1EXRA

The 1.0 angstrom crystal structure of ca+2 bound calmodulin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
146
structure length
146
Chain Sequence
EQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title The 1.0 A crystal structure of Ca(2+)-bound calmodulin: an analysis of disorder and implications for functionally relevant plasticity
pubmed doi rcsb
source organism Paramecium tetraurelia
molecule tags Metal transport
total genus 57
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2000-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1exrA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1exrA02
4FQOA 2LC5A 1S3PA 1NPQA 4P2YB 2ISDA 2F2PA 1KFUL 1OZOA 1PVBA 2WOSA 1K2HA 1JF2A 2CT9A 2LLSA 5JJGA 1DMOA 1PSRA 3WXAA 4ETOA 2M1UA 3JVTC 1Y1AA 2NCOA 5I2QA 1S36A 1DT7B 3QRXA 1XYDA 2LLUA 2ZRTA 1IKUA 1BT6A 2GGZA 1L2OB 2KFFA 1NIWA 3SJSA 2KOTA 1QX2A 2LAPA 4YGAA 1CLBA 4CFQA 1J1DA 1KSMA 3I5GC 1M46A 1W7IB 3E3RA 1S1EA 2KQYA 3O2PA 4MEWA 1F70A 1J7QA 2WCFA 1OE9B 4YGDB 1KSOA 2MA2A 1SK6D 4CFRA 3TS5C 2A4JA 4ORCB 4GAOA 1YTZC 5FYXA 2JQ6A 1BODA 1CMGA 1ALWA 2R2IA 5AFPA 2KI4B 2JNXA 2LV7A 2EGDA 4OV2A 2M29A 3KHEA 2KGRA 2OS8B 4WRIA 1M63B 1N0YA 2LANA 1WRLA 1FF1A 2ZNEA 3JTDB 2SASA 4HREE 1E8AA 1GJYA 2QACA 3NSKA 1QASA 2JWWA 4AQJA 4GUKA 4YGBB 1KFXL 2PALA 4MRYA 5HKZA 1EL4A 5CSJA 1CDPA 3SG2A 4R1EA 1SL8A 3VRPA 3OP0A 5HYDA 1YUTA 2AAOA 2G9BA 1NSHA 4WQ2A 5AXIA 2BL0C 1AUIB 1EG4A 1S5GY 3ZNIA 1V1FA 1MQ1A 1YRTB 4PE1A 2BCAA 4GGFA 3DD4A 1QX5B 4N1FA 2M7LA 2BECA 1HQVA 1XVJA 3PLFB 2KBMA 3C1VA 1OMVA 4Q04A 2LMVA 1S6IA 1R6PA 3OB1B 4PHJA 4MN0A 2JXCA 1K9PA 3AKBA 1PALA 4D1EA 1M31A 1W7JB 4YGEB 4C0KA 2LVKA 1SMGA 1AHRA 1OZSA 4HRGA 2AMIA 1IG5A 3CR4X 4JPZB 1IRJA 4GGFC 3O6BA 2ZRSA 1A29A 1XFZO 3OX5A 1NCXA 4E68A 2TN4A 4USLA 1F71A 2GV5A 1CM4A 1YVLA 5KSZA 1CM1A 2M3WA 2O60A 2JOJA 4U8DA 2KFHA 1F54A 3IF7A 3TUYB 1Y1UA 2L98A 1DGUA 1UHHA 2HQ8A 5K89A 1ALVA 3O4YA 1JC2A 3VGOA 1CTRA 2MRDA 2L5XB 4M2PA 2CNPA 1QJTA 1Y0VH 1XK4A 1TNWA 3GK1A 1AVSA 3PATA 2HF5A 4PHMA 1SCMB 1RWYA 1JSAA 2DOQA 2M7NA 1AJ5A 1KQMB 1MR8A 5HKWA 3ZWHA 2K0JA 1BLQA 1SBJA 4DCKA 2LM5A 4BY4A 1L2OC 3FS7A 2O5GA 3FWCA 4A4CA 1QX7A 3GOFA 2H61A 5JOLA 1TNPA 1H4BA 1UHKA 1DJZA 1XK4C 2Y5IA 2M49B 1RTP1 1FW4A 2L4HA 2MBXA 2HETA 5J3XA 3TDIA 4YRUA 1BOCA 3PSRA 1SR6B 1NX3A 2KAYA 4MZJA 2AUCA 1DTLA 2ZN8A 1B8RA 1KK8B 1BF5A 1SNLA 3NSOA 2LCPA 1RROA 2CCMA 3TZ1A 1EXRA 2LUCA 3BXKA 2K7CA 3AAKA 3PN7B 1OMDA 1ZMZA 4TNCA 2KI4C 1SPYA 4I5LB 4PCWA 1WRKA 2OS8C 2JNFA 1QIWA 1SL7A 1Y6WA 3MSEB 1F55A 3JTDC 3RM1A 2NCPA 1C07A 1GQMA 1DF0B 2COLB 2GGMA 2HQWA 4C0LA 1DJIA 1MWNA 1NX0A 4F0ZB 2KYFA 3CS1A 3WNXB 1PSBA 1A03A 2KNEA 2KDHA 1PVAA 3ICBA 1QTXA 1QVIZ 1G8IA 3TDZA 3KPXA 1DGVA 2E6WA 1IJ6A 1QV0A 1IJ5A 1SW8A 4MZLA 1KK7Y 1Y1XA 1K94A 2BKHB 1B7TY 4GBAA 2V53A 4CPVA 4YI9A 1RFJA 3EVUA 2K61A 4DRWA 5AANA 3BYAA 4QJ4B 3EK7A 4QJ5B 1M45A 1NCZA 4XJKB 1J1EA 1NYAA 2FJUB 3M0WA 1UWOA 2E30A 1YRUB 5TNCA 1A75B 1NCYA 4CIDA 3SG4A 2WCBA 2HPSA 1J7OA 1DJXA 1K9UA 1TNQA 1A2XA 1BJFA 1BG1A 4NQGA 2H2KA 3KF9A 2NZ0A 2M1KB 3CR5X 1SYMA 1NP8A 1QV1A 1UP5A 3FWBA 2JXLA 1QS7A 3NXAA 5DKNA 2KQ6A 1CKKA 2RGIA 1K96A 2L50A 2L51A 3LCPC 1R2UA 3CR2A 3DVKA 1IQ3A 2FCEA 1N2DA 4GPLB 4I5NB 2MLEC 4QJ3B 1YVHA 2NLNA 2F2OA 1DJGA 4HRHA 2WNDA 4MVFA 1D1OA 4ZCVA 3NSIA 4OKHA 1KK7Z 1UURA 4GFTA 1B7TZ 1S26D 2CTNA 1CDMA 4PDZA 3CZTX 3DVJA 2OPOA 4I5KA 3EVVA 2KAXA 4M2OA 4NDBA 4OVNF 4UPGA 2OTGC 1LVCD 1NUBA 2LVVA 1LXFC 5PALA 1WY9A 2JZIA 3LLEA 3TUYC 4P5OE 2K8MB 2ZNDA 2LMTA 2EC6B 4NDDA 4YGCB 2M97A 1IH0A 3EKHA 2VRGA 3D10A 1RJVA 2JU0A 4GNKB 1BR1B 1AK8A 1PRWA 3A8RA 1K8UA 1SY9A 2LLTA 1B9AA 1IWQA 4AOMA 1YX8A 2WCEA 2LE9B 2PSRA 1SCMC 2LVJA 3EKJA 3KEVA 5D69A 3BUMB 3VRRA 1S5GZ 1KQMC 2MJWB 3LL8B 1CMFA 1JWDA 4PHNA 1YX7A 1SRAA 2KSPA 1FBVA 1BU3A 2JT3A 1LKJA 3I5IB 1UHJA 1QIVA 1K9KA 3DVMA 2M8UA 1S6JA 4MSPA 3LK1A 3RLZA 2Y4QA 1QATA 1TRFA 1YR5A 2K7BA 3VRQA 1JF0A 1B8LA 1WDCB 1SR6C 1DF0A 5KU1A 3PFVA 1KWOB 1KFUS 3CGAA 3WHUB 1RK9A 2LUXA 2LMUA 1OOJA 3D0YB 2I18A 3HCMA 1QXPA 1OQPA 2IS9A 3I5HB 3OB2B 3IQQA 3F45A 2K2FA 3SG7A 2BE4A 2LHIA 5HLVA 4M2QA 2Q4UA 1TN4A 3A4UB 2PVBA 3BUOB 3FIAA 4XJKA 1K95A 2MLFC 2JTTA 4PHKA 2L2EA 1A75A 1TTXA 1EG3A 2P6BB 1BR4B 1NX1A 1DJYA 2H61C 2KYCA 3CLNA 3SG3A 1CFPA 3SIBA 1JUOA 2I7AA 1PK0D 1CFDA 2BCXA 4ZCUA 3BUXB 1HT9A 2FOTA 3HX4A 1K93D 4GGNA 1C7WA 3TDUA 1GGWA 5DKRA 2MAZA 2F3ZA 1LA3A 2ZKMX 1MXEA 2KAVA 3IQOA 4PE7A 5AERA 1FI5A 5F6TA 3EVRA 1MHOA 1J55A 3BUNB 3I5FB 1TOPA 4MZKA 2KGBC 2L0PA 2CXJA 3CTNA 1KFXS 3BOWB 1WLZA 1B47A 1YUSA 1JFKA 3O78A 1FPWA 1CFCA 2JT8A 1CLMA 1RECA 3JVTB 2L4IA 1LINA 1TNXA 1EJ3A 3BQ3A 2BBNA 4DUQA 3AKAA 3BUWB 4WQ3A 4YI8A 1ZACA 3WHTB 1MF8B 1B1GA 1KQVA 1U5IB 3CWGA 5IBWA 1H8BA 3EK8A 1M39A 1XFVO 2JRFA 3SG6A 1TCOB 2F33A 1F4OA 2KFGA 4CLNA 2JT0A 5AEQA 2WC8A 1IGVA 3I5GB 2F8PA 3VRNA 2K2AA 1YUUA 1DJWA 2LHLA 3SIAA 2EC6C 4ORBB 1XFYO 3GK2A 2K7OA 4BY5A 4IL1A 1C7VA 2G2BA 3KO0A 2M0RA 4DS7A 1MXLC 1CDLA 4OCIA 3TS5B 1WRZA 1X02A 4FTGA 2JTZA 1CNPA 1K90D 2I2RE 4AQIA 4I5JA 2PRUA 5BPJA 2WORA 2Y1MA 5CPVA 5I8NA 3PM8A 1N65A 3GK4X 2NXQA 2JULA 3I5IC 1XO5A 3D0YA 1YURA 3DF0A 1QLKA 1J7PA 2M9GA 2FCDA 5ER5A 4JWQA 1BMOA 1CLLA 1DVIA 3LK0A 1SCVA 2B1UA 2SCPA 1VRKA 1AP4A 2PMYA 4YBHB 2MHHA 1CB1A 2ZN9A 5HLOA 2Y1NA 1L7ZA 1NX2A 1WDCC 5DKQA 1XA5A 1UUSA 1ZOTB 1CFFA 1F8HA 1UHNA 1B8CA 1G33A 1MUXA 2EHBA 4L9MA 1JFJA 1KWOC 2BL0B 1J7RA 1S6CA 1TCFA 1UHIA 2I94A 2LP3A 5I2LA 2JC2A 5GQQC 2JPTA 3OHMB 5HKYA 1F4QA 2D8NA 2BKIB 1QLSA 1TIZA 3I5HC 3NSLA 2KI6C 4N5XA 1XFUO 2Q91A 1GGZA 1WLMA 4PE0A 3K21A 1DJHA 1CDNA 1IQ5A 1ZUZA 1G4YR 1LA0A 1ZFSA 2QPTA 3PALA 5CSNA 1V1GA 4ORAB 2LNKA 2OTGB 5CSIA 1OSAA 1NWDA 3VROA 1FI6A 1KK8C 5I2OA 4HSZA 1PULA 4ICBA 2KBIA 1B4CA 4MBEA 4C0JA 2KHNA 3SG5A 3DF0B 3AAJA 5D7FA 1EH2A 3PN7C 1SKTA 4MRXA 4OR9B 2CBLA 4NDCA 2K7DA 1SL9A 1Q80A 4PE4A 5B8IB 1XFWO 3DVEA 1OMRA 3BOWA 2BCBA 5CSFA 2ZFDA 3H4SE 1A4PA 1ODBA 5G08A 3EK4A 1KCYA 4N1GA 2KI6D 3OX6A 2BBMA 4DIRA 1AJ4A 2F3YA 2PASA 2BE6A 3I5FC 5KTYA 1XFXO 4MLWA 2LVIA 5ER4X 4XYNA 1JBAA 1QVIY 4JQ0D 4A4BA 1U5IA 4PALA 2LP2A
chains in the Genus database with same CATH superfamily
4FQOA 2LC5A 1S3PA 1NPQA 4P2YB 2ISDA 2F2PA 1KFUL 1OZOA 1PVBA 2WOSA 1K2HA 1JF2A 2CT9A 2LLSA 5JJGA 1DMOA 1PSRA 3WXAA 4ETOA 3RZSA 2M1UA 3JVTC 1Y1AA 2NCOA 5I2QA 1S36A 1DT7B 3QRXA 1XYDA 2LLUA 2ZRTA 1IKUA 1BT6A 2GGZA 1L2OB 2KFFA 1NIWA 3SJSA 2KOTA 1QX2A 2LAPA 4YGAA 1CLBA 2GTEA 4CFQA 1J1DA 1KSMA 3I5GC 1M46A 1W7IB 3E3RA 1S1EA 2KQYA 3O2PA 4FQTA 4MEWA 1F70A 1J7QA 2WCFA 1OE9B 3Q8IA 4YGDB 1P28A 1KSOA 2MA2A 1SK6D 4CFRA 3TS5C 2A4JA 4ORCB 3V2LA 4GAOA 2L5YA 1YTZC 5FYXA 3SS5A 2JQ6A 3O4XA 1BODA 1CMGA 1ALWA 2R2IA 5AFPA 2KI4B 2JNXA 2LV7A 2EGDA 3BFHA 2M29A 3KHEA 2KGRA 4OV2A 2OS8B 4WRIA 1M63B 1N0YA 1ORGA 1WRLA 2LANA 3FE6A 2ZNEA 1DC1A 3JTDB 1FF1A 2SASA 4HREE 1E8AA 1GJYA 2QACA 3NSKA 1QASA 2JWWA 4AQJA 4GUKA 4YGBB 1KFXL 2PALA 4MRYA 5HKZA 1EL4A 5CSJA 1CDPA 3SG2A 4R1EA 1SL8A 3VRPA 3OP0A 5HYDA 3S0BA 1YUTA 2AAOA 2G9BA 1NSHA 4WQ2A 5AXIA 3B87A 2BL0C 1AUIB 1EG4A 1S5GY 2QEVA 3ZNIA 1V1FA 3D73A 1MQ1A 1OOHA 3SS4A 1YRTB 4PE1A 2BCAA 4GGFA 3DD4A 1QX5B 4N1FA 3PJIA 1Z2CB 2M7LA 1Z4HA 2BECA 1HQVA 1XVJA 3PLFB 2KBMA 3C1VA 1OMVA 4Q04A 2LMVA 1S6IA 3FE9A 1R6PA 3OB1B 4IJ7A 4MN0A 4PHJA 2JXCA 1K9PA 3QMEA 3AKBA 1PALA 4D1EA 1M31A 1W7JB 1DELA 4YGEB 4C0KA 2LVKA 1SMGA 1AHRA 1OZSA 4HRGA 2AMIA 1IG5A 3CR4X 4JPZB 1IRJA 4GGFC 3O6BA 2ZRSA 1A29A 1XFZO 3OX5A 1NCXA 4E68A 2TN4A 4USLA 1F71A 2GV5A 3B6XA 1CM4A 3CABA 1YVLA 5KSZA 1CM1A 5D3OA 2M3WA 2O60A 2JOJA 4U8DA 2QEOA 2KFHA 1F54A 3IF7A 3TUYB 1Y1UA 3B86A 2L98A 1DGUA 1UHHA 2HQ8A 5K89A 3UO9A 1ALVA 2P71A 3O4YA 1JC2A 3VGOA 3DY9A 1CTRA 2MRDA 2FJYA 2L5XB 4M2PA 2CNPA 1QJTA 2QEBA 1Y0VH 1XK4A 1TNWA 3GK1A 3NHIA 1AVSA 3PATA 2HF5A 4PHMA 1SCMB 1RWYA 1JSAA 2DOQA 2M7NA 1AJ5A 1KQMB 1MR8A 5HKWA 3ZWHA 3D77A 2K0JA 1BLQA 1SBJA 3L47A 4DCKA 2LM5A 4BY4A 1L2OC 2L2CA 3FS7A 2O5GA 3FWCA 3CDNA 4A4CA 1QX7A 3GOFA 2H61A 5JOLA 1TNPA 1H4BA 1UHKA 1DJZA 1XK4C 2Y5IA 2M49B 1RTP1 1FW4A 2L4HA 3IVTA 2MBXA 2HETA 5J3XA 3TDIA 4YRUA 1BOCA 3PSRA 1SR6B 1NX3A 2KAYA 2KPHA 2AUCA 4MZJA 1DTLA 2ZN8A 1GM0A 1B8RA 1KK8B 3OBVA 1BF5A 1SNLA 3CZ0A 3NSOA 2LCPA 1RROA 2CCMA 3TZ1A 1EXRA 2LUCA 3BXKA 1TUZA 2K7CA 3AAKA 3PN7B 1OMDA 1TWOA 1ZMZA 4TNCA 2KI4C 1SPYA 4I5LB 4PCWA 1WRKA 3UNWA 2OS8C 2WCKA 2JNFA 1QIWA 1SL7A 1Y6WA 3MSEB 1F55A 3JTDC 3RM1A 2NCPA 1C07A 1GQMA 1DF0B 2COLB 2GGMA 2HQWA 4C0LA 1DJIA 1MWNA 2QEHA 1NX0A 4F0ZB 2KYFA 3CS1A 3WNXB 1PSBA 1A03A 2KNEA 2KDHA 1PVAA 3ICBA 1QTXA 2JPOA 1QVIZ 1G8IA 3CZ1A 3TDZA 1JFJA 3KPXA 1DGVA 2E6WA 1IJ6A 3D74A 1QV0A 1IJ5A 1SW8A 4MZLA 1KK7Y 1Y1XA 1K94A 2BKHB 5I94A 1B7TY 4GBAA 2V53A 4CPVA 4YI9A 1RFJA 3EVUA 2K61A 2BAPA 4DRWA 3S0AA 1OOFA 5AANA 3BYAA 4QJ4B 3EK7A 4QJ5B 1M45A 1NCZA 4XJKB 1J1EA 1NYAA 2FJUB 3M0WA 1UWOA 2E30A 1YRUB 5TNCA 1A75B 1NCYA 4CIDA 3SG4A 3VB1A 1DEKA 2WCBA 2HPSA 1J7OA 1DJXA 1K9UA 1TNQA 1A2XA 1BJFA 1BG1A 4NQGA 2H2KA 3KF9A 2NZ0A 2M1KB 3CR5X 1SYMA 1NP8A 1QV1A 1UP5A 3FWBA 2JXLA 1QS7A 3NXAA 3K1EA 5DKNA 2KQ6A 1CKKA 2RGIA 1K96A 2L50A 2L51A 3LCPC 1R2UA 1OW4A 3CR2A 3DVKA 1IQ3A 2FCEA 1N2DA 2WC6A 4GPLB 4I5NB 2MLEC 4QJ3B 1YVHA 2NLNA 2F2OA 1DJGA 4HRHA 2WNDA 4MVFA 1D1OA 4ZCVA 3DXLA 3NSIA 4INWA 1KK7Z 1UURA 4OKHA 3BJHA 4GFTA 1B7TZ 1S26D 2CTNA 1CDMA 4PDZA 3CZTX 3DVJA 2OPOA 4I5KA 3EVVA 2KAXA 4M2OA 4INXA 4NDBA 4OVNF 2OTGC 1LVCD 1NUBA 2LVVA 1LXFC 5PALA 4UPGA 1WY9A 2JZIA 2YGUA 3LLEA 3TUYC 4P5OE 3NGVA 2K8MB 2ZNDA 3N7HA 2LMTA 2EC6B 4NDDA 4YGCB 2M97A 1IH0A 1QWVA 3EKHA 2VRGA 3D10A 1RJVA 2JU0A 4GNKB 1BR1B 1AK8A 1PRWA 3A8RA 1K8UA 1SY9A 2LLTA 1B9AA 1IWQA 4AOMA 1YX8A 4OZDA 1XFRA 2WCEA 2LE9B 2PSRA 1SCMC 2LVJA 3EKJA 3KEVA 5D69A 3BUMB 3VRRA 1S5GZ 1KQMC 2MJWB 3LL8B 1CMFA 1JWDA 4PHNA 1YX7A 1SRAA 2KSPA 1FBVA 1BU3A 2JT3A 1LKJA 2BNXA 3I5IB 3R1PA 1UHJA 1QIVA 1K9KA 3DVMA 2M8UA 1DQEA 1S6JA 3BFAA 4MSPA 3LK1A 3RLZA 2Y4QA 5FI6A 3DYEA 1QATA 1TRFA 1YR5A 2K7BA 3VRQA 1JF0A 1B8LA 1WDCB 3R72A 1SR6C 1DF0A 5KU1A 3PFVA 1KWOB 1KFUS 3CGAA 3WHUB 1RK9A 2LUXA 2LMUA 1OOJA 3D0YB 2I18A 3HCMA 1QXPA 1T14A 1OQPA 2IS9A 2WC5A 3I5HB 3IQQA 3F45A 2K2FA 2WCJA 3OB2B 3SG7A 2BE4A 2LHIA 5HLVA 4M2QA 2Q4UA 3S0FA 3D75A 1TN4A 3A4UB 3NHTA 2PVBA 3BUOB 3FIAA 4XJKA 1K95A 1SSEB 3B7AA 2MLFC 3DZTA 2JTTA 4PHKA 2L2EA 1A75A 2QDIA 5HKYA 1TTXA 1EG3A 2P6BB 1BR4B 1NX1A 1DJYA 2H61C 2KYCA 3CLNA 3SG3A 1IIOA 1CFPA 3D76A 1C3ZA 2WCHA 1JUOA 2I7AA 3SIBA 1PK0D 1CFDA 2BCXA 4ZCUA 3BUXB 1HT9A 2FOTA 3FE8A 3HX4A 1K93D 3CYZA 1C7WA 4GGNA 3TDUA 1GGWA 5DKRA 2MAZA 2F3ZA 1LA3A 2ZKMX 3D78A 1C3YA 1MXEA 2KAVA 4KYNA 3IQOA 4JD9A 4PE7A 4JKTA 5AERA 1FI5A 5F6TA 3EVRA 1MHOA 1J55A 3BUNB 3I5FB 1TOPA 4MZKA 3L4AA 2KGBC 2L0PA 2CXJA 3CTNA 1KFXS 3BOWB 1WLZA 5FI7A 3BFBA 1B47A 1YUSA 1JFKA 3O78A 1FPWA 3SS3A 1CFCA 2JT8A 2PYQA 3R1VA 1CLMA 1RECA 3JVTB 2L4IA 1LINA 1TNXA 1EJ3A 3BQ3A 2WCMA 2BBNA 4DUQA 3AKAA 3BUWB 4WQ3A 4YI8A 5DICA 1ZACA 3WHTB 1MF8B 1B1GA 1KQVA 3S0DA 1U5IB 3CWGA 5IBWA 1OOGA 1H8BA 3EK8A 1M39A 1XFVO 2JRFA 3SG6A 1TCOB 2F33A 1F4OA 2KFGA 4CLNA 2JT0A 5AEQA 2WC8A 1IGVA 3I5GB 2F8PA 3VRNA 2K2AA 1YUUA 1DJWA 2LHLA 3SIAA 2EC6C 2H8VA 4ORBB 1XFYO 3GK2A 2K7OA 4BY5A 4IL1A 1C7VA 2G2BA 3KO0A 2M0RA 4DS7A 1MXLC 1CDLA 4OCIA 3TS5B 1WRZA 1X02A 4FTGA 2JTZA 1CNPA 1K90D 2I2RE 4AQIA 4I5JA 2PRUA 5BPJA 2WORA 2Y1MA 5CPVA 5I8NA 3PM8A 1N65A 3GK4X 2NXQA 2JULA 2KLEA 4PT1A 3I5IC 1XO5A 3D0YA 1YURA 3DF0A 1QLKA 1J7PA 2M9GA 2FCDA 5ER5A 4JWQA 1BMOA 2K60A 1CLLA 1DVIA 3LK0A 1SCVA 2B1UA 2SCPA 1VRKA 1AP4A 2PMYA 4YBHB 2MHHA 1CB1A 5FI2A 2ZN9A 5HLOA 3S0GA 2Y1NA 1L7ZA 1NX2A 1WDCC 5DKQA 1XA5A 1ZOTB 1TUJA 1UUSA 1CFFA 1F8HA 1UHNA 1B8CA 1G33A 1MUXA 2EHBA 2WCLA 4L9MA 1KWOC 2BL0B 1J7RA 1S6CA 1TCFA 1UHIA 2I94A 2LP3A 5I2LA 2JC2A 3OGNA 2JPTA 3OHMB 5GQQC 1F4QA 2D8NA 2BKIB 1QLSA 1TIZA 3I5HC 1OOIX 3NSLA 2KI6C 4N5XA 1XFUO 2Q91A 4F7FA 1GGZA 1WLMA 4PE0A 3K21A 1LS8A 1DJHA 1CDNA 1IQ5A 1ZUZA 1G4YR 1ZFSA 1LA0A 2QPTA 1W9ZA 3PALA 5CSNA 1V1GA 4ORAB 2P70A 2LNKA 2ERBA 2OTGB 5CSIA 1OSAA 1NWDA 3VROA 1FI6A 1KK8C 5I2OA 4HSZA 1PULA 4ICBA 2KBIA 1B4CA 4MBEA 5EL2A 4C0JA 2KHNA 3SG5A 3DF0B 3AAJA 5D7FA 1EH2A 3PN7C 1SKTA 4MRXA 4OR9B 2CBLA 4NDCA 2K7DA 1SL9A 1Q80A 4PE4A 5B8IB 1XFWO 3R1OA 3DVEA 1OMRA 3BOWA 2BCBA 2KLDA 5CSFA 2ZFDA 2PQLA 3H4SE 1A4PA 3S0EA 1ODBA 5G08A 3EK4A 1KCYA 3PM2A 2KI6D 4N1GA 3L4LA 3OX6A 2BBMA 3B88A 1AJ4A 2F3YA 4DIRA 2PASA 2BE6A 5HL1A 3I5FC 5KTYA 1XFXO 3CZ2A 4MLWA 2LVIA 5ER4X 4XYNA 1JBAA 1QVIY 3EG5B 4JQ0D 4A4BA 1U5IA 4PALA 2LP2A
chains in the Genus database with same CATH topology
4FQOA 2LC5A 1S3PA 1NPQA 4P2YB 2ISDA 2F2PA 1KFUL 1OZOA 1PVBA 2WOSA 1K2HA 1JF2A 2CT9A 2LLSA 5JJGA 1DMOA 1PSRA 3WXAA 4ETOA 2M1UA 3JVTC 1Y1AA 2NCOA 5I2QA 1S36A 1DT7B 3QRXA 1XYDA 2LLUA 2ZRTA 1IKUA 1BT6A 2GGZA 1L2OB 2KFFA 1NIWA 3SJSA 2KOTA 1QX2A 2LAPA 4YGAA 1CLBA 4CFQA 1J1DA 1KSMA 3I5GC 1M46A 1W7IB 3E3RA 1S1EA 2KQYA 3O2PA 4MEWA 1F70A 1J7QA 2WCFA 1OE9B 4YGDB 1KSOA 2MA2A 1SK6D 4CFRA 3TS5C 2A4JA 4ORCB 4GAOA 1YTZC 5FYXA 2JQ6A 1BODA 1CMGA 1ALWA 2R2IA 5AFPA 2KI4B 2JNXA 2LV7A 2EGDA 4OV2A 2M29A 3KHEA 2KGRA 2OS8B 4WRIA 1M63B 1N0YA 2LANA 1WRLA 1FF1A 2ZNEA 3JTDB 2SASA 4HREE 1E8AA 1GJYA 2QACA 3NSKA 1QASA 2JWWA 4AQJA 4GUKA 4YGBB 1KFXL 2PALA 4MRYA 5HKZA 1EL4A 5CSJA 1CDPA 3SG2A 4R1EA 1SL8A 3VRPA 3OP0A 5HYDA 1YUTA 2AAOA 2G9BA 1NSHA 4WQ2A 5AXIA 2BL0C 1AUIB 1EG4A 1S5GY 3ZNIA 1V1FA 1MQ1A 1YRTB 4PE1A 2BCAA 4GGFA 3DD4A 1QX5B 4N1FA 2M7LA 2BECA 1HQVA 1XVJA 3PLFB 2KBMA 3C1VA 1OMVA 4Q04A 2LMVA 1S6IA 1R6PA 3OB1B 4PHJA 4MN0A 2JXCA 1K9PA 3AKBA 1PALA 4D1EA 1M31A 1W7JB 4YGEB 4C0KA 2LVKA 1SMGA 1AHRA 1OZSA 4HRGA 2AMIA 1IG5A 3CR4X 4JPZB 1IRJA 4GGFC 3O6BA 2ZRSA 1A29A 1XFZO 3OX5A 1NCXA 4E68A 2TN4A 4USLA 1F71A 2GV5A 1CM4A 1YVLA 5KSZA 1CM1A 2M3WA 2O60A 2JOJA 4U8DA 2KFHA 1F54A 3IF7A 3TUYB 1Y1UA 2L98A 1DGUA 1UHHA 2HQ8A 5K89A 1ALVA 3O4YA 1JC2A 3VGOA 1CTRA 2MRDA 2L5XB 4M2PA 2CNPA 1QJTA 1Y0VH 1XK4A 1TNWA 3GK1A 1AVSA 3PATA 2HF5A 4PHMA 1SCMB 1RWYA 1JSAA 2DOQA 2M7NA 1AJ5A 1KQMB 1MR8A 5HKWA 3ZWHA 2K0JA 1BLQA 1SBJA 4DCKA 2LM5A 4BY4A 1L2OC 3FS7A 2O5GA 3FWCA 4A4CA 1QX7A 3GOFA 2H61A 5JOLA 1TNPA 1H4BA 1UHKA 1DJZA 1XK4C 2Y5IA 2M49B 1RTP1 1FW4A 2L4HA 2MBXA 2HETA 5J3XA 3TDIA 4YRUA 1BOCA 3PSRA 1SR6B 1NX3A 2KAYA 4MZJA 2AUCA 1DTLA 2ZN8A 1B8RA 1KK8B 1BF5A 1SNLA 3NSOA 2LCPA 1RROA 2CCMA 3TZ1A 1EXRA 2LUCA 3BXKA 2K7CA 3AAKA 3PN7B 1OMDA 1ZMZA 4TNCA 2KI4C 1SPYA 4I5LB 4PCWA 1WRKA 2OS8C 2JNFA 1QIWA 1SL7A 1Y6WA 3MSEB 1F55A 3JTDC 3RM1A 2NCPA 1C07A 1GQMA 1DF0B 2COLB 2GGMA 2HQWA 4C0LA 1DJIA 1MWNA 1NX0A 4F0ZB 2KYFA 3CS1A 3WNXB 1PSBA 1A03A 2KNEA 2KDHA 1PVAA 3ICBA 1QTXA 1QVIZ 1G8IA 3TDZA 3KPXA 1DGVA 2E6WA 1IJ6A 1QV0A 1IJ5A 1SW8A 4MZLA 1KK7Y 1Y1XA 1K94A 2BKHB 1B7TY 4GBAA 2V53A 4CPVA 4YI9A 1RFJA 3EVUA 2K61A 4DRWA 5AANA 3BYAA 4QJ4B 3EK7A 4QJ5B 1M45A 1NCZA 4XJKB 1J1EA 1NYAA 2FJUB 3M0WA 1UWOA 2E30A 1YRUB 5TNCA 1A75B 1NCYA 4CIDA 3SG4A 2WCBA 2HPSA 1J7OA 1DJXA 1K9UA 1TNQA 1A2XA 1BJFA 1BG1A 4NQGA 2H2KA 3KF9A 2NZ0A 2M1KB 3CR5X 1SYMA 1NP8A 1QV1A 1UP5A 3FWBA 2JXLA 1QS7A 3NXAA 5DKNA 2KQ6A 1CKKA 2RGIA 1K96A 2L50A 2L51A 3LCPC 1R2UA 3CR2A 3DVKA 1IQ3A 2FCEA 1N2DA 4GPLB 4I5NB 2MLEC 4QJ3B 1YVHA 2NLNA 2F2OA 1DJGA 4HRHA 2WNDA 4MVFA 1D1OA 4ZCVA 3NSIA 4OKHA 1KK7Z 1UURA 4GFTA 1B7TZ 1S26D 2CTNA 1CDMA 4PDZA 3CZTX 3DVJA 2OPOA 4I5KA 3EVVA 2KAXA 4M2OA 4NDBA 4OVNF 4UPGA 2OTGC 1LVCD 1NUBA 2LVVA 1LXFC 5PALA 1WY9A 2JZIA 3LLEA 3TUYC 4P5OE 2K8MB 2ZNDA 2LMTA 2EC6B 4NDDA 4YGCB 2M97A 1IH0A 3EKHA 2VRGA 3D10A 1RJVA 2JU0A 4GNKB 1BR1B 1AK8A 1PRWA 3A8RA 1K8UA 1SY9A 2LLTA 1B9AA 1IWQA 4AOMA 1YX8A 2WCEA 2LE9B 2PSRA 1SCMC 2LVJA 3EKJA 3KEVA 5D69A 3BUMB 3VRRA 1S5GZ 1KQMC 2MJWB 3LL8B 1CMFA 1JWDA 4PHNA 1YX7A 1SRAA 2KSPA 1FBVA 1BU3A 2JT3A 1LKJA 3I5IB 1UHJA 1QIVA 1K9KA 3DVMA 2M8UA 1S6JA 4MSPA 3LK1A 3RLZA 2Y4QA 1QATA 1TRFA 1YR5A 2K7BA 3VRQA 1JF0A 1B8LA 1WDCB 1SR6C 1DF0A 5KU1A 3PFVA 1KWOB 1KFUS 3CGAA 3WHUB 1RK9A 2LUXA 2LMUA 1OOJA 3D0YB 2I18A 3HCMA 1QXPA 1OQPA 2IS9A 3I5HB 3OB2B 3IQQA 3F45A 2K2FA 3SG7A 2BE4A 2LHIA 5HLVA 4M2QA 2Q4UA 1TN4A 3A4UB 2PVBA 3BUOB 3FIAA 4XJKA 1K95A 2MLFC 2JTTA 4PHKA 2L2EA 1A75A 1TTXA 1EG3A 2P6BB 1BR4B 1NX1A 1DJYA 2H61C 2KYCA 3CLNA 3SG3A 1CFPA 3SIBA 1JUOA 2I7AA 1PK0D 1CFDA 2BCXA 4ZCUA 3BUXB 1HT9A 2FOTA 3HX4A 1K93D 4GGNA 1C7WA 3TDUA 1GGWA 5DKRA 2MAZA 2F3ZA 1LA3A 2ZKMX 1MXEA 2KAVA 3IQOA 4PE7A 5AERA 1FI5A 5F6TA 3EVRA 1MHOA 1J55A 3BUNB 3I5FB 1TOPA 4MZKA 2KGBC 2L0PA 2CXJA 3CTNA 1KFXS 3BOWB 1WLZA 1B47A 1YUSA 1JFKA 3O78A 1FPWA 1CFCA 2JT8A 1CLMA 1RECA 3JVTB 2L4IA 1LINA 1TNXA 1EJ3A 3BQ3A 2BBNA 4DUQA 3AKAA 3BUWB 4WQ3A 4YI8A 1ZACA 3WHTB 1MF8B 1B1GA 1KQVA 1U5IB 3CWGA 5IBWA 1H8BA 3EK8A 1M39A 1XFVO 2JRFA 3SG6A 1TCOB 2F33A 1F4OA 2KFGA 4CLNA 2JT0A 5AEQA 2WC8A 1IGVA 3I5GB 2F8PA 3VRNA 2K2AA 1YUUA 1DJWA 2LHLA 3SIAA 2EC6C 4ORBB 1XFYO 3GK2A 2K7OA 4BY5A 4IL1A 1C7VA 2G2BA 3KO0A 2M0RA 4DS7A 1MXLC 1CDLA 4OCIA 3TS5B 1WRZA 1X02A 4FTGA 2JTZA 1CNPA 1K90D 2I2RE 4AQIA 4I5JA 2PRUA 5BPJA 2WORA 2Y1MA 5CPVA 5I8NA 3PM8A 1N65A 3GK4X 2NXQA 2JULA 3I5IC 1XO5A 3D0YA 1YURA 3DF0A 1QLKA 1J7PA 2M9GA 2FCDA 5ER5A 4JWQA 1BMOA 1CLLA 1DVIA 3LK0A 1SCVA 2B1UA 2SCPA 1VRKA 1AP4A 2PMYA 4YBHB 2MHHA 1CB1A 2ZN9A 5HLOA 2Y1NA 1L7ZA 1NX2A 1WDCC 5DKQA 1XA5A 1UUSA 1ZOTB 1CFFA 1F8HA 1UHNA 1B8CA 1G33A 1MUXA 2EHBA 4L9MA 1JFJA 1KWOC 2BL0B 1J7RA 1S6CA 1TCFA 1UHIA 2I94A 2LP3A 5I2LA 2JC2A 5GQQC 2JPTA 3OHMB 5HKYA 1F4QA 2D8NA 2BKIB 1QLSA 1TIZA 3I5HC 3NSLA 2KI6C 4N5XA 1XFUO 2Q91A 1GGZA 1WLMA 4PE0A 3K21A 1DJHA 1CDNA 1IQ5A 1ZUZA 1G4YR 1LA0A 1ZFSA 2QPTA 3PALA 5CSNA 1V1GA 4ORAB 2LNKA 2OTGB 5CSIA 1OSAA 1NWDA 3VROA 1FI6A 1KK8C 5I2OA 4HSZA 1PULA 4ICBA 2KBIA 1B4CA 4MBEA 4C0JA 2KHNA 3SG5A 3DF0B 3AAJA 5D7FA 1EH2A 3PN7C 1SKTA 4MRXA 4OR9B 2CBLA 4NDCA 2K7DA 1SL9A 1Q80A 4PE4A 5B8IB 1XFWO 3DVEA 1OMRA 3BOWA 2BCBA 5CSFA 2ZFDA 3H4SE 1A4PA 1ODBA 5G08A 3EK4A 1KCYA 4N1GA 2KI6D 3OX6A 2BBMA 4DIRA 1AJ4A 2F3YA 2PASA 2BE6A 3I5FC 5KTYA 1XFXO 4MLWA 2LVIA 5ER4X 4XYNA 1JBAA 1QVIY 4JQ0D 4A4BA 1U5IA 4PALA 2LP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FQO A;  2LC5 A;  1S3P A;  1NPQ A;  4P2Y B;  2ISD A;  2F2P A;  1KFU L;  1OZO A;  1PVB A;  2WOS A;  1K2H A;  1JF2 A;  2CT9 A;  2LLS A;  5JJG A;  1DMO A;  1PSR A;  3WXA A;  4ETO A;  2M1U A;  3JVT C;  1Y1A A;  2NCO A;  5I2Q A;  1S36 A;  1DT7 B;  3QRX A;  1XYD A;  2LLU A;  2ZRT A;  1IKU A;  1BT6 A;  2GGZ A;  1L2O B;  2KFF A;  1NIW A;  3SJS A;  2KOT A;  1QX2 A;  2LAP A;  4YGA A;  1CLB A;  4CFQ A;  1J1D A;  1KSM A;  3I5G C;  1M46 A;  1W7I B;  3E3R A;  1S1E A;  2KQY A;  3O2P A;  4MEW A;  1F70 A;  1J7Q A;  2WCF A;  1OE9 B;  4YGD B;  1KSO A;  2MA2 A;  1SK6 D;  4CFR A;  3TS5 C;  2A4J A;  4ORC B;  4GAO A;  1YTZ C;  5FYX A;  2JQ6 A;  1BOD A;  1CMG A;  1ALW A;  2R2I A;  5AFP A;  2KI4 B;  2JNX A;  2LV7 A;  2EGD A;  4OV2 A;  2M29 A;  3KHE A;  2KGR A;  2OS8 B;  4WRI A;  1M63 B;  1N0Y A;  2LAN A;  1WRL A;  1FF1 A;  2ZNE A;  3JTD B;  2SAS A;  4HRE E;  1E8A A;  1GJY A;  2QAC A;  3NSK A;  1QAS A;  2JWW A;  4AQJ A;  4GUK A;  4YGB B;  1KFX L;  2PAL A;  4MRY A;  5HKZ A;  1EL4 A;  5CSJ A;  1CDP A;  3SG2 A;  4R1E A;  1SL8 A;  3VRP A;  3OP0 A;  5HYD A;  1YUT A;  2AAO A;  2G9B A;  1NSH A;  4WQ2 A;  5AXI A;  2BL0 C;  1AUI B;  1EG4 A;  1S5G Y;  3ZNI A;  1V1F A;  1MQ1 A;  1YRT B;  4PE1 A;  2BCA A;  4GGF A;  3DD4 A;  1QX5 B;  4N1F A;  2M7L A;  2BEC A;  1HQV A;  1XVJ A;  3PLF B;  2KBM A;  3C1V A;  1OMV A;  4Q04 A;  2LMV A;  1S6I A;  1R6P A;  3OB1 B;  4PHJ A;  4MN0 A;  2JXC A;  1K9P A;  3AKB A;  1PAL A;  4D1E A;  1M31 A;  1W7J B;  4YGE B;  4C0K A;  2LVK A;  1SMG A;  1AHR A;  1OZS A;  4HRG A;  2AMI A;  1IG5 A;  3CR4 X;  4JPZ B;  1IRJ A;  4GGF C;  3O6B A;  2ZRS A;  1A29 A;  1XFZ O;  3OX5 A;  1NCX A;  4E68 A;  2TN4 A;  4USL A;  1F71 A;  2GV5 A;  1CM4 A;  1YVL A;  5KSZ A;  1CM1 A;  2M3W A;  2O60 A;  2JOJ A;  4U8D A;  2KFH A;  1F54 A;  3IF7 A;  3TUY B;  1Y1U A;  2L98 A;  1DGU A;  1UHH A;  2HQ8 A;  5K89 A;  1ALV A;  3O4Y A;  1JC2 A;  3VGO A;  1CTR A;  2MRD A;  2L5X B;  4M2P A;  2CNP A;  1QJT A;  1Y0V H;  1XK4 A;  1TNW A;  3GK1 A;  1AVS A;  3PAT A;  2HF5 A;  4PHM A;  1SCM B;  1RWY A;  1JSA A;  2DOQ A;  2M7N A;  1AJ5 A;  1KQM B;  1MR8 A;  5HKW A;  3ZWH A;  2K0J A;  1BLQ A;  1SBJ A;  4DCK A;  2LM5 A;  4BY4 A;  1L2O C;  3FS7 A;  2O5G A;  3FWC A;  4A4C A;  1QX7 A;  3GOF A;  2H61 A;  5JOL A;  1TNP A;  1H4B A;  1UHK A;  1DJZ A;  1XK4 C;  2Y5I A;  2M49 B;  1RTP 1;  1FW4 A;  2L4H A;  2MBX A;  2HET A;  5J3X A;  3TDI A;  4YRU A;  1BOC A;  3PSR A;  1SR6 B;  1NX3 A;  2KAY A;  4MZJ A;  2AUC A;  1DTL A;  2ZN8 A;  1B8R A;  1KK8 B;  1BF5 A;  1SNL A;  3NSO A;  2LCP A;  1RRO A;  2CCM A;  3TZ1 A;  1EXR A;  2LUC A;  3BXK A;  2K7C A;  3AAK A;  3PN7 B;  1OMD A;  1ZMZ A;  4TNC A;  2KI4 C;  1SPY A;  4I5L B;  4PCW A;  1WRK A;  2OS8 C;  2JNF A;  1QIW A;  1SL7 A;  1Y6W A;  3MSE B;  1F55 A;  3JTD C;  3RM1 A;  2NCP A;  1C07 A;  1GQM A;  1DF0 B;  2COL B;  2GGM A;  2HQW A;  4C0L A;  1DJI A;  1MWN A;  1NX0 A;  4F0Z B;  2KYF A;  3CS1 A;  3WNX B;  1PSB A;  1A03 A;  2KNE A;  2KDH A;  1PVA A;  3ICB A;  1QTX A;  1QVI Z;  1G8I A;  3TDZ A;  3KPX A;  1DGV A;  2E6W A;  1IJ6 A;  1QV0 A;  1IJ5 A;  1SW8 A;  4MZL A;  1KK7 Y;  1Y1X A;  1K94 A;  2BKH B;  1B7T Y;  4GBA A;  2V53 A;  4CPV A;  4YI9 A;  1RFJ A;  3EVU A;  2K61 A;  4DRW A;  5AAN A;  3BYA A;  4QJ4 B;  3EK7 A;  4QJ5 B;  1M45 A;  1NCZ A;  4XJK B;  1J1E A;  1NYA A;  2FJU B;  3M0W A;  1UWO A;  2E30 A;  1YRU B;  5TNC A;  1A75 B;  1NCY A;  4CID A;  3SG4 A;  2WCB A;  2HPS A;  1J7O A;  1DJX A;  1K9U A;  1TNQ A;  1A2X A;  1BJF A;  1BG1 A;  4NQG A;  2H2K A;  3KF9 A;  2NZ0 A;  2M1K B;  3CR5 X;  1SYM A;  1NP8 A;  1QV1 A;  1UP5 A;  3FWB A;  2JXL A;  1QS7 A;  3NXA A;  5DKN A;  2KQ6 A;  1CKK A;  2RGI A;  1K96 A;  2L50 A;  2L51 A;  3LCP C;  1R2U A;  3CR2 A;  3DVK A;  1IQ3 A;  2FCE A;  1N2D A;  4GPL B;  4I5N B;  2MLE C;  4QJ3 B;  1YVH A;  2NLN A;  2F2O A;  1DJG A;  4HRH A;  2WND A;  4MVF A;  1D1O A;  4ZCV A;  3NSI A;  4OKH A;  1KK7 Z;  1UUR A;  4GFT A;  1B7T Z;  1S26 D;  2CTN A;  1CDM A;  4PDZ A;  3CZT X;  3DVJ A;  2OPO A;  4I5K A;  3EVV A;  2KAX A;  4M2O A;  4NDB A;  4OVN F;  4UPG A;  2OTG C;  1LVC D;  1NUB A;  2LVV A;  1LXF C;  5PAL A;  1WY9 A;  2JZI A;  3LLE A;  3TUY C;  4P5O E;  2K8M B;  2ZND A;  2LMT A;  2EC6 B;  4NDD A;  4YGC B;  2M97 A;  1IH0 A;  3EKH A;  2VRG A;  3D10 A;  1RJV A;  2JU0 A;  4GNK B;  1BR1 B;  1AK8 A;  1PRW A;  3A8R A;  1K8U A;  1SY9 A;  2LLT A;  1B9A A;  1IWQ A;  4AOM A;  1YX8 A;  2WCE A;  2LE9 B;  2PSR A;  1SCM C;  2LVJ A;  3EKJ A;  3KEV A;  5D69 A;  3BUM B;  3VRR A;  1S5G Z;  1KQM C;  2MJW B;  3LL8 B;  1CMF A;  1JWD A;  4PHN A;  1YX7 A;  1SRA A;  2KSP A;  1FBV A;  1BU3 A;  2JT3 A;  1LKJ A;  3I5I B;  1UHJ A;  1QIV A;  1K9K A;  3DVM A;  2M8U A;  1S6J A;  4MSP A;  3LK1 A;  3RLZ A;  2Y4Q A;  1QAT A;  1TRF A;  1YR5 A;  2K7B A;  3VRQ A;  1JF0 A;  1B8L A;  1WDC B;  1SR6 C;  1DF0 A;  5KU1 A;  3PFV A;  1KWO B;  1KFU S;  3CGA A;  3WHU B;  1RK9 A;  2LUX A;  2LMU A;  1OOJ A;  3D0Y B;  2I18 A;  3HCM A;  1QXP A;  1OQP A;  2IS9 A;  3I5H B;  3OB2 B;  3IQQ A;  3F45 A;  2K2F A;  3SG7 A;  2BE4 A;  2LHI A;  5HLV A;  4M2Q A;  2Q4U A;  1TN4 A;  3A4U B;  2PVB A;  3BUO B;  3FIA A;  4XJK A;  1K95 A;  2MLF C;  2JTT A;  4PHK A;  2L2E A;  1A75 A;  1TTX A;  1EG3 A;  2P6B B;  1BR4 B;  1NX1 A;  1DJY A;  2H61 C;  2KYC A;  3CLN A;  3SG3 A;  1CFP A;  3SIB A;  1JUO A;  2I7A A;  1PK0 D;  1CFD A;  2BCX A;  4ZCU A;  3BUX B;  1HT9 A;  2FOT A;  3HX4 A;  1K93 D;  4GGN A;  1C7W A;  3TDU A;  1GGW A;  5DKR A;  2MAZ A;  2F3Z A;  1LA3 A;  2ZKM X;  1MXE A;  2KAV A;  3IQO A;  4PE7 A;  5AER A;  1FI5 A;  5F6T A;  3EVR A;  1MHO A;  1J55 A;  3BUN B;  3I5F B;  1TOP A;  4MZK A;  2KGB C;  2L0P A;  2CXJ A;  3CTN A;  1KFX S;  3BOW B;  1WLZ A;  1B47 A;  1YUS A;  1JFK A;  3O78 A;  1FPW A;  1CFC A;  2JT8 A;  1CLM A;  1REC A;  3JVT B;  2L4I A;  1LIN A;  1TNX A;  1EJ3 A;  3BQ3 A;  2BBN A;  4DUQ A;  3AKA A;  3BUW B;  4WQ3 A;  4YI8 A;  1ZAC A;  3WHT B;  1MF8 B;  1B1G A;  1KQV A;  1U5I B;  3CWG A;  5IBW A;  1H8B A;  3EK8 A;  1M39 A;  1XFV O;  2JRF A;  3SG6 A;  1TCO B;  2F33 A;  1F4O A;  2KFG A;  4CLN A;  2JT0 A;  5AEQ A;  2WC8 A;  1IGV A;  3I5G B;  2F8P A;  3VRN A;  2K2A A;  1YUU A;  1DJW A;  2LHL A;  3SIA A;  2EC6 C;  4ORB B;  1XFY O;  3GK2 A;  2K7O A;  4BY5 A;  4IL1 A;  1C7V A;  2G2B A;  3KO0 A;  2M0R A;  4DS7 A;  1MXL C;  1CDL A;  4OCI A;  3TS5 B;  1WRZ A;  1X02 A;  4FTG A;  2JTZ A;  1CNP A;  1K90 D;  2I2R E;  4AQI A;  4I5J A;  2PRU A;  5BPJ A;  2WOR A;  2Y1M A;  5CPV A;  5I8N A;  3PM8 A;  1N65 A;  3GK4 X;  2NXQ A;  2JUL A;  3I5I C;  1XO5 A;  3D0Y A;  1YUR A;  3DF0 A;  1QLK A;  1J7P A;  2M9G A;  2FCD A;  5ER5 A;  4JWQ A;  1BMO A;  1CLL A;  1DVI A;  3LK0 A;  1SCV A;  2B1U A;  2SCP A;  1VRK A;  1AP4 A;  2PMY A;  4YBH B;  2MHH A;  1CB1 A;  2ZN9 A;  5HLO A;  2Y1N A;  1L7Z A;  1NX2 A;  1WDC C;  5DKQ A;  1XA5 A;  1UUS A;  1ZOT B;  1CFF A;  1F8H A;  1UHN A;  1B8C A;  1G33 A;  1MUX A;  2EHB A;  4L9M A;  1JFJ A;  1KWO C;  2BL0 B;  1J7R A;  1S6C A;  1TCF A;  1UHI A;  2I94 A;  2LP3 A;  5I2L A;  2JC2 A;  5GQQ C;  2JPT A;  3OHM B;  5HKY A;  1F4Q A;  2D8N A;  2BKI B;  1QLS A;  1TIZ A;  3I5H C;  3NSL A;  2KI6 C;  4N5X A;  1XFU O;  2Q91 A;  1GGZ A;  1WLM A;  4PE0 A;  3K21 A;  1DJH A;  1CDN A;  1IQ5 A;  1ZUZ A;  1G4Y R;  1LA0 A;  1ZFS A;  2QPT A;  3PAL A;  5CSN A;  1V1G A;  4ORA B;  2LNK A;  2OTG B;  5CSI A;  1OSA A;  1NWD A;  3VRO A;  1FI6 A;  1KK8 C;  5I2O A;  4HSZ A;  1PUL A;  4ICB A;  2KBI A;  1B4C A;  4MBE A;  4C0J A;  2KHN A;  3SG5 A;  3DF0 B;  3AAJ A;  5D7F A;  1EH2 A;  3PN7 C;  1SKT A;  4MRX A;  4OR9 B;  2CBL A;  4NDC A;  2K7D A;  1SL9 A;  1Q80 A;  4PE4 A;  5B8I B;  1XFW O;  3DVE A;  1OMR A;  3BOW A;  2BCB A;  5CSF A;  2ZFD A;  3H4S E;  1A4P A;  1ODB A;  5G08 A;  3EK4 A;  1KCY A;  4N1G A;  2KI6 D;  3OX6 A;  2BBM A;  4DIR A;  1AJ4 A;  2F3Y A;  2PAS A;  2BE6 A;  3I5F C;  5KTY A;  1XFX O;  4MLW A;  2LVI A;  5ER4 X;  4XYN A;  1JBA A;  1QVI Y;  4JQ0 D;  4A4B A;  1U5I A;  4PAL A;  2LP2 A; 
#chains in the Genus database with same CATH topology
 4FQO A;  2LC5 A;  1S3P A;  1NPQ A;  4P2Y B;  2ISD A;  2F2P A;  1KFU L;  1OZO A;  1PVB A;  2WOS A;  1K2H A;  1JF2 A;  2CT9 A;  2LLS A;  5JJG A;  1DMO A;  1PSR A;  3WXA A;  4ETO A;  3RZS A;  2M1U A;  3JVT C;  1Y1A A;  2NCO A;  5I2Q A;  1S36 A;  1DT7 B;  3QRX A;  1XYD A;  2LLU A;  2ZRT A;  1IKU A;  1BT6 A;  2GGZ A;  1L2O B;  2KFF A;  1NIW A;  3SJS A;  2KOT A;  1QX2 A;  2LAP A;  4YGA A;  1CLB A;  2GTE A;  4CFQ A;  1J1D A;  1KSM A;  3I5G C;  1M46 A;  1W7I B;  3E3R A;  1S1E A;  2KQY A;  3O2P A;  4FQT A;  4MEW A;  1F70 A;  1J7Q A;  2WCF A;  1OE9 B;  3Q8I A;  4YGD B;  1P28 A;  1KSO A;  2MA2 A;  1SK6 D;  4CFR A;  3TS5 C;  2A4J A;  4ORC B;  3V2L A;  4GAO A;  2L5Y A;  1YTZ C;  5FYX A;  3SS5 A;  2JQ6 A;  3O4X A;  1BOD A;  1CMG A;  1ALW A;  2R2I A;  5AFP A;  2KI4 B;  2JNX A;  2LV7 A;  2EGD A;  3BFH A;  2M29 A;  3KHE A;  2KGR A;  4OV2 A;  2OS8 B;  4WRI A;  1M63 B;  1N0Y A;  1ORG A;  1WRL A;  2LAN A;  3FE6 A;  2ZNE A;  1DC1 A;  3JTD B;  1FF1 A;  2SAS A;  4HRE E;  1E8A A;  1GJY A;  2QAC A;  3NSK A;  1QAS A;  2JWW A;  4AQJ A;  4GUK A;  4YGB B;  1KFX L;  2PAL A;  4MRY A;  5HKZ A;  1EL4 A;  5CSJ A;  1CDP A;  3SG2 A;  4R1E A;  1SL8 A;  3VRP A;  3OP0 A;  5HYD A;  3S0B A;  1YUT A;  2AAO A;  2G9B A;  1NSH A;  4WQ2 A;  5AXI A;  3B87 A;  2BL0 C;  1AUI B;  1EG4 A;  1S5G Y;  2QEV A;  3ZNI A;  1V1F A;  3D73 A;  1MQ1 A;  1OOH A;  3SS4 A;  1YRT B;  4PE1 A;  2BCA A;  4GGF A;  3DD4 A;  1QX5 B;  4N1F A;  3PJI A;  1Z2C B;  2M7L A;  1Z4H A;  2BEC A;  1HQV A;  1XVJ A;  3PLF B;  2KBM A;  3C1V A;  1OMV A;  4Q04 A;  2LMV A;  1S6I A;  3FE9 A;  1R6P A;  3OB1 B;  4IJ7 A;  4MN0 A;  4PHJ A;  2JXC A;  1K9P A;  3QME A;  3AKB A;  1PAL A;  4D1E A;  1M31 A;  1W7J B;  1DEL A;  4YGE B;  4C0K A;  2LVK A;  1SMG A;  1AHR A;  1OZS A;  4HRG A;  2AMI A;  1IG5 A;  3CR4 X;  4JPZ B;  1IRJ A;  4GGF C;  3O6B A;  2ZRS A;  1A29 A;  1XFZ O;  3OX5 A;  1NCX A;  4E68 A;  2TN4 A;  4USL A;  1F71 A;  2GV5 A;  3B6X A;  1CM4 A;  3CAB A;  1YVL A;  5KSZ A;  1CM1 A;  5D3O A;  2M3W A;  2O60 A;  2JOJ A;  4U8D A;  2QEO A;  2KFH A;  1F54 A;  3IF7 A;  3TUY B;  1Y1U A;  3B86 A;  2L98 A;  1DGU A;  1UHH A;  2HQ8 A;  5K89 A;  3UO9 A;  1ALV A;  2P71 A;  3O4Y A;  1JC2 A;  3VGO A;  3DY9 A;  1CTR A;  2MRD A;  2FJY A;  2L5X B;  4M2P A;  2CNP A;  1QJT A;  2QEB A;  1Y0V H;  1XK4 A;  1TNW A;  3GK1 A;  3NHI A;  1AVS A;  3PAT A;  2HF5 A;  4PHM A;  1SCM B;  1RWY A;  1JSA A;  2DOQ A;  2M7N A;  1AJ5 A;  1KQM B;  1MR8 A;  5HKW A;  3ZWH A;  3D77 A;  2K0J A;  1BLQ A;  1SBJ A;  3L47 A;  4DCK A;  2LM5 A;  4BY4 A;  1L2O C;  2L2C A;  3FS7 A;  2O5G A;  3FWC A;  3CDN A;  4A4C A;  1QX7 A;  3GOF A;  2H61 A;  5JOL A;  1TNP A;  1H4B A;  1UHK A;  1DJZ A;  1XK4 C;  2Y5I A;  2M49 B;  1RTP 1;  1FW4 A;  2L4H A;  3IVT A;  2MBX A;  2HET A;  5J3X A;  3TDI A;  4YRU A;  1BOC A;  3PSR A;  1SR6 B;  1NX3 A;  2KAY A;  2KPH A;  2AUC A;  4MZJ A;  1DTL A;  2ZN8 A;  1GM0 A;  1B8R A;  1KK8 B;  3OBV A;  1BF5 A;  1SNL A;  3CZ0 A;  3NSO A;  2LCP A;  1RRO A;  2CCM A;  3TZ1 A;  1EXR A;  2LUC A;  3BXK A;  1TUZ A;  2K7C A;  3AAK A;  3PN7 B;  1OMD A;  1TWO A;  1ZMZ A;  4TNC A;  2KI4 C;  1SPY A;  4I5L B;  4PCW A;  1WRK A;  3UNW A;  2OS8 C;  2WCK A;  2JNF A;  1QIW A;  1SL7 A;  1Y6W A;  3MSE B;  1F55 A;  3JTD C;  3RM1 A;  2NCP A;  1C07 A;  1GQM A;  1DF0 B;  2COL B;  2GGM A;  2HQW A;  4C0L A;  1DJI A;  1MWN A;  2QEH A;  1NX0 A;  4F0Z B;  2KYF A;  3CS1 A;  3WNX B;  1PSB A;  1A03 A;  2KNE A;  2KDH A;  1PVA A;  3ICB A;  1QTX A;  2JPO A;  1QVI Z;  1G8I A;  3CZ1 A;  3TDZ A;  1JFJ A;  3KPX A;  1DGV A;  2E6W A;  1IJ6 A;  3D74 A;  1QV0 A;  1IJ5 A;  1SW8 A;  4MZL A;  1KK7 Y;  1Y1X A;  1K94 A;  2BKH B;  5I94 A;  1B7T Y;  4GBA A;  2V53 A;  4CPV A;  4YI9 A;  1RFJ A;  3EVU A;  2K61 A;  2BAP A;  4DRW A;  3S0A A;  1OOF A;  5AAN A;  3BYA A;  4QJ4 B;  3EK7 A;  4QJ5 B;  1M45 A;  1NCZ A;  4XJK B;  1J1E A;  1NYA A;  2FJU B;  3M0W A;  1UWO A;  2E30 A;  1YRU B;  5TNC A;  1A75 B;  1NCY A;  4CID A;  3SG4 A;  3VB1 A;  1DEK A;  2WCB A;  2HPS A;  1J7O A;  1DJX A;  1K9U A;  1TNQ A;  1A2X A;  1BJF A;  1BG1 A;  4NQG A;  2H2K A;  3KF9 A;  2NZ0 A;  2M1K B;  3CR5 X;  1SYM A;  1NP8 A;  1QV1 A;  1UP5 A;  3FWB A;  2JXL A;  1QS7 A;  3NXA A;  3K1E A;  5DKN A;  2KQ6 A;  1CKK A;  2RGI A;  1K96 A;  2L50 A;  2L51 A;  3LCP C;  1R2U A;  1OW4 A;  3CR2 A;  3DVK A;  1IQ3 A;  2FCE A;  1N2D A;  2WC6 A;  4GPL B;  4I5N B;  2MLE C;  4QJ3 B;  1YVH A;  2NLN A;  2F2O A;  1DJG A;  4HRH A;  2WND A;  4MVF A;  1D1O A;  4ZCV A;  3DXL A;  3NSI A;  4INW A;  1KK7 Z;  1UUR A;  4OKH A;  3BJH A;  4GFT A;  1B7T Z;  1S26 D;  2CTN A;  1CDM A;  4PDZ A;  3CZT X;  3DVJ A;  2OPO A;  4I5K A;  3EVV A;  2KAX A;  4M2O A;  4INX A;  4NDB A;  4OVN F;  2OTG C;  1LVC D;  1NUB A;  2LVV A;  1LXF C;  5PAL A;  4UPG A;  1WY9 A;  2JZI A;  2YGU A;  3LLE A;  3TUY C;  4P5O E;  3NGV A;  2K8M B;  2ZND A;  3N7H A;  2LMT A;  2EC6 B;  4NDD A;  4YGC B;  2M97 A;  1IH0 A;  1QWV A;  3EKH A;  2VRG A;  3D10 A;  1RJV A;  2JU0 A;  4GNK B;  1BR1 B;  1AK8 A;  1PRW A;  3A8R A;  1K8U A;  1SY9 A;  2LLT A;  1B9A A;  1IWQ A;  4AOM A;  1YX8 A;  4OZD A;  1XFR A;  2WCE A;  2LE9 B;  2PSR A;  1SCM C;  2LVJ A;  3EKJ A;  3KEV A;  5D69 A;  3BUM B;  3VRR A;  1S5G Z;  1KQM C;  2MJW B;  3LL8 B;  1CMF A;  1JWD A;  4PHN A;  1YX7 A;  1SRA A;  2KSP A;  1FBV A;  1BU3 A;  2JT3 A;  1LKJ A;  2BNX A;  3I5I B;  3R1P A;  1UHJ A;  1QIV A;  1K9K A;  3DVM A;  2M8U A;  1DQE A;  1S6J A;  3BFA A;  4MSP A;  3LK1 A;  3RLZ A;  2Y4Q A;  5FI6 A;  3DYE A;  1QAT A;  1TRF A;  1YR5 A;  2K7B A;  3VRQ A;  1JF0 A;  1B8L A;  1WDC B;  3R72 A;  1SR6 C;  1DF0 A;  5KU1 A;  3PFV A;  1KWO B;  1KFU S;  3CGA A;  3WHU B;  1RK9 A;  2LUX A;  2LMU A;  1OOJ A;  3D0Y B;  2I18 A;  3HCM A;  1QXP A;  1T14 A;  1OQP A;  2IS9 A;  2WC5 A;  3I5H B;  3IQQ A;  3F45 A;  2K2F A;  2WCJ A;  3OB2 B;  3SG7 A;  2BE4 A;  2LHI A;  5HLV A;  4M2Q A;  2Q4U A;  3S0F A;  3D75 A;  1TN4 A;  3A4U B;  3NHT A;  2PVB A;  3BUO B;  3FIA A;  4XJK A;  1K95 A;  1SSE B;  3B7A A;  2MLF C;  3DZT A;  2JTT A;  4PHK A;  2L2E A;  1A75 A;  2QDI A;  5HKY A;  1TTX A;  1EG3 A;  2P6B B;  1BR4 B;  1NX1 A;  1DJY A;  2H61 C;  2KYC A;  3CLN A;  3SG3 A;  1IIO A;  1CFP A;  3D76 A;  1C3Z A;  2WCH A;  1JUO A;  2I7A A;  3SIB A;  1PK0 D;  1CFD A;  2BCX A;  4ZCU A;  3BUX B;  1HT9 A;  2FOT A;  3FE8 A;  3HX4 A;  1K93 D;  3CYZ A;  1C7W A;  4GGN A;  3TDU A;  1GGW A;  5DKR A;  2MAZ A;  2F3Z A;  1LA3 A;  2ZKM X;  3D78 A;  1C3Y A;  1MXE A;  2KAV A;  4KYN A;  3IQO A;  4JD9 A;  4PE7 A;  4JKT A;  5AER A;  1FI5 A;  5F6T A;  3EVR A;  1MHO A;  1J55 A;  3BUN B;  3I5F B;  1TOP A;  4MZK A;  3L4A A;  2KGB C;  2L0P A;  2CXJ A;  3CTN A;  1KFX S;  3BOW B;  1WLZ A;  5FI7 A;  3BFB A;  1B47 A;  1YUS A;  1JFK A;  3O78 A;  1FPW A;  3SS3 A;  1CFC A;  2JT8 A;  2PYQ A;  3R1V A;  1CLM A;  1REC A;  3JVT B;  2L4I A;  1LIN A;  1TNX A;  1EJ3 A;  3BQ3 A;  2WCM A;  2BBN A;  4DUQ A;  3AKA A;  3BUW B;  4WQ3 A;  4YI8 A;  5DIC A;  1ZAC A;  3WHT B;  1MF8 B;  1B1G A;  1KQV A;  3S0D A;  1U5I B;  3CWG A;  5IBW A;  1OOG A;  1H8B A;  3EK8 A;  1M39 A;  1XFV O;  2JRF A;  3SG6 A;  1TCO B;  2F33 A;  1F4O A;  2KFG A;  4CLN A;  2JT0 A;  5AEQ A;  2WC8 A;  1IGV A;  3I5G B;  2F8P A;  3VRN A;  2K2A A;  1YUU A;  1DJW A;  2LHL A;  3SIA A;  2EC6 C;  2H8V A;  4ORB B;  1XFY O;  3GK2 A;  2K7O A;  4BY5 A;  4IL1 A;  1C7V A;  2G2B A;  3KO0 A;  2M0R A;  4DS7 A;  1MXL C;  1CDL A;  4OCI A;  3TS5 B;  1WRZ A;  1X02 A;  4FTG A;  2JTZ A;  1CNP A;  1K90 D;  2I2R E;  4AQI A;  4I5J A;  2PRU A;  5BPJ A;  2WOR A;  2Y1M A;  5CPV A;  5I8N A;  3PM8 A;  1N65 A;  3GK4 X;  2NXQ A;  2JUL A;  2KLE A;  4PT1 A;  3I5I C;  1XO5 A;  3D0Y A;  1YUR A;  3DF0 A;  1QLK A;  1J7P A;  2M9G A;  2FCD A;  5ER5 A;  4JWQ A;  1BMO A;  2K60 A;  1CLL A;  1DVI A;  3LK0 A;  1SCV A;  2B1U A;  2SCP A;  1VRK A;  1AP4 A;  2PMY A;  4YBH B;  2MHH A;  1CB1 A;  5FI2 A;  2ZN9 A;  5HLO A;  3S0G A;  2Y1N A;  1L7Z A;  1NX2 A;  1WDC C;  5DKQ A;  1XA5 A;  1ZOT B;  1TUJ A;  1UUS A;  1CFF A;  1F8H A;  1UHN A;  1B8C A;  1G33 A;  1MUX A;  2EHB A;  2WCL A;  4L9M A;  1KWO C;  2BL0 B;  1J7R A;  1S6C A;  1TCF A;  1UHI A;  2I94 A;  2LP3 A;  5I2L A;  2JC2 A;  3OGN A;  2JPT A;  3OHM B;  5GQQ C;  1F4Q A;  2D8N A;  2BKI B;  1QLS A;  1TIZ A;  3I5H C;  1OOI X;  3NSL A;  2KI6 C;  4N5X A;  1XFU O;  2Q91 A;  4F7F A;  1GGZ A;  1WLM A;  4PE0 A;  3K21 A;  1LS8 A;  1DJH A;  1CDN A;  1IQ5 A;  1ZUZ A;  1G4Y R;  1ZFS A;  1LA0 A;  2QPT A;  1W9Z A;  3PAL A;  5CSN A;  1V1G A;  4ORA B;  2P70 A;  2LNK A;  2ERB A;  2OTG B;  5CSI A;  1OSA A;  1NWD A;  3VRO A;  1FI6 A;  1KK8 C;  5I2O A;  4HSZ A;  1PUL A;  4ICB A;  2KBI A;  1B4C A;  4MBE A;  5EL2 A;  4C0J A;  2KHN A;  3SG5 A;  3DF0 B;  3AAJ A;  5D7F A;  1EH2 A;  3PN7 C;  1SKT A;  4MRX A;  4OR9 B;  2CBL A;  4NDC A;  2K7D A;  1SL9 A;  1Q80 A;  4PE4 A;  5B8I B;  1XFW O;  3R1O A;  3DVE A;  1OMR A;  3BOW A;  2BCB A;  2KLD A;  5CSF A;  2ZFD A;  2PQL A;  3H4S E;  1A4P A;  3S0E A;  1ODB A;  5G08 A;  3EK4 A;  1KCY A;  3PM2 A;  2KI6 D;  4N1G A;  3L4L A;  3OX6 A;  2BBM A;  3B88 A;  1AJ4 A;  2F3Y A;  4DIR A;  2PAS A;  2BE6 A;  5HL1 A;  3I5F C;  5KTY A;  1XFX O;  3CZ2 A;  4MLW A;  2LVI A;  5ER4 X;  4XYN A;  1JBA A;  1QVI Y;  3EG5 B;  4JQ0 D;  4A4B A;  1U5I A;  4PAL A;  2LP2 A; 
#chains in the Genus database with same CATH homology
 4FQO A;  2LC5 A;  1S3P A;  1NPQ A;  4P2Y B;  2ISD A;  2F2P A;  1KFU L;  1OZO A;  1PVB A;  2WOS A;  1K2H A;  1JF2 A;  2CT9 A;  2LLS A;  5JJG A;  1DMO A;  1PSR A;  3WXA A;  4ETO A;  2M1U A;  3JVT C;  1Y1A A;  2NCO A;  5I2Q A;  1S36 A;  1DT7 B;  3QRX A;  1XYD A;  2LLU A;  2ZRT A;  1IKU A;  1BT6 A;  2GGZ A;  1L2O B;  2KFF A;  1NIW A;  3SJS A;  2KOT A;  1QX2 A;  2LAP A;  4YGA A;  1CLB A;  4CFQ A;  1J1D A;  1KSM A;  3I5G C;  1M46 A;  1W7I B;  3E3R A;  1S1E A;  2KQY A;  3O2P A;  4MEW A;  1F70 A;  1J7Q A;  2WCF A;  1OE9 B;  4YGD B;  1KSO A;  2MA2 A;  1SK6 D;  4CFR A;  3TS5 C;  2A4J A;  4ORC B;  4GAO A;  1YTZ C;  5FYX A;  2JQ6 A;  1BOD A;  1CMG A;  1ALW A;  2R2I A;  5AFP A;  2KI4 B;  2JNX A;  2LV7 A;  2EGD A;  4OV2 A;  2M29 A;  3KHE A;  2KGR A;  2OS8 B;  4WRI A;  1M63 B;  1N0Y A;  2LAN A;  1WRL A;  1FF1 A;  2ZNE A;  3JTD B;  2SAS A;  4HRE E;  1E8A A;  1GJY A;  2QAC A;  3NSK A;  1QAS A;  2JWW A;  4AQJ A;  4GUK A;  4YGB B;  1KFX L;  2PAL A;  4MRY A;  5HKZ A;  1EL4 A;  5CSJ A;  1CDP A;  3SG2 A;  4R1E A;  1SL8 A;  3VRP A;  3OP0 A;  5HYD A;  1YUT A;  2AAO A;  2G9B A;  1NSH A;  4WQ2 A;  5AXI A;  2BL0 C;  1AUI B;  1EG4 A;  1S5G Y;  3ZNI A;  1V1F A;  1MQ1 A;  1YRT B;  4PE1 A;  2BCA A;  4GGF A;  3DD4 A;  1QX5 B;  4N1F A;  2M7L A;  2BEC A;  1HQV A;  1XVJ A;  3PLF B;  2KBM A;  3C1V A;  1OMV A;  4Q04 A;  2LMV A;  1S6I A;  1R6P A;  3OB1 B;  4PHJ A;  4MN0 A;  2JXC A;  1K9P A;  3AKB A;  1PAL A;  4D1E A;  1M31 A;  1W7J B;  4YGE B;  4C0K A;  2LVK A;  1SMG A;  1AHR A;  1OZS A;  4HRG A;  2AMI A;  1IG5 A;  3CR4 X;  4JPZ B;  1IRJ A;  4GGF C;  3O6B A;  2ZRS A;  1A29 A;  1XFZ O;  3OX5 A;  1NCX A;  4E68 A;  2TN4 A;  4USL A;  1F71 A;  2GV5 A;  1CM4 A;  1YVL A;  5KSZ A;  1CM1 A;  2M3W A;  2O60 A;  2JOJ A;  4U8D A;  2KFH A;  1F54 A;  3IF7 A;  3TUY B;  1Y1U A;  2L98 A;  1DGU A;  1UHH A;  2HQ8 A;  5K89 A;  1ALV A;  3O4Y A;  1JC2 A;  3VGO A;  1CTR A;  2MRD A;  2L5X B;  4M2P A;  2CNP A;  1QJT A;  1Y0V H;  1XK4 A;  1TNW A;  3GK1 A;  1AVS A;  3PAT A;  2HF5 A;  4PHM A;  1SCM B;  1RWY A;  1JSA A;  2DOQ A;  2M7N A;  1AJ5 A;  1KQM B;  1MR8 A;  5HKW A;  3ZWH A;  2K0J A;  1BLQ A;  1SBJ A;  4DCK A;  2LM5 A;  4BY4 A;  1L2O C;  3FS7 A;  2O5G A;  3FWC A;  4A4C A;  1QX7 A;  3GOF A;  2H61 A;  5JOL A;  1TNP A;  1H4B A;  1UHK A;  1DJZ A;  1XK4 C;  2Y5I A;  2M49 B;  1RTP 1;  1FW4 A;  2L4H A;  2MBX A;  2HET A;  5J3X A;  3TDI A;  4YRU A;  1BOC A;  3PSR A;  1SR6 B;  1NX3 A;  2KAY A;  4MZJ A;  2AUC A;  1DTL A;  2ZN8 A;  1B8R A;  1KK8 B;  1BF5 A;  1SNL A;  3NSO A;  2LCP A;  1RRO A;  2CCM A;  3TZ1 A;  1EXR A;  2LUC A;  3BXK A;  2K7C A;  3AAK A;  3PN7 B;  1OMD A;  1ZMZ A;  4TNC A;  2KI4 C;  1SPY A;  4I5L B;  4PCW A;  1WRK A;  2OS8 C;  2JNF A;  1QIW A;  1SL7 A;  1Y6W A;  3MSE B;  1F55 A;  3JTD C;  3RM1 A;  2NCP A;  1C07 A;  1GQM A;  1DF0 B;  2COL B;  2GGM A;  2HQW A;  4C0L A;  1DJI A;  1MWN A;  1NX0 A;  4F0Z B;  2KYF A;  3CS1 A;  3WNX B;  1PSB A;  1A03 A;  2KNE A;  2KDH A;  1PVA A;  3ICB A;  1QTX A;  1QVI Z;  1G8I A;  3TDZ A;  3KPX A;  1DGV A;  2E6W A;  1IJ6 A;  1QV0 A;  1IJ5 A;  1SW8 A;  4MZL A;  1KK7 Y;  1Y1X A;  1K94 A;  2BKH B;  1B7T Y;  4GBA A;  2V53 A;  4CPV A;  4YI9 A;  1RFJ A;  3EVU A;  2K61 A;  4DRW A;  5AAN A;  3BYA A;  4QJ4 B;  3EK7 A;  4QJ5 B;  1M45 A;  1NCZ A;  4XJK B;  1J1E A;  1NYA A;  2FJU B;  3M0W A;  1UWO A;  2E30 A;  1YRU B;  5TNC A;  1A75 B;  1NCY A;  4CID A;  3SG4 A;  2WCB A;  2HPS A;  1J7O A;  1DJX A;  1K9U A;  1TNQ A;  1A2X A;  1BJF A;  1BG1 A;  4NQG A;  2H2K A;  3KF9 A;  2NZ0 A;  2M1K B;  3CR5 X;  1SYM A;  1NP8 A;  1QV1 A;  1UP5 A;  3FWB A;  2JXL A;  1QS7 A;  3NXA A;  5DKN A;  2KQ6 A;  1CKK A;  2RGI A;  1K96 A;  2L50 A;  2L51 A;  3LCP C;  1R2U A;  3CR2 A;  3DVK A;  1IQ3 A;  2FCE A;  1N2D A;  4GPL B;  4I5N B;  2MLE C;  4QJ3 B;  1YVH A;  2NLN A;  2F2O A;  1DJG A;  4HRH A;  2WND A;  4MVF A;  1D1O A;  4ZCV A;  3NSI A;  4OKH A;  1KK7 Z;  1UUR A;  4GFT A;  1B7T Z;  1S26 D;  2CTN A;  1CDM A;  4PDZ A;  3CZT X;  3DVJ A;  2OPO A;  4I5K A;  3EVV A;  2KAX A;  4M2O A;  4NDB A;  4OVN F;  4UPG A;  2OTG C;  1LVC D;  1NUB A;  2LVV A;  1LXF C;  5PAL A;  1WY9 A;  2JZI A;  3LLE A;  3TUY C;  4P5O E;  2K8M B;  2ZND A;  2LMT A;  2EC6 B;  4NDD A;  4YGC B;  2M97 A;  1IH0 A;  3EKH A;  2VRG A;  3D10 A;  1RJV A;  2JU0 A;  4GNK B;  1BR1 B;  1AK8 A;  1PRW A;  3A8R A;  1K8U A;  1SY9 A;  2LLT A;  1B9A A;  1IWQ A;  4AOM A;  1YX8 A;  2WCE A;  2LE9 B;  2PSR A;  1SCM C;  2LVJ A;  3EKJ A;  3KEV A;  5D69 A;  3BUM B;  3VRR A;  1S5G Z;  1KQM C;  2MJW B;  3LL8 B;  1CMF A;  1JWD A;  4PHN A;  1YX7 A;  1SRA A;  2KSP A;  1FBV A;  1BU3 A;  2JT3 A;  1LKJ A;  3I5I B;  1UHJ A;  1QIV A;  1K9K A;  3DVM A;  2M8U A;  1S6J A;  4MSP A;  3LK1 A;  3RLZ A;  2Y4Q A;  1QAT A;  1TRF A;  1YR5 A;  2K7B A;  3VRQ A;  1JF0 A;  1B8L A;  1WDC B;  1SR6 C;  1DF0 A;  5KU1 A;  3PFV A;  1KWO B;  1KFU S;  3CGA A;  3WHU B;  1RK9 A;  2LUX A;  2LMU A;  1OOJ A;  3D0Y B;  2I18 A;  3HCM A;  1QXP A;  1OQP A;  2IS9 A;  3I5H B;  3OB2 B;  3IQQ A;  3F45 A;  2K2F A;  3SG7 A;  2BE4 A;  2LHI A;  5HLV A;  4M2Q A;  2Q4U A;  1TN4 A;  3A4U B;  2PVB A;  3BUO B;  3FIA A;  4XJK A;  1K95 A;  2MLF C;  2JTT A;  4PHK A;  2L2E A;  1A75 A;  1TTX A;  1EG3 A;  2P6B B;  1BR4 B;  1NX1 A;  1DJY A;  2H61 C;  2KYC A;  3CLN A;  3SG3 A;  1CFP A;  3SIB A;  1JUO A;  2I7A A;  1PK0 D;  1CFD A;  2BCX A;  4ZCU A;  3BUX B;  1HT9 A;  2FOT A;  3HX4 A;  1K93 D;  4GGN A;  1C7W A;  3TDU A;  1GGW A;  5DKR A;  2MAZ A;  2F3Z A;  1LA3 A;  2ZKM X;  1MXE A;  2KAV A;  3IQO A;  4PE7 A;  5AER A;  1FI5 A;  5F6T A;  3EVR A;  1MHO A;  1J55 A;  3BUN B;  3I5F B;  1TOP A;  4MZK A;  2KGB C;  2L0P A;  2CXJ A;  3CTN A;  1KFX S;  3BOW B;  1WLZ A;  1B47 A;  1YUS A;  1JFK A;  3O78 A;  1FPW A;  1CFC A;  2JT8 A;  1CLM A;  1REC A;  3JVT B;  2L4I A;  1LIN A;  1TNX A;  1EJ3 A;  3BQ3 A;  2BBN A;  4DUQ A;  3AKA A;  3BUW B;  4WQ3 A;  4YI8 A;  1ZAC A;  3WHT B;  1MF8 B;  1B1G A;  1KQV A;  1U5I B;  3CWG A;  5IBW A;  1H8B A;  3EK8 A;  1M39 A;  1XFV O;  2JRF A;  3SG6 A;  1TCO B;  2F33 A;  1F4O A;  2KFG A;  4CLN A;  2JT0 A;  5AEQ A;  2WC8 A;  1IGV A;  3I5G B;  2F8P A;  3VRN A;  2K2A A;  1YUU A;  1DJW A;  2LHL A;  3SIA A;  2EC6 C;  4ORB B;  1XFY O;  3GK2 A;  2K7O A;  4BY5 A;  4IL1 A;  1C7V A;  2G2B A;  3KO0 A;  2M0R A;  4DS7 A;  1MXL C;  1CDL A;  4OCI A;  3TS5 B;  1WRZ A;  1X02 A;  4FTG A;  2JTZ A;  1CNP A;  1K90 D;  2I2R E;  4AQI A;  4I5J A;  2PRU A;  5BPJ A;  2WOR A;  2Y1M A;  5CPV A;  5I8N A;  3PM8 A;  1N65 A;  3GK4 X;  2NXQ A;  2JUL A;  3I5I C;  1XO5 A;  3D0Y A;  1YUR A;  3DF0 A;  1QLK A;  1J7P A;  2M9G A;  2FCD A;  5ER5 A;  4JWQ A;  1BMO A;  1CLL A;  1DVI A;  3LK0 A;  1SCV A;  2B1U A;  2SCP A;  1VRK A;  1AP4 A;  2PMY A;  4YBH B;  2MHH A;  1CB1 A;  2ZN9 A;  5HLO A;  2Y1N A;  1L7Z A;  1NX2 A;  1WDC C;  5DKQ A;  1XA5 A;  1UUS A;  1ZOT B;  1CFF A;  1F8H A;  1UHN A;  1B8C A;  1G33 A;  1MUX A;  2EHB A;  4L9M A;  1JFJ A;  1KWO C;  2BL0 B;  1J7R A;  1S6C A;  1TCF A;  1UHI A;  2I94 A;  2LP3 A;  5I2L A;  2JC2 A;  5GQQ C;  2JPT A;  3OHM B;  5HKY A;  1F4Q A;  2D8N A;  2BKI B;  1QLS A;  1TIZ A;  3I5H C;  3NSL A;  2KI6 C;  4N5X A;  1XFU O;  2Q91 A;  1GGZ A;  1WLM A;  4PE0 A;  3K21 A;  1DJH A;  1CDN A;  1IQ5 A;  1ZUZ A;  1G4Y R;  1LA0 A;  1ZFS A;  2QPT A;  3PAL A;  5CSN A;  1V1G A;  4ORA B;  2LNK A;  2OTG B;  5CSI A;  1OSA A;  1NWD A;  3VRO A;  1FI6 A;  1KK8 C;  5I2O A;  4HSZ A;  1PUL A;  4ICB A;  2KBI A;  1B4C A;  4MBE A;  4C0J A;  2KHN A;  3SG5 A;  3DF0 B;  3AAJ A;  5D7F A;  1EH2 A;  3PN7 C;  1SKT A;  4MRX A;  4OR9 B;  2CBL A;  4NDC A;  2K7D A;  1SL9 A;  1Q80 A;  4PE4 A;  5B8I B;  1XFW O;  3DVE A;  1OMR A;  3BOW A;  2BCB A;  5CSF A;  2ZFD A;  3H4S E;  1A4P A;  1ODB A;  5G08 A;  3EK4 A;  1KCY A;  4N1G A;  2KI6 D;  3OX6 A;  2BBM A;  4DIR A;  1AJ4 A;  2F3Y A;  2PAS A;  2BE6 A;  3I5F C;  5KTY A;  1XFX O;  4MLW A;  2LVI A;  5ER4 X;  4XYN A;  1JBA A;  1QVI Y;  4JQ0 D;  4A4B A;  1U5I A;  4PAL A;  2LP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...