4KYNA

Crystal structure of odorant binding protein 48 from anopheles gambiae at 3.3 angstrom resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
172
structure length
172
Chain Sequence
GDNPCAAGPPVDTNPAECCPKPMLVDGTIMMDCYKKYGEQTKKQLQMDGIPRGCCIAECAMNATNMYADGMLKRDDLSKMFMDAVKDKPEWMSLVRDATNACFELAEKKMDEIEAGAKLEPSFEGEKICHPISGTILRCMGMMMFAQCPASVFNVNENCNKLREYGSICPMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Odorant binding protein-8
publication title Crystal and Solution Studies of the "Plus-C" Odorant-binding Protein 48 from Anopheles gambiae: CONTROL OF BINDING SPECIFICITY THROUGH THREE-DIMENSIONAL DOMAIN SWAPPING.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Transport protein
total genus 45
structure length 172
sequence length 172
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.270 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4kynA00
4IJ7A 3PM2A 4KYNA
chains in the Genus database with same CATH superfamily
1ZACA 4IL1A 2BKIB 2ZNEA 3NSOA 1Y0VH 4CFQA 1N0YA 1RROA 2LLUA 2ZN8A 1IQ3A 3O4YA 1SY9A 1DQEA 1BODA 1CB1A 2KGRA 4YI9A 4MEWA 3KEVA 2GGZA 1KSOA 1UWOA 2LLTA 2ZNDA 3NGVA 1IRJA 1A03A 1KSMA 3NSKA 4BY5A 1Y1UA 2ZFDA 3ZNIA 2K7BA 1CFFA 4PE1A 1C07A 2BAPA 2H2KA 2PALA 1K93D 1TWOA 4INWA 3K21A 1ZMZA 5FYXA 1B8LA 1L7ZA 3GK4X 1JBAA 3BQ3A 3AAJA 1EL4A 1QS7A 2KI4C 3LCPC 4OR9B 1C7VA 1VRKA 1YUSA 3AKBA 1H4BA 3I5GC 4PCWA 2G2BA 3VB1A 1TNWA 3PFVA 5ER4X 2L98A 4DRWA 2Y1MA 2LVVA 2CTNA 2GGMA 3D0YA 5BPJA 4OVNF 3UNWA 4FQOA 4WRIA 2K7DA 1SR6C 2LE9B 2WC6A 2HETA 2MA2A 3H4SE 1ORGA 2M8UA 4GGFC 1XFXO 1KWOC 1NCYA 1QTXA 3C1VA 1XFUO 2F2PA 4R1EA 1CMFA 2B1UA 3LK0A 1QV0A 3CZ2A 1G8IA 2KNEA 1SNLA 2KSPA 3D75A 3SS5A 2L2CA 4YRUA 1MWNA 1ZUZA 1OMVA 1JWDA 2LUCA 3R1PA 5I2LA 2LVJA 2LHLA 3SG3A 5I2QA 4I5LB 3CZ0A 3D74A 2PVBA 1QVIZ 5F6TA 3CZTX 3A8RA 1NP8A 1A75A 2L2EA 4BY4A 3B86A 4OCIA 2LCPA 2KQYA 3TDIA 1QXPA 1YTZC 3OB1B 4JQ0D 3NSIA 4GGNA 4Q04A 5DKQA 2F33A 2LVKA 2BE4A 5I8NA 2HQWA 3BFBA 3OP0A 2L4HA 2CT9A 1DJZA 1LINA 1MF8B 1SKTA 4L9MA 4ORCB 1KK8C 4PHNA 2OPOA 1YURA 2EC6B 3D0YB 3R1VA 2KFGA 2KQ6A 2M7NA 1FPWA 1PSRA 1JFKA 3NHIA 1RJVA 2ISDA 4GFTA 1B9AA 1MHOA 1SCVA 1QX5B 2BL0B 1C3ZA 1XFWO 2KAVA 2KAXA 2JT0A 2NCPA 1CNPA 1TRFA 2E30A 1LA3A 2M7LA 1SW8A 2WNDA 3DVEA 1IJ5A 1KFUL 2ZKMX 3WXAA 1KK7Z 2MJWB 4A4BA 1J7OA 4I5NB 5AFPA 3PM8A 1NX3A 1CTRA 1GGZA 1EG4A 2M29A 2F3YA 2GTEA 3B6XA 3CWGA 3CTNA 4MZJA 5DICA 3O6BA 3LLEA 4JD9A 4F7FA 1N65A 4I5JA 2JRFA 2RGIA 3Q8IA 1DT7B 2Y4QA 5EL2A 2OS8C 1A75B 1PVBA 3VROA 2QEHA 4I5KA 4GNKB 2KI6C 1B7TY 3EKJA 1HT9A 1RWYA 1IKUA 1OW4A 1K2HA 2BE6A 1CFDA 3D77A 1KFXL 1F70A 1FI5A 1R6PA 3O78A 3DYEA 3CZ1A 2K7OA 1WLZA 3HX4A 3WHTB 1N2DA 4ZCVA 1OZSA 1F4OA 1LS8A 3DF0A 1M31A 1TUJA 2FCEA 1NSHA 1NX0A 1AVSA 1F4QA 3JTDB 1SRAA 1XFYO 2YGUA 3VRPA 2QACA 1K94A 1CFPA 1XYDA 1TTXA 2QEOA 2JC2A 1B8CA 1CDPA 5KSZA 5DKRA 3I5GB 3S0DA 1DJHA 1F55A 1JF0A 1SSEB 1ZFSA 1QATA 1DGUA 1S5GY 3KF9A 4NQGA 5I2OA 5D3OA 1MXEA 1DJWA 1D1OA 2OTGB 1M63B 1S36A 1S1EA 1TUZA 1WDCC 3CS1A 1KQMB 1HQVA 1EH2A 1K9PA 1OOGA 1QLSA 3NHTA 1UUSA 2LHIA 1YR5A 2P6BB 2WCMA 4PHKA 1TNQA 3SG4A 3VRNA 2WCHA 2Y1NA 3PN7C 2CNPA 4PHMA 4TNCA 5AANA 4C0KA 3EK7A 2H61C 1DC1A 3BUNB 1BMOA 3RZSA 1V1GA 2LANA 3B87A 1EG3A 2QDIA 1PSBA 1J7PA 4NDDA 1SYMA 2K7CA 4XJKA 1RTP1 1K8UA 1RECA 3DF0B 4USLA 1CFCA 3CR5X 3GK2A 3I5IB 2K2FA 1B8RA 1A2XA 1CLLA 4AOMA 4AQIA 1NUBA 5HKWA 2M1UA 3WHUB 1CLBA 4OZDA 1CMGA 1OMDA 2BECA 3S0AA 4HSZA 2AAOA 2WCJA 1TIZA 2Q91A 4QJ5B 3E3RA 2BKHB 4YGBB 1IGVA 3EVVA 1GQMA 3BUWB 3SJSA 1IWQA 3PATA 4JWQA 2F3ZA 3M0WA 4WQ3A 2WORA 1PK0D 2WCBA 3KPXA 1XFZO 1BLQA 1S6CA 2F8PA 3EVUA 2KFFA 1M39A 4CIDA 3CR2A 1WY9A 3I5FB 1NYAA 3S0EA 1TCFA 1XK4C 3JVTC 5J3XA 4A4CA 4GBAA 2CCMA 3EKHA 1DMOA 1UHJA 2BCXA 1SCMB 2L50A 4MSPA 1A29A 2LC5A 1UP5A 5FI2A 4XJKB 1L2OB 2MLEC 1SL8A 3EG5B 4UPGA 4NDBA 2PRUA 2VRGA 5HLOA 2ZRTA 3TS5C 1NX1A 2G9BA 1IH0A 2PASA 3FS7A 1XFRA 2BBMA 2BNXA 3I5HC 2LM5A 2LP2A 3CDNA 1C7WA 4YI8A 1TOPA 2L4IA 1KQVA 2WC5A 1QASA 4FQTA 4GAOA 1BR1B 4C0LA 1B7TZ 1NX2A 3BOWA 3IF7A 2M97A 2WCEA 2BCAA 5ER5A 3D78A 1LA0A 2R2IA 1DF0A 3TUYB 3DXLA 1Y1XA 2FJUB 4HREE 1K90D 2NXQA 3V2LA 1JUOA 4M2QA 3FE6A 2PMYA 1QIWA 2MHHA 1NPQA 5B8IB 1YRUB 4M2OA 2LP3A 4DCKA 1V1FA 1ODBA 1DJYA 2Y5IA 5AEQA 1SBJA 1OOIX 2F2OA 4MRYA 1F8HA 2O60A 2LLSA 2NCOA 2KLDA 1TNXA 4PHJA 4OKHA 2JQ6A 1DJIA 1W9ZA 1IJ6A 2KI6D 5HYDA 3D10A 4MZKA 1FBVA 2JXCA 2V53A 1S5GZ 1QJTA 2K0JA 4GGFA 3S0BA 1FW4A 2BCBA 2KDHA 2KBIA 3FWCA 1MUXA 4ETOA 3BOWB 3BYAA 1W7JB 3PJIA 2QEBA 2WCKA 3O2PA 1SL9A 5D69A 1GGWA 1BU3A 2LVIA 1SMGA 1DF0B 2LUXA 4XYNA 5KTYA 3OX5A 2I2RE 1J1DA 5GQQC 1OZOA 2QEVA 2LMUA 2K8MB 2L5YA 3L4LA 3OHMB 1Q80A 2I7AA 2JT8A 4ORAB 5CPVA 1K95A 1KFUS 3SIBA 3VRRA 1JSAA 4GUKA 1QLKA 5HKZA 3L4AA 2ZN9A 2LV7A 2JXLA 4DIRA 1YX8A 2KI4B 4YGCB 2KHNA 1ALWA 4N1FA 3MSEB 4N5XA 3BXKA 5FI7A 3TZ1A 5TNCA 1IIOA 4MRXA 2M0RA 3TDZA 5IBWA 2EC6C 3SG6A 1CDMA 2MRDA 3GK1A 3K1EA 1CM1A 2KFHA 4CLNA 2JOJA 2JPOA 2BL0C 4N1GA 1BR4B 1K96A 3LL8B 5DKNA 1B4CA 2KYCA 1GM0A 1SR6B 1KFXS 2Q4UA 1PALA 1AK8A 1TN4A 3KHEA 5D7FA 1KWOB 4F0ZB 1AP4A 4PE4A 1M46A 3DVMA 3SG7A 3KO0A 5HKYA 3NXAA 3QRXA 5JJGA 4PE0A 3SG5A 2HF5A 2WC8A 2L0PA 1R2UA 1QWVA 2WOSA 2SCPA 3PALA 3FWBA 3FE8A 2CXJA 3DY9A 1SK6D 3PLFB 4PALA 3NSLA 5CSNA 2LAPA 3O4XA 1S6JA 1MXLC 1PULA 3I5HB 3R1OA 2SASA 4YBHB 4ZCUA 3VGOA 1DEKA 1B47A 1M45A 1WLMA 1DGVA 1XFVO 2QPTA 1AHRA 2TN4A 2KLEA 3LK1A 4YGDB 3RM1A 3DD4A 4JPZB 2HQ8A 3SS3A 1KK8B 1WRKA 1S3PA 2JZIA 2WCLA 3BUMB 4MZLA 1NCZA 4PE7A 4C0JA 2KOTA 5I94A 2BBNA 1YUUA 3SIAA 1ALVA 3DZTA 4ICBA 1WRLA 2PSRA 3FIAA 1YRTB 3JTDC 1OOJA 2CBLA 1EJ3A 1OOHA 2M3WA 3F45A 4KYNA 5HLVA 5HL1A 1F54A 1CDLA 3IQOA 1FF1A 4P5OE 1IG5A 2JU0A 2JTZA 1CLMA 1OMRA 5K89A 4YGEB 1DJXA 3FE9A 2DOQA 1DVIA 2PQLA 2FOTA 3PM2A 1LXFC 1C3YA 2JWWA 3QMEA 1XO5A 1PVAA 1YVHA 2OTGC 2JNXA 3DVKA 2ZRSA 3B88A 4HRHA 2KBMA 5PALA 4E68A 1CDNA 2O5GA 1Z4HA 1KQMC 2OS8B 1UURA 3GOFA 3VRQA 1E8AA 3N7HA 1DTLA 1AUIB 2JPTA 5AERA 1BG1A 1P28A 2M1KB 1MR8A 3BUOB 4GPLB 1AJ4A 1YUTA 1YVLA 2H61A 4P2YB 1OOFA 4MVFA 1QIVA 3BFHA 2K2AA 1NIWA 1NCXA 1RK9A 1QX7A 1UHIA 2JT3A 2M9GA 4DUQA 2FJYA 3I5IC 5KU1A 1X02A 3AKAA 1T14A 3S0FA 1JC2A 1J55A 1G4YR 2K60A 2JTTA 2LNKA 1QX2A 1BOCA 1QV1A 5JOLA 3RLZA 4PT1A 1J1EA 1NWDA 3OBVA 2JULA 3CR4X 3R72A 1LKJA 1MQ1A 1YX7A 3ZWHA 1RFJA 1K9KA 3OB2B 3S0GA 2P71A 1Y6WA 4JKTA 4IJ7A 3AAKA 3CLNA 5CSJA 5AXIA 4D1EA 3BFAA 2GV5A 1TNPA 4QJ4B 3CABA 1JFJA 2EHBA 3EK8A 3I5FC 2IS9A 3HCMA 1WDCB 2LMVA 4INXA 3L47A 4FTGA 1UHNA 4M2PA 1IQ5A 2A4JA 1DELA 1BJFA 1XK4A 1XVJA 1S6IA 3PSRA 1UHKA 1EXRA 3PN7B 1SCMC 4PDZA 4CFRA 4DS7A 1F71A 1JF2A 3ICBA 3BJHA 1QVIY 1BF5A 3CGAA 1Y1AA 1L2OC 2EGDA 1U5IA 2KGBC 3D73A 3EK4A 3B7AA 1XA5A 1CM4A 2H8VA 1DJGA 1KCYA 3SS4A 4HRGA 4NDCA 2L5XB 3IQQA 4MLWA 3BUXB 4QJ3B 2JNFA 2L51A 3TDUA 2FCDA 2D8NA 2E6WA 1UHHA 1WRZA 1SL7A 2AMIA 4ORBB 3D76A 1J7QA 1Z2CB 3TUYC 1BT6A 2ERBA 1LVCD 2KPHA 1K9UA 1W7IB 4MN0A 1AJ5A 1ZOTB 2K61A 1S26D 5CSIA 5FI6A 1KK7Y 2KYFA 1SPYA 3DVJA 3OX6A 2PYQA 1G33A 1J7RA 1PRWA 4YGAA 2MBXA 2P70A 3CYZA 1B1GA 1FI6A 3JVTB 3SG2A 4WQ2A 1CKKA 4U8DA 3EVRA 3A4UB 3UO9A 2AUCA 4CPVA 1U5IB 2HPSA 2NLNA 3WNXB 2COLB 2I18A 3OGNA 4MBEA 1TCOB 2KAYA 3IVTA 1GJYA 1OE9B 2MAZA 1OSAA 2NZ0A 5CSFA 3TS5B 2I94A 1OQPA 1H8BA 1A4PA 2WCFA 2M49B 5G08A 4OV2A 4AQJA 2MLFC 2LMTA
chains in the Genus database with same CATH topology
4I5NB 5FI6A 2BNXA 2KLEA 3UNWA 3OBVA 2L5YA 1Z4HA 3SS3A 1DC1A 4I5JA 2YGUA 4GAOA 4MEWA 3KEVA 2KLDA 5I94A 3SS4A 4JKTA 1W9ZA 4IJ7A 4I5KA 4KYNA 3UO9A 5HL1A 5FI7A 2BAPA 3IVTA 3SS5A 4GBAA 3O4XA 1Z2CB 5D3OA 5FI2A 1DELA 3PM2A 3EG5B 4I5LB 2K60A 1DEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJ7 A;  3PM2 A;  4KYN A; 
#chains in the Genus database with same CATH topology
 1ZAC A;  4IL1 A;  2BKI B;  2ZNE A;  3NSO A;  1Y0V H;  4CFQ A;  1N0Y A;  1RRO A;  2LLU A;  2ZN8 A;  1IQ3 A;  3O4Y A;  1SY9 A;  1DQE A;  1BOD A;  1CB1 A;  2KGR A;  4YI9 A;  4MEW A;  3KEV A;  2GGZ A;  1KSO A;  1UWO A;  2LLT A;  2ZND A;  3NGV A;  1IRJ A;  1A03 A;  1KSM A;  3NSK A;  4BY5 A;  1Y1U A;  2ZFD A;  3ZNI A;  2K7B A;  1CFF A;  4PE1 A;  1C07 A;  2BAP A;  2H2K A;  2PAL A;  1K93 D;  1TWO A;  4INW A;  3K21 A;  1ZMZ A;  5FYX A;  1B8L A;  1L7Z A;  3GK4 X;  1JBA A;  3BQ3 A;  3AAJ A;  1EL4 A;  1QS7 A;  2KI4 C;  3LCP C;  4OR9 B;  1C7V A;  1VRK A;  1YUS A;  3AKB A;  1H4B A;  3I5G C;  4PCW A;  2G2B A;  3VB1 A;  1TNW A;  3PFV A;  5ER4 X;  2L98 A;  4DRW A;  2Y1M A;  2LVV A;  2CTN A;  2GGM A;  3D0Y A;  5BPJ A;  4OVN F;  3UNW A;  4FQO A;  4WRI A;  2K7D A;  1SR6 C;  2LE9 B;  2WC6 A;  2HET A;  2MA2 A;  3H4S E;  1ORG A;  2M8U A;  4GGF C;  1XFX O;  1KWO C;  1NCY A;  1QTX A;  3C1V A;  1XFU O;  2F2P A;  4R1E A;  1CMF A;  2B1U A;  3LK0 A;  1QV0 A;  3CZ2 A;  1G8I A;  2KNE A;  1SNL A;  2KSP A;  3D75 A;  3SS5 A;  2L2C A;  4YRU A;  1MWN A;  1ZUZ A;  1OMV A;  1JWD A;  2LUC A;  3R1P A;  5I2L A;  2LVJ A;  2LHL A;  3SG3 A;  5I2Q A;  4I5L B;  3CZ0 A;  3D74 A;  2PVB A;  1QVI Z;  5F6T A;  3CZT X;  3A8R A;  1NP8 A;  1A75 A;  2L2E A;  4BY4 A;  3B86 A;  4OCI A;  2LCP A;  2KQY A;  3TDI A;  1QXP A;  1YTZ C;  3OB1 B;  4JQ0 D;  3NSI A;  4GGN A;  4Q04 A;  5DKQ A;  2F33 A;  2LVK A;  2BE4 A;  5I8N A;  2HQW A;  3BFB A;  3OP0 A;  2L4H A;  2CT9 A;  1DJZ A;  1LIN A;  1MF8 B;  1SKT A;  4L9M A;  4ORC B;  1KK8 C;  4PHN A;  2OPO A;  1YUR A;  2EC6 B;  3D0Y B;  3R1V A;  2KFG A;  2KQ6 A;  2M7N A;  1FPW A;  1PSR A;  1JFK A;  3NHI A;  1RJV A;  2ISD A;  4GFT A;  1B9A A;  1MHO A;  1SCV A;  1QX5 B;  2BL0 B;  1C3Z A;  1XFW O;  2KAV A;  2KAX A;  2JT0 A;  2NCP A;  1CNP A;  1TRF A;  2E30 A;  1LA3 A;  2M7L A;  1SW8 A;  2WND A;  3DVE A;  1IJ5 A;  1KFU L;  2ZKM X;  3WXA A;  1KK7 Z;  2MJW B;  4A4B A;  1J7O A;  4I5N B;  5AFP A;  3PM8 A;  1NX3 A;  1CTR A;  1GGZ A;  1EG4 A;  2M29 A;  2F3Y A;  2GTE A;  3B6X A;  3CWG A;  3CTN A;  4MZJ A;  5DIC A;  3O6B A;  3LLE A;  4JD9 A;  4F7F A;  1N65 A;  4I5J A;  2JRF A;  2RGI A;  3Q8I A;  1DT7 B;  2Y4Q A;  5EL2 A;  2OS8 C;  1A75 B;  1PVB A;  3VRO A;  2QEH A;  4I5K A;  4GNK B;  2KI6 C;  1B7T Y;  3EKJ A;  1HT9 A;  1RWY A;  1IKU A;  1OW4 A;  1K2H A;  2BE6 A;  1CFD A;  3D77 A;  1KFX L;  1F70 A;  1FI5 A;  1R6P A;  3O78 A;  3DYE A;  3CZ1 A;  2K7O A;  1WLZ A;  3HX4 A;  3WHT B;  1N2D A;  4ZCV A;  1OZS A;  1F4O A;  1LS8 A;  3DF0 A;  1M31 A;  1TUJ A;  2FCE A;  1NSH A;  1NX0 A;  1AVS A;  1F4Q A;  3JTD B;  1SRA A;  1XFY O;  2YGU A;  3VRP A;  2QAC A;  1K94 A;  1CFP A;  1XYD A;  1TTX A;  2QEO A;  2JC2 A;  1B8C A;  1CDP A;  5KSZ A;  5DKR A;  3I5G B;  3S0D A;  1DJH A;  1F55 A;  1JF0 A;  1SSE B;  1ZFS A;  1QAT A;  1DGU A;  1S5G Y;  3KF9 A;  4NQG A;  5I2O A;  5D3O A;  1MXE A;  1DJW A;  1D1O A;  2OTG B;  1M63 B;  1S36 A;  1S1E A;  1TUZ A;  1WDC C;  3CS1 A;  1KQM B;  1HQV A;  1EH2 A;  1K9P A;  1OOG A;  1QLS A;  3NHT A;  1UUS A;  2LHI A;  1YR5 A;  2P6B B;  2WCM A;  4PHK A;  1TNQ A;  3SG4 A;  3VRN A;  2WCH A;  2Y1N A;  3PN7 C;  2CNP A;  4PHM A;  4TNC A;  5AAN A;  4C0K A;  3EK7 A;  2H61 C;  1DC1 A;  3BUN B;  1BMO A;  3RZS A;  1V1G A;  2LAN A;  3B87 A;  1EG3 A;  2QDI A;  1PSB A;  1J7P A;  4NDD A;  1SYM A;  2K7C A;  4XJK A;  1RTP 1;  1K8U A;  1REC A;  3DF0 B;  4USL A;  1CFC A;  3CR5 X;  3GK2 A;  3I5I B;  2K2F A;  1B8R A;  1A2X A;  1CLL A;  4AOM A;  4AQI A;  1NUB A;  5HKW A;  2M1U A;  3WHU B;  1CLB A;  4OZD A;  1CMG A;  1OMD A;  2BEC A;  3S0A A;  4HSZ A;  2AAO A;  2WCJ A;  1TIZ A;  2Q91 A;  4QJ5 B;  3E3R A;  2BKH B;  4YGB B;  1IGV A;  3EVV A;  1GQM A;  3BUW B;  3SJS A;  1IWQ A;  3PAT A;  4JWQ A;  2F3Z A;  3M0W A;  4WQ3 A;  2WOR A;  1PK0 D;  2WCB A;  3KPX A;  1XFZ O;  1BLQ A;  1S6C A;  2F8P A;  3EVU A;  2KFF A;  1M39 A;  4CID A;  3CR2 A;  1WY9 A;  3I5F B;  1NYA A;  3S0E A;  1TCF A;  1XK4 C;  3JVT C;  5J3X A;  4A4C A;  4GBA A;  2CCM A;  3EKH A;  1DMO A;  1UHJ A;  2BCX A;  1SCM B;  2L50 A;  4MSP A;  1A29 A;  2LC5 A;  1UP5 A;  5FI2 A;  4XJK B;  1L2O B;  2MLE C;  1SL8 A;  3EG5 B;  4UPG A;  4NDB A;  2PRU A;  2VRG A;  5HLO A;  2ZRT A;  3TS5 C;  1NX1 A;  2G9B A;  1IH0 A;  2PAS A;  3FS7 A;  1XFR A;  2BBM A;  2BNX A;  3I5H C;  2LM5 A;  2LP2 A;  3CDN A;  1C7W A;  4YI8 A;  1TOP A;  2L4I A;  1KQV A;  2WC5 A;  1QAS A;  4FQT A;  4GAO A;  1BR1 B;  4C0L A;  1B7T Z;  1NX2 A;  3BOW A;  3IF7 A;  2M97 A;  2WCE A;  2BCA A;  5ER5 A;  3D78 A;  1LA0 A;  2R2I A;  1DF0 A;  3TUY B;  3DXL A;  1Y1X A;  2FJU B;  4HRE E;  1K90 D;  2NXQ A;  3V2L A;  1JUO A;  4M2Q A;  3FE6 A;  2PMY A;  1QIW A;  2MHH A;  1NPQ A;  5B8I B;  1YRU B;  4M2O A;  2LP3 A;  4DCK A;  1V1F A;  1ODB A;  1DJY A;  2Y5I A;  5AEQ A;  1SBJ A;  1OOI X;  2F2O A;  4MRY A;  1F8H A;  2O60 A;  2LLS A;  2NCO A;  2KLD A;  1TNX A;  4PHJ A;  4OKH A;  2JQ6 A;  1DJI A;  1W9Z A;  1IJ6 A;  2KI6 D;  5HYD A;  3D10 A;  4MZK A;  1FBV A;  2JXC A;  2V53 A;  1S5G Z;  1QJT A;  2K0J A;  4GGF A;  3S0B A;  1FW4 A;  2BCB A;  2KDH A;  2KBI A;  3FWC A;  1MUX A;  4ETO A;  3BOW B;  3BYA A;  1W7J B;  3PJI A;  2QEB A;  2WCK A;  3O2P A;  1SL9 A;  5D69 A;  1GGW A;  1BU3 A;  2LVI A;  1SMG A;  1DF0 B;  2LUX A;  4XYN A;  5KTY A;  3OX5 A;  2I2R E;  1J1D A;  5GQQ C;  1OZO A;  2QEV A;  2LMU A;  2K8M B;  2L5Y A;  3L4L A;  3OHM B;  1Q80 A;  2I7A A;  2JT8 A;  4ORA B;  5CPV A;  1K95 A;  1KFU S;  3SIB A;  3VRR A;  1JSA A;  4GUK A;  1QLK A;  5HKZ A;  3L4A A;  2ZN9 A;  2LV7 A;  2JXL A;  4DIR A;  1YX8 A;  2KI4 B;  4YGC B;  2KHN A;  1ALW A;  4N1F A;  3MSE B;  4N5X A;  3BXK A;  5FI7 A;  3TZ1 A;  5TNC A;  1IIO A;  4MRX A;  2M0R A;  3TDZ A;  5IBW A;  2EC6 C;  3SG6 A;  1CDM A;  2MRD A;  3GK1 A;  3K1E A;  1CM1 A;  2KFH A;  4CLN A;  2JOJ A;  2JPO A;  2BL0 C;  4N1G A;  1BR4 B;  1K96 A;  3LL8 B;  5DKN A;  1B4C A;  2KYC A;  1GM0 A;  1SR6 B;  1KFX S;  2Q4U A;  1PAL A;  1AK8 A;  1TN4 A;  3KHE A;  5D7F A;  1KWO B;  4F0Z B;  1AP4 A;  4PE4 A;  1M46 A;  3DVM A;  3SG7 A;  3KO0 A;  5HKY A;  3NXA A;  3QRX A;  5JJG A;  4PE0 A;  3SG5 A;  2HF5 A;  2WC8 A;  2L0P A;  1R2U A;  1QWV A;  2WOS A;  2SCP A;  3PAL A;  3FWB A;  3FE8 A;  2CXJ A;  3DY9 A;  1SK6 D;  3PLF B;  4PAL A;  3NSL A;  5CSN A;  2LAP A;  3O4X A;  1S6J A;  1MXL C;  1PUL A;  3I5H B;  3R1O A;  2SAS A;  4YBH B;  4ZCU A;  3VGO A;  1DEK A;  1B47 A;  1M45 A;  1WLM A;  1DGV A;  1XFV O;  2QPT A;  1AHR A;  2TN4 A;  2KLE A;  3LK1 A;  4YGD B;  3RM1 A;  3DD4 A;  4JPZ B;  2HQ8 A;  3SS3 A;  1KK8 B;  1WRK A;  1S3P A;  2JZI A;  2WCL A;  3BUM B;  4MZL A;  1NCZ A;  4PE7 A;  4C0J A;  2KOT A;  5I94 A;  2BBN A;  1YUU A;  3SIA A;  1ALV A;  3DZT A;  4ICB A;  1WRL A;  2PSR A;  3FIA A;  1YRT B;  3JTD C;  1OOJ A;  2CBL A;  1EJ3 A;  1OOH A;  2M3W A;  3F45 A;  4KYN A;  5HLV A;  5HL1 A;  1F54 A;  1CDL A;  3IQO A;  1FF1 A;  4P5O E;  1IG5 A;  2JU0 A;  2JTZ A;  1CLM A;  1OMR A;  5K89 A;  4YGE B;  1DJX A;  3FE9 A;  2DOQ A;  1DVI A;  2PQL A;  2FOT A;  3PM2 A;  1LXF C;  1C3Y A;  2JWW A;  3QME A;  1XO5 A;  1PVA A;  1YVH A;  2OTG C;  2JNX A;  3DVK A;  2ZRS A;  3B88 A;  4HRH A;  2KBM A;  5PAL A;  4E68 A;  1CDN A;  2O5G A;  1Z4H A;  1KQM C;  2OS8 B;  1UUR A;  3GOF A;  3VRQ A;  1E8A A;  3N7H A;  1DTL A;  1AUI B;  2JPT A;  5AER A;  1BG1 A;  1P28 A;  2M1K B;  1MR8 A;  3BUO B;  4GPL B;  1AJ4 A;  1YUT A;  1YVL A;  2H61 A;  4P2Y B;  1OOF A;  4MVF A;  1QIV A;  3BFH A;  2K2A A;  1NIW A;  1NCX A;  1RK9 A;  1QX7 A;  1UHI A;  2JT3 A;  2M9G A;  4DUQ A;  2FJY A;  3I5I C;  5KU1 A;  1X02 A;  3AKA A;  1T14 A;  3S0F A;  1JC2 A;  1J55 A;  1G4Y R;  2K60 A;  2JTT A;  2LNK A;  1QX2 A;  1BOC A;  1QV1 A;  5JOL A;  3RLZ A;  4PT1 A;  1J1E A;  1NWD A;  3OBV A;  2JUL A;  3CR4 X;  3R72 A;  1LKJ A;  1MQ1 A;  1YX7 A;  3ZWH A;  1RFJ A;  1K9K A;  3OB2 B;  3S0G A;  2P71 A;  1Y6W A;  4JKT A;  4IJ7 A;  3AAK A;  3CLN A;  5CSJ A;  5AXI A;  4D1E A;  3BFA A;  2GV5 A;  1TNP A;  4QJ4 B;  3CAB A;  1JFJ A;  2EHB A;  3EK8 A;  3I5F C;  2IS9 A;  3HCM A;  1WDC B;  2LMV A;  4INX A;  3L47 A;  4FTG A;  1UHN A;  4M2P A;  1IQ5 A;  2A4J A;  1DEL A;  1BJF A;  1XK4 A;  1XVJ A;  1S6I A;  3PSR A;  1UHK A;  1EXR A;  3PN7 B;  1SCM C;  4PDZ A;  4CFR A;  4DS7 A;  1F71 A;  1JF2 A;  3ICB A;  3BJH A;  1QVI Y;  1BF5 A;  3CGA A;  1Y1A A;  1L2O C;  2EGD A;  1U5I A;  2KGB C;  3D73 A;  3EK4 A;  3B7A A;  1XA5 A;  1CM4 A;  2H8V A;  1DJG A;  1KCY A;  3SS4 A;  4HRG A;  4NDC A;  2L5X B;  3IQQ A;  4MLW A;  3BUX B;  4QJ3 B;  2JNF A;  2L51 A;  3TDU A;  2FCD A;  2D8N A;  2E6W A;  1UHH A;  1WRZ A;  1SL7 A;  2AMI A;  4ORB B;  3D76 A;  1J7Q A;  1Z2C B;  3TUY C;  1BT6 A;  2ERB A;  1LVC D;  2KPH A;  1K9U A;  1W7I B;  4MN0 A;  1AJ5 A;  1ZOT B;  2K61 A;  1S26 D;  5CSI A;  5FI6 A;  1KK7 Y;  2KYF A;  1SPY A;  3DVJ A;  3OX6 A;  2PYQ A;  1G33 A;  1J7R A;  1PRW A;  4YGA A;  2MBX A;  2P70 A;  3CYZ A;  1B1G A;  1FI6 A;  3JVT B;  3SG2 A;  4WQ2 A;  1CKK A;  4U8D A;  3EVR A;  3A4U B;  3UO9 A;  2AUC A;  4CPV A;  1U5I B;  2HPS A;  2NLN A;  3WNX B;  2COL B;  2I18 A;  3OGN A;  4MBE A;  1TCO B;  2KAY A;  3IVT A;  1GJY A;  1OE9 B;  2MAZ A;  1OSA A;  2NZ0 A;  5CSF A;  3TS5 B;  2I94 A;  1OQP A;  1H8B A;  1A4P A;  2WCF A;  2M49 B;  5G08 A;  4OV2 A;  4AQJ A;  2MLF C;  2LMT A; 
#chains in the Genus database with same CATH homology
 4I5N B;  5FI6 A;  2BNX A;  2KLE A;  3UNW A;  3OBV A;  2L5Y A;  1Z4H A;  3SS3 A;  1DC1 A;  4I5J A;  2YGU A;  4GAO A;  4MEW A;  3KEV A;  2KLD A;  5I94 A;  3SS4 A;  4JKT A;  1W9Z A;  4IJ7 A;  4I5K A;  4KYN A;  3UO9 A;  5HL1 A;  5FI7 A;  2BAP A;  3IVT A;  3SS5 A;  4GBA A;  3O4X A;  1Z2C B;  5D3O A;  5FI2 A;  1DEL A;  3PM2 A;  3EG5 B;  4I5L B;  2K60 A;  1DEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...