2NXQA

Crystal structure of calcium binding protein 1 from entamoeba histolytica: a novel arrangement of ef hand motifs
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
66
structure length
66
Chain Sequence
AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calcium-binding protein
publication title Crystal structure of calcium binding protein-1 from Entamoeba histolytica: A novel arrangement of EF hand motifs.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 26
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2nxqA00
3C1VA 1DGVA 1CM4A 1OQPA 4M2PA 1Y1AA 2BECA 4PHJA 4YBHB 1IJ6A 1NIWA 2H61C 2GGZA 4OV2A 1L2OC 1N65A 4M2QA 4IL1A 1M39A 1S5GY 1G8IA 2KAXA 2F8PA 1DF0A 3AAKA 3SG6A 3PN7C 2BE4A 2PRUA 4GFTA 1TNXA 1CDMA 5CPVA 2NCOA 2BKHB 2KQYA 1FBVA 2GV5A 2LVVA 3WNXB 2JQ6A 1CDPA 1WRZA 1IRJA 1CB1A 2KI6C 4WQ3A 1TRFA 1J7RA 1RROA 2F2OA 3GK2A 4C0LA 5IBWA 3KF9A 1NP8A 2EHBA 5F6TA 3EK8A 1DMOA 1MXEA 2HF5A 3JVTC 3SIAA 2M97A 4D1EA 5G08A 3HX4A 3NSLA 2JTZA 1IQ5A 2WCEA 5AERA 3TS5C 1SRAA 3PN7B 5AANA 1LA0A 2LLTA 4DIRA 1QIVA 1KQMC 1K9KA 3CR4X 2K7CA 1CMGA 2L50A 1BMOA 1CFPA 3AKAA 2JU0A 2CCMA 3I5FB 2AMIA 2JULA 2EGDA 5HKWA 4GUKA 1MQ1A 3OB1B 1C07A 1GJYA 1LXFC 4PHNA 4FQOA 4ORBB 5K89A 3PSRA 1Y6WA 1WRLA 1S3PA 1ODBA 3FWBA 1RWYA 2NZ0A 3GK4X 1B47A 4XYNA 4I5LB 4XJKA 1UHNA 4I5NB 1MF8B 2WCFA 4NQGA 5DKRA 4CFQA 1NX0A 2JNXA 1ZUZA 4HSZA 5I2QA 2NCPA 4YGDB 1WDCC 3BUWB 1A03A 2CTNA 1AJ4A 2ZRSA 2KSPA 4NDCA 3EVRA 3OB2B 1K94A 5AEQA 1QTXA 2KI4B 1A29A 1KFXL 3NSOA 2LCPA 4MRXA 1DGUA 2K7OA 4MRYA 2EC6B 4ETOA 2KGRA 1CLLA 1SCMC 2FCEA 5HLVA 1NSHA 1L7ZA 1YUTA 5CSIA 2L51A 1XVJA 5HKZA 3LK0A 4MBEA 1FW4A 1K96A 2F33A 1E8AA 1PK0D 1FF1A 4HREE 2Q91A 1OZSA 1BJFA 4GPLB 1PVAA 1Q80A 2LMVA 1SBJA 2K0JA 2SCPA 1F4QA 3ZWHA 3TDIA 1OOJA 3BOWA 1SR6C 2WNDA 1KCYA 2M8UA 3FWCA 1XFUO 1IH0A 1CFDA 3VROA 1OMVA 3JTDC 1F70A 3DVMA 4N1GA 2H2KA 1YRUB 4P5OE 1K95A 1KFXS 3KPXA 3I5IC 1K2HA 1NWDA 2LUCA 3EVUA 1NCXA 1XA5A 3ZNIA 2WORA 2L5XB 2ZNEA 3H4SE 1K9UA 3SG3A 1WRKA 2L4HA 1BR4B 1XFZO 1B1GA 2L98A 3EVVA 2LNKA 4N1FA 4C0KA 3O6BA 1TIZA 1RJVA 3EKHA 3OX6A 2ZFDA 2HETA 1OSAA 2LE9B 1TTXA 3PATA 1ZOTB 1M46A 2M9GA 2K7BA 2DOQA 3SG2A 1OZOA 2K8MB 4F0ZB 1DJYA 1S6JA 2MJWB 2H61A 2MAZA 1MR8A 2BCAA 1CLMA 1A2XA 4A4CA 1A4PA 5I2OA 1JF0A 1K90D 4CFRA 3IF7A 5KSZA 1XK4C 3TUYC 1KWOB 1TNWA 2KFFA 2MA2A 1XFWO 2LLUA 2ZKMX 1CKKA 2KAVA 2COLB 3LK1A 2KFHA 3O2PA 3DVEA 1YURA 3GK1A 1SMGA 1L2OB 1NUBA 1XFXO 2O60A 4A4BA 3CLNA 4PHKA 2HPSA 3TDUA 3VRPA 1OMDA 1S26D 3EK4A 1DJGA 1MWNA 1S5GZ 2G9BA 2KQ6A 2OTGC 4YGEB 3RM1A 1IJ5A 1SPYA 2L2EA 3D0YA 1JSAA 2E30A 2VRGA 5J3XA 1H8BA 1CDLA 3FS7A 5ER5A 4FTGA 2JZIA 4M2OA 3DF0A 1SL7A 2ISDA 1FI6A 2JT8A 4PHMA 1KQVA 3JVTB 1X02A 2LC5A 1R6PA 4MVFA 1QIWA 2BE6A 1TCOB 1QV0A 3TS5B 1BOCA 1V1FA 1W7JB 1CNPA 1JFJA 1TNQA 1LVCD 1QASA 2BL0C 1GGZA 1MXLC 1KQMB 2M0RA 3NSKA 4I5KA 4OR9B 4USLA 2F3ZA 3WHTB 3MSEB 3EKJA 1JWDA 3D0YB 1UHKA 4WRIA 3IQOA 1PSRA 2CBLA 1QV1A 5I8NA 2ZN9A 3IQQA 5TNCA 4DUQA 2F2PA 1BG1A 2PVBA 1U5IB 1NYAA 3DF0B 1KFUL 2CXJA 1DJXA 1DJHA 1MHOA 1JC2A 4GGFC 2E6WA 2BBNA 2LVIA 1JF2A 1F55A 3VGOA 2K2AA 1J7QA 2BBMA 1QXPA 4CLNA 1M31A 2BL0B 2QACA 5JOLA 3PALA 2L0PA 4BY4A 3QRXA 3EK7A 1G4YR 1J55A 1NPQA 2KYFA 2ZN8A 3KHEA 2I18A 4HRHA 4PCWA 1SNLA 1PULA 1YVLA 2Y4QA 3O4YA 2F3YA 1CFFA 1WDCB 1SK6D 4DRWA 3VRQA 3TZ1A 1QX7A 1ZACA 2V53A 2JTTA 2PALA 2Q4UA 4OVNF 2NXQA 2RGIA 4L9MA 1DVIA 1R2UA 4NDBA 1QVIY 1OE9B 2KDHA 3AKBA 4PE0A 1S6IA 1YUUA 4U8DA 1NCZA 1J7OA 5AFPA 1SCMB 1ZFSA 1KFUS 4R1EA 1M63B 2LUXA 1KK8C 2I94A 1TCFA 2KGBC 3BXKA 2JXCA 4QJ3B 1WY9A 2WC8A 3WHUB 3PM8A 2AUCA 1AUIB 2JWWA 3I5HC 1CLBA 1F8HA 2LMUA 5BPJA 3HCMA 2LANA 1A75A 2PSRA 2HQ8A 4GBAA 3I5GC 3LL8B 1Y1XA 1OMRA 2M7NA 2KAYA 1M45A 1AVSA 1YR5A 2KI6D 1FPWA 1SR6B 2JOJA 2MLEC 5ER4X 1YX7A 1BF5A 4Q04A 4ZCVA 1NX1A 1QVIZ 1FI5A 1KK8B 1SW8A 3JTDB 2MLFC 3VRNA 1PRWA 3DD4A 1BU3A 1KSMA 1G33A 1Y1UA 1UP5A 2R2IA 2Y1MA 1PVBA 3I5IB 1KK7Y 2GGMA 1JUOA 3TDZA 2Y1NA 1B8RA 2KBIA 2MHHA 1QX5B 4OCIA 1A75B 4TNCA 3ICBA 4PE7A 1LINA 1XFYO 1YX8A 2CNPA 2MBXA 1XK4A 4MZLA 1TN4A 2M29A 2PASA 1SYMA 4AQIA 3BUNB 1EL4A 4AOMA 3CR2A 2MRDA 3PLFB 1S1EA 1S6CA 4GNKB 2KBMA 1BR1B 1QS7A 3DVKA 5HKYA 4GAOA 5I2LA 1Y0VH 1XYDA 5FYXA 1LA3A 1HT9A 1DJWA 2JC2A 4MEWA 3A8RA 1CTRA 4PDZA 5CSNA 1EG3A 1KK7Z 2LAPA 1F4OA 3SG4A 1ALWA 3SG5A 1B8LA 3OP0A 1RECA 3KEVA 3SJSA 3TUYB 2KHNA 1BT6A 2JT3A 1IGVA 2WCBA 1TNPA 2M1UA 4ZCUA 1AK8A 3SG7A 5B8IB 1IKUA 3O78A 4C0JA 1EXRA 2WOSA 3A4UB 1RTP1 1SL9A 1F54A 2FCDA 2KFGA 3I5FC 1UURA 5HYDA 1K8UA 1XFVO 1NCYA 4P2YB 4NDDA 5DKQA 3NSIA 1JFKA 1GGWA 3NXAA 3OHMB 1U5IA 2M49B 3GOFA 3M0WA 4PE4A 2LMTA 2PMYA 4YRUA 5DKNA 3BUMB 1YTZC 2Y5IA 2TN4A 4YI9A 1DF0B 1CFCA 4YGCB 4CPVA 3LLEA 2LM5A 4E68A 2I7AA 2L4IA 2NLNA 2BKIB 1YUSA 2OTGB 1CMFA 1B9AA 1QLSA 2IS9A 4QJ4B 1CM1A 3DVJA 4UPGA 5GQQC 1W7IB 2CT9A 1N0YA 2FOTA 2JXLA 2M3WA 4YGBB 5PALA 2LHIA 2JT0A 4I5JA 4BY5A 2K7DA 1WLZA 1RK9A 1ALVA 4GGFA 4WQ2A 4MN0A 2QPTA 4DCKA 1AHRA 2KI4C 4YGAA 4ORCB 5D7FA 1PSBA 2LVJA 4QJ5B 1BLQA 1JBAA 1IG5A 1GQMA 1QX2A 1EG4A 1SY9A 1YRTB 1SKTA 2EC6C 1V1GA 1DJZA 1EH2A 1IWQA 2KYCA 1QJTA 1J1DA 1HQVA 3CWGA 1TOPA 1UHHA 3OX5A 4ORAB 1C7WA 1MUXA 3BYAA 1RFJA 1EJ3A 3CR5X 2O5GA 5CSFA 5KU1A 4DS7A 2LP2A 3K21A 1KSOA 3BQ3A 4MLWA 2D8NA 2HQWA 2ZRTA 4GGNA 2AAOA 1AP4A 1SL8A 4JPZB 1AJ5A 2BCXA 4XJKB 1DJIA 4MSPA 1N2DA 1D1OA 1WLMA 1J7PA 1UUSA 2JRFA 4YI8A 3RLZA 2FJUB 4JWQA 1IQ3A 4MZJA 1UWOA 1C7VA 3CZTX 2M1KB 3D10A 2BCBA 3F45A 1NX2A 3E3RA 2LHLA 4MZKA 4N5XA 4OKHA 5CSJA 3VRRA 2B1UA 2OS8C 1QLKA 3FIAA 2LV7A 1J1EA 5HLOA 1BODA 1ZMZA 2OPOA 3KO0A 2P6BB 1DTLA 1LKJA 1UHJA 1YVHA 1B7TY 1VRKA 2JNFA 1DT7B 1CDNA 3CTNA 4PALA 1UHIA 2I2RE 2A4JA 2K2FA 3BUOB 1F71A 1NX3A 4AQJA 2LVKA 2JPTA 4PE1A 2SASA 3SIBA 1SCVA 3AAJA 2LLSA 3I5HB 5D69A 1K93D 3CGAA 1H4BA 2KOTA 2KNEA 5KTYA 3I5GB 1B8CA 2OS8B 2LP3A 2M7LA 5JJGA 5AXIA 4CIDA 2ZNDA 1B4CA 1KWOC 1S36A 3BOWB 4JQ0D 2G2BA 3LCPC 1PALA 1K9PA 2K61A 4ICBA 4HRGA 3WXAA 1B7TZ 3CS1A 3BUXB 1XO5A 1QATA 3PFVA
chains in the Genus database with same CATH superfamily
3C1VA 1DGVA 5FI6A 1CM4A 1OQPA 4M2PA 1Y1AA 2BECA 4PHJA 4YBHB 1IJ6A 1NIWA 3N7HA 2H61C 2GGZA 3PM2A 4OV2A 1L2OC 1N65A 4M2QA 4IL1A 1M39A 5FI7A 1S5GY 1G8IA 2KAXA 2F8PA 1DF0A 3AAKA 3SG6A 3PN7C 2BE4A 2PRUA 4GFTA 1TNXA 1CDMA 5CPVA 2NCOA 2BKHB 2KQYA 1FBVA 2GV5A 2LVVA 3WNXB 2JQ6A 1CDPA 1WRZA 1IRJA 1CB1A 2KI6C 4WQ3A 1TRFA 1J7RA 1RROA 2F2OA 3GK2A 4C0LA 5IBWA 3KF9A 1NP8A 2EHBA 5F6TA 3EK8A 1DMOA 1MXEA 2HF5A 3JVTC 3SIAA 2M97A 3S0EA 5G08A 4D1EA 3HX4A 3NSLA 2JTZA 1IQ5A 2WCEA 3SS5A 5AERA 3TS5C 1SRAA 1GM0A 1LS8A 3PN7B 5AANA 1LA0A 2LLTA 4DIRA 1QIVA 1KQMC 3BFBA 1K9KA 3CR4X 2K7CA 1CMGA 2L50A 1BMOA 1CFPA 3AKAA 2JU0A 2CCMA 3FE9A 3I5FB 2AMIA 2JULA 2EGDA 5HKWA 4GUKA 5FI2A 1MQ1A 3OB1B 3B7AA 1C07A 1GJYA 1LXFC 4PHNA 4FQOA 4ORBB 5K89A 3PSRA 1Y6WA 1WRLA 1S3PA 1ODBA 1OW4A 3FWBA 1RWYA 2NZ0A 3GK4X 1B47A 4XYNA 4I5LB 4XJKA 1UHNA 4I5NB 1MF8B 2WCFA 3L4LA 2ERBA 1XFRA 4NQGA 5DKRA 4CFQA 1NX0A 2JNXA 1ZUZA 4HSZA 5I2QA 2NCPA 4YGDB 1WDCC 3BUWB 1A03A 2CTNA 1AJ4A 2H8VA 2QDIA 1Z2CB 2ZRSA 2KSPA 4NDCA 3EVRA 3OB2B 1K94A 5AEQA 1QTXA 2KI4B 1A29A 1KFXL 3CZ0A 3EG5B 3NSOA 2LCPA 4MRXA 1DGUA 2K7OA 3CABA 2P71A 4MRYA 2EC6B 4ETOA 2KGRA 1CLLA 1SCMC 2FCEA 5HLVA 1YUTA 1NSHA 1L7ZA 1OOIX 5CSIA 2L51A 1XVJA 5HKZA 3LK0A 4MBEA 1FW4A 1K96A 2F33A 1E8AA 1PK0D 1FF1A 4HREE 2Q91A 1OZSA 1BJFA 2P70A 4GPLB 1PVAA 1Q80A 2LMVA 1SBJA 2K0JA 2SCPA 3UNWA 1F4QA 3ZWHA 3TDIA 1OOJA 3BOWA 1SR6C 2WNDA 1KCYA 2M8UA 3FWCA 1XFUO 1IH0A 4JKTA 1CFDA 3VROA 1OMVA 3JTDC 1F70A 3DVMA 4N1GA 2H2KA 3SS3A 1DQEA 1YRUB 1K95A 4P5OE 1KFXS 3KPXA 3I5IC 1K2HA 1NWDA 2LUCA 3EVUA 1NCXA 1XA5A 3SS4A 3ZNIA 2WORA 2L5XB 2ZNEA 3H4SE 1K9UA 3SG3A 1WRKA 2KPHA 2L4HA 1BR4B 1XFZO 1B1GA 2L98A 3EVVA 2LNKA 4N1FA 4C0KA 3O6BA 1TIZA 1RJVA 2L5YA 3EKHA 4FQTA 3OX6A 2ZFDA 2HETA 1OSAA 2LE9B 1TTXA 3PATA 3S0GA 1ZOTB 1M46A 2M9GA 2K7BA 2DOQA 3SG2A 3S0FA 1OZOA 1OOHA 2K8MB 4F0ZB 1DJYA 1S6JA 2MJWB 2BNXA 2H61A 2MAZA 1MR8A 2BCAA 1CLMA 1A2XA 4A4CA 3RZSA 1A4PA 5I2OA 1JF0A 1K90D 4CFRA 3IF7A 5KSZA 1XK4C 3TUYC 1KWOB 1TNWA 3UO9A 2KFFA 1DELA 2MA2A 1XFWO 2LLUA 2ZKMX 1CKKA 2KAVA 1CMFA 2COLB 3LK1A 2KFHA 3O2PA 3DVEA 1YURA 3GK1A 1C3YA 2QEVA 1SMGA 1L2OB 1NUBA 1XFXO 2O60A 4A4BA 3CLNA 4PHKA 2K60A 2QEHA 2HPSA 3TDUA 3QMEA 3VRPA 1OMDA 1TWOA 1S26D 3EK4A 1DJGA 1MWNA 1S5GZ 2G9BA 2KQ6A 2OTGC 4YGEB 3RM1A 1IJ5A 4IJ7A 1SPYA 2L2EA 3D0YA 1JSAA 2E30A 2QEBA 2VRGA 5J3XA 1H8BA 1CDLA 3FS7A 5ER5A 4FTGA 3O4XA 2JZIA 4M2OA 3DF0A 1SL7A 3DXLA 2ISDA 1FI6A 2JT8A 4PHMA 1KQVA 3JVTB 1DC1A 1X02A 2LC5A 1R6PA 4MVFA 1QIWA 1TCOB 2BE6A 1QV0A 3TS5B 1BOCA 1V1FA 1W7JB 1CNPA 3IVTA 1TUZA 1TNQA 1LVCD 1QASA 2BL0C 1GGZA 1MXLC 1KQMB 2M0RA 3NSKA 4I5KA 4OR9B 4USLA 2F3ZA 3WHTB 3MSEB 3EKJA 1JWDA 3D0YB 1UHKA 4WRIA 1OOGA 3IQOA 1PSRA 1QV1A 2CBLA 5I8NA 2L2CA 1QWVA 2ZN9A 3IQQA 5TNCA 2F2PA 4DUQA 1BG1A 2PVBA 1U5IB 1NYAA 3DF0B 1KFUL 2CXJA 1DJXA 1DJHA 3DY9A 1MHOA 2YGUA 3OGNA 3OBVA 4GGFC 1JC2A 2E6WA 2BBNA 2LVIA 1JF2A 1F55A 3B88A 3VGOA 2K2AA 1J7QA 5HL1A 2BBMA 3R1OA 1QXPA 4CLNA 1M31A 2BL0B 2QACA 3L47A 3PALA 2L0PA 5JOLA 3QRXA 4BY4A 3EK7A 1G4YR 1J55A 1NPQA 2KYFA 2ZN8A 3KHEA 2I18A 4HRHA 4JD9A 1SNLA 2JPOA 4PCWA 1PULA 1YVLA 2Y4QA 3O4YA 2F3YA 2GTEA 1CFFA 1WDCB 1SK6D 4DRWA 3VRQA 2QEOA 5EL2A 3TZ1A 3D73A 3L4AA 1QX7A 1ZACA 2V53A 2JTTA 2PALA 2Q4UA 4OVNF 2NXQA 3B6XA 2RGIA 4L9MA 1DVIA 1R2UA 4KYNA 4NDBA 3V2LA 1QVIY 1OE9B 3BFHA 2KDHA 3AKBA 3Q8IA 4OZDA 4PE0A 1S6IA 1YUUA 4U8DA 1NCZA 1J7OA 5AFPA 1SCMB 1ZFSA 1KFUS 4R1EA 1M63B 2LUXA 1KK8C 2I94A 1TCFA 2KGBC 3BXKA 2JXCA 3R1PA 1WY9A 4QJ3B 2WC8A 3WHUB 3PM8A 2AUCA 1AUIB 2JWWA 3I5HC 1CLBA 1F8HA 5D3OA 2LMUA 5BPJA 3HCMA 2LANA 1A75A 2PSRA 2HQ8A 4GBAA 3I5GC 3LL8B 1Y1XA 1OMRA 2M7NA 2KAYA 1M45A 3FE6A 1DT7B 1AVSA 1YR5A 2KI6D 1FPWA 1SR6B 2JOJA 2MLEC 5ER4X 1YX7A 3BFAA 3R72A 4Q04A 1BF5A 4ZCVA 1C3ZA 1NX1A 1QVIZ 1FI5A 4PT1A 1KK8B 1SW8A 3JTDB 2MLFC 3VRNA 1PRWA 3DD4A 1BU3A 1KSMA 1G33A 1T14A 1UP5A 1Y1UA 2FJYA 2R2IA 1PVBA 2Y1MA 3I5IB 1KK7Y 2GGMA 1JUOA 3TDZA 2Y1NA 1B8RA 2KBIA 2MHHA 1QX5B 4OCIA 1A75B 3B86A 4TNCA 3ICBA 4PE7A 2WCLA 1LINA 1XFYO 1YX8A 2CNPA 2MBXA 1XK4A 4MZLA 1TN4A 2M29A 3S0BA 2PASA 1SYMA 4AQIA 3BUNB 1EL4A 4AOMA 3FE8A 3CR2A 2MRDA 3PLFB 1S1EA 1S6CA 4GNKB 2KBMA 1BR1B 1QS7A 3DVKA 5HKYA 4GAOA 5I2LA 1Y0VH 1XYDA 5FYXA 1LA3A 3VB1A 3K1EA 1HT9A 1DJWA 2JC2A 4MEWA 3A8RA 1CTRA 3CYZA 4PDZA 5CSNA 1EG3A 1KK7Z 2LAPA 1F4OA 3SG4A 1ALWA 3SG5A 1B8LA 3OP0A 5I94A 1RECA 3KEVA 3SJSA 3TUYB 2KHNA 1BT6A 2JT3A 1IGVA 2WCBA 1TNPA 2M1UA 2WCJA 4ZCUA 1AK8A 3SG7A 5B8IB 2KLEA 3O78A 4C0JA 1IKUA 1EXRA 2WOSA 3A4UB 1RTP1 1SL9A 1F54A 2FCDA 2KFGA 3I5FC 1UURA 5HYDA 1K8UA 1XFVO 1NCYA 4P2YB 4NDDA 5DKQA 3NSIA 1JFKA 1GGWA 3NXAA 3OHMB 1U5IA 2M49B 2WCKA 3GOFA 3M0WA 4PE4A 2LMTA 2PMYA 3S0AA 4YRUA 5DKNA 3BUMB 1YTZC 2Y5IA 2TN4A 4YI9A 3NHTA 3CZ2A 1DF0B 1CFCA 1SSEB 4YGCB 4CPVA 1Z4HA 3LLEA 2LM5A 4E68A 2I7AA 1DEKA 2L4IA 2BKIB 1YUSA 2NLNA 2OTGB 3BJHA 1B9AA 1QLSA 2IS9A 4QJ4B 1CM1A 3D75A 3DVJA 4UPGA 5GQQC 1W7IB 2CT9A 1N0YA 2FOTA 2JXLA 2M3WA 4YGBB 5PALA 2LHIA 2JT0A 4I5JA 4BY5A 1OOFA 3S0DA 2K7DA 1WLZA 1RK9A 1ALVA 4GGFA 4WQ2A 4MN0A 2QPTA 4DCKA 1AHRA 2KI4C 1JFJA 4YGAA 4ORCB 5D7FA 1PSBA 2LVJA 4QJ5B 1BLQA 1JBAA 1IG5A 1GQMA 1QX2A 1EG4A 1SY9A 1YRTB 1SKTA 2EC6C 1V1GA 3CZ1A 1DJZA 1EH2A 1IWQA 2KYCA 1QJTA 1J1DA 1HQVA 3CWGA 1TOPA 1UHHA 3OX5A 4ORAB 1C7WA 1MUXA 3BYAA 1RFJA 2WCHA 1EJ3A 3CR5X 2O5GA 5DICA 5CSFA 3DYEA 5KU1A 4DS7A 2LP2A 3K21A 1KSOA 3BQ3A 4MLWA 2D8NA 2HQWA 2ZRTA 4GGNA 3NHIA 2AAOA 1AP4A 2KLDA 1SL8A 2WCMA 4JPZB 1AJ5A 2BCXA 4XJKB 1DJIA 4MSPA 1N2DA 1D1OA 1WLMA 1J7PA 1UUSA 2JRFA 4YI8A 3RLZA 2FJUB 4JWQA 1IQ3A 4INXA 4MZJA 1UWOA 1C7VA 3CZTX 3NGVA 2M1KB 3D10A 2BCBA 3F45A 1NX2A 3E3RA 2LHLA 4MZKA 4N5XA 4OKHA 5CSJA 3VRRA 2B1UA 2OS8C 1QLKA 3FIAA 2LV7A 1J1EA 5HLOA 3D74A 1ZMZA 1BODA 2OPOA 3KO0A 2P6BB 1DTLA 1LKJA 1VRKA 1YVHA 1B7TY 1ORGA 1UHJA 2JNFA 1W9ZA 2WC5A 3CTNA 4PALA 1CDNA 1UHIA 2I2RE 2A4JA 2K2FA 1TUJA 3BUOB 1F71A 1NX3A 3D77A 4AQJA 2LVKA 2JPTA 4PE1A 2SASA 3SIBA 1SCVA 3AAJA 2LLSA 3BUXB 3I5HB 3PJIA 1K93D 3CGAA 5D69A 1H4BA 2WC6A 2KOTA 2KNEA 5KTYA 3I5GB 1B8CA 2OS8B 2LP3A 4INWA 2M7LA 4F7FA 5JJGA 5AXIA 1P28A 2ZNDA 4CIDA 1B4CA 1IIOA 1KWOC 1S36A 3BOWB 4JQ0D 2G2BA 3D76A 3LCPC 1PALA 2BAPA 1K9PA 2K61A 2PQLA 3CDNA 2PYQA 4ICBA 4HRGA 3R1VA 3WXAA 1B7TZ 3CS1A 3D78A 3B87A 3DZTA 1XO5A 1QATA 3PFVA
chains in the Genus database with same CATH topology
3C1VA 1DGVA 1CM4A 1OQPA 4M2PA 1Y1AA 2BECA 4PHJA 4YBHB 1IJ6A 1NIWA 2H61C 2GGZA 4OV2A 1L2OC 1N65A 4M2QA 4IL1A 1M39A 1S5GY 1G8IA 2KAXA 2F8PA 1DF0A 3AAKA 3SG6A 3PN7C 2BE4A 2PRUA 4GFTA 1TNXA 1CDMA 5CPVA 2NCOA 2BKHB 2KQYA 1FBVA 2GV5A 2LVVA 3WNXB 2JQ6A 1CDPA 1WRZA 1IRJA 1CB1A 2KI6C 4WQ3A 1TRFA 1J7RA 1RROA 2F2OA 3GK2A 4C0LA 5IBWA 3KF9A 1NP8A 2EHBA 5F6TA 3EK8A 1DMOA 1MXEA 2HF5A 3JVTC 3SIAA 2M97A 4D1EA 5G08A 3HX4A 3NSLA 2JTZA 1IQ5A 2WCEA 5AERA 3TS5C 1SRAA 3PN7B 5AANA 1LA0A 2LLTA 4DIRA 1QIVA 1KQMC 1K9KA 3CR4X 2K7CA 1CMGA 2L50A 1BMOA 1CFPA 3AKAA 2JU0A 2CCMA 3I5FB 2AMIA 2JULA 2EGDA 5HKWA 4GUKA 1MQ1A 3OB1B 1C07A 1GJYA 1LXFC 4PHNA 4FQOA 4ORBB 5K89A 3PSRA 1Y6WA 1WRLA 1S3PA 1ODBA 3FWBA 1RWYA 2NZ0A 3GK4X 1B47A 4XYNA 4I5LB 4XJKA 1UHNA 4I5NB 1MF8B 2WCFA 4NQGA 5DKRA 4CFQA 1NX0A 2JNXA 1ZUZA 4HSZA 5I2QA 2NCPA 4YGDB 1WDCC 3BUWB 1A03A 2CTNA 1AJ4A 2ZRSA 2KSPA 4NDCA 3EVRA 3OB2B 1K94A 5AEQA 1QTXA 2KI4B 1A29A 1KFXL 3NSOA 2LCPA 4MRXA 1DGUA 2K7OA 4MRYA 2EC6B 4ETOA 2KGRA 1CLLA 1SCMC 2FCEA 5HLVA 1NSHA 1L7ZA 1YUTA 5CSIA 2L51A 1XVJA 5HKZA 3LK0A 4MBEA 1FW4A 1K96A 2F33A 1E8AA 1PK0D 1FF1A 4HREE 2Q91A 1OZSA 1BJFA 4GPLB 1PVAA 1Q80A 2LMVA 1SBJA 2K0JA 2SCPA 1F4QA 3ZWHA 3TDIA 1OOJA 3BOWA 1SR6C 2WNDA 1KCYA 2M8UA 3FWCA 1XFUO 1IH0A 1CFDA 3VROA 1OMVA 3JTDC 1F70A 3DVMA 4N1GA 2H2KA 1YRUB 4P5OE 1K95A 1KFXS 3KPXA 3I5IC 1K2HA 1NWDA 2LUCA 3EVUA 1NCXA 1XA5A 3ZNIA 2WORA 2L5XB 2ZNEA 3H4SE 1K9UA 3SG3A 1WRKA 2L4HA 1BR4B 1XFZO 1B1GA 2L98A 3EVVA 2LNKA 4N1FA 4C0KA 3O6BA 1TIZA 1RJVA 3EKHA 3OX6A 2ZFDA 2HETA 1OSAA 2LE9B 1TTXA 3PATA 1ZOTB 1M46A 2M9GA 2K7BA 2DOQA 3SG2A 1OZOA 2K8MB 4F0ZB 1DJYA 1S6JA 2MJWB 2H61A 2MAZA 1MR8A 2BCAA 1CLMA 1A2XA 4A4CA 1A4PA 5I2OA 1JF0A 1K90D 4CFRA 3IF7A 5KSZA 1XK4C 3TUYC 1KWOB 1TNWA 2KFFA 2MA2A 1XFWO 2LLUA 2ZKMX 1CKKA 2KAVA 2COLB 3LK1A 2KFHA 3O2PA 3DVEA 1YURA 3GK1A 1SMGA 1L2OB 1NUBA 1XFXO 2O60A 4A4BA 3CLNA 4PHKA 2HPSA 3TDUA 3VRPA 1OMDA 1S26D 3EK4A 1DJGA 1MWNA 1S5GZ 2G9BA 2KQ6A 2OTGC 4YGEB 3RM1A 1IJ5A 1SPYA 2L2EA 3D0YA 1JSAA 2E30A 2VRGA 5J3XA 1H8BA 1CDLA 3FS7A 5ER5A 4FTGA 2JZIA 4M2OA 3DF0A 1SL7A 2ISDA 1FI6A 2JT8A 4PHMA 1KQVA 3JVTB 1X02A 2LC5A 1R6PA 4MVFA 1QIWA 2BE6A 1TCOB 1QV0A 3TS5B 1BOCA 1V1FA 1W7JB 1CNPA 1JFJA 1TNQA 1LVCD 1QASA 2BL0C 1GGZA 1MXLC 1KQMB 2M0RA 3NSKA 4I5KA 4OR9B 4USLA 2F3ZA 3WHTB 3MSEB 3EKJA 1JWDA 3D0YB 1UHKA 4WRIA 3IQOA 1PSRA 2CBLA 1QV1A 5I8NA 2ZN9A 3IQQA 5TNCA 4DUQA 2F2PA 1BG1A 2PVBA 1U5IB 1NYAA 3DF0B 1KFUL 2CXJA 1DJXA 1DJHA 1MHOA 1JC2A 4GGFC 2E6WA 2BBNA 2LVIA 1JF2A 1F55A 3VGOA 2K2AA 1J7QA 2BBMA 1QXPA 4CLNA 1M31A 2BL0B 2QACA 5JOLA 3PALA 2L0PA 4BY4A 3QRXA 3EK7A 1G4YR 1J55A 1NPQA 2KYFA 2ZN8A 3KHEA 2I18A 4HRHA 4PCWA 1SNLA 1PULA 1YVLA 2Y4QA 3O4YA 2F3YA 1CFFA 1WDCB 1SK6D 4DRWA 3VRQA 3TZ1A 1QX7A 1ZACA 2V53A 2JTTA 2PALA 2Q4UA 4OVNF 2NXQA 2RGIA 4L9MA 1DVIA 1R2UA 4NDBA 1QVIY 1OE9B 2KDHA 3AKBA 4PE0A 1S6IA 1YUUA 4U8DA 1NCZA 1J7OA 5AFPA 1SCMB 1ZFSA 1KFUS 4R1EA 1M63B 2LUXA 1KK8C 2I94A 1TCFA 2KGBC 3BXKA 2JXCA 4QJ3B 1WY9A 2WC8A 3WHUB 3PM8A 2AUCA 1AUIB 2JWWA 3I5HC 1CLBA 1F8HA 2LMUA 5BPJA 3HCMA 2LANA 1A75A 2PSRA 2HQ8A 4GBAA 3I5GC 3LL8B 1Y1XA 1OMRA 2M7NA 2KAYA 1M45A 1AVSA 1YR5A 2KI6D 1FPWA 1SR6B 2JOJA 2MLEC 5ER4X 1YX7A 1BF5A 4Q04A 4ZCVA 1NX1A 1QVIZ 1FI5A 1KK8B 1SW8A 3JTDB 2MLFC 3VRNA 1PRWA 3DD4A 1BU3A 1KSMA 1G33A 1Y1UA 1UP5A 2R2IA 2Y1MA 1PVBA 3I5IB 1KK7Y 2GGMA 1JUOA 3TDZA 2Y1NA 1B8RA 2KBIA 2MHHA 1QX5B 4OCIA 1A75B 4TNCA 3ICBA 4PE7A 1LINA 1XFYO 1YX8A 2CNPA 2MBXA 1XK4A 4MZLA 1TN4A 2M29A 2PASA 1SYMA 4AQIA 3BUNB 1EL4A 4AOMA 3CR2A 2MRDA 3PLFB 1S1EA 1S6CA 4GNKB 2KBMA 1BR1B 1QS7A 3DVKA 5HKYA 4GAOA 5I2LA 1Y0VH 1XYDA 5FYXA 1LA3A 1HT9A 1DJWA 2JC2A 4MEWA 3A8RA 1CTRA 4PDZA 5CSNA 1EG3A 1KK7Z 2LAPA 1F4OA 3SG4A 1ALWA 3SG5A 1B8LA 3OP0A 1RECA 3KEVA 3SJSA 3TUYB 2KHNA 1BT6A 2JT3A 1IGVA 2WCBA 1TNPA 2M1UA 4ZCUA 1AK8A 3SG7A 5B8IB 1IKUA 3O78A 4C0JA 1EXRA 2WOSA 3A4UB 1RTP1 1SL9A 1F54A 2FCDA 2KFGA 3I5FC 1UURA 5HYDA 1K8UA 1XFVO 1NCYA 4P2YB 4NDDA 5DKQA 3NSIA 1JFKA 1GGWA 3NXAA 3OHMB 1U5IA 2M49B 3GOFA 3M0WA 4PE4A 2LMTA 2PMYA 4YRUA 5DKNA 3BUMB 1YTZC 2Y5IA 2TN4A 4YI9A 1DF0B 1CFCA 4YGCB 4CPVA 3LLEA 2LM5A 4E68A 2I7AA 2L4IA 2NLNA 2BKIB 1YUSA 2OTGB 1CMFA 1B9AA 1QLSA 2IS9A 4QJ4B 1CM1A 3DVJA 4UPGA 5GQQC 1W7IB 2CT9A 1N0YA 2FOTA 2JXLA 2M3WA 4YGBB 5PALA 2LHIA 2JT0A 4I5JA 4BY5A 2K7DA 1WLZA 1RK9A 1ALVA 4GGFA 4WQ2A 4MN0A 2QPTA 4DCKA 1AHRA 2KI4C 4YGAA 4ORCB 5D7FA 1PSBA 2LVJA 4QJ5B 1BLQA 1JBAA 1IG5A 1GQMA 1QX2A 1EG4A 1SY9A 1YRTB 1SKTA 2EC6C 1V1GA 1DJZA 1EH2A 1IWQA 2KYCA 1QJTA 1J1DA 1HQVA 3CWGA 1TOPA 1UHHA 3OX5A 4ORAB 1C7WA 1MUXA 3BYAA 1RFJA 1EJ3A 3CR5X 2O5GA 5CSFA 5KU1A 4DS7A 2LP2A 3K21A 1KSOA 3BQ3A 4MLWA 2D8NA 2HQWA 2ZRTA 4GGNA 2AAOA 1AP4A 1SL8A 4JPZB 1AJ5A 2BCXA 4XJKB 1DJIA 4MSPA 1N2DA 1D1OA 1WLMA 1J7PA 1UUSA 2JRFA 4YI8A 3RLZA 2FJUB 4JWQA 1IQ3A 4MZJA 1UWOA 1C7VA 3CZTX 2M1KB 3D10A 2BCBA 3F45A 1NX2A 3E3RA 2LHLA 4MZKA 4N5XA 4OKHA 5CSJA 3VRRA 2B1UA 2OS8C 1QLKA 3FIAA 2LV7A 1J1EA 5HLOA 1BODA 1ZMZA 2OPOA 3KO0A 2P6BB 1DTLA 1LKJA 1UHJA 1YVHA 1B7TY 1VRKA 2JNFA 1DT7B 1CDNA 3CTNA 4PALA 1UHIA 2I2RE 2A4JA 2K2FA 3BUOB 1F71A 1NX3A 4AQJA 2LVKA 2JPTA 4PE1A 2SASA 3SIBA 1SCVA 3AAJA 2LLSA 3I5HB 5D69A 1K93D 3CGAA 1H4BA 2KOTA 2KNEA 5KTYA 3I5GB 1B8CA 2OS8B 2LP3A 2M7LA 5JJGA 5AXIA 4CIDA 2ZNDA 1B4CA 1KWOC 1S36A 3BOWB 4JQ0D 2G2BA 3LCPC 1PALA 1K9PA 2K61A 4ICBA 4HRGA 3WXAA 1B7TZ 3CS1A 3BUXB 1XO5A 1QATA 3PFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1V A;  1DGV A;  1CM4 A;  1OQP A;  4M2P A;  1Y1A A;  2BEC A;  4PHJ A;  4YBH B;  1IJ6 A;  1NIW A;  2H61 C;  2GGZ A;  4OV2 A;  1L2O C;  1N65 A;  4M2Q A;  4IL1 A;  1M39 A;  1S5G Y;  1G8I A;  2KAX A;  2F8P A;  1DF0 A;  3AAK A;  3SG6 A;  3PN7 C;  2BE4 A;  2PRU A;  4GFT A;  1TNX A;  1CDM A;  5CPV A;  2NCO A;  2BKH B;  2KQY A;  1FBV A;  2GV5 A;  2LVV A;  3WNX B;  2JQ6 A;  1CDP A;  1WRZ A;  1IRJ A;  1CB1 A;  2KI6 C;  4WQ3 A;  1TRF A;  1J7R A;  1RRO A;  2F2O A;  3GK2 A;  4C0L A;  5IBW A;  3KF9 A;  1NP8 A;  2EHB A;  5F6T A;  3EK8 A;  1DMO A;  1MXE A;  2HF5 A;  3JVT C;  3SIA A;  2M97 A;  4D1E A;  5G08 A;  3HX4 A;  3NSL A;  2JTZ A;  1IQ5 A;  2WCE A;  5AER A;  3TS5 C;  1SRA A;  3PN7 B;  5AAN A;  1LA0 A;  2LLT A;  4DIR A;  1QIV A;  1KQM C;  1K9K A;  3CR4 X;  2K7C A;  1CMG A;  2L50 A;  1BMO A;  1CFP A;  3AKA A;  2JU0 A;  2CCM A;  3I5F B;  2AMI A;  2JUL A;  2EGD A;  5HKW A;  4GUK A;  1MQ1 A;  3OB1 B;  1C07 A;  1GJY A;  1LXF C;  4PHN A;  4FQO A;  4ORB B;  5K89 A;  3PSR A;  1Y6W A;  1WRL A;  1S3P A;  1ODB A;  3FWB A;  1RWY A;  2NZ0 A;  3GK4 X;  1B47 A;  4XYN A;  4I5L B;  4XJK A;  1UHN A;  4I5N B;  1MF8 B;  2WCF A;  4NQG A;  5DKR A;  4CFQ A;  1NX0 A;  2JNX A;  1ZUZ A;  4HSZ A;  5I2Q A;  2NCP A;  4YGD B;  1WDC C;  3BUW B;  1A03 A;  2CTN A;  1AJ4 A;  2ZRS A;  2KSP A;  4NDC A;  3EVR A;  3OB2 B;  1K94 A;  5AEQ A;  1QTX A;  2KI4 B;  1A29 A;  1KFX L;  3NSO A;  2LCP A;  4MRX A;  1DGU A;  2K7O A;  4MRY A;  2EC6 B;  4ETO A;  2KGR A;  1CLL A;  1SCM C;  2FCE A;  5HLV A;  1NSH A;  1L7Z A;  1YUT A;  5CSI A;  2L51 A;  1XVJ A;  5HKZ A;  3LK0 A;  4MBE A;  1FW4 A;  1K96 A;  2F33 A;  1E8A A;  1PK0 D;  1FF1 A;  4HRE E;  2Q91 A;  1OZS A;  1BJF A;  4GPL B;  1PVA A;  1Q80 A;  2LMV A;  1SBJ A;  2K0J A;  2SCP A;  1F4Q A;  3ZWH A;  3TDI A;  1OOJ A;  3BOW A;  1SR6 C;  2WND A;  1KCY A;  2M8U A;  3FWC A;  1XFU O;  1IH0 A;  1CFD A;  3VRO A;  1OMV A;  3JTD C;  1F70 A;  3DVM A;  4N1G A;  2H2K A;  1YRU B;  4P5O E;  1K95 A;  1KFX S;  3KPX A;  3I5I C;  1K2H A;  1NWD A;  2LUC A;  3EVU A;  1NCX A;  1XA5 A;  3ZNI A;  2WOR A;  2L5X B;  2ZNE A;  3H4S E;  1K9U A;  3SG3 A;  1WRK A;  2L4H A;  1BR4 B;  1XFZ O;  1B1G A;  2L98 A;  3EVV A;  2LNK A;  4N1F A;  4C0K A;  3O6B A;  1TIZ A;  1RJV A;  3EKH A;  3OX6 A;  2ZFD A;  2HET A;  1OSA A;  2LE9 B;  1TTX A;  3PAT A;  1ZOT B;  1M46 A;  2M9G A;  2K7B A;  2DOQ A;  3SG2 A;  1OZO A;  2K8M B;  4F0Z B;  1DJY A;  1S6J A;  2MJW B;  2H61 A;  2MAZ A;  1MR8 A;  2BCA A;  1CLM A;  1A2X A;  4A4C A;  1A4P A;  5I2O A;  1JF0 A;  1K90 D;  4CFR A;  3IF7 A;  5KSZ A;  1XK4 C;  3TUY C;  1KWO B;  1TNW A;  2KFF A;  2MA2 A;  1XFW O;  2LLU A;  2ZKM X;  1CKK A;  2KAV A;  2COL B;  3LK1 A;  2KFH A;  3O2P A;  3DVE A;  1YUR A;  3GK1 A;  1SMG A;  1L2O B;  1NUB A;  1XFX O;  2O60 A;  4A4B A;  3CLN A;  4PHK A;  2HPS A;  3TDU A;  3VRP A;  1OMD A;  1S26 D;  3EK4 A;  1DJG A;  1MWN A;  1S5G Z;  2G9B A;  2KQ6 A;  2OTG C;  4YGE B;  3RM1 A;  1IJ5 A;  1SPY A;  2L2E A;  3D0Y A;  1JSA A;  2E30 A;  2VRG A;  5J3X A;  1H8B A;  1CDL A;  3FS7 A;  5ER5 A;  4FTG A;  2JZI A;  4M2O A;  3DF0 A;  1SL7 A;  2ISD A;  1FI6 A;  2JT8 A;  4PHM A;  1KQV A;  3JVT B;  1X02 A;  2LC5 A;  1R6P A;  4MVF A;  1QIW A;  2BE6 A;  1TCO B;  1QV0 A;  3TS5 B;  1BOC A;  1V1F A;  1W7J B;  1CNP A;  1JFJ A;  1TNQ A;  1LVC D;  1QAS A;  2BL0 C;  1GGZ A;  1MXL C;  1KQM B;  2M0R A;  3NSK A;  4I5K A;  4OR9 B;  4USL A;  2F3Z A;  3WHT B;  3MSE B;  3EKJ A;  1JWD A;  3D0Y B;  1UHK A;  4WRI A;  3IQO A;  1PSR A;  2CBL A;  1QV1 A;  5I8N A;  2ZN9 A;  3IQQ A;  5TNC A;  4DUQ A;  2F2P A;  1BG1 A;  2PVB A;  1U5I B;  1NYA A;  3DF0 B;  1KFU L;  2CXJ A;  1DJX A;  1DJH A;  1MHO A;  1JC2 A;  4GGF C;  2E6W A;  2BBN A;  2LVI A;  1JF2 A;  1F55 A;  3VGO A;  2K2A A;  1J7Q A;  2BBM A;  1QXP A;  4CLN A;  1M31 A;  2BL0 B;  2QAC A;  5JOL A;  3PAL A;  2L0P A;  4BY4 A;  3QRX A;  3EK7 A;  1G4Y R;  1J55 A;  1NPQ A;  2KYF A;  2ZN8 A;  3KHE A;  2I18 A;  4HRH A;  4PCW A;  1SNL A;  1PUL A;  1YVL A;  2Y4Q A;  3O4Y A;  2F3Y A;  1CFF A;  1WDC B;  1SK6 D;  4DRW A;  3VRQ A;  3TZ1 A;  1QX7 A;  1ZAC A;  2V53 A;  2JTT A;  2PAL A;  2Q4U A;  4OVN F;  2NXQ A;  2RGI A;  4L9M A;  1DVI A;  1R2U A;  4NDB A;  1QVI Y;  1OE9 B;  2KDH A;  3AKB A;  4PE0 A;  1S6I A;  1YUU A;  4U8D A;  1NCZ A;  1J7O A;  5AFP A;  1SCM B;  1ZFS A;  1KFU S;  4R1E A;  1M63 B;  2LUX A;  1KK8 C;  2I94 A;  1TCF A;  2KGB C;  3BXK A;  2JXC A;  4QJ3 B;  1WY9 A;  2WC8 A;  3WHU B;  3PM8 A;  2AUC A;  1AUI B;  2JWW A;  3I5H C;  1CLB A;  1F8H A;  2LMU A;  5BPJ A;  3HCM A;  2LAN A;  1A75 A;  2PSR A;  2HQ8 A;  4GBA A;  3I5G C;  3LL8 B;  1Y1X A;  1OMR A;  2M7N A;  2KAY A;  1M45 A;  1AVS A;  1YR5 A;  2KI6 D;  1FPW A;  1SR6 B;  2JOJ A;  2MLE C;  5ER4 X;  1YX7 A;  1BF5 A;  4Q04 A;  4ZCV A;  1NX1 A;  1QVI Z;  1FI5 A;  1KK8 B;  1SW8 A;  3JTD B;  2MLF C;  3VRN A;  1PRW A;  3DD4 A;  1BU3 A;  1KSM A;  1G33 A;  1Y1U A;  1UP5 A;  2R2I A;  2Y1M A;  1PVB A;  3I5I B;  1KK7 Y;  2GGM A;  1JUO A;  3TDZ A;  2Y1N A;  1B8R A;  2KBI A;  2MHH A;  1QX5 B;  4OCI A;  1A75 B;  4TNC A;  3ICB A;  4PE7 A;  1LIN A;  1XFY O;  1YX8 A;  2CNP A;  2MBX A;  1XK4 A;  4MZL A;  1TN4 A;  2M29 A;  2PAS A;  1SYM A;  4AQI A;  3BUN B;  1EL4 A;  4AOM A;  3CR2 A;  2MRD A;  3PLF B;  1S1E A;  1S6C A;  4GNK B;  2KBM A;  1BR1 B;  1QS7 A;  3DVK A;  5HKY A;  4GAO A;  5I2L A;  1Y0V H;  1XYD A;  5FYX A;  1LA3 A;  1HT9 A;  1DJW A;  2JC2 A;  4MEW A;  3A8R A;  1CTR A;  4PDZ A;  5CSN A;  1EG3 A;  1KK7 Z;  2LAP A;  1F4O A;  3SG4 A;  1ALW A;  3SG5 A;  1B8L A;  3OP0 A;  1REC A;  3KEV A;  3SJS A;  3TUY B;  2KHN A;  1BT6 A;  2JT3 A;  1IGV A;  2WCB A;  1TNP A;  2M1U A;  4ZCU A;  1AK8 A;  3SG7 A;  5B8I B;  1IKU A;  3O78 A;  4C0J A;  1EXR A;  2WOS A;  3A4U B;  1RTP 1;  1SL9 A;  1F54 A;  2FCD A;  2KFG A;  3I5F C;  1UUR A;  5HYD A;  1K8U A;  1XFV O;  1NCY A;  4P2Y B;  4NDD A;  5DKQ A;  3NSI A;  1JFK A;  1GGW A;  3NXA A;  3OHM B;  1U5I A;  2M49 B;  3GOF A;  3M0W A;  4PE4 A;  2LMT A;  2PMY A;  4YRU A;  5DKN A;  3BUM B;  1YTZ C;  2Y5I A;  2TN4 A;  4YI9 A;  1DF0 B;  1CFC A;  4YGC B;  4CPV A;  3LLE A;  2LM5 A;  4E68 A;  2I7A A;  2L4I A;  2NLN A;  2BKI B;  1YUS A;  2OTG B;  1CMF A;  1B9A A;  1QLS A;  2IS9 A;  4QJ4 B;  1CM1 A;  3DVJ A;  4UPG A;  5GQQ C;  1W7I B;  2CT9 A;  1N0Y A;  2FOT A;  2JXL A;  2M3W A;  4YGB B;  5PAL A;  2LHI A;  2JT0 A;  4I5J A;  4BY5 A;  2K7D A;  1WLZ A;  1RK9 A;  1ALV A;  4GGF A;  4WQ2 A;  4MN0 A;  2QPT A;  4DCK A;  1AHR A;  2KI4 C;  4YGA A;  4ORC B;  5D7F A;  1PSB A;  2LVJ A;  4QJ5 B;  1BLQ A;  1JBA A;  1IG5 A;  1GQM A;  1QX2 A;  1EG4 A;  1SY9 A;  1YRT B;  1SKT A;  2EC6 C;  1V1G A;  1DJZ A;  1EH2 A;  1IWQ A;  2KYC A;  1QJT A;  1J1D A;  1HQV A;  3CWG A;  1TOP A;  1UHH A;  3OX5 A;  4ORA B;  1C7W A;  1MUX A;  3BYA A;  1RFJ A;  1EJ3 A;  3CR5 X;  2O5G A;  5CSF A;  5KU1 A;  4DS7 A;  2LP2 A;  3K21 A;  1KSO A;  3BQ3 A;  4MLW A;  2D8N A;  2HQW A;  2ZRT A;  4GGN A;  2AAO A;  1AP4 A;  1SL8 A;  4JPZ B;  1AJ5 A;  2BCX A;  4XJK B;  1DJI A;  4MSP A;  1N2D A;  1D1O A;  1WLM A;  1J7P A;  1UUS A;  2JRF A;  4YI8 A;  3RLZ A;  2FJU B;  4JWQ A;  1IQ3 A;  4MZJ A;  1UWO A;  1C7V A;  3CZT X;  2M1K B;  3D10 A;  2BCB A;  3F45 A;  1NX2 A;  3E3R A;  2LHL A;  4MZK A;  4N5X A;  4OKH A;  5CSJ A;  3VRR A;  2B1U A;  2OS8 C;  1QLK A;  3FIA A;  2LV7 A;  1J1E A;  5HLO A;  1BOD A;  1ZMZ A;  2OPO A;  3KO0 A;  2P6B B;  1DTL A;  1LKJ A;  1UHJ A;  1YVH A;  1B7T Y;  1VRK A;  2JNF A;  1DT7 B;  1CDN A;  3CTN A;  4PAL A;  1UHI A;  2I2R E;  2A4J A;  2K2F A;  3BUO B;  1F71 A;  1NX3 A;  4AQJ A;  2LVK A;  2JPT A;  4PE1 A;  2SAS A;  3SIB A;  1SCV A;  3AAJ A;  2LLS A;  3I5H B;  5D69 A;  1K93 D;  3CGA A;  1H4B A;  2KOT A;  2KNE A;  5KTY A;  3I5G B;  1B8C A;  2OS8 B;  2LP3 A;  2M7L A;  5JJG A;  5AXI A;  4CID A;  2ZND A;  1B4C A;  1KWO C;  1S36 A;  3BOW B;  4JQ0 D;  2G2B A;  3LCP C;  1PAL A;  1K9P A;  2K61 A;  4ICB A;  4HRG A;  3WXA A;  1B7T Z;  3CS1 A;  3BUX B;  1XO5 A;  1QAT A;  3PFV A; 
#chains in the Genus database with same CATH topology
 3C1V A;  1DGV A;  5FI6 A;  1CM4 A;  1OQP A;  4M2P A;  1Y1A A;  2BEC A;  4PHJ A;  4YBH B;  1IJ6 A;  1NIW A;  3N7H A;  2H61 C;  2GGZ A;  3PM2 A;  4OV2 A;  1L2O C;  1N65 A;  4M2Q A;  4IL1 A;  1M39 A;  5FI7 A;  1S5G Y;  1G8I A;  2KAX A;  2F8P A;  1DF0 A;  3AAK A;  3SG6 A;  3PN7 C;  2BE4 A;  2PRU A;  4GFT A;  1TNX A;  1CDM A;  5CPV A;  2NCO A;  2BKH B;  2KQY A;  1FBV A;  2GV5 A;  2LVV A;  3WNX B;  2JQ6 A;  1CDP A;  1WRZ A;  1IRJ A;  1CB1 A;  2KI6 C;  4WQ3 A;  1TRF A;  1J7R A;  1RRO A;  2F2O A;  3GK2 A;  4C0L A;  5IBW A;  3KF9 A;  1NP8 A;  2EHB A;  5F6T A;  3EK8 A;  1DMO A;  1MXE A;  2HF5 A;  3JVT C;  3SIA A;  2M97 A;  3S0E A;  5G08 A;  4D1E A;  3HX4 A;  3NSL A;  2JTZ A;  1IQ5 A;  2WCE A;  3SS5 A;  5AER A;  3TS5 C;  1SRA A;  1GM0 A;  1LS8 A;  3PN7 B;  5AAN A;  1LA0 A;  2LLT A;  4DIR A;  1QIV A;  1KQM C;  3BFB A;  1K9K A;  3CR4 X;  2K7C A;  1CMG A;  2L50 A;  1BMO A;  1CFP A;  3AKA A;  2JU0 A;  2CCM A;  3FE9 A;  3I5F B;  2AMI A;  2JUL A;  2EGD A;  5HKW A;  4GUK A;  5FI2 A;  1MQ1 A;  3OB1 B;  3B7A A;  1C07 A;  1GJY A;  1LXF C;  4PHN A;  4FQO A;  4ORB B;  5K89 A;  3PSR A;  1Y6W A;  1WRL A;  1S3P A;  1ODB A;  1OW4 A;  3FWB A;  1RWY A;  2NZ0 A;  3GK4 X;  1B47 A;  4XYN A;  4I5L B;  4XJK A;  1UHN A;  4I5N B;  1MF8 B;  2WCF A;  3L4L A;  2ERB A;  1XFR A;  4NQG A;  5DKR A;  4CFQ A;  1NX0 A;  2JNX A;  1ZUZ A;  4HSZ A;  5I2Q A;  2NCP A;  4YGD B;  1WDC C;  3BUW B;  1A03 A;  2CTN A;  1AJ4 A;  2H8V A;  2QDI A;  1Z2C B;  2ZRS A;  2KSP A;  4NDC A;  3EVR A;  3OB2 B;  1K94 A;  5AEQ A;  1QTX A;  2KI4 B;  1A29 A;  1KFX L;  3CZ0 A;  3EG5 B;  3NSO A;  2LCP A;  4MRX A;  1DGU A;  2K7O A;  3CAB A;  2P71 A;  4MRY A;  2EC6 B;  4ETO A;  2KGR A;  1CLL A;  1SCM C;  2FCE A;  5HLV A;  1YUT A;  1NSH A;  1L7Z A;  1OOI X;  5CSI A;  2L51 A;  1XVJ A;  5HKZ A;  3LK0 A;  4MBE A;  1FW4 A;  1K96 A;  2F33 A;  1E8A A;  1PK0 D;  1FF1 A;  4HRE E;  2Q91 A;  1OZS A;  1BJF A;  2P70 A;  4GPL B;  1PVA A;  1Q80 A;  2LMV A;  1SBJ A;  2K0J A;  2SCP A;  3UNW A;  1F4Q A;  3ZWH A;  3TDI A;  1OOJ A;  3BOW A;  1SR6 C;  2WND A;  1KCY A;  2M8U A;  3FWC A;  1XFU O;  1IH0 A;  4JKT A;  1CFD A;  3VRO A;  1OMV A;  3JTD C;  1F70 A;  3DVM A;  4N1G A;  2H2K A;  3SS3 A;  1DQE A;  1YRU B;  1K95 A;  4P5O E;  1KFX S;  3KPX A;  3I5I C;  1K2H A;  1NWD A;  2LUC A;  3EVU A;  1NCX A;  1XA5 A;  3SS4 A;  3ZNI A;  2WOR A;  2L5X B;  2ZNE A;  3H4S E;  1K9U A;  3SG3 A;  1WRK A;  2KPH A;  2L4H A;  1BR4 B;  1XFZ O;  1B1G A;  2L98 A;  3EVV A;  2LNK A;  4N1F A;  4C0K A;  3O6B A;  1TIZ A;  1RJV A;  2L5Y A;  3EKH A;  4FQT A;  3OX6 A;  2ZFD A;  2HET A;  1OSA A;  2LE9 B;  1TTX A;  3PAT A;  3S0G A;  1ZOT B;  1M46 A;  2M9G A;  2K7B A;  2DOQ A;  3SG2 A;  3S0F A;  1OZO A;  1OOH A;  2K8M B;  4F0Z B;  1DJY A;  1S6J A;  2MJW B;  2BNX A;  2H61 A;  2MAZ A;  1MR8 A;  2BCA A;  1CLM A;  1A2X A;  4A4C A;  3RZS A;  1A4P A;  5I2O A;  1JF0 A;  1K90 D;  4CFR A;  3IF7 A;  5KSZ A;  1XK4 C;  3TUY C;  1KWO B;  1TNW A;  3UO9 A;  2KFF A;  1DEL A;  2MA2 A;  1XFW O;  2LLU A;  2ZKM X;  1CKK A;  2KAV A;  1CMF A;  2COL B;  3LK1 A;  2KFH A;  3O2P A;  3DVE A;  1YUR A;  3GK1 A;  1C3Y A;  2QEV A;  1SMG A;  1L2O B;  1NUB A;  1XFX O;  2O60 A;  4A4B A;  3CLN A;  4PHK A;  2K60 A;  2QEH A;  2HPS A;  3TDU A;  3QME A;  3VRP A;  1OMD A;  1TWO A;  1S26 D;  3EK4 A;  1DJG A;  1MWN A;  1S5G Z;  2G9B A;  2KQ6 A;  2OTG C;  4YGE B;  3RM1 A;  1IJ5 A;  4IJ7 A;  1SPY A;  2L2E A;  3D0Y A;  1JSA A;  2E30 A;  2QEB A;  2VRG A;  5J3X A;  1H8B A;  1CDL A;  3FS7 A;  5ER5 A;  4FTG A;  3O4X A;  2JZI A;  4M2O A;  3DF0 A;  1SL7 A;  3DXL A;  2ISD A;  1FI6 A;  2JT8 A;  4PHM A;  1KQV A;  3JVT B;  1DC1 A;  1X02 A;  2LC5 A;  1R6P A;  4MVF A;  1QIW A;  1TCO B;  2BE6 A;  1QV0 A;  3TS5 B;  1BOC A;  1V1F A;  1W7J B;  1CNP A;  3IVT A;  1TUZ A;  1TNQ A;  1LVC D;  1QAS A;  2BL0 C;  1GGZ A;  1MXL C;  1KQM B;  2M0R A;  3NSK A;  4I5K A;  4OR9 B;  4USL A;  2F3Z A;  3WHT B;  3MSE B;  3EKJ A;  1JWD A;  3D0Y B;  1UHK A;  4WRI A;  1OOG A;  3IQO A;  1PSR A;  1QV1 A;  2CBL A;  5I8N A;  2L2C A;  1QWV A;  2ZN9 A;  3IQQ A;  5TNC A;  2F2P A;  4DUQ A;  1BG1 A;  2PVB A;  1U5I B;  1NYA A;  3DF0 B;  1KFU L;  2CXJ A;  1DJX A;  1DJH A;  3DY9 A;  1MHO A;  2YGU A;  3OGN A;  3OBV A;  4GGF C;  1JC2 A;  2E6W A;  2BBN A;  2LVI A;  1JF2 A;  1F55 A;  3B88 A;  3VGO A;  2K2A A;  1J7Q A;  5HL1 A;  2BBM A;  3R1O A;  1QXP A;  4CLN A;  1M31 A;  2BL0 B;  2QAC A;  3L47 A;  3PAL A;  2L0P A;  5JOL A;  3QRX A;  4BY4 A;  3EK7 A;  1G4Y R;  1J55 A;  1NPQ A;  2KYF A;  2ZN8 A;  3KHE A;  2I18 A;  4HRH A;  4JD9 A;  1SNL A;  2JPO A;  4PCW A;  1PUL A;  1YVL A;  2Y4Q A;  3O4Y A;  2F3Y A;  2GTE A;  1CFF A;  1WDC B;  1SK6 D;  4DRW A;  3VRQ A;  2QEO A;  5EL2 A;  3TZ1 A;  3D73 A;  3L4A A;  1QX7 A;  1ZAC A;  2V53 A;  2JTT A;  2PAL A;  2Q4U A;  4OVN F;  2NXQ A;  3B6X A;  2RGI A;  4L9M A;  1DVI A;  1R2U A;  4KYN A;  4NDB A;  3V2L A;  1QVI Y;  1OE9 B;  3BFH A;  2KDH A;  3AKB A;  3Q8I A;  4OZD A;  4PE0 A;  1S6I A;  1YUU A;  4U8D A;  1NCZ A;  1J7O A;  5AFP A;  1SCM B;  1ZFS A;  1KFU S;  4R1E A;  1M63 B;  2LUX A;  1KK8 C;  2I94 A;  1TCF A;  2KGB C;  3BXK A;  2JXC A;  3R1P A;  1WY9 A;  4QJ3 B;  2WC8 A;  3WHU B;  3PM8 A;  2AUC A;  1AUI B;  2JWW A;  3I5H C;  1CLB A;  1F8H A;  5D3O A;  2LMU A;  5BPJ A;  3HCM A;  2LAN A;  1A75 A;  2PSR A;  2HQ8 A;  4GBA A;  3I5G C;  3LL8 B;  1Y1X A;  1OMR A;  2M7N A;  2KAY A;  1M45 A;  3FE6 A;  1DT7 B;  1AVS A;  1YR5 A;  2KI6 D;  1FPW A;  1SR6 B;  2JOJ A;  2MLE C;  5ER4 X;  1YX7 A;  3BFA A;  3R72 A;  4Q04 A;  1BF5 A;  4ZCV A;  1C3Z A;  1NX1 A;  1QVI Z;  1FI5 A;  4PT1 A;  1KK8 B;  1SW8 A;  3JTD B;  2MLF C;  3VRN A;  1PRW A;  3DD4 A;  1BU3 A;  1KSM A;  1G33 A;  1T14 A;  1UP5 A;  1Y1U A;  2FJY A;  2R2I A;  1PVB A;  2Y1M A;  3I5I B;  1KK7 Y;  2GGM A;  1JUO A;  3TDZ A;  2Y1N A;  1B8R A;  2KBI A;  2MHH A;  1QX5 B;  4OCI A;  1A75 B;  3B86 A;  4TNC A;  3ICB A;  4PE7 A;  2WCL A;  1LIN A;  1XFY O;  1YX8 A;  2CNP A;  2MBX A;  1XK4 A;  4MZL A;  1TN4 A;  2M29 A;  3S0B A;  2PAS A;  1SYM A;  4AQI A;  3BUN B;  1EL4 A;  4AOM A;  3FE8 A;  3CR2 A;  2MRD A;  3PLF B;  1S1E A;  1S6C A;  4GNK B;  2KBM A;  1BR1 B;  1QS7 A;  3DVK A;  5HKY A;  4GAO A;  5I2L A;  1Y0V H;  1XYD A;  5FYX A;  1LA3 A;  3VB1 A;  3K1E A;  1HT9 A;  1DJW A;  2JC2 A;  4MEW A;  3A8R A;  1CTR A;  3CYZ A;  4PDZ A;  5CSN A;  1EG3 A;  1KK7 Z;  2LAP A;  1F4O A;  3SG4 A;  1ALW A;  3SG5 A;  1B8L A;  3OP0 A;  5I94 A;  1REC A;  3KEV A;  3SJS A;  3TUY B;  2KHN A;  1BT6 A;  2JT3 A;  1IGV A;  2WCB A;  1TNP A;  2M1U A;  2WCJ A;  4ZCU A;  1AK8 A;  3SG7 A;  5B8I B;  2KLE A;  3O78 A;  4C0J A;  1IKU A;  1EXR A;  2WOS A;  3A4U B;  1RTP 1;  1SL9 A;  1F54 A;  2FCD A;  2KFG A;  3I5F C;  1UUR A;  5HYD A;  1K8U A;  1XFV O;  1NCY A;  4P2Y B;  4NDD A;  5DKQ A;  3NSI A;  1JFK A;  1GGW A;  3NXA A;  3OHM B;  1U5I A;  2M49 B;  2WCK A;  3GOF A;  3M0W A;  4PE4 A;  2LMT A;  2PMY A;  3S0A A;  4YRU A;  5DKN A;  3BUM B;  1YTZ C;  2Y5I A;  2TN4 A;  4YI9 A;  3NHT A;  3CZ2 A;  1DF0 B;  1CFC A;  1SSE B;  4YGC B;  4CPV A;  1Z4H A;  3LLE A;  2LM5 A;  4E68 A;  2I7A A;  1DEK A;  2L4I A;  2BKI B;  1YUS A;  2NLN A;  2OTG B;  3BJH A;  1B9A A;  1QLS A;  2IS9 A;  4QJ4 B;  1CM1 A;  3D75 A;  3DVJ A;  4UPG A;  5GQQ C;  1W7I B;  2CT9 A;  1N0Y A;  2FOT A;  2JXL A;  2M3W A;  4YGB B;  5PAL A;  2LHI A;  2JT0 A;  4I5J A;  4BY5 A;  1OOF A;  3S0D A;  2K7D A;  1WLZ A;  1RK9 A;  1ALV A;  4GGF A;  4WQ2 A;  4MN0 A;  2QPT A;  4DCK A;  1AHR A;  2KI4 C;  1JFJ A;  4YGA A;  4ORC B;  5D7F A;  1PSB A;  2LVJ A;  4QJ5 B;  1BLQ A;  1JBA A;  1IG5 A;  1GQM A;  1QX2 A;  1EG4 A;  1SY9 A;  1YRT B;  1SKT A;  2EC6 C;  1V1G A;  3CZ1 A;  1DJZ A;  1EH2 A;  1IWQ A;  2KYC A;  1QJT A;  1J1D A;  1HQV A;  3CWG A;  1TOP A;  1UHH A;  3OX5 A;  4ORA B;  1C7W A;  1MUX A;  3BYA A;  1RFJ A;  2WCH A;  1EJ3 A;  3CR5 X;  2O5G A;  5DIC A;  5CSF A;  3DYE A;  5KU1 A;  4DS7 A;  2LP2 A;  3K21 A;  1KSO A;  3BQ3 A;  4MLW A;  2D8N A;  2HQW A;  2ZRT A;  4GGN A;  3NHI A;  2AAO A;  1AP4 A;  2KLD A;  1SL8 A;  2WCM A;  4JPZ B;  1AJ5 A;  2BCX A;  4XJK B;  1DJI A;  4MSP A;  1N2D A;  1D1O A;  1WLM A;  1J7P A;  1UUS A;  2JRF A;  4YI8 A;  3RLZ A;  2FJU B;  4JWQ A;  1IQ3 A;  4INX A;  4MZJ A;  1UWO A;  1C7V A;  3CZT X;  3NGV A;  2M1K B;  3D10 A;  2BCB A;  3F45 A;  1NX2 A;  3E3R A;  2LHL A;  4MZK A;  4N5X A;  4OKH A;  5CSJ A;  3VRR A;  2B1U A;  2OS8 C;  1QLK A;  3FIA A;  2LV7 A;  1J1E A;  5HLO A;  3D74 A;  1ZMZ A;  1BOD A;  2OPO A;  3KO0 A;  2P6B B;  1DTL A;  1LKJ A;  1VRK A;  1YVH A;  1B7T Y;  1ORG A;  1UHJ A;  2JNF A;  1W9Z A;  2WC5 A;  3CTN A;  4PAL A;  1CDN A;  1UHI A;  2I2R E;  2A4J A;  2K2F A;  1TUJ A;  3BUO B;  1F71 A;  1NX3 A;  3D77 A;  4AQJ A;  2LVK A;  2JPT A;  4PE1 A;  2SAS A;  3SIB A;  1SCV A;  3AAJ A;  2LLS A;  3BUX B;  3I5H B;  3PJI A;  1K93 D;  3CGA A;  5D69 A;  1H4B A;  2WC6 A;  2KOT A;  2KNE A;  5KTY A;  3I5G B;  1B8C A;  2OS8 B;  2LP3 A;  4INW A;  2M7L A;  4F7F A;  5JJG A;  5AXI A;  1P28 A;  2ZND A;  4CID A;  1B4C A;  1IIO A;  1KWO C;  1S36 A;  3BOW B;  4JQ0 D;  2G2B A;  3D76 A;  3LCP C;  1PAL A;  2BAP A;  1K9P A;  2K61 A;  2PQL A;  3CDN A;  2PYQ A;  4ICB A;  4HRG A;  3R1V A;  3WXA A;  1B7T Z;  3CS1 A;  3D78 A;  3B87 A;  3DZT A;  1XO5 A;  1QAT A;  3PFV A; 
#chains in the Genus database with same CATH homology
 3C1V A;  1DGV A;  1CM4 A;  1OQP A;  4M2P A;  1Y1A A;  2BEC A;  4PHJ A;  4YBH B;  1IJ6 A;  1NIW A;  2H61 C;  2GGZ A;  4OV2 A;  1L2O C;  1N65 A;  4M2Q A;  4IL1 A;  1M39 A;  1S5G Y;  1G8I A;  2KAX A;  2F8P A;  1DF0 A;  3AAK A;  3SG6 A;  3PN7 C;  2BE4 A;  2PRU A;  4GFT A;  1TNX A;  1CDM A;  5CPV A;  2NCO A;  2BKH B;  2KQY A;  1FBV A;  2GV5 A;  2LVV A;  3WNX B;  2JQ6 A;  1CDP A;  1WRZ A;  1IRJ A;  1CB1 A;  2KI6 C;  4WQ3 A;  1TRF A;  1J7R A;  1RRO A;  2F2O A;  3GK2 A;  4C0L A;  5IBW A;  3KF9 A;  1NP8 A;  2EHB A;  5F6T A;  3EK8 A;  1DMO A;  1MXE A;  2HF5 A;  3JVT C;  3SIA A;  2M97 A;  4D1E A;  5G08 A;  3HX4 A;  3NSL A;  2JTZ A;  1IQ5 A;  2WCE A;  5AER A;  3TS5 C;  1SRA A;  3PN7 B;  5AAN A;  1LA0 A;  2LLT A;  4DIR A;  1QIV A;  1KQM C;  1K9K A;  3CR4 X;  2K7C A;  1CMG A;  2L50 A;  1BMO A;  1CFP A;  3AKA A;  2JU0 A;  2CCM A;  3I5F B;  2AMI A;  2JUL A;  2EGD A;  5HKW A;  4GUK A;  1MQ1 A;  3OB1 B;  1C07 A;  1GJY A;  1LXF C;  4PHN A;  4FQO A;  4ORB B;  5K89 A;  3PSR A;  1Y6W A;  1WRL A;  1S3P A;  1ODB A;  3FWB A;  1RWY A;  2NZ0 A;  3GK4 X;  1B47 A;  4XYN A;  4I5L B;  4XJK A;  1UHN A;  4I5N B;  1MF8 B;  2WCF A;  4NQG A;  5DKR A;  4CFQ A;  1NX0 A;  2JNX A;  1ZUZ A;  4HSZ A;  5I2Q A;  2NCP A;  4YGD B;  1WDC C;  3BUW B;  1A03 A;  2CTN A;  1AJ4 A;  2ZRS A;  2KSP A;  4NDC A;  3EVR A;  3OB2 B;  1K94 A;  5AEQ A;  1QTX A;  2KI4 B;  1A29 A;  1KFX L;  3NSO A;  2LCP A;  4MRX A;  1DGU A;  2K7O A;  4MRY A;  2EC6 B;  4ETO A;  2KGR A;  1CLL A;  1SCM C;  2FCE A;  5HLV A;  1NSH A;  1L7Z A;  1YUT A;  5CSI A;  2L51 A;  1XVJ A;  5HKZ A;  3LK0 A;  4MBE A;  1FW4 A;  1K96 A;  2F33 A;  1E8A A;  1PK0 D;  1FF1 A;  4HRE E;  2Q91 A;  1OZS A;  1BJF A;  4GPL B;  1PVA A;  1Q80 A;  2LMV A;  1SBJ A;  2K0J A;  2SCP A;  1F4Q A;  3ZWH A;  3TDI A;  1OOJ A;  3BOW A;  1SR6 C;  2WND A;  1KCY A;  2M8U A;  3FWC A;  1XFU O;  1IH0 A;  1CFD A;  3VRO A;  1OMV A;  3JTD C;  1F70 A;  3DVM A;  4N1G A;  2H2K A;  1YRU B;  4P5O E;  1K95 A;  1KFX S;  3KPX A;  3I5I C;  1K2H A;  1NWD A;  2LUC A;  3EVU A;  1NCX A;  1XA5 A;  3ZNI A;  2WOR A;  2L5X B;  2ZNE A;  3H4S E;  1K9U A;  3SG3 A;  1WRK A;  2L4H A;  1BR4 B;  1XFZ O;  1B1G A;  2L98 A;  3EVV A;  2LNK A;  4N1F A;  4C0K A;  3O6B A;  1TIZ A;  1RJV A;  3EKH A;  3OX6 A;  2ZFD A;  2HET A;  1OSA A;  2LE9 B;  1TTX A;  3PAT A;  1ZOT B;  1M46 A;  2M9G A;  2K7B A;  2DOQ A;  3SG2 A;  1OZO A;  2K8M B;  4F0Z B;  1DJY A;  1S6J A;  2MJW B;  2H61 A;  2MAZ A;  1MR8 A;  2BCA A;  1CLM A;  1A2X A;  4A4C A;  1A4P A;  5I2O A;  1JF0 A;  1K90 D;  4CFR A;  3IF7 A;  5KSZ A;  1XK4 C;  3TUY C;  1KWO B;  1TNW A;  2KFF A;  2MA2 A;  1XFW O;  2LLU A;  2ZKM X;  1CKK A;  2KAV A;  2COL B;  3LK1 A;  2KFH A;  3O2P A;  3DVE A;  1YUR A;  3GK1 A;  1SMG A;  1L2O B;  1NUB A;  1XFX O;  2O60 A;  4A4B A;  3CLN A;  4PHK A;  2HPS A;  3TDU A;  3VRP A;  1OMD A;  1S26 D;  3EK4 A;  1DJG A;  1MWN A;  1S5G Z;  2G9B A;  2KQ6 A;  2OTG C;  4YGE B;  3RM1 A;  1IJ5 A;  1SPY A;  2L2E A;  3D0Y A;  1JSA A;  2E30 A;  2VRG A;  5J3X A;  1H8B A;  1CDL A;  3FS7 A;  5ER5 A;  4FTG A;  2JZI A;  4M2O A;  3DF0 A;  1SL7 A;  2ISD A;  1FI6 A;  2JT8 A;  4PHM A;  1KQV A;  3JVT B;  1X02 A;  2LC5 A;  1R6P A;  4MVF A;  1QIW A;  2BE6 A;  1TCO B;  1QV0 A;  3TS5 B;  1BOC A;  1V1F A;  1W7J B;  1CNP A;  1JFJ A;  1TNQ A;  1LVC D;  1QAS A;  2BL0 C;  1GGZ A;  1MXL C;  1KQM B;  2M0R A;  3NSK A;  4I5K A;  4OR9 B;  4USL A;  2F3Z A;  3WHT B;  3MSE B;  3EKJ A;  1JWD A;  3D0Y B;  1UHK A;  4WRI A;  3IQO A;  1PSR A;  2CBL A;  1QV1 A;  5I8N A;  2ZN9 A;  3IQQ A;  5TNC A;  4DUQ A;  2F2P A;  1BG1 A;  2PVB A;  1U5I B;  1NYA A;  3DF0 B;  1KFU L;  2CXJ A;  1DJX A;  1DJH A;  1MHO A;  1JC2 A;  4GGF C;  2E6W A;  2BBN A;  2LVI A;  1JF2 A;  1F55 A;  3VGO A;  2K2A A;  1J7Q A;  2BBM A;  1QXP A;  4CLN A;  1M31 A;  2BL0 B;  2QAC A;  5JOL A;  3PAL A;  2L0P A;  4BY4 A;  3QRX A;  3EK7 A;  1G4Y R;  1J55 A;  1NPQ A;  2KYF A;  2ZN8 A;  3KHE A;  2I18 A;  4HRH A;  4PCW A;  1SNL A;  1PUL A;  1YVL A;  2Y4Q A;  3O4Y A;  2F3Y A;  1CFF A;  1WDC B;  1SK6 D;  4DRW A;  3VRQ A;  3TZ1 A;  1QX7 A;  1ZAC A;  2V53 A;  2JTT A;  2PAL A;  2Q4U A;  4OVN F;  2NXQ A;  2RGI A;  4L9M A;  1DVI A;  1R2U A;  4NDB A;  1QVI Y;  1OE9 B;  2KDH A;  3AKB A;  4PE0 A;  1S6I A;  1YUU A;  4U8D A;  1NCZ A;  1J7O A;  5AFP A;  1SCM B;  1ZFS A;  1KFU S;  4R1E A;  1M63 B;  2LUX A;  1KK8 C;  2I94 A;  1TCF A;  2KGB C;  3BXK A;  2JXC A;  4QJ3 B;  1WY9 A;  2WC8 A;  3WHU B;  3PM8 A;  2AUC A;  1AUI B;  2JWW A;  3I5H C;  1CLB A;  1F8H A;  2LMU A;  5BPJ A;  3HCM A;  2LAN A;  1A75 A;  2PSR A;  2HQ8 A;  4GBA A;  3I5G C;  3LL8 B;  1Y1X A;  1OMR A;  2M7N A;  2KAY A;  1M45 A;  1AVS A;  1YR5 A;  2KI6 D;  1FPW A;  1SR6 B;  2JOJ A;  2MLE C;  5ER4 X;  1YX7 A;  1BF5 A;  4Q04 A;  4ZCV A;  1NX1 A;  1QVI Z;  1FI5 A;  1KK8 B;  1SW8 A;  3JTD B;  2MLF C;  3VRN A;  1PRW A;  3DD4 A;  1BU3 A;  1KSM A;  1G33 A;  1Y1U A;  1UP5 A;  2R2I A;  2Y1M A;  1PVB A;  3I5I B;  1KK7 Y;  2GGM A;  1JUO A;  3TDZ A;  2Y1N A;  1B8R A;  2KBI A;  2MHH A;  1QX5 B;  4OCI A;  1A75 B;  4TNC A;  3ICB A;  4PE7 A;  1LIN A;  1XFY O;  1YX8 A;  2CNP A;  2MBX A;  1XK4 A;  4MZL A;  1TN4 A;  2M29 A;  2PAS A;  1SYM A;  4AQI A;  3BUN B;  1EL4 A;  4AOM A;  3CR2 A;  2MRD A;  3PLF B;  1S1E A;  1S6C A;  4GNK B;  2KBM A;  1BR1 B;  1QS7 A;  3DVK A;  5HKY A;  4GAO A;  5I2L A;  1Y0V H;  1XYD A;  5FYX A;  1LA3 A;  1HT9 A;  1DJW A;  2JC2 A;  4MEW A;  3A8R A;  1CTR A;  4PDZ A;  5CSN A;  1EG3 A;  1KK7 Z;  2LAP A;  1F4O A;  3SG4 A;  1ALW A;  3SG5 A;  1B8L A;  3OP0 A;  1REC A;  3KEV A;  3SJS A;  3TUY B;  2KHN A;  1BT6 A;  2JT3 A;  1IGV A;  2WCB A;  1TNP A;  2M1U A;  4ZCU A;  1AK8 A;  3SG7 A;  5B8I B;  1IKU A;  3O78 A;  4C0J A;  1EXR A;  2WOS A;  3A4U B;  1RTP 1;  1SL9 A;  1F54 A;  2FCD A;  2KFG A;  3I5F C;  1UUR A;  5HYD A;  1K8U A;  1XFV O;  1NCY A;  4P2Y B;  4NDD A;  5DKQ A;  3NSI A;  1JFK A;  1GGW A;  3NXA A;  3OHM B;  1U5I A;  2M49 B;  3GOF A;  3M0W A;  4PE4 A;  2LMT A;  2PMY A;  4YRU A;  5DKN A;  3BUM B;  1YTZ C;  2Y5I A;  2TN4 A;  4YI9 A;  1DF0 B;  1CFC A;  4YGC B;  4CPV A;  3LLE A;  2LM5 A;  4E68 A;  2I7A A;  2L4I A;  2NLN A;  2BKI B;  1YUS A;  2OTG B;  1CMF A;  1B9A A;  1QLS A;  2IS9 A;  4QJ4 B;  1CM1 A;  3DVJ A;  4UPG A;  5GQQ C;  1W7I B;  2CT9 A;  1N0Y A;  2FOT A;  2JXL A;  2M3W A;  4YGB B;  5PAL A;  2LHI A;  2JT0 A;  4I5J A;  4BY5 A;  2K7D A;  1WLZ A;  1RK9 A;  1ALV A;  4GGF A;  4WQ2 A;  4MN0 A;  2QPT A;  4DCK A;  1AHR A;  2KI4 C;  4YGA A;  4ORC B;  5D7F A;  1PSB A;  2LVJ A;  4QJ5 B;  1BLQ A;  1JBA A;  1IG5 A;  1GQM A;  1QX2 A;  1EG4 A;  1SY9 A;  1YRT B;  1SKT A;  2EC6 C;  1V1G A;  1DJZ A;  1EH2 A;  1IWQ A;  2KYC A;  1QJT A;  1J1D A;  1HQV A;  3CWG A;  1TOP A;  1UHH A;  3OX5 A;  4ORA B;  1C7W A;  1MUX A;  3BYA A;  1RFJ A;  1EJ3 A;  3CR5 X;  2O5G A;  5CSF A;  5KU1 A;  4DS7 A;  2LP2 A;  3K21 A;  1KSO A;  3BQ3 A;  4MLW A;  2D8N A;  2HQW A;  2ZRT A;  4GGN A;  2AAO A;  1AP4 A;  1SL8 A;  4JPZ B;  1AJ5 A;  2BCX A;  4XJK B;  1DJI A;  4MSP A;  1N2D A;  1D1O A;  1WLM A;  1J7P A;  1UUS A;  2JRF A;  4YI8 A;  3RLZ A;  2FJU B;  4JWQ A;  1IQ3 A;  4MZJ A;  1UWO A;  1C7V A;  3CZT X;  2M1K B;  3D10 A;  2BCB A;  3F45 A;  1NX2 A;  3E3R A;  2LHL A;  4MZK A;  4N5X A;  4OKH A;  5CSJ A;  3VRR A;  2B1U A;  2OS8 C;  1QLK A;  3FIA A;  2LV7 A;  1J1E A;  5HLO A;  1BOD A;  1ZMZ A;  2OPO A;  3KO0 A;  2P6B B;  1DTL A;  1LKJ A;  1UHJ A;  1YVH A;  1B7T Y;  1VRK A;  2JNF A;  1DT7 B;  1CDN A;  3CTN A;  4PAL A;  1UHI A;  2I2R E;  2A4J A;  2K2F A;  3BUO B;  1F71 A;  1NX3 A;  4AQJ A;  2LVK A;  2JPT A;  4PE1 A;  2SAS A;  3SIB A;  1SCV A;  3AAJ A;  2LLS A;  3I5H B;  5D69 A;  1K93 D;  3CGA A;  1H4B A;  2KOT A;  2KNE A;  5KTY A;  3I5G B;  1B8C A;  2OS8 B;  2LP3 A;  2M7L A;  5JJG A;  5AXI A;  4CID A;  2ZND A;  1B4C A;  1KWO C;  1S36 A;  3BOW B;  4JQ0 D;  2G2B A;  3LCP C;  1PAL A;  1K9P A;  2K61 A;  4ICB A;  4HRG A;  3WXA A;  1B7T Z;  3CS1 A;  3BUX B;  1XO5 A;  1QAT A;  3PFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...