2NXQA

Crystal structure of calcium binding protein 1 from entamoeba histolytica: a novel arrangement of ef hand motifs
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
66
structure length
66
Chain Sequence
AEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein
publication title Crystal structure of calcium binding protein-1 from Entamoeba histolytica: A novel arrangement of EF hand motifs.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Metal binding protein
total genus 26
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2nxqA00
1CNPA 1UHNA 2SCPA 4ORAB 1S5GY 1CLBA 1BLQA 4YGDB 5TNCA 4MRYA 2PASA 1Y1XA 2JU0A 2BE6A 1M31A 2HQWA 4ORBB 2KQYA 5CPVA 2LAPA 3BXKA 3VRRA 4PE0A 3NXAA 4QJ4B 1PK0D 1W7JB 3I5IB 3DVJA 4DIRA 1S6JA 1DJWA 1KSOA 3AAJA 3KO0A 3I5GC 3OP0A 3CR4X 1C7VA 2KAXA 1GQMA 1DJXA 1J1EA 1JF0A 1NCXA 2AAOA 2L5XB 3I5HB 2KAVA 1QJTA 3EVRA 4OR9B 1FPWA 3LL8B 1N0YA 2JC2A 3RM1A 1DJIA 3CLNA 1NIWA 2KSPA 4NDBA 5DKRA 5HKWA 1OOJA 4E68A 1F4OA 5K89A 1UUSA 1B4CA 5HYDA 2QPTA 1XK4A 3CZTX 3LLEA 4PHJA 1EG4A 1N65A 1XVJA 1EXRA 1J7OA 1WRKA 4MBEA 4P2YB 1KSMA 2MRDA 1L2OC 2PSRA 1OSAA 1TCOB 5I8NA 4I5KA 2JTTA 2CBLA 1QLKA 3I5GB 1RK9A 1WDCC 1IWQA 2FCDA 1AUIB 1ZOTB 3CR2A 1A4PA 3ZWHA 3CTNA 3AKBA 2LLUA 1B7TY 4M2OA 5AEQA 1EG3A 3DF0B 2WC8A 3A4UB 4HRGA 1MR8A 1YX7A 2I7AA 1FI6A 1SMGA 2F2PA 2LCPA 1DJGA 3BOWA 4NDCA 2TN4A 2KYCA 4MLWA 1JWDA 1L2OB 2LMTA 3WHTB 3TUYC 1KFXS 1OE9B 1IQ5A 5HKZA 2WCEA 1AJ5A 1WLZA 1WDCB 2RGIA 3PATA 4GGFA 3SG5A 1QVIY 5HKYA 1YUTA 5CSNA 1YRUB 1DF0A 1TCFA 4GPLB 1SBJA 2WOSA 3SG7A 1F55A 3BQ3A 1M46A 1V1FA 2K0JA 1XA5A 2PMYA 4N1FA 4HRHA 1BU3A 1LKJA 2A4JA 5PALA 4CLNA 5G08A 3JTDC 3TUYB 4PHKA 1DVIA 3KEVA 1SPYA 2CT9A 2M7LA 4D1EA 1TNQA 2KGRA 3BUMB 3SIBA 3C1VA 4MEWA 4XJKB 1JBAA 3TDZA 5AFPA 3TZ1A 3H4SE 2JXLA 4IL1A 3F45A 1YURA 4WQ2A 5HLVA 1MXLC 1G8IA 1GGZA 1SCMC 1L7ZA 2Y5IA 2Y1MA 2AMIA 4GUKA 1MWNA 1CMFA 3SJSA 2JTZA 5DKNA 4A4CA 4OCIA 1N2DA 1VRKA 2HPSA 2H61A 4PE1A 2JOJA 3EVVA 4HSZA 3JTDB 5KSZA 1ODBA 2EC6C 2HETA 1F70A 1D1OA 2JWWA 1YVHA 2G2BA 2LV7A 2GGMA 1PSRA 2LLSA 4NDDA 3VROA 2MLEC 2LUCA 2LHLA 2M49B 4JQ0D 4ZCUA 3JVTC 1A75B 1SCMB 2CNPA 3VGOA 2K7DA 2LC5A 1FF1A 4GNKB 3SG2A 2COLB 2Y4QA 1BR1B 2ZNDA 1K95A 3PN7C 4I5JA 1XYDA 2BECA 5IBWA 2K8MB 4P5OE 1G4YR 1DJYA 1BR4B 1S5GZ 2M1UA 2KYFA 2EC6B 2K7BA 1RTP1 2PRUA 5KU1A 1K9UA 2NLNA 2JNFA 3LK1A 4ICBA 2MBXA 2FCEA 1KFUL 3QRXA 1YX8A 1WRLA 4A4BA 4DUQA 2KBMA 1KK8B 1NCYA 1Y1UA 2ZNEA 4CPVA 5D7FA 2ZKMX 3O6BA 1K2HA 1C7WA 1KK7Y 1NSHA 1QXPA 1OMRA 1WLMA 3JVTB 4M2PA 1TN4A 2LHIA 1U5IA 3E3RA 1UHIA 1SYMA 2BBMA 5FYXA 3MSEB 2BKHB 5DKQA 4YI9A 4UPGA 1S26D 2FOTA 3PN7B 1QX5B 1XFWO 2LP2A 2LUXA 1IJ6A 2LNKA 2L0PA 2KI6D 1BODA 3TS5C 3EK7A 1IG5A 1NYAA 3KHEA 1K9KA 1M63B 4JPZB 3CGAA 3EVUA 3PSRA 2L2EA 2M0RA 1EH2A 1JF2A 1FBVA 1SL7A 3PLFB 4FQOA 1J7QA 1XFYO 4PALA 1K94A 1KWOB 2KQ6A 2KFGA 4WQ3A 3NSKA 1FW4A 4AOMA 5BPJA 4MZKA 4C0JA 1CMGA 5CSJA 1B8RA 1QIVA 2NZ0A 4PE7A 1TIZA 3DVKA 1B7TZ 3I5FC 4Q04A 1TRFA 1OMVA 4MZJA 4YGAA 1CM1A 3TS5B 2O60A 1CDPA 2KAYA 1SKTA 1ZMZA 2PALA 1B8CA 3ICBA 1LXFC 2ZRTA 4GFTA 1NX1A 1QV0A 1BJFA 1PSBA 2F8PA 2LM5A 5I2LA 2F3YA 1A03A 1TNXA 2R2IA 1XFVO 3DVEA 1TTXA 4OKHA 1QVIZ 4NQGA 1NPQA 1W7IB 2ZFDA 1PALA 1J7PA 1CFPA 2M3WA 3O78A 1LINA 3SG6A 3I5FB 1DJHA 2MLFC 3AKAA 2EHBA 3O2PA 5CSFA 1JFKA 1SL8A 4BY4A 4PHMA 1IH0A 1ALVA 3OB1B 1YRTB 2OTGC 1CFCA 1S36A 1YTZC 3ZNIA 2JRFA 3DF0A 4F0ZB 2BCBA 2D8NA 1YVLA 3BYAA 2ISDA 1A29A 1NX0A 1HQVA 3D10A 3FWBA 1AHRA 1NX2A 1R2UA 1QX2A 4BY5A 1QLSA 4GGNA 4USLA 1SRAA 2BE4A 2VRGA 2KGBC 3NSIA 2M1KB 2HQ8A 1C07A 1K96A 1S6IA 1PRWA 3OB2B 2HF5A 2OTGB 3D0YB 2L4IA 1DT7B 1KQMC 4ZCVA 3SG4A 1QIWA 2WCBA 1PVBA 4MN0A 4C0KA 1QS7A 2GGZA 4HREE 1OZOA 4N5XA 1SW8A 1KK8C 2K2AA 1Y0VH 3GK1A 3IF7A 4OV2A 2H2KA 2CXJA 1XFXO 1ZUZA 1HT9A 1B47A 1PVAA 4FTGA 2JZIA 3TDUA 1F4QA 1BT6A 1PULA 2KBIA 5B8IB 2JQ6A 4XJKA 1IKUA 2AUCA 3EK4A 1NCZA 3FIAA 1MUXA 1ALWA 4XYNA 1KQMB 1KFUS 2EGDA 1R6PA 1JFJA 4MSPA 5F6TA 3CS1A 1XFZO 1NX3A 3CR5X 3WHUB 3OX6A 1Y6WA 1UURA 2FJUB 2LVKA 2BL0C 3CWGA 1NUBA 1KK7Z 1XK4C 2NCPA 3NSLA 1S3PA 1J7RA 2L51A 1QASA 2JT8A 4MRXA 2KFHA 3K21A 1QX7A 5CSIA 1KWOC 1RWYA 1OQPA 2ZRSA 1YR5A 1CLLA 1LVCD 2K2FA 3WXAA 1DJZA 1YUUA 2JULA 1A75A 3VRPA 3FWCA 1MHOA 4MZLA 4DRWA 1F54A 3OX5A 1KCYA 1IGVA 2CCMA 1JSAA 3DD4A 4PCWA 1GGWA 2BL0B 2DOQA 1RECA 2E30A 3HX4A 1JUOA 1A2XA 1Q80A 3BUWB 2MHHA 1J55A 1NWDA 1SNLA 2Q4UA 4I5LB 4M2QA 2MAZA 2PVBA 1K93D 1K9PA 2LVJA 4CFQA 1DGVA 1ZFSA 1CDMA 1CDLA 2KI4C 1X02A 3KF9A 1CFDA 4YBHB 3LK0A 2B1UA 2K7OA 4AQIA 4GGFC 2OS8C 4R1EA 5ER5A 5AERA 3IQQA 2KOTA 1AP4A 1RROA 1SL9A 2I94A 4PE4A 1AK8A 2I18A 2F2OA 2LANA 1ZACA 2LVVA 1WRZA 4YGEB 4WRIA 1RJVA 2E6WA 2KFFA 1DGUA 2LLTA 2G9BA 2JT0A 3GOFA 2LP3A 2M97A 1CFFA 3BOWB 1Y1AA 4MVFA 2SASA 4DCKA 1MF8B 3EK8A 1BF5A 1B9AA 1NP8A 2KI4B 3PALA 4QJ3B 4DS7A 2O5GA 1SR6C 1K8UA 2LVIA 2OS8B 4YGCB 4CFRA 1KQVA 3SG3A 1OMDA 1MXEA 1OZSA 3DVMA 4U8DA 4N1GA 2CTNA 2WCFA 1DF0B 1UP5A 1BOCA 2KHNA 2JPTA 1M45A 1SY9A 1B8LA 1EJ3A 2ZN8A 1AJ4A 1UHKA 2K7CA 3TDIA 4TNCA 5I2OA 5GQQC 2H61C 2I2RE 3OHMB 4PDZA 1F8HA 1FI5A 5HLOA 2K61A 4QJ5B 1DTLA 2BBNA 2BCXA 4OVNF 2V53A 3VRNA 1SR6B 5I2QA 2WORA 2F3ZA 1UWOA 2M7NA 2M9GA 4YI8A 5AANA 1BG1A 1XFUO 2LE9B 1J1DA 2M29A 1KFXL 2LMUA 2JT3A 1TNPA 3PFVA 3FS7A 1CDNA 2L50A 1QV1A 2NCOA 2OPOA 1H8BA 1LA0A 1IRJA 2Y1NA 1YUSA 1G33A 3AAKA 3HCMA 1S1EA 3BUNB 4C0LA 4AQJA 2JNXA 1UHHA 2KNEA 2BCAA 2LMVA 1M39A 1LA3A 2Q91A 2JXCA 2ZN9A 1F71A 1AVSA 1IQ3A 3A8RA 1S6CA 3SIAA 2F33A 2KI6C 2M8UA 3BUOB 3WNXB 4I5NB 1B1GA 3KPXA 3GK2A 1RFJA 1H4BA 4ORCB 1DMOA 1XO5A 1GJYA 2WNDA 3LCPC 5JJGA 4YGBB 2NXQA 1UHJA 3M0WA 1TNWA 2L98A 3IQOA 2L4HA 1SK6D 3EKJA 5KTYA 1CLMA 1V1GA 3D0YA 2MA2A 4YRUA 1E8AA 5ER4X 1CB1A 1SCVA 1QATA 4GAOA 1EL4A 2MJWB 1QTXA 2P6BB 1TOPA 4GBAA 1CTRA 1WY9A 1CKKA 3GK4X 1U5IB 3O4YA 4CIDA 5J3XA 3VRQA 3NSOA 4L9MA 3PM8A 2GV5A 1CM4A 3BUXB 1IJ5A 5D69A 2KDHA 1MQ1A 5AXIA 5JOLA 4PHNA 2QACA 3I5IC 2BKIB 1JC2A 1K90D 3EKHA 4ETOA 2IS9A 1BMOA 4JWQA 3I5HC 3RLZA
chains in the Genus database with same CATH superfamily
1CNPA 1UHNA 2SCPA 4ORAB 1S5GY 1CLBA 1BLQA 4YGDB 5TNCA 4MRYA 2PASA 3D73A 1Y1XA 2JU0A 2BE6A 1M31A 1C3YA 2HQWA 4ORBB 2KQYA 5CPVA 2LAPA 3BXKA 3VRRA 4PE0A 3NXAA 4QJ4B 1PK0D 1W7JB 3I5IB 3DVJA 4DIRA 1S6JA 1DJWA 1KSOA 3AAJA 3KO0A 3BFBA 3I5GC 3OP0A 3CR4X 1C7VA 2KAXA 1GQMA 1DJXA 1J1EA 1JF0A 1NCXA 2AAOA 2L5XB 3I5HB 5D3OA 3V2LA 2KAVA 1QJTA 3EVRA 4OR9B 1FPWA 3LL8B 1N0YA 2JC2A 3RM1A 1DJIA 3CLNA 1NIWA 2KSPA 4NDBA 5DKRA 5HKWA 1OOJA 4E68A 1F4OA 3D74A 5K89A 1UUSA 1B4CA 5HYDA 2QPTA 1XK4A 3CZTX 3LLEA 4PHJA 1EG4A 1N65A 1XVJA 1EXRA 1J7OA 1WRKA 4MBEA 5DICA 4P2YB 1KSMA 2MRDA 2WC6A 1L2OC 2QEHA 3B6XA 2PSRA 1OSAA 1TCOB 5I8NA 4I5KA 2JTTA 2CBLA 1QLKA 3I5GB 1RK9A 1WDCC 1IWQA 2FCDA 1AUIB 1ZOTB 3CR2A 1A4PA 3ZWHA 3SS4A 3CTNA 3AKBA 2LLUA 1B7TY 4M2OA 5AEQA 1EG3A 3DF0B 2WC8A 3A4UB 4HRGA 1MR8A 1YX7A 2I7AA 2H8VA 1SMGA 2F2PA 2LCPA 1DJGA 3BOWA 4FQTA 4NDCA 2TN4A 3S0EA 1IIOA 2KYCA 4MLWA 4F7FA 1JWDA 1L2OB 2LMTA 2WCKA 3QMEA 3WHTB 3TUYC 1KFXS 3FE9A 1OE9B 1IQ5A 5HKZA 2WCEA 1AJ5A 1WLZA 1WDCB 2RGIA 3PATA 4GGFA 3SG5A 1QVIY 5HKYA 1OOGA 1YUTA 5CSNA 1YRUB 1DF0A 1TCFA 2PYQA 3OGNA 4GPLB 1OOFA 1SBJA 2WOSA 3SG7A 1F55A 3BQ3A 1M46A 3NHTA 1C3ZA 1V1FA 2K0JA 1XA5A 2PMYA 4N1FA 4HRHA 3PM2A 1BU3A 1LKJA 2A4JA 5PALA 1DQEA 4CLNA 5G08A 3JTDC 1OW4A 3TUYB 4PHKA 1DVIA 3KEVA 1SPYA 3SS5A 2CT9A 2M7LA 4D1EA 1TNQA 2KGRA 3BUMB 3SIBA 3C1VA 4MEWA 4XJKB 1JBAA 3TDZA 5AFPA 3TZ1A 3H4SE 2JXLA 4IL1A 3F45A 1YURA 4WQ2A 4KYNA 1MXLC 1G8IA 1GGZA 1SCMC 1L7ZA 5HLVA 2Y5IA 2Y1MA 2AMIA 4GUKA 1MWNA 3RLZA 1CMFA 3SJSA 3IVTA 2JTZA 5DKNA 1XFRA 3FE6A 4A4CA 4OCIA 1N2DA 1VRKA 2HPSA 2H61A 4PE1A 2JOJA 3EVVA 4HSZA 3JTDB 5KSZA 1ODBA 2EC6C 2HETA 1F70A 1D1OA 2JWWA 1FI6A 1YVHA 3CZ1A 2G2BA 2LV7A 2GGMA 1PSRA 2LLSA 4NDDA 3VROA 2MLEC 2LUCA 2LHLA 2M49B 4JQ0D 4ZCUA 3JVTC 2WCJA 1A75B 3CDNA 1SCMB 2QDIA 2CNPA 3VGOA 2K7DA 2LC5A 1FF1A 4GNKB 3SG2A 2COLB 2Y4QA 5KU1A 1BR1B 2ZNDA 1K95A 3PN7C 4I5JA 1XYDA 2BECA 5IBWA 2K8MB 2WCHA 3CZ2A 1TUJA 4P5OE 1G4YR 1DJYA 1BR4B 1S5GZ 2M1UA 2KYFA 2EC6B 2K7BA 1RTP1 2PRUA 3B7AA 1K9UA 2NLNA 2JNFA 3LK1A 4ICBA 2MBXA 2FCEA 1KFUL 3QRXA 1YX8A 1WRLA 4A4BA 4DUQA 2KBMA 1KK8B 1NCYA 1Y1UA 2ZNEA 1ORGA 2WCMA 4CPVA 5D7FA 2K60A 2ZKMX 3O6BA 1K2HA 1C7WA 1KK7Y 1NSHA 1QXPA 1OMRA 1WLMA 3JVTB 4M2PA 5FI2A 1TN4A 2LHIA 1U5IA 3E3RA 1UHIA 3BJHA 1SYMA 3S0AA 2BBMA 5FYXA 3MSEB 5EL2A 2BKHB 3DYEA 5DKQA 4YI9A 4UPGA 1S26D 2FOTA 3CZ0A 1QX5B 3PN7B 3VB1A 1XFWO 2LP2A 2LUXA 1IJ6A 2LNKA 2L0PA 2KI6D 1BODA 3TS5C 3EK7A 1IG5A 1NYAA 3KHEA 1K9KA 1M63B 4JPZB 2BNXA 3CGAA 5FI7A 3EVUA 3D76A 3PSRA 2L2EA 2M0RA 2BAPA 3R1VA 1EH2A 1JF2A 3FE8A 1FBVA 1SL7A 3PLFB 4FQOA 1DC1A 1XFYO 4PALA 2ERBA 1K94A 1J7QA 1KWOB 2KQ6A 2KFGA 4WQ3A 3NSKA 1FW4A 4AOMA 5BPJA 4MZKA 4C0JA 3DZTA 1CMGA 5CSJA 1B8RA 1QIVA 2NZ0A 4PE7A 1TIZA 3DVKA 1B7TZ 3I5FC 4Q04A 1TRFA 1OMVA 4MZJA 4YGAA 4OZDA 1CM1A 3TS5B 2O60A 1CDPA 3B88A 2KAYA 1SKTA 1ZMZA 2GTEA 2PALA 3B87A 1B8CA 3ICBA 1LXFC 2ZRTA 4GFTA 1NX1A 1QV0A 1BJFA 1PSBA 2F8PA 2LM5A 5I2LA 2F3YA 1A03A 1TNXA 2R2IA 1XFVO 3DVEA 1TTXA 3L4LA 4OKHA 1QVIZ 4NQGA 1NPQA 1W7IB 2ZFDA 1PALA 1J7PA 1CFPA 2M3WA 3O78A 1LINA 3SG6A 3I5FB 1DJHA 2MLFC 3AKAA 2EHBA 3O2PA 5CSFA 1JFKA 5HL1A 1SL8A 4BY4A 4PHMA 1IH0A 1ALVA 3OB1B 1YRTB 2OTGC 1CFCA 1S36A 1YTZC 3ZNIA 2JRFA 3DF0A 4F0ZB 2BCBA 2D8NA 1YVLA 3BYAA 2ISDA 1A29A 1NX0A 1HQVA 3D10A 3FWBA 3L4AA 1AHRA 1NX2A 1R2UA 1QX2A 4BY5A 1QLSA 3OBVA 1T14A 4GGNA 4USLA 1SRAA 2BE4A 2VRGA 2KGBC 3NSIA 2M1KB 3DY9A 2HQ8A 1C07A 1K96A 1S6IA 1PRWA 3OB2B 2HF5A 2QEVA 2OTGB 3D0YB 2L4IA 1DT7B 1KQMC 3D77A 4ZCVA 3SG4A 1QIWA 2WCBA 1PVBA 4MN0A 4C0KA 2YGUA 3RZSA 1QS7A 2GGZA 4HREE 3NHIA 3K1EA 3EG5B 1OZOA 4N5XA 2QEOA 1SW8A 1KK8C 2K2AA 1Y0VH 3GK1A 3IF7A 4OV2A 2H2KA 2CXJA 1XFXO 1ZUZA 1HT9A 1B47A 2WC5A 1PVAA 4FTGA 2JZIA 3TDUA 1F4QA 1BT6A 1PULA 2KBIA 5B8IB 2JQ6A 4XJKA 1IKUA 2AUCA 3EK4A 3L47A 1NCZA 3FIAA 1MUXA 1ALWA 4XYNA 1KQMB 1KFUS 2EGDA 1R6PA 4IJ7A 1JFJA 4MSPA 5F6TA 3CS1A 1XFZO 1NX3A 3CR5X 3WHUB 3OX6A 1Y6WA 1UURA 3N7HA 2FJUB 2LVKA 2BL0C 3CWGA 1NUBA 1KK7Z 1XK4C 2NCPA 3NSLA 1S3PA 1J7RA 2L51A 1QASA 2JT8A 3R1OA 3S0FA 2KPHA 2KFHA 3K21A 4MRXA 1QX7A 5CSIA 1KWOC 1RWYA 1OQPA 2ZRSA 1YR5A 1CLLA 1LVCD 2K2FA 3WXAA 1DJZA 1YUUA 2JULA 1A75A 3VRPA 5FI6A 4JKTA 1DEKA 3FWCA 1MHOA 4MZLA 4DRWA 1F54A 3OX5A 1KCYA 5I94A 3S0GA 1IGVA 2CCMA 1JSAA 3DD4A 4PCWA 1GGWA 2BL0B 2DOQA 1RECA 2E30A 2L5YA 1OOIX 3HX4A 1JUOA 1A2XA 1Q80A 3BUWB 2MHHA 1J55A 2P70A 1NWDA 1SNLA 2Q4UA 4I5LB 4M2QA 1TWOA 2MAZA 2PVBA 1K93D 1K9PA 2LVJA 4CFQA 1DGVA 1ZFSA 1CDMA 1CDLA 2KI4C 3CABA 1X02A 3KF9A 3SS3A 1CFDA 4YBHB 3LK0A 2B1UA 2K7OA 4AQIA 4GGFC 2OS8C 4R1EA 5ER5A 5AERA 3IQQA 2KOTA 1AP4A 1RROA 1SL9A 2I94A 4PE4A 1AK8A 2I18A 2F2OA 2LANA 1ZACA 2LVVA 3NGVA 1WRZA 4YGEB 4WRIA 1DELA 1RJVA 2E6WA 3DXLA 2KFFA 1DGUA 2LLTA 2G9BA 2JT0A 3GOFA 2LP3A 2M97A 3PJIA 1CFFA 3BOWB 1Y1AA 4MVFA 2SASA 4DCKA 1MF8B 3EK8A 1BF5A 1B9AA 1NP8A 2KI4B 3PALA 4QJ3B 4DS7A 2O5GA 1SR6C 1K8UA 2LVIA 2OS8B 4YGCB 4CFRA 1SSEB 1KQVA 3SG3A 1OMDA 1MXEA 2KLDA 1OZSA 3DVMA 4U8DA 4N1GA 2CTNA 2WCFA 1DF0B 1UP5A 1BOCA 2KHNA 2JPTA 1M45A 1SY9A 3D78A 1B8LA 3R1PA 3O4XA 1EJ3A 2ZN8A 1AJ4A 1UHKA 2K7CA 3TDIA 4TNCA 5I2OA 5GQQC 2H61C 2I2RE 3OHMB 4PDZA 1F8HA 1FI5A 3CYZA 2K61A 3D75A 5HLOA 1DTLA 2BBNA 2BCXA 4OVNF 4QJ5B 2V53A 3VRNA 1SR6B 5I2QA 2WORA 2F3ZA 1UWOA 2M7NA 2M9GA 4YI8A 5AANA 1BG1A 1XFUO 2LE9B 1J1DA 2M29A 1KFXL 2LMUA 2JT3A 1TNPA 3UNWA 3PFVA 3FS7A 3UO9A 1CDNA 2L50A 4INWA 3B86A 1QV1A 1Z4HA 2NCOA 2OPOA 1H8BA 4INXA 1LA0A 1P28A 1IRJA 2Y1NA 1YUSA 1G33A 2WCLA 2KLEA 3AAKA 3HCMA 1S1EA 3BUNB 4C0LA 4AQJA 2JNXA 1UHHA 2KNEA 2BCAA 2LMVA 1M39A 1LA3A 2Q91A 2JXCA 2ZN9A 1F71A 1AVSA 1IQ3A 3A8RA 1S6CA 3SIAA 2F33A 2KI6C 2M8UA 3BUOB 3WNXB 4I5NB 1B1GA 2PQLA 3KPXA 3GK2A 1RFJA 3R72A 1H4BA 4ORCB 1DMOA 1XO5A 4PT1A 1GJYA 2WNDA 3LCPC 5JJGA 4YGBB 2FJYA 2L2CA 2NXQA 1UHJA 3M0WA 1TNWA 1Z2CB 2L98A 3IQOA 2L4HA 1SK6D 3EKJA 3Q8IA 1CLMA 5KTYA 1V1GA 3D0YA 2MA2A 4YRUA 1E8AA 3BFHA 5ER4X 1CB1A 1SCVA 1QATA 4GAOA 1EL4A 2MJWB 1OOHA 1QTXA 2P6BB 2QEBA 1TOPA 4GBAA 1CTRA 1WY9A 2JPOA 1CKKA 3GK4X 1U5IB 3O4YA 3BFAA 4CIDA 1TUZA 5J3XA 3VRQA 1W9ZA 3S0DA 3NSOA 4L9MA 1GM0A 3PM8A 2GV5A 1CM4A 3BUXB 1IJ5A 1QWVA 2KDHA 1MQ1A 5D69A 5AXIA 5JOLA 4PHNA 2QACA 3I5IC 2BKIB 1JC2A 3S0BA 2P71A 1K90D 3EKHA 4ETOA 1LS8A 2IS9A 1BMOA 4JWQA 3I5HC 4JD9A
chains in the Genus database with same CATH topology
1CNPA 1UHNA 2SCPA 4ORAB 1S5GY 1CLBA 1BLQA 4YGDB 5TNCA 4MRYA 2PASA 1Y1XA 2JU0A 2BE6A 1M31A 2HQWA 4ORBB 2KQYA 5CPVA 2LAPA 3BXKA 3VRRA 4PE0A 3NXAA 4QJ4B 1PK0D 1W7JB 3I5IB 3DVJA 4DIRA 1S6JA 1DJWA 1KSOA 3AAJA 3KO0A 3I5GC 3OP0A 3CR4X 1C7VA 2KAXA 1GQMA 1DJXA 1J1EA 1JF0A 1NCXA 2AAOA 2L5XB 3I5HB 2KAVA 1QJTA 3EVRA 4OR9B 1FPWA 3LL8B 1N0YA 2JC2A 3RM1A 1DJIA 3CLNA 1NIWA 2KSPA 4NDBA 5DKRA 5HKWA 1OOJA 4E68A 1F4OA 5K89A 1UUSA 1B4CA 5HYDA 2QPTA 1XK4A 3CZTX 3LLEA 4PHJA 1EG4A 1N65A 1XVJA 1EXRA 1J7OA 1WRKA 4MBEA 4P2YB 1KSMA 2MRDA 1L2OC 2PSRA 1OSAA 1TCOB 5I8NA 4I5KA 2JTTA 2CBLA 1QLKA 3I5GB 1RK9A 1WDCC 1IWQA 2FCDA 1AUIB 1ZOTB 3CR2A 1A4PA 3ZWHA 3CTNA 3AKBA 2LLUA 1B7TY 4M2OA 5AEQA 1EG3A 3DF0B 2WC8A 3A4UB 4HRGA 1MR8A 1YX7A 2I7AA 1FI6A 1SMGA 2F2PA 2LCPA 1DJGA 3BOWA 4NDCA 2TN4A 2KYCA 4MLWA 1JWDA 1L2OB 2LMTA 3WHTB 3TUYC 1KFXS 1OE9B 1IQ5A 5HKZA 2WCEA 1AJ5A 1WLZA 1WDCB 2RGIA 3PATA 4GGFA 3SG5A 1QVIY 5HKYA 1YUTA 5CSNA 1YRUB 1DF0A 1TCFA 4GPLB 1SBJA 2WOSA 3SG7A 1F55A 3BQ3A 1M46A 1V1FA 2K0JA 1XA5A 2PMYA 4N1FA 4HRHA 1BU3A 1LKJA 2A4JA 5PALA 4CLNA 5G08A 3JTDC 3TUYB 4PHKA 1DVIA 3KEVA 1SPYA 2CT9A 2M7LA 4D1EA 1TNQA 2KGRA 3BUMB 3SIBA 3C1VA 4MEWA 4XJKB 1JBAA 3TDZA 5AFPA 3TZ1A 3H4SE 2JXLA 4IL1A 3F45A 1YURA 4WQ2A 5HLVA 1MXLC 1G8IA 1GGZA 1SCMC 1L7ZA 2Y5IA 2Y1MA 2AMIA 4GUKA 1MWNA 1CMFA 3SJSA 2JTZA 5DKNA 4A4CA 4OCIA 1N2DA 1VRKA 2HPSA 2H61A 4PE1A 2JOJA 3EVVA 4HSZA 3JTDB 5KSZA 1ODBA 2EC6C 2HETA 1F70A 1D1OA 2JWWA 1YVHA 2G2BA 2LV7A 2GGMA 1PSRA 2LLSA 4NDDA 3VROA 2MLEC 2LUCA 2LHLA 2M49B 4JQ0D 4ZCUA 3JVTC 1A75B 1SCMB 2CNPA 3VGOA 2K7DA 2LC5A 1FF1A 4GNKB 3SG2A 2COLB 2Y4QA 1BR1B 2ZNDA 1K95A 3PN7C 4I5JA 1XYDA 2BECA 5IBWA 2K8MB 4P5OE 1G4YR 1DJYA 1BR4B 1S5GZ 2M1UA 2KYFA 2EC6B 2K7BA 1RTP1 2PRUA 5KU1A 1K9UA 2NLNA 2JNFA 3LK1A 4ICBA 2MBXA 2FCEA 1KFUL 3QRXA 1YX8A 1WRLA 4A4BA 4DUQA 2KBMA 1KK8B 1NCYA 1Y1UA 2ZNEA 4CPVA 5D7FA 2ZKMX 3O6BA 1K2HA 1C7WA 1KK7Y 1NSHA 1QXPA 1OMRA 1WLMA 3JVTB 4M2PA 1TN4A 2LHIA 1U5IA 3E3RA 1UHIA 1SYMA 2BBMA 5FYXA 3MSEB 2BKHB 5DKQA 4YI9A 4UPGA 1S26D 2FOTA 3PN7B 1QX5B 1XFWO 2LP2A 2LUXA 1IJ6A 2LNKA 2L0PA 2KI6D 1BODA 3TS5C 3EK7A 1IG5A 1NYAA 3KHEA 1K9KA 1M63B 4JPZB 3CGAA 3EVUA 3PSRA 2L2EA 2M0RA 1EH2A 1JF2A 1FBVA 1SL7A 3PLFB 4FQOA 1J7QA 1XFYO 4PALA 1K94A 1KWOB 2KQ6A 2KFGA 4WQ3A 3NSKA 1FW4A 4AOMA 5BPJA 4MZKA 4C0JA 1CMGA 5CSJA 1B8RA 1QIVA 2NZ0A 4PE7A 1TIZA 3DVKA 1B7TZ 3I5FC 4Q04A 1TRFA 1OMVA 4MZJA 4YGAA 1CM1A 3TS5B 2O60A 1CDPA 2KAYA 1SKTA 1ZMZA 2PALA 1B8CA 3ICBA 1LXFC 2ZRTA 4GFTA 1NX1A 1QV0A 1BJFA 1PSBA 2F8PA 2LM5A 5I2LA 2F3YA 1A03A 1TNXA 2R2IA 1XFVO 3DVEA 1TTXA 4OKHA 1QVIZ 4NQGA 1NPQA 1W7IB 2ZFDA 1PALA 1J7PA 1CFPA 2M3WA 3O78A 1LINA 3SG6A 3I5FB 1DJHA 2MLFC 3AKAA 2EHBA 3O2PA 5CSFA 1JFKA 1SL8A 4BY4A 4PHMA 1IH0A 1ALVA 3OB1B 1YRTB 2OTGC 1CFCA 1S36A 1YTZC 3ZNIA 2JRFA 3DF0A 4F0ZB 2BCBA 2D8NA 1YVLA 3BYAA 2ISDA 1A29A 1NX0A 1HQVA 3D10A 3FWBA 1AHRA 1NX2A 1R2UA 1QX2A 4BY5A 1QLSA 4GGNA 4USLA 1SRAA 2BE4A 2VRGA 2KGBC 3NSIA 2M1KB 2HQ8A 1C07A 1K96A 1S6IA 1PRWA 3OB2B 2HF5A 2OTGB 3D0YB 2L4IA 1DT7B 1KQMC 4ZCVA 3SG4A 1QIWA 2WCBA 1PVBA 4MN0A 4C0KA 1QS7A 2GGZA 4HREE 1OZOA 4N5XA 1SW8A 1KK8C 2K2AA 1Y0VH 3GK1A 3IF7A 4OV2A 2H2KA 2CXJA 1XFXO 1ZUZA 1HT9A 1B47A 1PVAA 4FTGA 2JZIA 3TDUA 1F4QA 1BT6A 1PULA 2KBIA 5B8IB 2JQ6A 4XJKA 1IKUA 2AUCA 3EK4A 1NCZA 3FIAA 1MUXA 1ALWA 4XYNA 1KQMB 1KFUS 2EGDA 1R6PA 1JFJA 4MSPA 5F6TA 3CS1A 1XFZO 1NX3A 3CR5X 3WHUB 3OX6A 1Y6WA 1UURA 2FJUB 2LVKA 2BL0C 3CWGA 1NUBA 1KK7Z 1XK4C 2NCPA 3NSLA 1S3PA 1J7RA 2L51A 1QASA 2JT8A 4MRXA 2KFHA 3K21A 1QX7A 5CSIA 1KWOC 1RWYA 1OQPA 2ZRSA 1YR5A 1CLLA 1LVCD 2K2FA 3WXAA 1DJZA 1YUUA 2JULA 1A75A 3VRPA 3FWCA 1MHOA 4MZLA 4DRWA 1F54A 3OX5A 1KCYA 1IGVA 2CCMA 1JSAA 3DD4A 4PCWA 1GGWA 2BL0B 2DOQA 1RECA 2E30A 3HX4A 1JUOA 1A2XA 1Q80A 3BUWB 2MHHA 1J55A 1NWDA 1SNLA 2Q4UA 4I5LB 4M2QA 2MAZA 2PVBA 1K93D 1K9PA 2LVJA 4CFQA 1DGVA 1ZFSA 1CDMA 1CDLA 2KI4C 1X02A 3KF9A 1CFDA 4YBHB 3LK0A 2B1UA 2K7OA 4AQIA 4GGFC 2OS8C 4R1EA 5ER5A 5AERA 3IQQA 2KOTA 1AP4A 1RROA 1SL9A 2I94A 4PE4A 1AK8A 2I18A 2F2OA 2LANA 1ZACA 2LVVA 1WRZA 4YGEB 4WRIA 1RJVA 2E6WA 2KFFA 1DGUA 2LLTA 2G9BA 2JT0A 3GOFA 2LP3A 2M97A 1CFFA 3BOWB 1Y1AA 4MVFA 2SASA 4DCKA 1MF8B 3EK8A 1BF5A 1B9AA 1NP8A 2KI4B 3PALA 4QJ3B 4DS7A 2O5GA 1SR6C 1K8UA 2LVIA 2OS8B 4YGCB 4CFRA 1KQVA 3SG3A 1OMDA 1MXEA 1OZSA 3DVMA 4U8DA 4N1GA 2CTNA 2WCFA 1DF0B 1UP5A 1BOCA 2KHNA 2JPTA 1M45A 1SY9A 1B8LA 1EJ3A 2ZN8A 1AJ4A 1UHKA 2K7CA 3TDIA 4TNCA 5I2OA 5GQQC 2H61C 2I2RE 3OHMB 4PDZA 1F8HA 1FI5A 5HLOA 2K61A 4QJ5B 1DTLA 2BBNA 2BCXA 4OVNF 2V53A 3VRNA 1SR6B 5I2QA 2WORA 2F3ZA 1UWOA 2M7NA 2M9GA 4YI8A 5AANA 1BG1A 1XFUO 2LE9B 1J1DA 2M29A 1KFXL 2LMUA 2JT3A 1TNPA 3PFVA 3FS7A 1CDNA 2L50A 1QV1A 2NCOA 2OPOA 1H8BA 1LA0A 1IRJA 2Y1NA 1YUSA 1G33A 3AAKA 3HCMA 1S1EA 3BUNB 4C0LA 4AQJA 2JNXA 1UHHA 2KNEA 2BCAA 2LMVA 1M39A 1LA3A 2Q91A 2JXCA 2ZN9A 1F71A 1AVSA 1IQ3A 3A8RA 1S6CA 3SIAA 2F33A 2KI6C 2M8UA 3BUOB 3WNXB 4I5NB 1B1GA 3KPXA 3GK2A 1RFJA 1H4BA 4ORCB 1DMOA 1XO5A 1GJYA 2WNDA 3LCPC 5JJGA 4YGBB 2NXQA 1UHJA 3M0WA 1TNWA 2L98A 3IQOA 2L4HA 1SK6D 3EKJA 5KTYA 1CLMA 1V1GA 3D0YA 2MA2A 4YRUA 1E8AA 5ER4X 1CB1A 1SCVA 1QATA 4GAOA 1EL4A 2MJWB 1QTXA 2P6BB 1TOPA 4GBAA 1CTRA 1WY9A 1CKKA 3GK4X 1U5IB 3O4YA 4CIDA 5J3XA 3VRQA 3NSOA 4L9MA 3PM8A 2GV5A 1CM4A 3BUXB 1IJ5A 5D69A 2KDHA 1MQ1A 5AXIA 5JOLA 4PHNA 2QACA 3I5IC 2BKIB 1JC2A 1K90D 3EKHA 4ETOA 2IS9A 1BMOA 4JWQA 3I5HC 3RLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CNP A;  1UHN A;  2SCP A;  4ORA B;  1S5G Y;  1CLB A;  1BLQ A;  4YGD B;  5TNC A;  4MRY A;  2PAS A;  1Y1X A;  2JU0 A;  2BE6 A;  1M31 A;  2HQW A;  4ORB B;  2KQY A;  5CPV A;  2LAP A;  3BXK A;  3VRR A;  4PE0 A;  3NXA A;  4QJ4 B;  1PK0 D;  1W7J B;  3I5I B;  3DVJ A;  4DIR A;  1S6J A;  1DJW A;  1KSO A;  3AAJ A;  3KO0 A;  3I5G C;  3OP0 A;  3CR4 X;  1C7V A;  2KAX A;  1GQM A;  1DJX A;  1J1E A;  1JF0 A;  1NCX A;  2AAO A;  2L5X B;  3I5H B;  2KAV A;  1QJT A;  3EVR A;  4OR9 B;  1FPW A;  3LL8 B;  1N0Y A;  2JC2 A;  3RM1 A;  1DJI A;  3CLN A;  1NIW A;  2KSP A;  4NDB A;  5DKR A;  5HKW A;  1OOJ A;  4E68 A;  1F4O A;  5K89 A;  1UUS A;  1B4C A;  5HYD A;  2QPT A;  1XK4 A;  3CZT X;  3LLE A;  4PHJ A;  1EG4 A;  1N65 A;  1XVJ A;  1EXR A;  1J7O A;  1WRK A;  4MBE A;  4P2Y B;  1KSM A;  2MRD A;  1L2O C;  2PSR A;  1OSA A;  1TCO B;  5I8N A;  4I5K A;  2JTT A;  2CBL A;  1QLK A;  3I5G B;  1RK9 A;  1WDC C;  1IWQ A;  2FCD A;  1AUI B;  1ZOT B;  3CR2 A;  1A4P A;  3ZWH A;  3CTN A;  3AKB A;  2LLU A;  1B7T Y;  4M2O A;  5AEQ A;  1EG3 A;  3DF0 B;  2WC8 A;  3A4U B;  4HRG A;  1MR8 A;  1YX7 A;  2I7A A;  1FI6 A;  1SMG A;  2F2P A;  2LCP A;  1DJG A;  3BOW A;  4NDC A;  2TN4 A;  2KYC A;  4MLW A;  1JWD A;  1L2O B;  2LMT A;  3WHT B;  3TUY C;  1KFX S;  1OE9 B;  1IQ5 A;  5HKZ A;  2WCE A;  1AJ5 A;  1WLZ A;  1WDC B;  2RGI A;  3PAT A;  4GGF A;  3SG5 A;  1QVI Y;  5HKY A;  1YUT A;  5CSN A;  1YRU B;  1DF0 A;  1TCF A;  4GPL B;  1SBJ A;  2WOS A;  3SG7 A;  1F55 A;  3BQ3 A;  1M46 A;  1V1F A;  2K0J A;  1XA5 A;  2PMY A;  4N1F A;  4HRH A;  1BU3 A;  1LKJ A;  2A4J A;  5PAL A;  4CLN A;  5G08 A;  3JTD C;  3TUY B;  4PHK A;  1DVI A;  3KEV A;  1SPY A;  2CT9 A;  2M7L A;  4D1E A;  1TNQ A;  2KGR A;  3BUM B;  3SIB A;  3C1V A;  4MEW A;  4XJK B;  1JBA A;  3TDZ A;  5AFP A;  3TZ1 A;  3H4S E;  2JXL A;  4IL1 A;  3F45 A;  1YUR A;  4WQ2 A;  5HLV A;  1MXL C;  1G8I A;  1GGZ A;  1SCM C;  1L7Z A;  2Y5I A;  2Y1M A;  2AMI A;  4GUK A;  1MWN A;  1CMF A;  3SJS A;  2JTZ A;  5DKN A;  4A4C A;  4OCI A;  1N2D A;  1VRK A;  2HPS A;  2H61 A;  4PE1 A;  2JOJ A;  3EVV A;  4HSZ A;  3JTD B;  5KSZ A;  1ODB A;  2EC6 C;  2HET A;  1F70 A;  1D1O A;  2JWW A;  1YVH A;  2G2B A;  2LV7 A;  2GGM A;  1PSR A;  2LLS A;  4NDD A;  3VRO A;  2MLE C;  2LUC A;  2LHL A;  2M49 B;  4JQ0 D;  4ZCU A;  3JVT C;  1A75 B;  1SCM B;  2CNP A;  3VGO A;  2K7D A;  2LC5 A;  1FF1 A;  4GNK B;  3SG2 A;  2COL B;  2Y4Q A;  1BR1 B;  2ZND A;  1K95 A;  3PN7 C;  4I5J A;  1XYD A;  2BEC A;  5IBW A;  2K8M B;  4P5O E;  1G4Y R;  1DJY A;  1BR4 B;  1S5G Z;  2M1U A;  2KYF A;  2EC6 B;  2K7B A;  1RTP 1;  2PRU A;  5KU1 A;  1K9U A;  2NLN A;  2JNF A;  3LK1 A;  4ICB A;  2MBX A;  2FCE A;  1KFU L;  3QRX A;  1YX8 A;  1WRL A;  4A4B A;  4DUQ A;  2KBM A;  1KK8 B;  1NCY A;  1Y1U A;  2ZNE A;  4CPV A;  5D7F A;  2ZKM X;  3O6B A;  1K2H A;  1C7W A;  1KK7 Y;  1NSH A;  1QXP A;  1OMR A;  1WLM A;  3JVT B;  4M2P A;  1TN4 A;  2LHI A;  1U5I A;  3E3R A;  1UHI A;  1SYM A;  2BBM A;  5FYX A;  3MSE B;  2BKH B;  5DKQ A;  4YI9 A;  4UPG A;  1S26 D;  2FOT A;  3PN7 B;  1QX5 B;  1XFW O;  2LP2 A;  2LUX A;  1IJ6 A;  2LNK A;  2L0P A;  2KI6 D;  1BOD A;  3TS5 C;  3EK7 A;  1IG5 A;  1NYA A;  3KHE A;  1K9K A;  1M63 B;  4JPZ B;  3CGA A;  3EVU A;  3PSR A;  2L2E A;  2M0R A;  1EH2 A;  1JF2 A;  1FBV A;  1SL7 A;  3PLF B;  4FQO A;  1J7Q A;  1XFY O;  4PAL A;  1K94 A;  1KWO B;  2KQ6 A;  2KFG A;  4WQ3 A;  3NSK A;  1FW4 A;  4AOM A;  5BPJ A;  4MZK A;  4C0J A;  1CMG A;  5CSJ A;  1B8R A;  1QIV A;  2NZ0 A;  4PE7 A;  1TIZ A;  3DVK A;  1B7T Z;  3I5F C;  4Q04 A;  1TRF A;  1OMV A;  4MZJ A;  4YGA A;  1CM1 A;  3TS5 B;  2O60 A;  1CDP A;  2KAY A;  1SKT A;  1ZMZ A;  2PAL A;  1B8C A;  3ICB A;  1LXF C;  2ZRT A;  4GFT A;  1NX1 A;  1QV0 A;  1BJF A;  1PSB A;  2F8P A;  2LM5 A;  5I2L A;  2F3Y A;  1A03 A;  1TNX A;  2R2I A;  1XFV O;  3DVE A;  1TTX A;  4OKH A;  1QVI Z;  4NQG A;  1NPQ A;  1W7I B;  2ZFD A;  1PAL A;  1J7P A;  1CFP A;  2M3W A;  3O78 A;  1LIN A;  3SG6 A;  3I5F B;  1DJH A;  2MLF C;  3AKA A;  2EHB A;  3O2P A;  5CSF A;  1JFK A;  1SL8 A;  4BY4 A;  4PHM A;  1IH0 A;  1ALV A;  3OB1 B;  1YRT B;  2OTG C;  1CFC A;  1S36 A;  1YTZ C;  3ZNI A;  2JRF A;  3DF0 A;  4F0Z B;  2BCB A;  2D8N A;  1YVL A;  3BYA A;  2ISD A;  1A29 A;  1NX0 A;  1HQV A;  3D10 A;  3FWB A;  1AHR A;  1NX2 A;  1R2U A;  1QX2 A;  4BY5 A;  1QLS A;  4GGN A;  4USL A;  1SRA A;  2BE4 A;  2VRG A;  2KGB C;  3NSI A;  2M1K B;  2HQ8 A;  1C07 A;  1K96 A;  1S6I A;  1PRW A;  3OB2 B;  2HF5 A;  2OTG B;  3D0Y B;  2L4I A;  1DT7 B;  1KQM C;  4ZCV A;  3SG4 A;  1QIW A;  2WCB A;  1PVB A;  4MN0 A;  4C0K A;  1QS7 A;  2GGZ A;  4HRE E;  1OZO A;  4N5X A;  1SW8 A;  1KK8 C;  2K2A A;  1Y0V H;  3GK1 A;  3IF7 A;  4OV2 A;  2H2K A;  2CXJ A;  1XFX O;  1ZUZ A;  1HT9 A;  1B47 A;  1PVA A;  4FTG A;  2JZI A;  3TDU A;  1F4Q A;  1BT6 A;  1PUL A;  2KBI A;  5B8I B;  2JQ6 A;  4XJK A;  1IKU A;  2AUC A;  3EK4 A;  1NCZ A;  3FIA A;  1MUX A;  1ALW A;  4XYN A;  1KQM B;  1KFU S;  2EGD A;  1R6P A;  1JFJ A;  4MSP A;  5F6T A;  3CS1 A;  1XFZ O;  1NX3 A;  3CR5 X;  3WHU B;  3OX6 A;  1Y6W A;  1UUR A;  2FJU B;  2LVK A;  2BL0 C;  3CWG A;  1NUB A;  1KK7 Z;  1XK4 C;  2NCP A;  3NSL A;  1S3P A;  1J7R A;  2L51 A;  1QAS A;  2JT8 A;  4MRX A;  2KFH A;  3K21 A;  1QX7 A;  5CSI A;  1KWO C;  1RWY A;  1OQP A;  2ZRS A;  1YR5 A;  1CLL A;  1LVC D;  2K2F A;  3WXA A;  1DJZ A;  1YUU A;  2JUL A;  1A75 A;  3VRP A;  3FWC A;  1MHO A;  4MZL A;  4DRW A;  1F54 A;  3OX5 A;  1KCY A;  1IGV A;  2CCM A;  1JSA A;  3DD4 A;  4PCW A;  1GGW A;  2BL0 B;  2DOQ A;  1REC A;  2E30 A;  3HX4 A;  1JUO A;  1A2X A;  1Q80 A;  3BUW B;  2MHH A;  1J55 A;  1NWD A;  1SNL A;  2Q4U A;  4I5L B;  4M2Q A;  2MAZ A;  2PVB A;  1K93 D;  1K9P A;  2LVJ A;  4CFQ A;  1DGV A;  1ZFS A;  1CDM A;  1CDL A;  2KI4 C;  1X02 A;  3KF9 A;  1CFD A;  4YBH B;  3LK0 A;  2B1U A;  2K7O A;  4AQI A;  4GGF C;  2OS8 C;  4R1E A;  5ER5 A;  5AER A;  3IQQ A;  2KOT A;  1AP4 A;  1RRO A;  1SL9 A;  2I94 A;  4PE4 A;  1AK8 A;  2I18 A;  2F2O A;  2LAN A;  1ZAC A;  2LVV A;  1WRZ A;  4YGE B;  4WRI A;  1RJV A;  2E6W A;  2KFF A;  1DGU A;  2LLT A;  2G9B A;  2JT0 A;  3GOF A;  2LP3 A;  2M97 A;  1CFF A;  3BOW B;  1Y1A A;  4MVF A;  2SAS A;  4DCK A;  1MF8 B;  3EK8 A;  1BF5 A;  1B9A A;  1NP8 A;  2KI4 B;  3PAL A;  4QJ3 B;  4DS7 A;  2O5G A;  1SR6 C;  1K8U A;  2LVI A;  2OS8 B;  4YGC B;  4CFR A;  1KQV A;  3SG3 A;  1OMD A;  1MXE A;  1OZS A;  3DVM A;  4U8D A;  4N1G A;  2CTN A;  2WCF A;  1DF0 B;  1UP5 A;  1BOC A;  2KHN A;  2JPT A;  1M45 A;  1SY9 A;  1B8L A;  1EJ3 A;  2ZN8 A;  1AJ4 A;  1UHK A;  2K7C A;  3TDI A;  4TNC A;  5I2O A;  5GQQ C;  2H61 C;  2I2R E;  3OHM B;  4PDZ A;  1F8H A;  1FI5 A;  5HLO A;  2K61 A;  4QJ5 B;  1DTL A;  2BBN A;  2BCX A;  4OVN F;  2V53 A;  3VRN A;  1SR6 B;  5I2Q A;  2WOR A;  2F3Z A;  1UWO A;  2M7N A;  2M9G A;  4YI8 A;  5AAN A;  1BG1 A;  1XFU O;  2LE9 B;  1J1D A;  2M29 A;  1KFX L;  2LMU A;  2JT3 A;  1TNP A;  3PFV A;  3FS7 A;  1CDN A;  2L50 A;  1QV1 A;  2NCO A;  2OPO A;  1H8B A;  1LA0 A;  1IRJ A;  2Y1N A;  1YUS A;  1G33 A;  3AAK A;  3HCM A;  1S1E A;  3BUN B;  4C0L A;  4AQJ A;  2JNX A;  1UHH A;  2KNE A;  2BCA A;  2LMV A;  1M39 A;  1LA3 A;  2Q91 A;  2JXC A;  2ZN9 A;  1F71 A;  1AVS A;  1IQ3 A;  3A8R A;  1S6C A;  3SIA A;  2F33 A;  2KI6 C;  2M8U A;  3BUO B;  3WNX B;  4I5N B;  1B1G A;  3KPX A;  3GK2 A;  1RFJ A;  1H4B A;  4ORC B;  1DMO A;  1XO5 A;  1GJY A;  2WND A;  3LCP C;  5JJG A;  4YGB B;  2NXQ A;  1UHJ A;  3M0W A;  1TNW A;  2L98 A;  3IQO A;  2L4H A;  1SK6 D;  3EKJ A;  5KTY A;  1CLM A;  1V1G A;  3D0Y A;  2MA2 A;  4YRU A;  1E8A A;  5ER4 X;  1CB1 A;  1SCV A;  1QAT A;  4GAO A;  1EL4 A;  2MJW B;  1QTX A;  2P6B B;  1TOP A;  4GBA A;  1CTR A;  1WY9 A;  1CKK A;  3GK4 X;  1U5I B;  3O4Y A;  4CID A;  5J3X A;  3VRQ A;  3NSO A;  4L9M A;  3PM8 A;  2GV5 A;  1CM4 A;  3BUX B;  1IJ5 A;  5D69 A;  2KDH A;  1MQ1 A;  5AXI A;  5JOL A;  4PHN A;  2QAC A;  3I5I C;  2BKI B;  1JC2 A;  1K90 D;  3EKH A;  4ETO A;  2IS9 A;  1BMO A;  4JWQ A;  3I5H C;  3RLZ A; 
#chains in the Genus database with same CATH topology
 1CNP A;  1UHN A;  2SCP A;  4ORA B;  1S5G Y;  1CLB A;  1BLQ A;  4YGD B;  5TNC A;  4MRY A;  2PAS A;  3D73 A;  1Y1X A;  2JU0 A;  2BE6 A;  1M31 A;  1C3Y A;  2HQW A;  4ORB B;  2KQY A;  5CPV A;  2LAP A;  3BXK A;  3VRR A;  4PE0 A;  3NXA A;  4QJ4 B;  1PK0 D;  1W7J B;  3I5I B;  3DVJ A;  4DIR A;  1S6J A;  1DJW A;  1KSO A;  3AAJ A;  3KO0 A;  3BFB A;  3I5G C;  3OP0 A;  3CR4 X;  1C7V A;  2KAX A;  1GQM A;  1DJX A;  1J1E A;  1JF0 A;  1NCX A;  2AAO A;  2L5X B;  3I5H B;  5D3O A;  3V2L A;  2KAV A;  1QJT A;  3EVR A;  4OR9 B;  1FPW A;  3LL8 B;  1N0Y A;  2JC2 A;  3RM1 A;  1DJI A;  3CLN A;  1NIW A;  2KSP A;  4NDB A;  5DKR A;  5HKW A;  1OOJ A;  4E68 A;  1F4O A;  3D74 A;  5K89 A;  1UUS A;  1B4C A;  5HYD A;  2QPT A;  1XK4 A;  3CZT X;  3LLE A;  4PHJ A;  1EG4 A;  1N65 A;  1XVJ A;  1EXR A;  1J7O A;  1WRK A;  4MBE A;  5DIC A;  4P2Y B;  1KSM A;  2MRD A;  2WC6 A;  1L2O C;  2QEH A;  3B6X A;  2PSR A;  1OSA A;  1TCO B;  5I8N A;  4I5K A;  2JTT A;  2CBL A;  1QLK A;  3I5G B;  1RK9 A;  1WDC C;  1IWQ A;  2FCD A;  1AUI B;  1ZOT B;  3CR2 A;  1A4P A;  3ZWH A;  3SS4 A;  3CTN A;  3AKB A;  2LLU A;  1B7T Y;  4M2O A;  5AEQ A;  1EG3 A;  3DF0 B;  2WC8 A;  3A4U B;  4HRG A;  1MR8 A;  1YX7 A;  2I7A A;  2H8V A;  1SMG A;  2F2P A;  2LCP A;  1DJG A;  3BOW A;  4FQT A;  4NDC A;  2TN4 A;  3S0E A;  1IIO A;  2KYC A;  4MLW A;  4F7F A;  1JWD A;  1L2O B;  2LMT A;  2WCK A;  3QME A;  3WHT B;  3TUY C;  1KFX S;  3FE9 A;  1OE9 B;  1IQ5 A;  5HKZ A;  2WCE A;  1AJ5 A;  1WLZ A;  1WDC B;  2RGI A;  3PAT A;  4GGF A;  3SG5 A;  1QVI Y;  5HKY A;  1OOG A;  1YUT A;  5CSN A;  1YRU B;  1DF0 A;  1TCF A;  2PYQ A;  3OGN A;  4GPL B;  1OOF A;  1SBJ A;  2WOS A;  3SG7 A;  1F55 A;  3BQ3 A;  1M46 A;  3NHT A;  1C3Z A;  1V1F A;  2K0J A;  1XA5 A;  2PMY A;  4N1F A;  4HRH A;  3PM2 A;  1BU3 A;  1LKJ A;  2A4J A;  5PAL A;  1DQE A;  4CLN A;  5G08 A;  3JTD C;  1OW4 A;  3TUY B;  4PHK A;  1DVI A;  3KEV A;  1SPY A;  3SS5 A;  2CT9 A;  2M7L A;  4D1E A;  1TNQ A;  2KGR A;  3BUM B;  3SIB A;  3C1V A;  4MEW A;  4XJK B;  1JBA A;  3TDZ A;  5AFP A;  3TZ1 A;  3H4S E;  2JXL A;  4IL1 A;  3F45 A;  1YUR A;  4WQ2 A;  4KYN A;  1MXL C;  1G8I A;  1GGZ A;  1SCM C;  1L7Z A;  5HLV A;  2Y5I A;  2Y1M A;  2AMI A;  4GUK A;  1MWN A;  3RLZ A;  1CMF A;  3SJS A;  3IVT A;  2JTZ A;  5DKN A;  1XFR A;  3FE6 A;  4A4C A;  4OCI A;  1N2D A;  1VRK A;  2HPS A;  2H61 A;  4PE1 A;  2JOJ A;  3EVV A;  4HSZ A;  3JTD B;  5KSZ A;  1ODB A;  2EC6 C;  2HET A;  1F70 A;  1D1O A;  2JWW A;  1FI6 A;  1YVH A;  3CZ1 A;  2G2B A;  2LV7 A;  2GGM A;  1PSR A;  2LLS A;  4NDD A;  3VRO A;  2MLE C;  2LUC A;  2LHL A;  2M49 B;  4JQ0 D;  4ZCU A;  3JVT C;  2WCJ A;  1A75 B;  3CDN A;  1SCM B;  2QDI A;  2CNP A;  3VGO A;  2K7D A;  2LC5 A;  1FF1 A;  4GNK B;  3SG2 A;  2COL B;  2Y4Q A;  5KU1 A;  1BR1 B;  2ZND A;  1K95 A;  3PN7 C;  4I5J A;  1XYD A;  2BEC A;  5IBW A;  2K8M B;  2WCH A;  3CZ2 A;  1TUJ A;  4P5O E;  1G4Y R;  1DJY A;  1BR4 B;  1S5G Z;  2M1U A;  2KYF A;  2EC6 B;  2K7B A;  1RTP 1;  2PRU A;  3B7A A;  1K9U A;  2NLN A;  2JNF A;  3LK1 A;  4ICB A;  2MBX A;  2FCE A;  1KFU L;  3QRX A;  1YX8 A;  1WRL A;  4A4B A;  4DUQ A;  2KBM A;  1KK8 B;  1NCY A;  1Y1U A;  2ZNE A;  1ORG A;  2WCM A;  4CPV A;  5D7F A;  2K60 A;  2ZKM X;  3O6B A;  1K2H A;  1C7W A;  1KK7 Y;  1NSH A;  1QXP A;  1OMR A;  1WLM A;  3JVT B;  4M2P A;  5FI2 A;  1TN4 A;  2LHI A;  1U5I A;  3E3R A;  1UHI A;  3BJH A;  1SYM A;  3S0A A;  2BBM A;  5FYX A;  3MSE B;  5EL2 A;  2BKH B;  3DYE A;  5DKQ A;  4YI9 A;  4UPG A;  1S26 D;  2FOT A;  3CZ0 A;  1QX5 B;  3PN7 B;  3VB1 A;  1XFW O;  2LP2 A;  2LUX A;  1IJ6 A;  2LNK A;  2L0P A;  2KI6 D;  1BOD A;  3TS5 C;  3EK7 A;  1IG5 A;  1NYA A;  3KHE A;  1K9K A;  1M63 B;  4JPZ B;  2BNX A;  3CGA A;  5FI7 A;  3EVU A;  3D76 A;  3PSR A;  2L2E A;  2M0R A;  2BAP A;  3R1V A;  1EH2 A;  1JF2 A;  3FE8 A;  1FBV A;  1SL7 A;  3PLF B;  4FQO A;  1DC1 A;  1XFY O;  4PAL A;  2ERB A;  1K94 A;  1J7Q A;  1KWO B;  2KQ6 A;  2KFG A;  4WQ3 A;  3NSK A;  1FW4 A;  4AOM A;  5BPJ A;  4MZK A;  4C0J A;  3DZT A;  1CMG A;  5CSJ A;  1B8R A;  1QIV A;  2NZ0 A;  4PE7 A;  1TIZ A;  3DVK A;  1B7T Z;  3I5F C;  4Q04 A;  1TRF A;  1OMV A;  4MZJ A;  4YGA A;  4OZD A;  1CM1 A;  3TS5 B;  2O60 A;  1CDP A;  3B88 A;  2KAY A;  1SKT A;  1ZMZ A;  2GTE A;  2PAL A;  3B87 A;  1B8C A;  3ICB A;  1LXF C;  2ZRT A;  4GFT A;  1NX1 A;  1QV0 A;  1BJF A;  1PSB A;  2F8P A;  2LM5 A;  5I2L A;  2F3Y A;  1A03 A;  1TNX A;  2R2I A;  1XFV O;  3DVE A;  1TTX A;  3L4L A;  4OKH A;  1QVI Z;  4NQG A;  1NPQ A;  1W7I B;  2ZFD A;  1PAL A;  1J7P A;  1CFP A;  2M3W A;  3O78 A;  1LIN A;  3SG6 A;  3I5F B;  1DJH A;  2MLF C;  3AKA A;  2EHB A;  3O2P A;  5CSF A;  1JFK A;  5HL1 A;  1SL8 A;  4BY4 A;  4PHM A;  1IH0 A;  1ALV A;  3OB1 B;  1YRT B;  2OTG C;  1CFC A;  1S36 A;  1YTZ C;  3ZNI A;  2JRF A;  3DF0 A;  4F0Z B;  2BCB A;  2D8N A;  1YVL A;  3BYA A;  2ISD A;  1A29 A;  1NX0 A;  1HQV A;  3D10 A;  3FWB A;  3L4A A;  1AHR A;  1NX2 A;  1R2U A;  1QX2 A;  4BY5 A;  1QLS A;  3OBV A;  1T14 A;  4GGN A;  4USL A;  1SRA A;  2BE4 A;  2VRG A;  2KGB C;  3NSI A;  2M1K B;  3DY9 A;  2HQ8 A;  1C07 A;  1K96 A;  1S6I A;  1PRW A;  3OB2 B;  2HF5 A;  2QEV A;  2OTG B;  3D0Y B;  2L4I A;  1DT7 B;  1KQM C;  3D77 A;  4ZCV A;  3SG4 A;  1QIW A;  2WCB A;  1PVB A;  4MN0 A;  4C0K A;  2YGU A;  3RZS A;  1QS7 A;  2GGZ A;  4HRE E;  3NHI A;  3K1E A;  3EG5 B;  1OZO A;  4N5X A;  2QEO A;  1SW8 A;  1KK8 C;  2K2A A;  1Y0V H;  3GK1 A;  3IF7 A;  4OV2 A;  2H2K A;  2CXJ A;  1XFX O;  1ZUZ A;  1HT9 A;  1B47 A;  2WC5 A;  1PVA A;  4FTG A;  2JZI A;  3TDU A;  1F4Q A;  1BT6 A;  1PUL A;  2KBI A;  5B8I B;  2JQ6 A;  4XJK A;  1IKU A;  2AUC A;  3EK4 A;  3L47 A;  1NCZ A;  3FIA A;  1MUX A;  1ALW A;  4XYN A;  1KQM B;  1KFU S;  2EGD A;  1R6P A;  4IJ7 A;  1JFJ A;  4MSP A;  5F6T A;  3CS1 A;  1XFZ O;  1NX3 A;  3CR5 X;  3WHU B;  3OX6 A;  1Y6W A;  1UUR A;  3N7H A;  2FJU B;  2LVK A;  2BL0 C;  3CWG A;  1NUB A;  1KK7 Z;  1XK4 C;  2NCP A;  3NSL A;  1S3P A;  1J7R A;  2L51 A;  1QAS A;  2JT8 A;  3R1O A;  3S0F A;  2KPH A;  2KFH A;  3K21 A;  4MRX A;  1QX7 A;  5CSI A;  1KWO C;  1RWY A;  1OQP A;  2ZRS A;  1YR5 A;  1CLL A;  1LVC D;  2K2F A;  3WXA A;  1DJZ A;  1YUU A;  2JUL A;  1A75 A;  3VRP A;  5FI6 A;  4JKT A;  1DEK A;  3FWC A;  1MHO A;  4MZL A;  4DRW A;  1F54 A;  3OX5 A;  1KCY A;  5I94 A;  3S0G A;  1IGV A;  2CCM A;  1JSA A;  3DD4 A;  4PCW A;  1GGW A;  2BL0 B;  2DOQ A;  1REC A;  2E30 A;  2L5Y A;  1OOI X;  3HX4 A;  1JUO A;  1A2X A;  1Q80 A;  3BUW B;  2MHH A;  1J55 A;  2P70 A;  1NWD A;  1SNL A;  2Q4U A;  4I5L B;  4M2Q A;  1TWO A;  2MAZ A;  2PVB A;  1K93 D;  1K9P A;  2LVJ A;  4CFQ A;  1DGV A;  1ZFS A;  1CDM A;  1CDL A;  2KI4 C;  3CAB A;  1X02 A;  3KF9 A;  3SS3 A;  1CFD A;  4YBH B;  3LK0 A;  2B1U A;  2K7O A;  4AQI A;  4GGF C;  2OS8 C;  4R1E A;  5ER5 A;  5AER A;  3IQQ A;  2KOT A;  1AP4 A;  1RRO A;  1SL9 A;  2I94 A;  4PE4 A;  1AK8 A;  2I18 A;  2F2O A;  2LAN A;  1ZAC A;  2LVV A;  3NGV A;  1WRZ A;  4YGE B;  4WRI A;  1DEL A;  1RJV A;  2E6W A;  3DXL A;  2KFF A;  1DGU A;  2LLT A;  2G9B A;  2JT0 A;  3GOF A;  2LP3 A;  2M97 A;  3PJI A;  1CFF A;  3BOW B;  1Y1A A;  4MVF A;  2SAS A;  4DCK A;  1MF8 B;  3EK8 A;  1BF5 A;  1B9A A;  1NP8 A;  2KI4 B;  3PAL A;  4QJ3 B;  4DS7 A;  2O5G A;  1SR6 C;  1K8U A;  2LVI A;  2OS8 B;  4YGC B;  4CFR A;  1SSE B;  1KQV A;  3SG3 A;  1OMD A;  1MXE A;  2KLD A;  1OZS A;  3DVM A;  4U8D A;  4N1G A;  2CTN A;  2WCF A;  1DF0 B;  1UP5 A;  1BOC A;  2KHN A;  2JPT A;  1M45 A;  1SY9 A;  3D78 A;  1B8L A;  3R1P A;  3O4X A;  1EJ3 A;  2ZN8 A;  1AJ4 A;  1UHK A;  2K7C A;  3TDI A;  4TNC A;  5I2O A;  5GQQ C;  2H61 C;  2I2R E;  3OHM B;  4PDZ A;  1F8H A;  1FI5 A;  3CYZ A;  2K61 A;  3D75 A;  5HLO A;  1DTL A;  2BBN A;  2BCX A;  4OVN F;  4QJ5 B;  2V53 A;  3VRN A;  1SR6 B;  5I2Q A;  2WOR A;  2F3Z A;  1UWO A;  2M7N A;  2M9G A;  4YI8 A;  5AAN A;  1BG1 A;  1XFU O;  2LE9 B;  1J1D A;  2M29 A;  1KFX L;  2LMU A;  2JT3 A;  1TNP A;  3UNW A;  3PFV A;  3FS7 A;  3UO9 A;  1CDN A;  2L50 A;  4INW A;  3B86 A;  1QV1 A;  1Z4H A;  2NCO A;  2OPO A;  1H8B A;  4INX A;  1LA0 A;  1P28 A;  1IRJ A;  2Y1N A;  1YUS A;  1G33 A;  2WCL A;  2KLE A;  3AAK A;  3HCM A;  1S1E A;  3BUN B;  4C0L A;  4AQJ A;  2JNX A;  1UHH A;  2KNE A;  2BCA A;  2LMV A;  1M39 A;  1LA3 A;  2Q91 A;  2JXC A;  2ZN9 A;  1F71 A;  1AVS A;  1IQ3 A;  3A8R A;  1S6C A;  3SIA A;  2F33 A;  2KI6 C;  2M8U A;  3BUO B;  3WNX B;  4I5N B;  1B1G A;  2PQL A;  3KPX A;  3GK2 A;  1RFJ A;  3R72 A;  1H4B A;  4ORC B;  1DMO A;  1XO5 A;  4PT1 A;  1GJY A;  2WND A;  3LCP C;  5JJG A;  4YGB B;  2FJY A;  2L2C A;  2NXQ A;  1UHJ A;  3M0W A;  1TNW A;  1Z2C B;  2L98 A;  3IQO A;  2L4H A;  1SK6 D;  3EKJ A;  3Q8I A;  1CLM A;  5KTY A;  1V1G A;  3D0Y A;  2MA2 A;  4YRU A;  1E8A A;  3BFH A;  5ER4 X;  1CB1 A;  1SCV A;  1QAT A;  4GAO A;  1EL4 A;  2MJW B;  1OOH A;  1QTX A;  2P6B B;  2QEB A;  1TOP A;  4GBA A;  1CTR A;  1WY9 A;  2JPO A;  1CKK A;  3GK4 X;  1U5I B;  3O4Y A;  3BFA A;  4CID A;  1TUZ A;  5J3X A;  3VRQ A;  1W9Z A;  3S0D A;  3NSO A;  4L9M A;  1GM0 A;  3PM8 A;  2GV5 A;  1CM4 A;  3BUX B;  1IJ5 A;  1QWV A;  2KDH A;  1MQ1 A;  5D69 A;  5AXI A;  5JOL A;  4PHN A;  2QAC A;  3I5I C;  2BKI B;  1JC2 A;  3S0B A;  2P71 A;  1K90 D;  3EKH A;  4ETO A;  1LS8 A;  2IS9 A;  1BMO A;  4JWQ A;  3I5H C;  4JD9 A; 
#chains in the Genus database with same CATH homology
 1CNP A;  1UHN A;  2SCP A;  4ORA B;  1S5G Y;  1CLB A;  1BLQ A;  4YGD B;  5TNC A;  4MRY A;  2PAS A;  1Y1X A;  2JU0 A;  2BE6 A;  1M31 A;  2HQW A;  4ORB B;  2KQY A;  5CPV A;  2LAP A;  3BXK A;  3VRR A;  4PE0 A;  3NXA A;  4QJ4 B;  1PK0 D;  1W7J B;  3I5I B;  3DVJ A;  4DIR A;  1S6J A;  1DJW A;  1KSO A;  3AAJ A;  3KO0 A;  3I5G C;  3OP0 A;  3CR4 X;  1C7V A;  2KAX A;  1GQM A;  1DJX A;  1J1E A;  1JF0 A;  1NCX A;  2AAO A;  2L5X B;  3I5H B;  2KAV A;  1QJT A;  3EVR A;  4OR9 B;  1FPW A;  3LL8 B;  1N0Y A;  2JC2 A;  3RM1 A;  1DJI A;  3CLN A;  1NIW A;  2KSP A;  4NDB A;  5DKR A;  5HKW A;  1OOJ A;  4E68 A;  1F4O A;  5K89 A;  1UUS A;  1B4C A;  5HYD A;  2QPT A;  1XK4 A;  3CZT X;  3LLE A;  4PHJ A;  1EG4 A;  1N65 A;  1XVJ A;  1EXR A;  1J7O A;  1WRK A;  4MBE A;  4P2Y B;  1KSM A;  2MRD A;  1L2O C;  2PSR A;  1OSA A;  1TCO B;  5I8N A;  4I5K A;  2JTT A;  2CBL A;  1QLK A;  3I5G B;  1RK9 A;  1WDC C;  1IWQ A;  2FCD A;  1AUI B;  1ZOT B;  3CR2 A;  1A4P A;  3ZWH A;  3CTN A;  3AKB A;  2LLU A;  1B7T Y;  4M2O A;  5AEQ A;  1EG3 A;  3DF0 B;  2WC8 A;  3A4U B;  4HRG A;  1MR8 A;  1YX7 A;  2I7A A;  1FI6 A;  1SMG A;  2F2P A;  2LCP A;  1DJG A;  3BOW A;  4NDC A;  2TN4 A;  2KYC A;  4MLW A;  1JWD A;  1L2O B;  2LMT A;  3WHT B;  3TUY C;  1KFX S;  1OE9 B;  1IQ5 A;  5HKZ A;  2WCE A;  1AJ5 A;  1WLZ A;  1WDC B;  2RGI A;  3PAT A;  4GGF A;  3SG5 A;  1QVI Y;  5HKY A;  1YUT A;  5CSN A;  1YRU B;  1DF0 A;  1TCF A;  4GPL B;  1SBJ A;  2WOS A;  3SG7 A;  1F55 A;  3BQ3 A;  1M46 A;  1V1F A;  2K0J A;  1XA5 A;  2PMY A;  4N1F A;  4HRH A;  1BU3 A;  1LKJ A;  2A4J A;  5PAL A;  4CLN A;  5G08 A;  3JTD C;  3TUY B;  4PHK A;  1DVI A;  3KEV A;  1SPY A;  2CT9 A;  2M7L A;  4D1E A;  1TNQ A;  2KGR A;  3BUM B;  3SIB A;  3C1V A;  4MEW A;  4XJK B;  1JBA A;  3TDZ A;  5AFP A;  3TZ1 A;  3H4S E;  2JXL A;  4IL1 A;  3F45 A;  1YUR A;  4WQ2 A;  5HLV A;  1MXL C;  1G8I A;  1GGZ A;  1SCM C;  1L7Z A;  2Y5I A;  2Y1M A;  2AMI A;  4GUK A;  1MWN A;  1CMF A;  3SJS A;  2JTZ A;  5DKN A;  4A4C A;  4OCI A;  1N2D A;  1VRK A;  2HPS A;  2H61 A;  4PE1 A;  2JOJ A;  3EVV A;  4HSZ A;  3JTD B;  5KSZ A;  1ODB A;  2EC6 C;  2HET A;  1F70 A;  1D1O A;  2JWW A;  1YVH A;  2G2B A;  2LV7 A;  2GGM A;  1PSR A;  2LLS A;  4NDD A;  3VRO A;  2MLE C;  2LUC A;  2LHL A;  2M49 B;  4JQ0 D;  4ZCU A;  3JVT C;  1A75 B;  1SCM B;  2CNP A;  3VGO A;  2K7D A;  2LC5 A;  1FF1 A;  4GNK B;  3SG2 A;  2COL B;  2Y4Q A;  1BR1 B;  2ZND A;  1K95 A;  3PN7 C;  4I5J A;  1XYD A;  2BEC A;  5IBW A;  2K8M B;  4P5O E;  1G4Y R;  1DJY A;  1BR4 B;  1S5G Z;  2M1U A;  2KYF A;  2EC6 B;  2K7B A;  1RTP 1;  2PRU A;  5KU1 A;  1K9U A;  2NLN A;  2JNF A;  3LK1 A;  4ICB A;  2MBX A;  2FCE A;  1KFU L;  3QRX A;  1YX8 A;  1WRL A;  4A4B A;  4DUQ A;  2KBM A;  1KK8 B;  1NCY A;  1Y1U A;  2ZNE A;  4CPV A;  5D7F A;  2ZKM X;  3O6B A;  1K2H A;  1C7W A;  1KK7 Y;  1NSH A;  1QXP A;  1OMR A;  1WLM A;  3JVT B;  4M2P A;  1TN4 A;  2LHI A;  1U5I A;  3E3R A;  1UHI A;  1SYM A;  2BBM A;  5FYX A;  3MSE B;  2BKH B;  5DKQ A;  4YI9 A;  4UPG A;  1S26 D;  2FOT A;  3PN7 B;  1QX5 B;  1XFW O;  2LP2 A;  2LUX A;  1IJ6 A;  2LNK A;  2L0P A;  2KI6 D;  1BOD A;  3TS5 C;  3EK7 A;  1IG5 A;  1NYA A;  3KHE A;  1K9K A;  1M63 B;  4JPZ B;  3CGA A;  3EVU A;  3PSR A;  2L2E A;  2M0R A;  1EH2 A;  1JF2 A;  1FBV A;  1SL7 A;  3PLF B;  4FQO A;  1J7Q A;  1XFY O;  4PAL A;  1K94 A;  1KWO B;  2KQ6 A;  2KFG A;  4WQ3 A;  3NSK A;  1FW4 A;  4AOM A;  5BPJ A;  4MZK A;  4C0J A;  1CMG A;  5CSJ A;  1B8R A;  1QIV A;  2NZ0 A;  4PE7 A;  1TIZ A;  3DVK A;  1B7T Z;  3I5F C;  4Q04 A;  1TRF A;  1OMV A;  4MZJ A;  4YGA A;  1CM1 A;  3TS5 B;  2O60 A;  1CDP A;  2KAY A;  1SKT A;  1ZMZ A;  2PAL A;  1B8C A;  3ICB A;  1LXF C;  2ZRT A;  4GFT A;  1NX1 A;  1QV0 A;  1BJF A;  1PSB A;  2F8P A;  2LM5 A;  5I2L A;  2F3Y A;  1A03 A;  1TNX A;  2R2I A;  1XFV O;  3DVE A;  1TTX A;  4OKH A;  1QVI Z;  4NQG A;  1NPQ A;  1W7I B;  2ZFD A;  1PAL A;  1J7P A;  1CFP A;  2M3W A;  3O78 A;  1LIN A;  3SG6 A;  3I5F B;  1DJH A;  2MLF C;  3AKA A;  2EHB A;  3O2P A;  5CSF A;  1JFK A;  1SL8 A;  4BY4 A;  4PHM A;  1IH0 A;  1ALV A;  3OB1 B;  1YRT B;  2OTG C;  1CFC A;  1S36 A;  1YTZ C;  3ZNI A;  2JRF A;  3DF0 A;  4F0Z B;  2BCB A;  2D8N A;  1YVL A;  3BYA A;  2ISD A;  1A29 A;  1NX0 A;  1HQV A;  3D10 A;  3FWB A;  1AHR A;  1NX2 A;  1R2U A;  1QX2 A;  4BY5 A;  1QLS A;  4GGN A;  4USL A;  1SRA A;  2BE4 A;  2VRG A;  2KGB C;  3NSI A;  2M1K B;  2HQ8 A;  1C07 A;  1K96 A;  1S6I A;  1PRW A;  3OB2 B;  2HF5 A;  2OTG B;  3D0Y B;  2L4I A;  1DT7 B;  1KQM C;  4ZCV A;  3SG4 A;  1QIW A;  2WCB A;  1PVB A;  4MN0 A;  4C0K A;  1QS7 A;  2GGZ A;  4HRE E;  1OZO A;  4N5X A;  1SW8 A;  1KK8 C;  2K2A A;  1Y0V H;  3GK1 A;  3IF7 A;  4OV2 A;  2H2K A;  2CXJ A;  1XFX O;  1ZUZ A;  1HT9 A;  1B47 A;  1PVA A;  4FTG A;  2JZI A;  3TDU A;  1F4Q A;  1BT6 A;  1PUL A;  2KBI A;  5B8I B;  2JQ6 A;  4XJK A;  1IKU A;  2AUC A;  3EK4 A;  1NCZ A;  3FIA A;  1MUX A;  1ALW A;  4XYN A;  1KQM B;  1KFU S;  2EGD A;  1R6P A;  1JFJ A;  4MSP A;  5F6T A;  3CS1 A;  1XFZ O;  1NX3 A;  3CR5 X;  3WHU B;  3OX6 A;  1Y6W A;  1UUR A;  2FJU B;  2LVK A;  2BL0 C;  3CWG A;  1NUB A;  1KK7 Z;  1XK4 C;  2NCP A;  3NSL A;  1S3P A;  1J7R A;  2L51 A;  1QAS A;  2JT8 A;  4MRX A;  2KFH A;  3K21 A;  1QX7 A;  5CSI A;  1KWO C;  1RWY A;  1OQP A;  2ZRS A;  1YR5 A;  1CLL A;  1LVC D;  2K2F A;  3WXA A;  1DJZ A;  1YUU A;  2JUL A;  1A75 A;  3VRP A;  3FWC A;  1MHO A;  4MZL A;  4DRW A;  1F54 A;  3OX5 A;  1KCY A;  1IGV A;  2CCM A;  1JSA A;  3DD4 A;  4PCW A;  1GGW A;  2BL0 B;  2DOQ A;  1REC A;  2E30 A;  3HX4 A;  1JUO A;  1A2X A;  1Q80 A;  3BUW B;  2MHH A;  1J55 A;  1NWD A;  1SNL A;  2Q4U A;  4I5L B;  4M2Q A;  2MAZ A;  2PVB A;  1K93 D;  1K9P A;  2LVJ A;  4CFQ A;  1DGV A;  1ZFS A;  1CDM A;  1CDL A;  2KI4 C;  1X02 A;  3KF9 A;  1CFD A;  4YBH B;  3LK0 A;  2B1U A;  2K7O A;  4AQI A;  4GGF C;  2OS8 C;  4R1E A;  5ER5 A;  5AER A;  3IQQ A;  2KOT A;  1AP4 A;  1RRO A;  1SL9 A;  2I94 A;  4PE4 A;  1AK8 A;  2I18 A;  2F2O A;  2LAN A;  1ZAC A;  2LVV A;  1WRZ A;  4YGE B;  4WRI A;  1RJV A;  2E6W A;  2KFF A;  1DGU A;  2LLT A;  2G9B A;  2JT0 A;  3GOF A;  2LP3 A;  2M97 A;  1CFF A;  3BOW B;  1Y1A A;  4MVF A;  2SAS A;  4DCK A;  1MF8 B;  3EK8 A;  1BF5 A;  1B9A A;  1NP8 A;  2KI4 B;  3PAL A;  4QJ3 B;  4DS7 A;  2O5G A;  1SR6 C;  1K8U A;  2LVI A;  2OS8 B;  4YGC B;  4CFR A;  1KQV A;  3SG3 A;  1OMD A;  1MXE A;  1OZS A;  3DVM A;  4U8D A;  4N1G A;  2CTN A;  2WCF A;  1DF0 B;  1UP5 A;  1BOC A;  2KHN A;  2JPT A;  1M45 A;  1SY9 A;  1B8L A;  1EJ3 A;  2ZN8 A;  1AJ4 A;  1UHK A;  2K7C A;  3TDI A;  4TNC A;  5I2O A;  5GQQ C;  2H61 C;  2I2R E;  3OHM B;  4PDZ A;  1F8H A;  1FI5 A;  5HLO A;  2K61 A;  4QJ5 B;  1DTL A;  2BBN A;  2BCX A;  4OVN F;  2V53 A;  3VRN A;  1SR6 B;  5I2Q A;  2WOR A;  2F3Z A;  1UWO A;  2M7N A;  2M9G A;  4YI8 A;  5AAN A;  1BG1 A;  1XFU O;  2LE9 B;  1J1D A;  2M29 A;  1KFX L;  2LMU A;  2JT3 A;  1TNP A;  3PFV A;  3FS7 A;  1CDN A;  2L50 A;  1QV1 A;  2NCO A;  2OPO A;  1H8B A;  1LA0 A;  1IRJ A;  2Y1N A;  1YUS A;  1G33 A;  3AAK A;  3HCM A;  1S1E A;  3BUN B;  4C0L A;  4AQJ A;  2JNX A;  1UHH A;  2KNE A;  2BCA A;  2LMV A;  1M39 A;  1LA3 A;  2Q91 A;  2JXC A;  2ZN9 A;  1F71 A;  1AVS A;  1IQ3 A;  3A8R A;  1S6C A;  3SIA A;  2F33 A;  2KI6 C;  2M8U A;  3BUO B;  3WNX B;  4I5N B;  1B1G A;  3KPX A;  3GK2 A;  1RFJ A;  1H4B A;  4ORC B;  1DMO A;  1XO5 A;  1GJY A;  2WND A;  3LCP C;  5JJG A;  4YGB B;  2NXQ A;  1UHJ A;  3M0W A;  1TNW A;  2L98 A;  3IQO A;  2L4H A;  1SK6 D;  3EKJ A;  5KTY A;  1CLM A;  1V1G A;  3D0Y A;  2MA2 A;  4YRU A;  1E8A A;  5ER4 X;  1CB1 A;  1SCV A;  1QAT A;  4GAO A;  1EL4 A;  2MJW B;  1QTX A;  2P6B B;  1TOP A;  4GBA A;  1CTR A;  1WY9 A;  1CKK A;  3GK4 X;  1U5I B;  3O4Y A;  4CID A;  5J3X A;  3VRQ A;  3NSO A;  4L9M A;  3PM8 A;  2GV5 A;  1CM4 A;  3BUX B;  1IJ5 A;  5D69 A;  2KDH A;  1MQ1 A;  5AXI A;  5JOL A;  4PHN A;  2QAC A;  3I5I C;  2BKI B;  1JC2 A;  1K90 D;  3EKH A;  4ETO A;  2IS9 A;  1BMO A;  4JWQ A;  3I5H C;  3RLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...