1LVCD 2JXCA 1RTP1 2KLEA 3BUNB 3RM1A 3VROA 3OB1B 2WCHA 3PN7C 1DJYA 4KYNA 2HETA 3D74A 3DXLA 1QVIZ 2KI6D 4YI8A 2P70A 1X02A 2PMYA 1CFDA 3K1EA 4C0LA 1S5GZ 2P71A 3BUOB 1PRWA 1LINA 1YRTB 1WRLA 1AUIB 1XK4C 2LMUA 1BF5A 1NCYA 1QTXA 2OS8C 2K7CA 2BE4A 4I5NB 1S36A
chains in the Genus database with same CATH topology
4MEWA 5I94A 3SS4A 3OBVA 3KEVA 2BNXA 2L5YA 1Z2CB 3SS3A 4JKTA 5FI6A 2BAPA 5FI2A 5FI7A 2KLEA 1DEKA 1W9ZA 4I5KA 2YGUA 3UO9A 3UNWA 5HL1A 1Z4HA 3IVTA 3SS5A 4KYNA 2K60A 3PM2A 2KLDA 1DELA 4GBAA 3EG5B 4GAOA 4I5LB 4I5NB 4IJ7A 1DC1A 5D3OA 4I5JA 3O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PM2 A;  4KYN A;  4IJ7 A; 
#chains in the Genus database with same CATH topology
 1YVL A;  3BFA A;  1JFK A;  1LA0 A;  1XFZ O;  2JC2 A;  2QPT A;  1S6J A;  5KU1 A;  2BEC A;  2E6W A;  4GNK B;  4JPZ B;  3SS3 A;  1LKJ A;  1JUO A;  2H61 C;  2AUC A;  3JVT B;  3ZWH A;  4DS7 A;  5FYX A;  2KQ6 A;  4MRY A;  2LP2 A;  3VB1 A;  1SMG A;  1G4Y R;  3NSL A;  4YGA A;  3HX4 A;  1DJX A;  4F7F A;  3TZ1 A;  3S0A A;  2FCE A;  1W7J B;  2KPH A;  1M45 A;  1NCX A;  1D1O A;  2QEO A;  1UHN A;  1MHO A;  3D10 A;  2PVB A;  2A4J A;  1M39 A;  4GGN A;  1SYM A;  3SG5 A;  2CTN A;  1OMD A;  1BOC A;  2LVK A;  5ER4 X;  4HSZ A;  3EVU A;  1K95 A;  1NUB A;  4DCK A;  1MXL C;  1SSE B;  3VRR A;  1EL4 A;  1IG5 A;  2F3Z A;  2LUC A;  1KK7 Y;  4E68 A;  4FQO A;  5FI2 A;  3TDI A;  2M1U A;  3O2P A;  4MBE A;  3CWG A;  1IWQ A;  1CDN A;  1YUS A;  4OV2 A;  4USL A;  1A75 B;  2COL B;  1YVH A;  1ZFS A;  3I5I C;  2JNF A;  2LLS A;  3CYZ A;  1B7T Y;  4IL1 A;  3EK7 A;  1TIZ A;  3OHM B;  3WXA A;  2LLT A;  2BKH B;  1SR6 C;  5CSN A;  3D77 A;  1SNL A;  2WCJ A;  1F4O A;  2LM5 A;  5PAL A;  2M0R A;  2V53 A;  1G33 A;  3GOF A;  1DJI A;  4GAO A;  1C3Y A;  1CDM A;  3L47 A;  1IJ5 A;  1Y1X A;  1WDC B;  1PVB A;  3CAB A;  2F3Y A;  3A8R A;  4ICB A;  1C7V A;  1CFF A;  4ZCV A;  2L2E A;  2KI6 C;  4MSP A;  3KF9 A;  4ZCU A;  1TWO A;  4PAL A;  5I8N A;  5TNC A;  2K7D A;  3I5H C;  2ZFD A;  2L51 A;  3CZ0 A;  1F54 A;  3E3R A;  5D7F A;  4NQG A;  5DKN A;  3CR2 A;  2L2C A;  3C1V A;  2K0J A;  3ICB A;  1G8I A;  2KBM A;  1JSA A;  1QJT A;  1M46 A;  2PRU A;  2NXQ A;  1DEL A;  2ZN8 A;  5JOL A;  2LHL A;  1FI5 A;  2BBN A;  2K2A A;  4YI9 A;  1KQM B;  4I5L B;  3FWB A;  4ORC B;  5K89 A;  4PDZ A;  1OE9 B;  4AQJ A;  3SG6 A;  3O4X A;  1IIO A;  2I94 A;  1LS8 A;  3DVJ A;  3CR5 X;  1SR6 B;  2LV7 A;  3DF0 A;  2HPS A;  3IF7 A;  4GGF C;  1U5I A;  4XYN A;  5JJG A;  3D0Y B;  1QAT A;  3DVE A;  1QV0 A;  1SBJ A;  3DYE A;  3NSK A;  2CXJ A;  2JT3 A;  1YUT A;  1NYA A;  2LVJ A;  5KSZ A;  3IVT A;  1S26 D;  2AAO A;  1F8H A;  1OOH A;  1IKU A;  2LC5 A;  1LA3 A;  5F6T A;  3EK4 A;  3AKA A;  2EGD A;  3SG3 A;  1YRU B;  3NHI A;  1NCZ A;  1SCV A;  1A4P A;  5I2O A;  1K9P A;  1QV1 A;  1CM1 A;  2LP3 A;  3JVT C;  1ZUZ A;  2D8N A;  1J7O A;  4JD9 A;  5I94 A;  3OBV A;  2MHH A;  1TCO B;  3EVR A;  3OX6 A;  1XO5 A;  4GGF A;  2JU0 A;  1Z2C B;  2KHN A;  2WC8 A;  4XJK B;  1N0Y A;  3JTD B;  5HLV A;  3TDU A;  4DUQ A;  4OKH A;  2KFH A;  1BG1 A;  1IH0 A;  1YR5 A;  1K94 A;  1MQ1 A;  3SS5 A;  1UUR A;  2CNP A;  1B8L A;  3LLE A;  4MZK A;  1N2D A;  3PJI A;  4YGC B;  2CCM A;  2MA2 A;  4GUK A;  1CDL A;  4TNC A;  2Q4U A;  1BLQ A;  1W7I B;  4BY4 A;  2GGZ A;  5B8I B;  1RRO A;  1QIW A;  2NLN A;  1SCM C;  5HKZ A;  3S0D A;  2I7A A;  3BOW B;  2NCO A;  3O6B A;  1CM4 A;  4OVN F;  1DVI A;  2L98 A;  4QJ4 B;  2G9B A;  2JTZ A;  1UUS A;  3I5G B;  3SG7 A;  1BOD A;  2LAN A;  1F70 A;  3IQQ A;  2WCB A;  1NX0 A;  1ZAC A;  1MXE A;  2LMT A;  4MLW A;  5GQQ C;  1DEK A;  1WRZ A;  1B9A A;  2M97 A;  1QVI Y;  1K9U A;  1MR8 A;  3BFB A;  3OB2 B;  4N1F A;  4N1G A;  2LNK A;  1WLM A;  3TS5 B;  3WNX B;  2IS9 A;  1S5G Y;  1WDC C;  4MZJ A;  2L0P A;  2MJW B;  5IBW A;  3OX5 A;  4QJ5 B;  2QEH A;  5BPJ A;  2Q91 A;  4JQ0 D;  2KQY A;  3BXK A;  1FPW A;  1DF0 B;  1TUJ A;  1XK4 A;  4HRH A;  5DIC A;  4MRX A;  1J7P A;  1KQV A;  1A75 A;  2K2F A;  2O60 A;  3R1P A;  1K8U A;  2FCD A;  1JF2 A;  4IJ7 A;  3K21 A;  5J3X A;  1NX3 A;  3H4S E;  5EL2 A;  2BCX A;  5D69 A;  1C7W A;  1XYD A;  3SS4 A;  1OOG A;  2FJY A;  1AK8 A;  3D78 A;  3GK4 X;  3OGN A;  2JUL A;  1XFW O;  2JT8 A;  1UHH A;  3AKB A;  4M2Q A;  2LVI A;  4DRW A;  2H61 A;  3MSE B;  1SCM B;  4N5X A;  5DKR A;  2YGU A;  3L4A A;  3PAT A;  3UNW A;  1KQM C;  1NPQ A;  1EG3 A;  2M7N A;  2WCL A;  1DJG A;  3EK8 A;  3VRQ A;  1LXF C;  4MN0 A;  1EH2 A;  1KK8 C;  2O5G A;  2H8V A;  2LVV A;  3IQO A;  1SK6 D;  1S6I A;  1QWV A;  2I2R E;  4FTG A;  2NZ0 A;  1EG4 A;  1KFU L;  4ORB B;  4GPL B;  2KNE A;  3EVV A;  1DC1 A;  1IQ5 A;  2JZI A;  2SCP A;  5D3O A;  1VRK A;  1XFX O;  3R1V A;  3WHU B;  1BR1 B;  4AQI A;  1N65 A;  5ER5 A;  2WCK A;  1GGW A;  1JF0 A;  3KHE A;  1H8B A;  1M63 B;  1GGZ A;  3I5F B;  3S0G A;  3ZNI A;  2H2K A;  1KCY A;  1AP4 A;  5KTY A;  1NIW A;  3O4Y A;  4PCW A;  1TRF A;  1SRA A;  1PUL A;  1W9Z A;  2ZRT A;  1RK9 A;  1DJW A;  5HL1 A;  2LLU A;  1J1E A;  2I18 A;  3DY9 A;  1Y1U A;  3N7H A;  4GFT A;  3PM2 A;  2BCA A;  3D75 A;  1Y0V H;  4C0J A;  3Q8I A;  2JOJ A;  3DVK A;  1QAS A;  1FF1 A;  2LUX A;  3JTD C;  2M3W A;  3D0Y A;  1EJ3 A;  3HCM A;  4GBA A;  2BKI B;  3DVM A;  4DIR A;  3LCP C;  1TNQ A;  3KPX A;  1WY9 A;  1ALW A;  1YX7 A;  3NSO A;  1NSH A;  1OMV A;  2JXL A;  4WQ3 A;  1KK8 B;  1UHK A;  4P5O E;  1QX7 A;  2LCP A;  2HQW A;  4YGE B;  1OW4 A;  1P28 A;  5CSJ A;  3BUM B;  2GGM A;  1GQM A;  3SIA A;  1XFV O;  2QEV A;  1YX8 A;  2GV5 A;  2PQL A;  1FI6 A;  3L4L A;  4PE0 A;  1BJF A;  2OPO A;  4XJK A;  1A2X A;  2M9G A;  3B6X A;  3I5G C;  4PE7 A;  1YTZ C;  2K7O A;  3VRP A;  3FS7 A;  1CFC A;  3LL8 B;  1EXR A;  4PE1 A;  2NCP A;  1DT7 B;  1QX2 A;  4PHN A;  5AAN A;  2B1U A;  1J7R A;  4NDB A;  4WRI A;  3OP0 A;  3R1O A;  4R1E A;  2BL0 B;  1SL7 A;  3TS5 C;  3F45 A;  1WLZ A;  5CSI A;  4CPV A;  3CDN A;  1BMO A;  1PAL A;  1ALV A;  1KFU S;  2BCB A;  1PSR A;  3SG4 A;  1UHJ A;  2BE6 A;  2ZND A;  3B88 A;  1PVA A;  3PAL A;  4F0Z B;  2JWW A;  1AVS A;  1L2O C;  3BOW A;  1RJV A;  2Y1M A;  3EKH A;  3LK0 A;  4P2Y B;  3RLZ A;  3VRN A;  5AER A;  1KSM A;  5AXI A;  1AJ5 A;  2Y5I A;  3B7A A;  1NX1 A;  1SY9 A;  2F33 A;  3BUW B;  1QX5 B;  2HQ8 A;  3LK1 A;  1QLK A;  1CFP A;  1CB1 A;  2M8U A;  3CTN A;  1F4Q A;  1QS7 A;  1DJZ A;  2LMV A;  1NP8 A;  1RWY A;  2KAY A;  1J55 A;  2PSR A;  2SAS A;  4PT1 A;  2F2O A;  3V2L A;  1B4C A;  4OCI A;  1FW4 A;  1A29 A;  2EC6 C;  2JPT A;  2ZKM X;  3NHT A;  2M49 B;  3S0B A;  4ORA B;  4CFR A;  1S3P A;  2L4I A;  4CFQ A;  4MEW A;  2KYC A;  1MWN A;  3GK1 A;  2ERB A;  2PAS A;  1PK0 D;  3D76 A;  3BUX B;  2M29 A;  2EHB A;  1CMG A;  1OZS A;  5DKQ A;  2KGB C;  1K96 A;  1NX2 A;  2RGI A;  2WCF A;  1E8A A;  3UO9 A;  2K61 A;  1NWD A;  4NDC A;  2KI4 C;  1CDP A;  2MAZ A;  2WND A;  5HLO A;  1KFX S;  2KFF A;  2K60 A;  3TUY B;  1C07 A;  4INX A;  3BQ3 A;  2WCM A;  4PHM A;  1CTR A;  3I5F C;  1R2U A;  4A4B A;  1KWO B;  1AHR A;  2CT9 A;  1IJ6 A;  1MUX A;  3BYA A;  3B86 A;  3CLN A;  3PFV A;  1IRJ A;  2L50 A;  4HRG A;  4PHJ A;  3DZT A;  1L2O B;  2KYF A;  2MBX A;  3AAJ A;  1QLS A;  4I5J A;  1V1G A;  1UP5 A;  1OZO A;  4L9M A;  1PSB A;  3WHT B;  3CZ1 A;  4OZD A;  3FE8 A;  4C0K A;  2L4H A;  4JWQ A;  1XA5 A;  1KK7 Z;  2OTG B;  1REC A;  1HT9 A;  3FE6 A;  4I5K A;  1S1E A;  1JWD A;  2KGR A;  2EC6 B;  1J1D A;  1H4B A;  2FJU B;  1UWO A;  1B47 A;  2P6B B;  1JFJ A;  4PHK A;  1B7T Z;  1R6P A;  1ODB A;  2Y4Q A;  2Y1N A;  5HKY A;  2R2I A;  4FQT A;  4PE4 A;  2PYQ A;  4WQ2 A;  2M7L A;  2JT0 A;  2KOT A;  3B87 A;  5CPV A;  1B1G A;  1OOI X;  2LE9 B;  3PN7 B;  1DGV A;  1OOF A;  2QAC A;  5HKW A;  4YGB B;  2KI4 B;  1ZOT B;  4Q04 A;  1C3Z A;  2QEB A;  1Q80 A;  3CZ2 A;  1B8R A;  3KEV A;  1QIV A;  2KAV A;  2K7B A;  1YUU A;  2L5Y A;  2QDI A;  3CS1 A;  2OS8 B;  1BT6 A;  2LAP A;  1TNP A;  1CLM A;  3FE9 A;  1CLB A;  3CR4 X;  3CGA A;  2DOQ A;  1AJ4 A;  3KO0 A;  1GM0 A;  1TN4 A;  2BL0 C;  1T14 A;  2F8P A;  2JRF A;  2MLF C;  1WRK A;  3EKJ A;  3QME A;  2E30 A;  2KBI A;  2ISD A;  4CID A;  1K2H A;  2JPO A;  1Y1A A;  1K9K A;  2JNX A;  3NSI A;  1TTX A;  3O78 A;  4INW A;  4A4C A;  2KLD A;  1K90 D;  4CLN A;  1XFY O;  3D73 A;  1XFR A;  1DMO A;  1K93 D;  1BR4 B;  2MLE C;  2WC6 A;  1OSA A;  2KDH A;  4NDD A;  1FBV A;  5AEQ A;  2KSP A;  4U8D A;  1A03 A;  1KSO A;  1SKT A;  1B8C A;  1KFX L;  2F2P A;  1OOJ A;  2LHI A;  3CZT X;  1ORG A;  3PM8 A;  1DJH A;  4JKT A;  5CSF A;  2WC5 A;  5FI6 A;  5FI7 A;  4BY5 A;  4ETO A;  3FWC A;  3SJS A;  3SIB A;  4M2P A;  1F55 A;  3DD4 A;  5I2L A;  2WOS A;  4M2O A;  2KFG A;  1MF8 B;  2GTE A;  5HYD A;  2JTT A;  2G2B A;  3AAK A;  3A4U B;  1CMF A;  1CKK A;  2M1K B;  2WCE A;  5I2Q A;  5AFP A;  1YUR A;  1TNW A;  1DTL A;  1L7Z A;  4UPG A;  1UHI A;  3PLF B;  3NXA A;  3PSR A;  1OMR A;  2FOT A;  1DGU A;  1RFJ A;  1TNX A;  4YRU A;  3I5I B;  1IQ3 A;  1QXP A;  3S0F A;  2TN4 A;  1SPY A;  1OQP A;  2CBL A;  4HRE E;  1CNP A;  1S6C A;  2K8M B;  3TUY C;  1GJY A;  2BNX A;  2ZN9 A;  4MVF A;  1TOP A;  3S0E A;  1SW8 A;  1XVJ A;  2BAP A;  1J7Q A;  2WOR A;  1KWO C;  1V1F A;  3GK2 A;  4YGD B;  1SL9 A;  1BU3 A;  1CLL A;  2HF5 A;  2PAL A;  1Z4H A;  3RZS A;  2L5X B;  3BFH A;  3VGO A;  1SL8 A;  2ZNE A;  3M0W A;  4OR9 B;  4AOM A;  1ZMZ A;  3DF0 B;  1F71 A;  2JQ6 A;  2MRD A;  1DQE A;  3FIA A;  2ZRS A;  3I5H B;  1U5I B;  1TUZ A;  1JC2 A;  3EG5 B;  2OTG C;  2KAX A;  4YBH B;  2BBM A;  2VRG A;  3TDZ A;  1TCF A;  4QJ3 B;  1JBA A;  1XFU O;  2AMI A;  3R72 A;  4MZL A;  3NGV A;  1Y6W A;  5G08 A;  3SG2 A;  1IGV A;  3BJH A;  1M31 A;  4D1E A;  1DF0 A;  3QRX A;  1HQV A;  1LVC D;  2JXC A;  1RTP 1;  2KLE A;  3BUN B;  3RM1 A;  3VRO A;  3OB1 B;  2WCH A;  3PN7 C;  1DJY A;  4KYN A;  2HET A;  3D74 A;  3DXL A;  1QVI Z;  2KI6 D;  4YI8 A;  2P70 A;  1X02 A;  2PMY A;  1CFD A;  3K1E A;  4C0L A;  1S5G Z;  2P71 A;  3BUO B;  1PRW A;  1LIN A;  1YRT B;  1WRL A;  1AUI B;  1XK4 C;  2LMU A;  1BF5 A;  1NCY A;  1QTX A;  2OS8 C;  2K7C A;  2BE4 A;  4I5N B;  1S36 A; 
#chains in the Genus database with same CATH homology
 4MEW A;  5I94 A;  3SS4 A;  3OBV A;  3KEV A;  2BNX A;  2L5Y A;  1Z2C B;  3SS3 A;  4JKT A;  5FI6 A;  2BAP A;  5FI2 A;  5FI7 A;  2KLE A;  1DEK A;  1W9Z A;  4I5K A;  2YGU A;  3UO9 A;  3UNW A;  5HL1 A;  1Z4H A;  3IVT A;  3SS5 A;  4KYN A;  2K60 A;  3PM2 A;  2KLD A;  1DEL A;  4GBA A;  3EG5 B;  4GAO A;  4I5L B;  4I5N B;  4IJ7 A;  1DC1 A;  5D3O A;  4I5J A;  3O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...