1EXRA

The 1.0 angstrom crystal structure of ca+2 bound calmodulin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
146
structure length
146
Chain Sequence
EQLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.0 A crystal structure of Ca(2+)-bound calmodulin: an analysis of disorder and implications for functionally relevant plasticity
pubmed doi rcsb
molecule keywords CALMODULIN
molecule tags Metal transport
source organism Paramecium tetraurelia
total genus 57
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2000-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1exrA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1exrA02
3QRXA 1FBVA 4NQGA 1A29A 1SL9A 2H61C 1YRUB 4GGNA 2JOJA 1YVHA 1DGVA 1WY9A 2ZN9A 1BF5A 3E3RA 4QJ5B 1MQ1A 5AXIA 1LINA 1QJTA 3C1VA 4N1GA 4CPVA 2KFHA 1B8LA 1TOPA 5CSFA 5DKQA 2KI6C 1SKTA 1JFJA 4I5NB 1Q80A 3FWBA 2JTTA 2OS8B 2G2BA 1OZSA 3I5FB 1XYDA 1AVSA 1DVIA 1NX2A 4I5LB 1SK6D 4D1EA 1B7TZ 3AKAA 2PASA 1YUSA 2LP3A 3JTDB 3O6BA 1QVIZ 1DF0A 2O60A 3BUXB 1M46A 2EGDA 1UHKA 3KPXA 2K7BA 1B8CA 3MSEB 4NDDA 2VRGA 4GNKB 1DJWA 5D7FA 1SNLA 3LLEA 3FS7A 2LCPA 2JXCA 4PDZA 3WXAA 2KGBC 1NWDA 2L5XB 4XYNA 5CPVA 5PALA 1CKKA 1B4CA 1UHJA 3KO0A 5CSNA 2A4JA 1TCOB 1K8UA 3BXKA 4YBHB 1YRTB 1J7OA 1UWOA 1BLQA 2KFFA 1QV1A 3TZ1A 1IH0A 2L0PA 1DGUA 1LA3A 2F2OA 2EC6C 1ZMZA 5J3XA 4JPZB 3D0YB 1X02A 3HX4A 3ICBA 3CR5X 3O2PA 3DF0B 3EVVA 1AUIB 1CDMA 1YX8A 2G9BA 1CMGA 2KYFA 4C0LA 2M7LA 5I8NA 2WNDA 1Y1AA 2LHIA 1ZFSA 1FW4A 3BUNB 3EKJA 3PLFB 1TCFA 2LVJA 4AOMA 1FI6A 1SBJA 1G33A 1KWOB 3I5GB 4DCKA 1S6CA 1FI5A 2JULA 3SG2A 1CMFA 1QTXA 2BBNA 2R2IA 1FPWA 1M45A 3VROA 1KFUS 2OTGB 1LVCD 3BOWB 1H4BA 4ETOA 1J7QA 1RK9A 5JOLA 3PATA 3GK1A 2KBMA 1K2HA 1K96A 1AK8A 2JU0A 2MBXA 1M63B 1GQMA 1DJHA 1B7TY 1CLLA 5HKYA 1BOCA 2KSPA 2BE4A 1XFUO 3ZNIA 2LVIA 2PSRA 3HCMA 1C7VA 2NZ0A 3I5HC 1NUBA 2P6BB 3DVJA 1SL7A 1F8HA 1ALVA 1CLMA 1MR8A 1NCYA 2H2KA 2KAYA 1U5IA 1XFWO 3PM8A 2L4HA 2KFGA 2LAPA 3TUYC 1V1FA 2LP2A 3PN7B 3PSRA 1BMOA 3CR2A 4XJKA 2BE6A 5F6TA 3SIAA 2CNPA 1W7JB 4OV2A 1BR4B 1BU3A 1UHHA 2KAVA 2ZNDA 3NSIA 1KK8B 4GBAA 5HYDA 2F3ZA 1WRKA 1PK0D 1OSAA 1Y0VH 2M8UA 4N5XA 2M0RA 1MHOA 4M2PA 2PALA 3BUOB 1V1GA 1CDPA 1OZOA 5BPJA 1YX7A 2JNFA 2WORA 2K2FA 2LVVA 3AAKA 4YI8A 1CDLA 2GV5A 4WQ2A 4MLWA 4PHMA 1AJ5A 5HKWA 1B9AA 3NSOA 3FIAA 2TN4A 2F33A 2F8PA 2KHNA 2ZFDA 2KQ6A 4C0JA 2K7DA 1YUUA 3CWGA 4E68A 1TNQA 1JUOA 1KFXS 4MBEA 5TNCA 2JC2A 4UPGA 1F71A 1C07A 2K61A 1EG4A 2E30A 2KI4C 3GK2A 2HF5A 1IRJA 1QXPA 2EC6B 4NDBA 4HRGA 2JRFA 1UP5A 2JWWA 1CDNA 4WQ3A 1F54A 2AAOA 2K2AA 2I2RE 1QIWA 1F70A 1L7ZA 5G08A 1OE9B 3AAJA 4CLNA 3OB1B 1L2OB 2BKIB 2IS9A 2M49B 2BL0C 1QS7A 1KQMC 2GGZA 1Y1XA 4PE0A 1N0YA 1CFFA 2MLFC 3GK4X 1K93D 4N1FA 4QJ3B 3WHTB 1NP8A 1CNPA 2O5GA 2SASA 2NCOA 1NCZA 1OMVA 3EK4A 2F3YA 1KCYA 1K9PA 1OQPA 1SR6C 2KGRA 2QPTA 1IQ3A 2LVKA 1ZOTB 3OP0A 1RTP1 2CXJA 4HSZA 1CM1A 1OMRA 2LUXA 1SCMC 2MAZA 3DVKA 4PE7A 1CFCA 5KU1A 3O4YA 1KFXL 4OR9B 2L50A 2M3WA 4OVNF 5CSJA 3SJSA 1ZACA 2Y1MA 1KQVA 2LM5A 1SL8A 1SY9A 3SIBA 1IGVA 2SCPA 1LXFC 1YR5A 2L51A 2BECA 2HETA 1A2XA 4OKHA 1SCVA 3KHEA 1XFYO 3I5IB 3IQQA 1AP4A 1A75A 3CLNA 1S6JA 3VRRA 1JSAA 4L9MA 5KTYA 2M7NA 1DJYA 4OCIA 3ZWHA 5IBWA 1CFPA 2M1KB 3SG6A 4PCWA 1KK7Z 4PALA 1XA5A 2WCFA 2ZRTA 2Y1NA 1NX3A 2CTNA 4MRYA 5K89A 3LCPC 2MA2A 3F45A 1TRFA 1YVLA 1XO5A 2FJUB 1JC2A 1WDCB 2LHLA 2K0JA 2WCBA 1G4YR 2LE9B 4GGFC 1F4QA 1S3PA 4GGFA 1SYMA 4ICBA 3LK1A 1A4PA 5HLOA 2OPOA 1QVIY 2Q4UA 3TS5C 1DJXA 3SG5A 3VGOA 3SG3A 1S26D 3I5FC 1TIZA 1JF0A 3CS1A 2V53A 1IG5A 2JNXA 2LMUA 4C0KA 3OB2B 3K21A 3SG4A 1B8RA 1OMDA 1J7RA 1CB1A 1B47A 1QV0A 4MEWA 3DD4A 1CTRA 4YRUA 1EJ3A 3JTDC 3LL8B 4ORBB 1KQMB 2ZN8A 3KF9A 2LLUA 1SMGA 1CFDA 4CFQA 2AMIA 2KDHA 2LV7A 3VRPA 4QJ4B 2WC8A 4BY5A 1UHNA 2JT0A 2ISDA 3TDIA 4PE4A 1G8IA 1QASA 1IKUA 3CZTX 1IJ6A 3CTNA 3JVTC 5HKZA 1RWYA 1MXEA 1DF0B 2BCXA 1MUXA 2NXQA 1NSHA 3TDZA 1J1EA 2PMYA 4MZKA 4A4BA 5D69A 4Q04A 1N65A 1D1OA 1DJZA 3VRNA 1KK7Y 1SW8A 2EHBA 1NPQA 1ODBA 1SPYA 3CGAA 2E6WA 2M1UA 3D0YA 1TNXA 1XVJA 2M97A 2K8MB 2NCPA 3DF0A 2KYCA 3GOFA 3SG7A 2LLTA 4MZLA 2K7CA 4GAOA 4HRHA 1WRLA 2Y4QA 1QLKA 3A4UB 2KAXA 3BUMB 3IF7A 1F4OA 2RGIA 4ZCVA 1K94A 2I7AA 2B1UA 1C7WA 3NSLA 1KWOC 1UHIA 3I5GC 4PHNA 4WRIA 1Y6WA 2BCBA 2COLB 4PHKA 1QATA 3WHUB 4M2OA 1QX2A 2OTGC 5I2QA 3BOWA 1R2UA 1QIVA 2JT8A 1QX7A 1NX1A 1NX0A 4P5OE 4DUQA 4GUKA 3EK8A 1NYAA 1PALA 1QLSA 2JTZA 1PVAA 2Y5IA 5ER4X 1PSRA 1ZUZA 1TNPA 1XFZO 2JZIA 3O78A 2H61A 4JQ0D 5AEQA 1ALWA 4HREE 1K90D 2BCAA 4USLA 1PULA 1J55A 3DVMA 1M39A 1KSOA 1N2DA 2MRDA 3IQOA 1WRZA 5GQQC 3PN7C 3KEVA 2BKHB 4M2QA 1S6IA 2BBMA 3TS5B 1GJYA 2JPTA 1OOJA 3I5HB 4DIRA 1KK8C 3EK7A 1TNWA 1XFVO 1EH2A 3BUWB 4IL1A 1U5IB 4ZCUA 3TUYB 1GGWA 4ORCB 1CLBA 1S36A 2WCEA 2PRUA 1JF2A 1PVBA 4XJKB 1E8AA 4R1EA 1R6PA 2KQYA 1YURA 2FOTA 3TDUA 3D10A 1AHRA 1A03A 1PSBA 1M31A 1MXLC 1BR1B 1RJVA 1HT9A 4YGCB 2L98A 1IQ5A 1HQVA 2MJWB 2CT9A 4YGDB 1S5GZ 3WNXB 2I94A 3JVTB 2I18A 4CFRA 1LKJA 2LC5A 3EVUA 4DS7A 2L4IA 5AERA 4TNCA 4YGBB 5I2OA 1YTZC 1VRKA 4MVFA 1BODA 2KOTA 1UURA 4BY4A 5CSIA 2FCEA 1K9KA 1IJ5A 1K9UA 2WOSA 4FQOA 2HPSA 4NDCA 3OX6A 5ER5A 5I2LA 2M29A 4DRWA 3BQ3A 2QACA 2KI4B 2JQ6A 1JFKA 2HQ8A 1L2OC 2MHHA 4GPLB 3RLZA 2LMTA 4YGEB 3H4SE 5FYXA 4ORAB 1B1GA 3VRQA 1JBAA 2JT3A 2OS8C 2F2PA 1EG3A 3EKHA 1IWQA 5AFPA 3DVEA 1MF8B 3OHMB 1W7IB 5JJGA 1XK4C 1XK4A 2Q91A 2BL0B 2K7OA 2KBIA 1MWNA 3OX5A 1WLMA 1SRAA 2HQWA 1S1EA 2LANA 3CR4X 2ZKMX 5DKNA 4AQIA 2LNKA 4JWQA 1DTLA 2JXLA 1BJFA 2LLSA 4I5JA 4YGAA 4GFTA 1LA0A 5DKRA 1UUSA 1FF1A 4MN0A 4U8DA 1QX5B 1YUTA 4PHJA 1AJ4A 3AKBA 5HLVA 1BT6A 2CBLA 3EVRA 4FTGA 1K95A 4MZJA 1NCXA 1SR6B 1RECA 1RFJA 3NSKA 1S5GY 2KNEA 4I5KA 4PE1A 5B8IB 2KI6D 1DT7B 1J7PA 1F55A 3FWCA 4YI9A 1PRWA 4MRXA 3M0WA 2AUCA 2MLEC 4F0ZB 1EL4A 1SCMB 1DJIA 3NXAA 3PFVA 4P2YB 1JWDA 2NLNA 2DOQA 3I5IC 5AANA 1RROA 2LUCA 1J1DA 1NIWA 2M9GA 2ZNEA 3A8RA 1BG1A 4MSPA 1CM4A 5KSZA 3LK0A 1H8BA 1KSMA 2D8NA 1XFXO 2CCMA 2LMVA 1A75B 2L2EA 4AQJA 4CIDA 3RM1A 4A4CA 1KFUL 3BYAA 1TTXA 1GGZA 1DJGA 1WDCC 3PALA 2PVBA 2GGMA 2FCDA 1WLZA 2ZRSA 1TN4A 1DMOA 1EXRA 1Y1UA
chains in the Genus database with same CATH superfamily
3QRXA 1FBVA 4NQGA 5HL1A 1A29A 1SL9A 2H61C 1YRUB 3L4AA 4GGNA 2JOJA 1YVHA 1DGVA 1WY9A 2ZN9A 3PM8A 3E3RA 1BF5A 4QJ5B 1MQ1A 5AXIA 1LINA 1QJTA 3C1VA 4N1GA 4CPVA 2KFHA 1B8LA 1TOPA 5CSFA 5DKQA 2KI6C 1SKTA 1JFJA 4I5NB 4INXA 1Q80A 2KPHA 3FWBA 2JTTA 2OS8B 2G2BA 1OZSA 3I5FB 1XYDA 1AVSA 1DVIA 1NX2A 4I5LB 1SK6D 4D1EA 2KLEA 1B7TZ 3AKAA 2PASA 3B7AA 1YUSA 2LP3A 3JTDB 3O6BA 1QVIZ 1DF0A 2O60A 3BUXB 1M46A 2EGDA 1UHKA 3KPXA 2K7BA 1B8CA 3MSEB 2WCKA 4NDDA 2VRGA 4GNKB 1DJWA 5D7FA 1SNLA 3LLEA 3FS7A 3R1OA 2LCPA 2PQLA 2JXCA 3Q8IA 4PDZA 3WXAA 5FI7A 2KGBC 1NWDA 2L5XB 3CDNA 4XYNA 5CPVA 5PALA 1CKKA 1B4CA 1UHJA 3KO0A 5CSNA 2A4JA 1TCOB 1K8UA 3BXKA 4YBHB 1YRTB 1J7OA 1UWOA 3K1EA 2KFFA 1QV1A 3TZ1A 1BLQA 1IH0A 2L0PA 3O4XA 1DGUA 1LA3A 2F2OA 2EC6C 1ZMZA 5J3XA 4JPZB 3D0YB 1X02A 3HX4A 3ICBA 3CR5X 3O2PA 3DF0B 3EVVA 1AUIB 1CDMA 1YX8A 2G9BA 3NHIA 1CMGA 2KYFA 4C0LA 2M7LA 5I8NA 2WNDA 3L4LA 1Y1AA 2LHIA 1ZFSA 1FW4A 3BUNB 3EKJA 3PLFB 1TCFA 3CABA 2LVJA 4AOMA 1FI6A 1OOIX 1SBJA 2QEBA 1G33A 1KWOB 2ERBA 3I5GB 4DCKA 1S6CA 1FI5A 2JULA 3SG2A 1CMFA 1QTXA 3D75A 2BBNA 2R2IA 1FPWA 1M45A 3VROA 1KFUS 2OTGB 1LVCD 3BOWB 1H4BA 3UO9A 4ETOA 1J7QA 1RK9A 5JOLA 3SS3A 3PATA 3GK1A 2KBMA 1K2HA 1K96A 3FE8A 1AK8A 2JU0A 2MBXA 1M63B 1GQMA 1DJHA 1B7TY 1CLLA 3DXLA 5HKYA 1BOCA 2KSPA 2BE4A 1XFUO 4F7FA 3ZNIA 2LVIA 3D77A 2PSRA 3HCMA 3CZ1A 1C7VA 2FJYA 1TWOA 2NZ0A 3I5HC 1NUBA 2P6BB 3DVJA 1SL7A 1F8HA 1ALVA 1CLMA 1MR8A 1NCYA 2H2KA 2KAYA 1U5IA 1XFWO 2QEVA 2L4HA 2KFGA 2LAPA 3TUYC 1V1FA 2LP2A 3PN7B 3PSRA 3SS4A 1BMOA 3CR2A 3DYEA 2BE6A 4XJKA 5F6TA 3SIAA 2CNPA 1W7JB 4OV2A 1BR4B 1BU3A 1UHHA 2KAVA 2ZNDA 3CYZA 1KK8B 3NSIA 4GBAA 5HYDA 1W9ZA 2F3ZA 1WRKA 1PK0D 1OSAA 2BNXA 3EG5B 1Y0VH 2M8UA 4N5XA 2M0RA 1MHOA 4M2PA 2PALA 3BUOB 1V1GA 1CDPA 1OZOA 5BPJA 1YX7A 2JNFA 2WORA 2K2FA 2LVVA 3AAKA 4JD9A 4YI8A 1CDLA 2GV5A 4WQ2A 4MLWA 4PHMA 1AJ5A 5HKWA 1B9AA 3NSOA 3FIAA 2TN4A 2F33A 2F8PA 2KHNA 2ZFDA 2KQ6A 2WCJA 4C0JA 2K7DA 1YUUA 3CWGA 4E68A 1TNQA 1JUOA 1KFXS 4MBEA 5TNCA 2JC2A 4JKTA 4UPGA 1F71A 1C07A 2L5YA 1LS8A 2K61A 1EG4A 2E30A 2KI4C 3GK2A 2HF5A 1IRJA 3CZ0A 4FQTA 1Z2CB 1QXPA 2EC6B 4NDBA 4HRGA 2JRFA 2PYQA 1UP5A 2JWWA 1CDNA 4WQ3A 1F54A 2AAOA 2K2AA 2I2RE 1QIWA 3BFBA 1F70A 1L7ZA 5G08A 2GTEA 1OE9B 3AAJA 4CLNA 3OB1B 1L2OB 2BKIB 2IS9A 2M49B 2BL0C 1QS7A 1KQMC 2GGZA 1Y1XA 4PE0A 1N0YA 1CFFA 2MLFC 3GK4X 1K93D 3NGVA 3PJIA 4N1FA 4QJ3B 3WHTB 1NP8A 1CNPA 2O5GA 2SASA 3DZTA 2H8VA 2NCOA 1NCZA 1OMVA 3EK4A 2F3YA 3B88A 1K9PA 1KCYA 1OQPA 1SR6C 2KGRA 2QPTA 1IQ3A 2LVKA 3UNWA 1ZOTB 3OP0A 1RTP1 2CXJA 4HSZA 1CM1A 1OMRA 2LUXA 1SCMC 2MAZA 3DVKA 4PE7A 1CFCA 5KU1A 3O4YA 1KFXL 4OR9B 2L50A 2M3WA 4OVNF 5CSJA 3SJSA 2WC5A 1ZACA 2Y1MA 1KQVA 2LM5A 3N7HA 1SL8A 1SY9A 3SIBA 1IGVA 2SCPA 1LXFC 1YR5A 2L51A 2BECA 2HETA 1DQEA 1A2XA 4OKHA 1SCVA 3KHEA 1XFYO 4IJ7A 3I5IB 3IQQA 1AP4A 1A75A 3CLNA 1S6JA 3VRRA 1JSAA 4L9MA 5KTYA 2M7NA 2QDIA 1DJYA 4OCIA 1OOFA 2WC6A 4KYNA 3ZWHA 5IBWA 1OOGA 1CFPA 2M1KB 3SG6A 3OGNA 4PCWA 5EL2A 1KK7Z 2BAPA 4PALA 1XA5A 2WCFA 2ZRTA 3S0GA 2P70A 2Y1NA 1NX3A 2CTNA 4MRYA 5K89A 3LCPC 2MA2A 3F45A 1TRFA 1YVLA 1XO5A 2QEHA 2FJUB 1JC2A 1WDCB 2LHLA 2K0JA 2WCBA 1G4YR 2LE9B 4GGFC 1F4QA 1S3PA 4GGFA 1SYMA 4ICBA 3LK1A 3S0FA 1A4PA 5HLOA 2OPOA 1QVIY 2Q4UA 3TS5C 1DJXA 3SG5A 3VGOA 3SG3A 3CZ2A 1S26D 3I5FC 3V2LA 1TIZA 1JF0A 3CS1A 2V53A 1IG5A 2JNXA 2LMUA 4C0KA 3OB2B 3K21A 3OBVA 3SG4A 1B8RA 1OMDA 1J7RA 1CB1A 1B47A 1QV0A 4MEWA 3DD4A 1CTRA 4YRUA 1EJ3A 2WCMA 3JTDC 3LL8B 4ORBB 1KQMB 2ZN8A 3KF9A 3DY9A 2LLUA 1SMGA 1CFDA 4CFQA 2AMIA 2KDHA 2LV7A 2K60A 3VRPA 4QJ4B 2WC8A 4BY5A 1UHNA 2JT0A 2ISDA 3TDIA 4PE4A 1G8IA 1QASA 1IKUA 3CZTX 1IJ6A 3CTNA 3JVTC 5HKZA 1RWYA 1MXEA 1DF0B 2BCXA 1MUXA 2NXQA 1NSHA 3TDZA 1J1EA 2PMYA 4MZKA 4A4BA 5D69A 4Q04A 1N65A 1D1OA 1DJZA 3VRNA 1KK7Y 1SW8A 2EHBA 1NPQA 1ODBA 1SPYA 3CGAA 2E6WA 2M1UA 3D0YA 1TNXA 1XVJA 3D76A 2M97A 2K8MB 2NCPA 3DF0A 2KYCA 3GOFA 3SG7A 2LLTA 4MZLA 2K7CA 4GAOA 4HRHA 1WRLA 2Y4QA 1QLKA 3A4UB 2KAXA 3BUMB 3IF7A 1F4OA 2RGIA 4ZCVA 1K94A 2I7AA 2B1UA 1C7WA 3NSLA 1KWOC 1UHIA 3I5GC 4PHNA 4WRIA 1Y6WA 2BCBA 2COLB 4PHKA 1QATA 3WHUB 4M2OA 3D74A 1QX2A 2OTGC 1SSEB 3R72A 3BOWA 5I2QA 1R2UA 1QIVA 2WCLA 2JT8A 1QX7A 1NX1A 1NX0A 3IVTA 3D78A 4P5OE 4DUQA 4GUKA 3EK8A 1NYAA 1PALA 1QLSA 2JTZA 1PVAA 2Y5IA 5ER4X 3S0BA 1PSRA 1ZUZA 1TNPA 1XFZO 2JZIA 3O78A 5FI2A 2H61A 4JQ0D 5AEQA 1ALWA 4HREE 1K90D 2BCAA 1XFRA 4USLA 1PULA 1J55A 3DVMA 1M39A 1OOHA 1KSOA 1N2DA 2MRDA 3IQOA 1WRZA 5GQQC 3PN7C 3KEVA 2BKHB 4M2QA 5DICA 1S6IA 2BBMA 3S0DA 1GJYA 2JPTA 3TS5B 1OOJA 3I5HB 4DIRA 4INWA 1KK8C 3D73A 3EK7A 1TNWA 1XFVO 5FI6A 1EH2A 3BUWB 4IL1A 3S0EA 1U5IB 4ZCUA 3TUYB 3S0AA 1GGWA 3NHTA 4ORCB 1CLBA 1S36A 2WCEA 1IIOA 2PRUA 1QWVA 1JF2A 3R1PA 1PVBA 4XJKB 1E8AA 4R1EA 1R6PA 2KQYA 1DC1A 1YURA 2FOTA 1OW4A 3L47A 3D10A 1AHRA 3TDUA 2WCHA 1A03A 1PSBA 1M31A 1MXLC 1BR1B 1RJVA 1HT9A 4YGCB 2L98A 1IQ5A 1HQVA 2MJWB 5I94A 2CT9A 4YGDB 3FE9A 3QMEA 1DELA 1S5GZ 2I94A 3WNXB 3JVTB 2I18A 4CFRA 1LKJA 2LC5A 3EVUA 4DS7A 2L4IA 5AERA 4TNCA 4YGBB 5I2OA 1YTZC 1VRKA 4MVFA 1BODA 1TUJA 2KOTA 1UURA 4BY4A 5CSIA 2FCEA 1K9KA 1IJ5A 1K9UA 2WOSA 4FQOA 4OZDA 2HPSA 4NDCA 2KLDA 3OX6A 5ER5A 5I2LA 2M29A 4DRWA 3BQ3A 2QACA 2KI4B 2JQ6A 1JFKA 2HQ8A 1L2OC 2MHHA 4GPLB 1ORGA 3RLZA 2LMTA 1C3ZA 4YGEB 3H4SE 5FYXA 4ORAB 1B1GA 1DEKA 3VRQA 2JT3A 1JBAA 2OS8C 2F2PA 1EG3A 3EKHA 1IWQA 5AFPA 3DVEA 1MF8B 3OHMB 1W7IB 5JJGA 1XK4C 1XK4A 2Q91A 2BL0B 2K7OA 2KBIA 1MWNA 3OX5A 1WLMA 1SRAA 2HQWA 1S1EA 2LANA 3B6XA 2ZKMX 3CR4X 5DKNA 4AQIA 2LNKA 4JWQA 1DTLA 2P71A 2JXLA 1BJFA 2LLSA 4I5JA 4YGAA 4GFTA 1LA0A 5DKRA 1UUSA 1FF1A 4MN0A 4U8DA 1TUZA 1Z4HA 1QX5B 1YUTA 3BFHA 4PHJA 1AJ4A 3AKBA 5HLVA 3PM2A 1T14A 1BT6A 1GM0A 2CBLA 3EVRA 3R1VA 1K95A 4FTGA 4MZJA 1NCXA 1SR6B 1RECA 1RFJA 3NSKA 1S5GY 2KNEA 4I5KA 4PE1A 5B8IB 2KI6D 1DT7B 1C3YA 1J7PA 1F55A 3FWCA 4YI9A 1PRWA 4MRXA 3M0WA 2AUCA 2MLEC 4F0ZB 1EL4A 1SCMB 1DJIA 3NXAA 3PFVA 4P2YB 1JWDA 3BFAA 2NLNA 2JPOA 2DOQA 3VB1A 3I5IC 5AANA 1RROA 2LUCA 2YGUA 3B86A 1J1DA 1NIWA 2M9GA 2ZNEA 3A8RA 5D3OA 1BG1A 4MSPA 1CM4A 5KSZA 3LK0A 3B87A 1H8BA 1KSMA 2QEOA 2D8NA 1XFXO 2CCMA 2L2CA 2LMVA 4PT1A 1A75B 2L2EA 4AQJA 4CIDA 3RM1A 3FE6A 1KFUL 3BYAA 4A4CA 1TTXA 1GGZA 1P28A 1DJGA 3SS5A 1WDCC 3PALA 3BJHA 2PVBA 2GGMA 2FCDA 1WLZA 2ZRSA 3RZSA 1TN4A 1DMOA 1EXRA 1Y1UA
chains in the Genus database with same CATH topology
3QRXA 1FBVA 4NQGA 1A29A 1SL9A 2H61C 1YRUB 4GGNA 2JOJA 1YVHA 1DGVA 1WY9A 2ZN9A 1BF5A 3E3RA 4QJ5B 1MQ1A 5AXIA 1LINA 1QJTA 3C1VA 4N1GA 4CPVA 2KFHA 1B8LA 1TOPA 5CSFA 5DKQA 2KI6C 1SKTA 1JFJA 4I5NB 1Q80A 3FWBA 2JTTA 2OS8B 2G2BA 1OZSA 3I5FB 1XYDA 1AVSA 1DVIA 1NX2A 4I5LB 1SK6D 4D1EA 1B7TZ 3AKAA 2PASA 1YUSA 2LP3A 3JTDB 3O6BA 1QVIZ 1DF0A 2O60A 3BUXB 1M46A 2EGDA 1UHKA 3KPXA 2K7BA 1B8CA 3MSEB 4NDDA 2VRGA 4GNKB 1DJWA 5D7FA 1SNLA 3LLEA 3FS7A 2LCPA 2JXCA 4PDZA 3WXAA 2KGBC 1NWDA 2L5XB 4XYNA 5CPVA 5PALA 1CKKA 1B4CA 1UHJA 3KO0A 5CSNA 2A4JA 1TCOB 1K8UA 3BXKA 4YBHB 1YRTB 1J7OA 1UWOA 1BLQA 2KFFA 1QV1A 3TZ1A 1IH0A 2L0PA 1DGUA 1LA3A 2F2OA 2EC6C 1ZMZA 5J3XA 4JPZB 3D0YB 1X02A 3HX4A 3ICBA 3CR5X 3O2PA 3DF0B 3EVVA 1AUIB 1CDMA 1YX8A 2G9BA 1CMGA 2KYFA 4C0LA 2M7LA 5I8NA 2WNDA 1Y1AA 2LHIA 1ZFSA 1FW4A 3BUNB 3EKJA 3PLFB 1TCFA 2LVJA 4AOMA 1FI6A 1SBJA 1G33A 1KWOB 3I5GB 4DCKA 1S6CA 1FI5A 2JULA 3SG2A 1CMFA 1QTXA 2BBNA 2R2IA 1FPWA 1M45A 3VROA 1KFUS 2OTGB 1LVCD 3BOWB 1H4BA 4ETOA 1J7QA 1RK9A 5JOLA 3PATA 3GK1A 2KBMA 1K2HA 1K96A 1AK8A 2JU0A 2MBXA 1M63B 1GQMA 1DJHA 1B7TY 1CLLA 5HKYA 1BOCA 2KSPA 2BE4A 1XFUO 3ZNIA 2LVIA 2PSRA 3HCMA 1C7VA 2NZ0A 3I5HC 1NUBA 2P6BB 3DVJA 1SL7A 1F8HA 1ALVA 1CLMA 1MR8A 1NCYA 2H2KA 2KAYA 1U5IA 1XFWO 3PM8A 2L4HA 2KFGA 2LAPA 3TUYC 1V1FA 2LP2A 3PN7B 3PSRA 1BMOA 3CR2A 4XJKA 2BE6A 5F6TA 3SIAA 2CNPA 1W7JB 4OV2A 1BR4B 1BU3A 1UHHA 2KAVA 2ZNDA 3NSIA 1KK8B 4GBAA 5HYDA 2F3ZA 1WRKA 1PK0D 1OSAA 1Y0VH 2M8UA 4N5XA 2M0RA 1MHOA 4M2PA 2PALA 3BUOB 1V1GA 1CDPA 1OZOA 5BPJA 1YX7A 2JNFA 2WORA 2K2FA 2LVVA 3AAKA 4YI8A 1CDLA 2GV5A 4WQ2A 4MLWA 4PHMA 1AJ5A 5HKWA 1B9AA 3NSOA 3FIAA 2TN4A 2F33A 2F8PA 2KHNA 2ZFDA 2KQ6A 4C0JA 2K7DA 1YUUA 3CWGA 4E68A 1TNQA 1JUOA 1KFXS 4MBEA 5TNCA 2JC2A 4UPGA 1F71A 1C07A 2K61A 1EG4A 2E30A 2KI4C 3GK2A 2HF5A 1IRJA 1QXPA 2EC6B 4NDBA 4HRGA 2JRFA 1UP5A 2JWWA 1CDNA 4WQ3A 1F54A 2AAOA 2K2AA 2I2RE 1QIWA 1F70A 1L7ZA 5G08A 1OE9B 3AAJA 4CLNA 3OB1B 1L2OB 2BKIB 2IS9A 2M49B 2BL0C 1QS7A 1KQMC 2GGZA 1Y1XA 4PE0A 1N0YA 1CFFA 2MLFC 3GK4X 1K93D 4N1FA 4QJ3B 3WHTB 1NP8A 1CNPA 2O5GA 2SASA 2NCOA 1NCZA 1OMVA 3EK4A 2F3YA 1KCYA 1K9PA 1OQPA 1SR6C 2KGRA 2QPTA 1IQ3A 2LVKA 1ZOTB 3OP0A 1RTP1 2CXJA 4HSZA 1CM1A 1OMRA 2LUXA 1SCMC 2MAZA 3DVKA 4PE7A 1CFCA 5KU1A 3O4YA 1KFXL 4OR9B 2L50A 2M3WA 4OVNF 5CSJA 3SJSA 1ZACA 2Y1MA 1KQVA 2LM5A 1SL8A 1SY9A 3SIBA 1IGVA 2SCPA 1LXFC 1YR5A 2L51A 2BECA 2HETA 1A2XA 4OKHA 1SCVA 3KHEA 1XFYO 3I5IB 3IQQA 1AP4A 1A75A 3CLNA 1S6JA 3VRRA 1JSAA 4L9MA 5KTYA 2M7NA 1DJYA 4OCIA 3ZWHA 5IBWA 1CFPA 2M1KB 3SG6A 4PCWA 1KK7Z 4PALA 1XA5A 2WCFA 2ZRTA 2Y1NA 1NX3A 2CTNA 4MRYA 5K89A 3LCPC 2MA2A 3F45A 1TRFA 1YVLA 1XO5A 2FJUB 1JC2A 1WDCB 2LHLA 2K0JA 2WCBA 1G4YR 2LE9B 4GGFC 1F4QA 1S3PA 4GGFA 1SYMA 4ICBA 3LK1A 1A4PA 5HLOA 2OPOA 1QVIY 2Q4UA 3TS5C 1DJXA 3SG5A 3VGOA 3SG3A 1S26D 3I5FC 1TIZA 1JF0A 3CS1A 2V53A 1IG5A 2JNXA 2LMUA 4C0KA 3OB2B 3K21A 3SG4A 1B8RA 1OMDA 1J7RA 1CB1A 1B47A 1QV0A 4MEWA 3DD4A 1CTRA 4YRUA 1EJ3A 3JTDC 3LL8B 4ORBB 1KQMB 2ZN8A 3KF9A 2LLUA 1SMGA 1CFDA 4CFQA 2AMIA 2KDHA 2LV7A 3VRPA 4QJ4B 2WC8A 4BY5A 1UHNA 2JT0A 2ISDA 3TDIA 4PE4A 1G8IA 1QASA 1IKUA 3CZTX 1IJ6A 3CTNA 3JVTC 5HKZA 1RWYA 1MXEA 1DF0B 2BCXA 1MUXA 2NXQA 1NSHA 3TDZA 1J1EA 2PMYA 4MZKA 4A4BA 5D69A 4Q04A 1N65A 1D1OA 1DJZA 3VRNA 1KK7Y 1SW8A 2EHBA 1NPQA 1ODBA 1SPYA 3CGAA 2E6WA 2M1UA 3D0YA 1TNXA 1XVJA 2M97A 2K8MB 2NCPA 3DF0A 2KYCA 3GOFA 3SG7A 2LLTA 4MZLA 2K7CA 4GAOA 4HRHA 1WRLA 2Y4QA 1QLKA 3A4UB 2KAXA 3BUMB 3IF7A 1F4OA 2RGIA 4ZCVA 1K94A 2I7AA 2B1UA 1C7WA 3NSLA 1KWOC 1UHIA 3I5GC 4PHNA 4WRIA 1Y6WA 2BCBA 2COLB 4PHKA 1QATA 3WHUB 4M2OA 1QX2A 2OTGC 5I2QA 3BOWA 1R2UA 1QIVA 2JT8A 1QX7A 1NX1A 1NX0A 4P5OE 4DUQA 4GUKA 3EK8A 1NYAA 1PALA 1QLSA 2JTZA 1PVAA 2Y5IA 5ER4X 1PSRA 1ZUZA 1TNPA 1XFZO 2JZIA 3O78A 2H61A 4JQ0D 5AEQA 1ALWA 4HREE 1K90D 2BCAA 4USLA 1PULA 1J55A 3DVMA 1M39A 1KSOA 1N2DA 2MRDA 3IQOA 1WRZA 5GQQC 3PN7C 3KEVA 2BKHB 4M2QA 1S6IA 2BBMA 3TS5B 1GJYA 2JPTA 1OOJA 3I5HB 4DIRA 1KK8C 3EK7A 1TNWA 1XFVO 1EH2A 3BUWB 4IL1A 1U5IB 4ZCUA 3TUYB 1GGWA 4ORCB 1CLBA 1S36A 2WCEA 2PRUA 1JF2A 1PVBA 4XJKB 1E8AA 4R1EA 1R6PA 2KQYA 1YURA 2FOTA 3TDUA 3D10A 1AHRA 1A03A 1PSBA 1M31A 1MXLC 1BR1B 1RJVA 1HT9A 4YGCB 2L98A 1IQ5A 1HQVA 2MJWB 2CT9A 4YGDB 1S5GZ 3WNXB 2I94A 3JVTB 2I18A 4CFRA 1LKJA 2LC5A 3EVUA 4DS7A 2L4IA 5AERA 4TNCA 4YGBB 5I2OA 1YTZC 1VRKA 4MVFA 1BODA 2KOTA 1UURA 4BY4A 5CSIA 2FCEA 1K9KA 1IJ5A 1K9UA 2WOSA 4FQOA 2HPSA 4NDCA 3OX6A 5ER5A 5I2LA 2M29A 4DRWA 3BQ3A 2QACA 2KI4B 2JQ6A 1JFKA 2HQ8A 1L2OC 2MHHA 4GPLB 3RLZA 2LMTA 4YGEB 3H4SE 5FYXA 4ORAB 1B1GA 3VRQA 1JBAA 2JT3A 2OS8C 2F2PA 1EG3A 3EKHA 1IWQA 5AFPA 3DVEA 1MF8B 3OHMB 1W7IB 5JJGA 1XK4C 1XK4A 2Q91A 2BL0B 2K7OA 2KBIA 1MWNA 3OX5A 1WLMA 1SRAA 2HQWA 1S1EA 2LANA 3CR4X 2ZKMX 5DKNA 4AQIA 2LNKA 4JWQA 1DTLA 2JXLA 1BJFA 2LLSA 4I5JA 4YGAA 4GFTA 1LA0A 5DKRA 1UUSA 1FF1A 4MN0A 4U8DA 1QX5B 1YUTA 4PHJA 1AJ4A 3AKBA 5HLVA 1BT6A 2CBLA 3EVRA 4FTGA 1K95A 4MZJA 1NCXA 1SR6B 1RECA 1RFJA 3NSKA 1S5GY 2KNEA 4I5KA 4PE1A 5B8IB 2KI6D 1DT7B 1J7PA 1F55A 3FWCA 4YI9A 1PRWA 4MRXA 3M0WA 2AUCA 2MLEC 4F0ZB 1EL4A 1SCMB 1DJIA 3NXAA 3PFVA 4P2YB 1JWDA 2NLNA 2DOQA 3I5IC 5AANA 1RROA 2LUCA 1J1DA 1NIWA 2M9GA 2ZNEA 3A8RA 1BG1A 4MSPA 1CM4A 5KSZA 3LK0A 1H8BA 1KSMA 2D8NA 1XFXO 2CCMA 2LMVA 1A75B 2L2EA 4AQJA 4CIDA 3RM1A 4A4CA 1KFUL 3BYAA 1TTXA 1GGZA 1DJGA 1WDCC 3PALA 2PVBA 2GGMA 2FCDA 1WLZA 2ZRSA 1TN4A 1DMOA 1EXRA 1Y1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRX A;  1FBV A;  4NQG A;  1A29 A;  1SL9 A;  2H61 C;  1YRU B;  4GGN A;  2JOJ A;  1YVH A;  1DGV A;  1WY9 A;  2ZN9 A;  1BF5 A;  3E3R A;  4QJ5 B;  1MQ1 A;  5AXI A;  1LIN A;  1QJT A;  3C1V A;  4N1G A;  4CPV A;  2KFH A;  1B8L A;  1TOP A;  5CSF A;  5DKQ A;  2KI6 C;  1SKT A;  1JFJ A;  4I5N B;  1Q80 A;  3FWB A;  2JTT A;  2OS8 B;  2G2B A;  1OZS A;  3I5F B;  1XYD A;  1AVS A;  1DVI A;  1NX2 A;  4I5L B;  1SK6 D;  4D1E A;  1B7T Z;  3AKA A;  2PAS A;  1YUS A;  2LP3 A;  3JTD B;  3O6B A;  1QVI Z;  1DF0 A;  2O60 A;  3BUX B;  1M46 A;  2EGD A;  1UHK A;  3KPX A;  2K7B A;  1B8C A;  3MSE B;  4NDD A;  2VRG A;  4GNK B;  1DJW A;  5D7F A;  1SNL A;  3LLE A;  3FS7 A;  2LCP A;  2JXC A;  4PDZ A;  3WXA A;  2KGB C;  1NWD A;  2L5X B;  4XYN A;  5CPV A;  5PAL A;  1CKK A;  1B4C A;  1UHJ A;  3KO0 A;  5CSN A;  2A4J A;  1TCO B;  1K8U A;  3BXK A;  4YBH B;  1YRT B;  1J7O A;  1UWO A;  1BLQ A;  2KFF A;  1QV1 A;  3TZ1 A;  1IH0 A;  2L0P A;  1DGU A;  1LA3 A;  2F2O A;  2EC6 C;  1ZMZ A;  5J3X A;  4JPZ B;  3D0Y B;  1X02 A;  3HX4 A;  3ICB A;  3CR5 X;  3O2P A;  3DF0 B;  3EVV A;  1AUI B;  1CDM A;  1YX8 A;  2G9B A;  1CMG A;  2KYF A;  4C0L A;  2M7L A;  5I8N A;  2WND A;  1Y1A A;  2LHI A;  1ZFS A;  1FW4 A;  3BUN B;  3EKJ A;  3PLF B;  1TCF A;  2LVJ A;  4AOM A;  1FI6 A;  1SBJ A;  1G33 A;  1KWO B;  3I5G B;  4DCK A;  1S6C A;  1FI5 A;  2JUL A;  3SG2 A;  1CMF A;  1QTX A;  2BBN A;  2R2I A;  1FPW A;  1M45 A;  3VRO A;  1KFU S;  2OTG B;  1LVC D;  3BOW B;  1H4B A;  4ETO A;  1J7Q A;  1RK9 A;  5JOL A;  3PAT A;  3GK1 A;  2KBM A;  1K2H A;  1K96 A;  1AK8 A;  2JU0 A;  2MBX A;  1M63 B;  1GQM A;  1DJH A;  1B7T Y;  1CLL A;  5HKY A;  1BOC A;  2KSP A;  2BE4 A;  1XFU O;  3ZNI A;  2LVI A;  2PSR A;  3HCM A;  1C7V A;  2NZ0 A;  3I5H C;  1NUB A;  2P6B B;  3DVJ A;  1SL7 A;  1F8H A;  1ALV A;  1CLM A;  1MR8 A;  1NCY A;  2H2K A;  2KAY A;  1U5I A;  1XFW O;  3PM8 A;  2L4H A;  2KFG A;  2LAP A;  3TUY C;  1V1F A;  2LP2 A;  3PN7 B;  3PSR A;  1BMO A;  3CR2 A;  4XJK A;  2BE6 A;  5F6T A;  3SIA A;  2CNP A;  1W7J B;  4OV2 A;  1BR4 B;  1BU3 A;  1UHH A;  2KAV A;  2ZND A;  3NSI A;  1KK8 B;  4GBA A;  5HYD A;  2F3Z A;  1WRK A;  1PK0 D;  1OSA A;  1Y0V H;  2M8U A;  4N5X A;  2M0R A;  1MHO A;  4M2P A;  2PAL A;  3BUO B;  1V1G A;  1CDP A;  1OZO A;  5BPJ A;  1YX7 A;  2JNF A;  2WOR A;  2K2F A;  2LVV A;  3AAK A;  4YI8 A;  1CDL A;  2GV5 A;  4WQ2 A;  4MLW A;  4PHM A;  1AJ5 A;  5HKW A;  1B9A A;  3NSO A;  3FIA A;  2TN4 A;  2F33 A;  2F8P A;  2KHN A;  2ZFD A;  2KQ6 A;  4C0J A;  2K7D A;  1YUU A;  3CWG A;  4E68 A;  1TNQ A;  1JUO A;  1KFX S;  4MBE A;  5TNC A;  2JC2 A;  4UPG A;  1F71 A;  1C07 A;  2K61 A;  1EG4 A;  2E30 A;  2KI4 C;  3GK2 A;  2HF5 A;  1IRJ A;  1QXP A;  2EC6 B;  4NDB A;  4HRG A;  2JRF A;  1UP5 A;  2JWW A;  1CDN A;  4WQ3 A;  1F54 A;  2AAO A;  2K2A A;  2I2R E;  1QIW A;  1F70 A;  1L7Z A;  5G08 A;  1OE9 B;  3AAJ A;  4CLN A;  3OB1 B;  1L2O B;  2BKI B;  2IS9 A;  2M49 B;  2BL0 C;  1QS7 A;  1KQM C;  2GGZ A;  1Y1X A;  4PE0 A;  1N0Y A;  1CFF A;  2MLF C;  3GK4 X;  1K93 D;  4N1F A;  4QJ3 B;  3WHT B;  1NP8 A;  1CNP A;  2O5G A;  2SAS A;  2NCO A;  1NCZ A;  1OMV A;  3EK4 A;  2F3Y A;  1KCY A;  1K9P A;  1OQP A;  1SR6 C;  2KGR A;  2QPT A;  1IQ3 A;  2LVK A;  1ZOT B;  3OP0 A;  1RTP 1;  2CXJ A;  4HSZ A;  1CM1 A;  1OMR A;  2LUX A;  1SCM C;  2MAZ A;  3DVK A;  4PE7 A;  1CFC A;  5KU1 A;  3O4Y A;  1KFX L;  4OR9 B;  2L50 A;  2M3W A;  4OVN F;  5CSJ A;  3SJS A;  1ZAC A;  2Y1M A;  1KQV A;  2LM5 A;  1SL8 A;  1SY9 A;  3SIB A;  1IGV A;  2SCP A;  1LXF C;  1YR5 A;  2L51 A;  2BEC A;  2HET A;  1A2X A;  4OKH A;  1SCV A;  3KHE A;  1XFY O;  3I5I B;  3IQQ A;  1AP4 A;  1A75 A;  3CLN A;  1S6J A;  3VRR A;  1JSA A;  4L9M A;  5KTY A;  2M7N A;  1DJY A;  4OCI A;  3ZWH A;  5IBW A;  1CFP A;  2M1K B;  3SG6 A;  4PCW A;  1KK7 Z;  4PAL A;  1XA5 A;  2WCF A;  2ZRT A;  2Y1N A;  1NX3 A;  2CTN A;  4MRY A;  5K89 A;  3LCP C;  2MA2 A;  3F45 A;  1TRF A;  1YVL A;  1XO5 A;  2FJU B;  1JC2 A;  1WDC B;  2LHL A;  2K0J A;  2WCB A;  1G4Y R;  2LE9 B;  4GGF C;  1F4Q A;  1S3P A;  4GGF A;  1SYM A;  4ICB A;  3LK1 A;  1A4P A;  5HLO A;  2OPO A;  1QVI Y;  2Q4U A;  3TS5 C;  1DJX A;  3SG5 A;  3VGO A;  3SG3 A;  1S26 D;  3I5F C;  1TIZ A;  1JF0 A;  3CS1 A;  2V53 A;  1IG5 A;  2JNX A;  2LMU A;  4C0K A;  3OB2 B;  3K21 A;  3SG4 A;  1B8R A;  1OMD A;  1J7R A;  1CB1 A;  1B47 A;  1QV0 A;  4MEW A;  3DD4 A;  1CTR A;  4YRU A;  1EJ3 A;  3JTD C;  3LL8 B;  4ORB B;  1KQM B;  2ZN8 A;  3KF9 A;  2LLU A;  1SMG A;  1CFD A;  4CFQ A;  2AMI A;  2KDH A;  2LV7 A;  3VRP A;  4QJ4 B;  2WC8 A;  4BY5 A;  1UHN A;  2JT0 A;  2ISD A;  3TDI A;  4PE4 A;  1G8I A;  1QAS A;  1IKU A;  3CZT X;  1IJ6 A;  3CTN A;  3JVT C;  5HKZ A;  1RWY A;  1MXE A;  1DF0 B;  2BCX A;  1MUX A;  2NXQ A;  1NSH A;  3TDZ A;  1J1E A;  2PMY A;  4MZK A;  4A4B A;  5D69 A;  4Q04 A;  1N65 A;  1D1O A;  1DJZ A;  3VRN A;  1KK7 Y;  1SW8 A;  2EHB A;  1NPQ A;  1ODB A;  1SPY A;  3CGA A;  2E6W A;  2M1U A;  3D0Y A;  1TNX A;  1XVJ A;  2M97 A;  2K8M B;  2NCP A;  3DF0 A;  2KYC A;  3GOF A;  3SG7 A;  2LLT A;  4MZL A;  2K7C A;  4GAO A;  4HRH A;  1WRL A;  2Y4Q A;  1QLK A;  3A4U B;  2KAX A;  3BUM B;  3IF7 A;  1F4O A;  2RGI A;  4ZCV A;  1K94 A;  2I7A A;  2B1U A;  1C7W A;  3NSL A;  1KWO C;  1UHI A;  3I5G C;  4PHN A;  4WRI A;  1Y6W A;  2BCB A;  2COL B;  4PHK A;  1QAT A;  3WHU B;  4M2O A;  1QX2 A;  2OTG C;  5I2Q A;  3BOW A;  1R2U A;  1QIV A;  2JT8 A;  1QX7 A;  1NX1 A;  1NX0 A;  4P5O E;  4DUQ A;  4GUK A;  3EK8 A;  1NYA A;  1PAL A;  1QLS A;  2JTZ A;  1PVA A;  2Y5I A;  5ER4 X;  1PSR A;  1ZUZ A;  1TNP A;  1XFZ O;  2JZI A;  3O78 A;  2H61 A;  4JQ0 D;  5AEQ A;  1ALW A;  4HRE E;  1K90 D;  2BCA A;  4USL A;  1PUL A;  1J55 A;  3DVM A;  1M39 A;  1KSO A;  1N2D A;  2MRD A;  3IQO A;  1WRZ A;  5GQQ C;  3PN7 C;  3KEV A;  2BKH B;  4M2Q A;  1S6I A;  2BBM A;  3TS5 B;  1GJY A;  2JPT A;  1OOJ A;  3I5H B;  4DIR A;  1KK8 C;  3EK7 A;  1TNW A;  1XFV O;  1EH2 A;  3BUW B;  4IL1 A;  1U5I B;  4ZCU A;  3TUY B;  1GGW A;  4ORC B;  1CLB A;  1S36 A;  2WCE A;  2PRU A;  1JF2 A;  1PVB A;  4XJK B;  1E8A A;  4R1E A;  1R6P A;  2KQY A;  1YUR A;  2FOT A;  3TDU A;  3D10 A;  1AHR A;  1A03 A;  1PSB A;  1M31 A;  1MXL C;  1BR1 B;  1RJV A;  1HT9 A;  4YGC B;  2L98 A;  1IQ5 A;  1HQV A;  2MJW B;  2CT9 A;  4YGD B;  1S5G Z;  3WNX B;  2I94 A;  3JVT B;  2I18 A;  4CFR A;  1LKJ A;  2LC5 A;  3EVU A;  4DS7 A;  2L4I A;  5AER A;  4TNC A;  4YGB B;  5I2O A;  1YTZ C;  1VRK A;  4MVF A;  1BOD A;  2KOT A;  1UUR A;  4BY4 A;  5CSI A;  2FCE A;  1K9K A;  1IJ5 A;  1K9U A;  2WOS A;  4FQO A;  2HPS A;  4NDC A;  3OX6 A;  5ER5 A;  5I2L A;  2M29 A;  4DRW A;  3BQ3 A;  2QAC A;  2KI4 B;  2JQ6 A;  1JFK A;  2HQ8 A;  1L2O C;  2MHH A;  4GPL B;  3RLZ A;  2LMT A;  4YGE B;  3H4S E;  5FYX A;  4ORA B;  1B1G A;  3VRQ A;  1JBA A;  2JT3 A;  2OS8 C;  2F2P A;  1EG3 A;  3EKH A;  1IWQ A;  5AFP A;  3DVE A;  1MF8 B;  3OHM B;  1W7I B;  5JJG A;  1XK4 C;  1XK4 A;  2Q91 A;  2BL0 B;  2K7O A;  2KBI A;  1MWN A;  3OX5 A;  1WLM A;  1SRA A;  2HQW A;  1S1E A;  2LAN A;  3CR4 X;  2ZKM X;  5DKN A;  4AQI A;  2LNK A;  4JWQ A;  1DTL A;  2JXL A;  1BJF A;  2LLS A;  4I5J A;  4YGA A;  4GFT A;  1LA0 A;  5DKR A;  1UUS A;  1FF1 A;  4MN0 A;  4U8D A;  1QX5 B;  1YUT A;  4PHJ A;  1AJ4 A;  3AKB A;  5HLV A;  1BT6 A;  2CBL A;  3EVR A;  4FTG A;  1K95 A;  4MZJ A;  1NCX A;  1SR6 B;  1REC A;  1RFJ A;  3NSK A;  1S5G Y;  2KNE A;  4I5K A;  4PE1 A;  5B8I B;  2KI6 D;  1DT7 B;  1J7P A;  1F55 A;  3FWC A;  4YI9 A;  1PRW A;  4MRX A;  3M0W A;  2AUC A;  2MLE C;  4F0Z B;  1EL4 A;  1SCM B;  1DJI A;  3NXA A;  3PFV A;  4P2Y B;  1JWD A;  2NLN A;  2DOQ A;  3I5I C;  5AAN A;  1RRO A;  2LUC A;  1J1D A;  1NIW A;  2M9G A;  2ZNE A;  3A8R A;  1BG1 A;  4MSP A;  1CM4 A;  5KSZ A;  3LK0 A;  1H8B A;  1KSM A;  2D8N A;  1XFX O;  2CCM A;  2LMV A;  1A75 B;  2L2E A;  4AQJ A;  4CID A;  3RM1 A;  4A4C A;  1KFU L;  3BYA A;  1TTX A;  1GGZ A;  1DJG A;  1WDC C;  3PAL A;  2PVB A;  2GGM A;  2FCD A;  1WLZ A;  2ZRS A;  1TN4 A;  1DMO A;  1EXR A;  1Y1U A; 
#chains in the Genus database with same CATH topology
 3QRX A;  1FBV A;  4NQG A;  5HL1 A;  1A29 A;  1SL9 A;  2H61 C;  1YRU B;  3L4A A;  4GGN A;  2JOJ A;  1YVH A;  1DGV A;  1WY9 A;  2ZN9 A;  3PM8 A;  3E3R A;  1BF5 A;  4QJ5 B;  1MQ1 A;  5AXI A;  1LIN A;  1QJT A;  3C1V A;  4N1G A;  4CPV A;  2KFH A;  1B8L A;  1TOP A;  5CSF A;  5DKQ A;  2KI6 C;  1SKT A;  1JFJ A;  4I5N B;  4INX A;  1Q80 A;  2KPH A;  3FWB A;  2JTT A;  2OS8 B;  2G2B A;  1OZS A;  3I5F B;  1XYD A;  1AVS A;  1DVI A;  1NX2 A;  4I5L B;  1SK6 D;  4D1E A;  2KLE A;  1B7T Z;  3AKA A;  2PAS A;  3B7A A;  1YUS A;  2LP3 A;  3JTD B;  3O6B A;  1QVI Z;  1DF0 A;  2O60 A;  3BUX B;  1M46 A;  2EGD A;  1UHK A;  3KPX A;  2K7B A;  1B8C A;  3MSE B;  2WCK A;  4NDD A;  2VRG A;  4GNK B;  1DJW A;  5D7F A;  1SNL A;  3LLE A;  3FS7 A;  3R1O A;  2LCP A;  2PQL A;  2JXC A;  3Q8I A;  4PDZ A;  3WXA A;  5FI7 A;  2KGB C;  1NWD A;  2L5X B;  3CDN A;  4XYN A;  5CPV A;  5PAL A;  1CKK A;  1B4C A;  1UHJ A;  3KO0 A;  5CSN A;  2A4J A;  1TCO B;  1K8U A;  3BXK A;  4YBH B;  1YRT B;  1J7O A;  1UWO A;  3K1E A;  2KFF A;  1QV1 A;  3TZ1 A;  1BLQ A;  1IH0 A;  2L0P A;  3O4X A;  1DGU A;  1LA3 A;  2F2O A;  2EC6 C;  1ZMZ A;  5J3X A;  4JPZ B;  3D0Y B;  1X02 A;  3HX4 A;  3ICB A;  3CR5 X;  3O2P A;  3DF0 B;  3EVV A;  1AUI B;  1CDM A;  1YX8 A;  2G9B A;  3NHI A;  1CMG A;  2KYF A;  4C0L A;  2M7L A;  5I8N A;  2WND A;  3L4L A;  1Y1A A;  2LHI A;  1ZFS A;  1FW4 A;  3BUN B;  3EKJ A;  3PLF B;  1TCF A;  3CAB A;  2LVJ A;  4AOM A;  1FI6 A;  1OOI X;  1SBJ A;  2QEB A;  1G33 A;  1KWO B;  2ERB A;  3I5G B;  4DCK A;  1S6C A;  1FI5 A;  2JUL A;  3SG2 A;  1CMF A;  1QTX A;  3D75 A;  2BBN A;  2R2I A;  1FPW A;  1M45 A;  3VRO A;  1KFU S;  2OTG B;  1LVC D;  3BOW B;  1H4B A;  3UO9 A;  4ETO A;  1J7Q A;  1RK9 A;  5JOL A;  3SS3 A;  3PAT A;  3GK1 A;  2KBM A;  1K2H A;  1K96 A;  3FE8 A;  1AK8 A;  2JU0 A;  2MBX A;  1M63 B;  1GQM A;  1DJH A;  1B7T Y;  1CLL A;  3DXL A;  5HKY A;  1BOC A;  2KSP A;  2BE4 A;  1XFU O;  4F7F A;  3ZNI A;  2LVI A;  3D77 A;  2PSR A;  3HCM A;  3CZ1 A;  1C7V A;  2FJY A;  1TWO A;  2NZ0 A;  3I5H C;  1NUB A;  2P6B B;  3DVJ A;  1SL7 A;  1F8H A;  1ALV A;  1CLM A;  1MR8 A;  1NCY A;  2H2K A;  2KAY A;  1U5I A;  1XFW O;  2QEV A;  2L4H A;  2KFG A;  2LAP A;  3TUY C;  1V1F A;  2LP2 A;  3PN7 B;  3PSR A;  3SS4 A;  1BMO A;  3CR2 A;  3DYE A;  2BE6 A;  4XJK A;  5F6T A;  3SIA A;  2CNP A;  1W7J B;  4OV2 A;  1BR4 B;  1BU3 A;  1UHH A;  2KAV A;  2ZND A;  3CYZ A;  1KK8 B;  3NSI A;  4GBA A;  5HYD A;  1W9Z A;  2F3Z A;  1WRK A;  1PK0 D;  1OSA A;  2BNX A;  3EG5 B;  1Y0V H;  2M8U A;  4N5X A;  2M0R A;  1MHO A;  4M2P A;  2PAL A;  3BUO B;  1V1G A;  1CDP A;  1OZO A;  5BPJ A;  1YX7 A;  2JNF A;  2WOR A;  2K2F A;  2LVV A;  3AAK A;  4JD9 A;  4YI8 A;  1CDL A;  2GV5 A;  4WQ2 A;  4MLW A;  4PHM A;  1AJ5 A;  5HKW A;  1B9A A;  3NSO A;  3FIA A;  2TN4 A;  2F33 A;  2F8P A;  2KHN A;  2ZFD A;  2KQ6 A;  2WCJ A;  4C0J A;  2K7D A;  1YUU A;  3CWG A;  4E68 A;  1TNQ A;  1JUO A;  1KFX S;  4MBE A;  5TNC A;  2JC2 A;  4JKT A;  4UPG A;  1F71 A;  1C07 A;  2L5Y A;  1LS8 A;  2K61 A;  1EG4 A;  2E30 A;  2KI4 C;  3GK2 A;  2HF5 A;  1IRJ A;  3CZ0 A;  4FQT A;  1Z2C B;  1QXP A;  2EC6 B;  4NDB A;  4HRG A;  2JRF A;  2PYQ A;  1UP5 A;  2JWW A;  1CDN A;  4WQ3 A;  1F54 A;  2AAO A;  2K2A A;  2I2R E;  1QIW A;  3BFB A;  1F70 A;  1L7Z A;  5G08 A;  2GTE A;  1OE9 B;  3AAJ A;  4CLN A;  3OB1 B;  1L2O B;  2BKI B;  2IS9 A;  2M49 B;  2BL0 C;  1QS7 A;  1KQM C;  2GGZ A;  1Y1X A;  4PE0 A;  1N0Y A;  1CFF A;  2MLF C;  3GK4 X;  1K93 D;  3NGV A;  3PJI A;  4N1F A;  4QJ3 B;  3WHT B;  1NP8 A;  1CNP A;  2O5G A;  2SAS A;  3DZT A;  2H8V A;  2NCO A;  1NCZ A;  1OMV A;  3EK4 A;  2F3Y A;  3B88 A;  1K9P A;  1KCY A;  1OQP A;  1SR6 C;  2KGR A;  2QPT A;  1IQ3 A;  2LVK A;  3UNW A;  1ZOT B;  3OP0 A;  1RTP 1;  2CXJ A;  4HSZ A;  1CM1 A;  1OMR A;  2LUX A;  1SCM C;  2MAZ A;  3DVK A;  4PE7 A;  1CFC A;  5KU1 A;  3O4Y A;  1KFX L;  4OR9 B;  2L50 A;  2M3W A;  4OVN F;  5CSJ A;  3SJS A;  2WC5 A;  1ZAC A;  2Y1M A;  1KQV A;  2LM5 A;  3N7H A;  1SL8 A;  1SY9 A;  3SIB A;  1IGV A;  2SCP A;  1LXF C;  1YR5 A;  2L51 A;  2BEC A;  2HET A;  1DQE A;  1A2X A;  4OKH A;  1SCV A;  3KHE A;  1XFY O;  4IJ7 A;  3I5I B;  3IQQ A;  1AP4 A;  1A75 A;  3CLN A;  1S6J A;  3VRR A;  1JSA A;  4L9M A;  5KTY A;  2M7N A;  2QDI A;  1DJY A;  4OCI A;  1OOF A;  2WC6 A;  4KYN A;  3ZWH A;  5IBW A;  1OOG A;  1CFP A;  2M1K B;  3SG6 A;  3OGN A;  4PCW A;  5EL2 A;  1KK7 Z;  2BAP A;  4PAL A;  1XA5 A;  2WCF A;  2ZRT A;  3S0G A;  2P70 A;  2Y1N A;  1NX3 A;  2CTN A;  4MRY A;  5K89 A;  3LCP C;  2MA2 A;  3F45 A;  1TRF A;  1YVL A;  1XO5 A;  2QEH A;  2FJU B;  1JC2 A;  1WDC B;  2LHL A;  2K0J A;  2WCB A;  1G4Y R;  2LE9 B;  4GGF C;  1F4Q A;  1S3P A;  4GGF A;  1SYM A;  4ICB A;  3LK1 A;  3S0F A;  1A4P A;  5HLO A;  2OPO A;  1QVI Y;  2Q4U A;  3TS5 C;  1DJX A;  3SG5 A;  3VGO A;  3SG3 A;  3CZ2 A;  1S26 D;  3I5F C;  3V2L A;  1TIZ A;  1JF0 A;  3CS1 A;  2V53 A;  1IG5 A;  2JNX A;  2LMU A;  4C0K A;  3OB2 B;  3K21 A;  3OBV A;  3SG4 A;  1B8R A;  1OMD A;  1J7R A;  1CB1 A;  1B47 A;  1QV0 A;  4MEW A;  3DD4 A;  1CTR A;  4YRU A;  1EJ3 A;  2WCM A;  3JTD C;  3LL8 B;  4ORB B;  1KQM B;  2ZN8 A;  3KF9 A;  3DY9 A;  2LLU A;  1SMG A;  1CFD A;  4CFQ A;  2AMI A;  2KDH A;  2LV7 A;  2K60 A;  3VRP A;  4QJ4 B;  2WC8 A;  4BY5 A;  1UHN A;  2JT0 A;  2ISD A;  3TDI A;  4PE4 A;  1G8I A;  1QAS A;  1IKU A;  3CZT X;  1IJ6 A;  3CTN A;  3JVT C;  5HKZ A;  1RWY A;  1MXE A;  1DF0 B;  2BCX A;  1MUX A;  2NXQ A;  1NSH A;  3TDZ A;  1J1E A;  2PMY A;  4MZK A;  4A4B A;  5D69 A;  4Q04 A;  1N65 A;  1D1O A;  1DJZ A;  3VRN A;  1KK7 Y;  1SW8 A;  2EHB A;  1NPQ A;  1ODB A;  1SPY A;  3CGA A;  2E6W A;  2M1U A;  3D0Y A;  1TNX A;  1XVJ A;  3D76 A;  2M97 A;  2K8M B;  2NCP A;  3DF0 A;  2KYC A;  3GOF A;  3SG7 A;  2LLT A;  4MZL A;  2K7C A;  4GAO A;  4HRH A;  1WRL A;  2Y4Q A;  1QLK A;  3A4U B;  2KAX A;  3BUM B;  3IF7 A;  1F4O A;  2RGI A;  4ZCV A;  1K94 A;  2I7A A;  2B1U A;  1C7W A;  3NSL A;  1KWO C;  1UHI A;  3I5G C;  4PHN A;  4WRI A;  1Y6W A;  2BCB A;  2COL B;  4PHK A;  1QAT A;  3WHU B;  4M2O A;  3D74 A;  1QX2 A;  2OTG C;  1SSE B;  3R72 A;  3BOW A;  5I2Q A;  1R2U A;  1QIV A;  2WCL A;  2JT8 A;  1QX7 A;  1NX1 A;  1NX0 A;  3IVT A;  3D78 A;  4P5O E;  4DUQ A;  4GUK A;  3EK8 A;  1NYA A;  1PAL A;  1QLS A;  2JTZ A;  1PVA A;  2Y5I A;  5ER4 X;  3S0B A;  1PSR A;  1ZUZ A;  1TNP A;  1XFZ O;  2JZI A;  3O78 A;  5FI2 A;  2H61 A;  4JQ0 D;  5AEQ A;  1ALW A;  4HRE E;  1K90 D;  2BCA A;  1XFR A;  4USL A;  1PUL A;  1J55 A;  3DVM A;  1M39 A;  1OOH A;  1KSO A;  1N2D A;  2MRD A;  3IQO A;  1WRZ A;  5GQQ C;  3PN7 C;  3KEV A;  2BKH B;  4M2Q A;  5DIC A;  1S6I A;  2BBM A;  3S0D A;  1GJY A;  2JPT A;  3TS5 B;  1OOJ A;  3I5H B;  4DIR A;  4INW A;  1KK8 C;  3D73 A;  3EK7 A;  1TNW A;  1XFV O;  5FI6 A;  1EH2 A;  3BUW B;  4IL1 A;  3S0E A;  1U5I B;  4ZCU A;  3TUY B;  3S0A A;  1GGW A;  3NHT A;  4ORC B;  1CLB A;  1S36 A;  2WCE A;  1IIO A;  2PRU A;  1QWV A;  1JF2 A;  3R1P A;  1PVB A;  4XJK B;  1E8A A;  4R1E A;  1R6P A;  2KQY A;  1DC1 A;  1YUR A;  2FOT A;  1OW4 A;  3L47 A;  3D10 A;  1AHR A;  3TDU A;  2WCH A;  1A03 A;  1PSB A;  1M31 A;  1MXL C;  1BR1 B;  1RJV A;  1HT9 A;  4YGC B;  2L98 A;  1IQ5 A;  1HQV A;  2MJW B;  5I94 A;  2CT9 A;  4YGD B;  3FE9 A;  3QME A;  1DEL A;  1S5G Z;  2I94 A;  3WNX B;  3JVT B;  2I18 A;  4CFR A;  1LKJ A;  2LC5 A;  3EVU A;  4DS7 A;  2L4I A;  5AER A;  4TNC A;  4YGB B;  5I2O A;  1YTZ C;  1VRK A;  4MVF A;  1BOD A;  1TUJ A;  2KOT A;  1UUR A;  4BY4 A;  5CSI A;  2FCE A;  1K9K A;  1IJ5 A;  1K9U A;  2WOS A;  4FQO A;  4OZD A;  2HPS A;  4NDC A;  2KLD A;  3OX6 A;  5ER5 A;  5I2L A;  2M29 A;  4DRW A;  3BQ3 A;  2QAC A;  2KI4 B;  2JQ6 A;  1JFK A;  2HQ8 A;  1L2O C;  2MHH A;  4GPL B;  1ORG A;  3RLZ A;  2LMT A;  1C3Z A;  4YGE B;  3H4S E;  5FYX A;  4ORA B;  1B1G A;  1DEK A;  3VRQ A;  2JT3 A;  1JBA A;  2OS8 C;  2F2P A;  1EG3 A;  3EKH A;  1IWQ A;  5AFP A;  3DVE A;  1MF8 B;  3OHM B;  1W7I B;  5JJG A;  1XK4 C;  1XK4 A;  2Q91 A;  2BL0 B;  2K7O A;  2KBI A;  1MWN A;  3OX5 A;  1WLM A;  1SRA A;  2HQW A;  1S1E A;  2LAN A;  3B6X A;  2ZKM X;  3CR4 X;  5DKN A;  4AQI A;  2LNK A;  4JWQ A;  1DTL A;  2P71 A;  2JXL A;  1BJF A;  2LLS A;  4I5J A;  4YGA A;  4GFT A;  1LA0 A;  5DKR A;  1UUS A;  1FF1 A;  4MN0 A;  4U8D A;  1TUZ A;  1Z4H A;  1QX5 B;  1YUT A;  3BFH A;  4PHJ A;  1AJ4 A;  3AKB A;  5HLV A;  3PM2 A;  1T14 A;  1BT6 A;  1GM0 A;  2CBL A;  3EVR A;  3R1V A;  1K95 A;  4FTG A;  4MZJ A;  1NCX A;  1SR6 B;  1REC A;  1RFJ A;  3NSK A;  1S5G Y;  2KNE A;  4I5K A;  4PE1 A;  5B8I B;  2KI6 D;  1DT7 B;  1C3Y A;  1J7P A;  1F55 A;  3FWC A;  4YI9 A;  1PRW A;  4MRX A;  3M0W A;  2AUC A;  2MLE C;  4F0Z B;  1EL4 A;  1SCM B;  1DJI A;  3NXA A;  3PFV A;  4P2Y B;  1JWD A;  3BFA A;  2NLN A;  2JPO A;  2DOQ A;  3VB1 A;  3I5I C;  5AAN A;  1RRO A;  2LUC A;  2YGU A;  3B86 A;  1J1D A;  1NIW A;  2M9G A;  2ZNE A;  3A8R A;  5D3O A;  1BG1 A;  4MSP A;  1CM4 A;  5KSZ A;  3LK0 A;  3B87 A;  1H8B A;  1KSM A;  2QEO A;  2D8N A;  1XFX O;  2CCM A;  2L2C A;  2LMV A;  4PT1 A;  1A75 B;  2L2E A;  4AQJ A;  4CID A;  3RM1 A;  3FE6 A;  1KFU L;  3BYA A;  4A4C A;  1TTX A;  1GGZ A;  1P28 A;  1DJG A;  3SS5 A;  1WDC C;  3PAL A;  3BJH A;  2PVB A;  2GGM A;  2FCD A;  1WLZ A;  2ZRS A;  3RZS A;  1TN4 A;  1DMO A;  1EXR A;  1Y1U A; 
#chains in the Genus database with same CATH homology
 3QRX A;  1FBV A;  4NQG A;  1A29 A;  1SL9 A;  2H61 C;  1YRU B;  4GGN A;  2JOJ A;  1YVH A;  1DGV A;  1WY9 A;  2ZN9 A;  1BF5 A;  3E3R A;  4QJ5 B;  1MQ1 A;  5AXI A;  1LIN A;  1QJT A;  3C1V A;  4N1G A;  4CPV A;  2KFH A;  1B8L A;  1TOP A;  5CSF A;  5DKQ A;  2KI6 C;  1SKT A;  1JFJ A;  4I5N B;  1Q80 A;  3FWB A;  2JTT A;  2OS8 B;  2G2B A;  1OZS A;  3I5F B;  1XYD A;  1AVS A;  1DVI A;  1NX2 A;  4I5L B;  1SK6 D;  4D1E A;  1B7T Z;  3AKA A;  2PAS A;  1YUS A;  2LP3 A;  3JTD B;  3O6B A;  1QVI Z;  1DF0 A;  2O60 A;  3BUX B;  1M46 A;  2EGD A;  1UHK A;  3KPX A;  2K7B A;  1B8C A;  3MSE B;  4NDD A;  2VRG A;  4GNK B;  1DJW A;  5D7F A;  1SNL A;  3LLE A;  3FS7 A;  2LCP A;  2JXC A;  4PDZ A;  3WXA A;  2KGB C;  1NWD A;  2L5X B;  4XYN A;  5CPV A;  5PAL A;  1CKK A;  1B4C A;  1UHJ A;  3KO0 A;  5CSN A;  2A4J A;  1TCO B;  1K8U A;  3BXK A;  4YBH B;  1YRT B;  1J7O A;  1UWO A;  1BLQ A;  2KFF A;  1QV1 A;  3TZ1 A;  1IH0 A;  2L0P A;  1DGU A;  1LA3 A;  2F2O A;  2EC6 C;  1ZMZ A;  5J3X A;  4JPZ B;  3D0Y B;  1X02 A;  3HX4 A;  3ICB A;  3CR5 X;  3O2P A;  3DF0 B;  3EVV A;  1AUI B;  1CDM A;  1YX8 A;  2G9B A;  1CMG A;  2KYF A;  4C0L A;  2M7L A;  5I8N A;  2WND A;  1Y1A A;  2LHI A;  1ZFS A;  1FW4 A;  3BUN B;  3EKJ A;  3PLF B;  1TCF A;  2LVJ A;  4AOM A;  1FI6 A;  1SBJ A;  1G33 A;  1KWO B;  3I5G B;  4DCK A;  1S6C A;  1FI5 A;  2JUL A;  3SG2 A;  1CMF A;  1QTX A;  2BBN A;  2R2I A;  1FPW A;  1M45 A;  3VRO A;  1KFU S;  2OTG B;  1LVC D;  3BOW B;  1H4B A;  4ETO A;  1J7Q A;  1RK9 A;  5JOL A;  3PAT A;  3GK1 A;  2KBM A;  1K2H A;  1K96 A;  1AK8 A;  2JU0 A;  2MBX A;  1M63 B;  1GQM A;  1DJH A;  1B7T Y;  1CLL A;  5HKY A;  1BOC A;  2KSP A;  2BE4 A;  1XFU O;  3ZNI A;  2LVI A;  2PSR A;  3HCM A;  1C7V A;  2NZ0 A;  3I5H C;  1NUB A;  2P6B B;  3DVJ A;  1SL7 A;  1F8H A;  1ALV A;  1CLM A;  1MR8 A;  1NCY A;  2H2K A;  2KAY A;  1U5I A;  1XFW O;  3PM8 A;  2L4H A;  2KFG A;  2LAP A;  3TUY C;  1V1F A;  2LP2 A;  3PN7 B;  3PSR A;  1BMO A;  3CR2 A;  4XJK A;  2BE6 A;  5F6T A;  3SIA A;  2CNP A;  1W7J B;  4OV2 A;  1BR4 B;  1BU3 A;  1UHH A;  2KAV A;  2ZND A;  3NSI A;  1KK8 B;  4GBA A;  5HYD A;  2F3Z A;  1WRK A;  1PK0 D;  1OSA A;  1Y0V H;  2M8U A;  4N5X A;  2M0R A;  1MHO A;  4M2P A;  2PAL A;  3BUO B;  1V1G A;  1CDP A;  1OZO A;  5BPJ A;  1YX7 A;  2JNF A;  2WOR A;  2K2F A;  2LVV A;  3AAK A;  4YI8 A;  1CDL A;  2GV5 A;  4WQ2 A;  4MLW A;  4PHM A;  1AJ5 A;  5HKW A;  1B9A A;  3NSO A;  3FIA A;  2TN4 A;  2F33 A;  2F8P A;  2KHN A;  2ZFD A;  2KQ6 A;  4C0J A;  2K7D A;  1YUU A;  3CWG A;  4E68 A;  1TNQ A;  1JUO A;  1KFX S;  4MBE A;  5TNC A;  2JC2 A;  4UPG A;  1F71 A;  1C07 A;  2K61 A;  1EG4 A;  2E30 A;  2KI4 C;  3GK2 A;  2HF5 A;  1IRJ A;  1QXP A;  2EC6 B;  4NDB A;  4HRG A;  2JRF A;  1UP5 A;  2JWW A;  1CDN A;  4WQ3 A;  1F54 A;  2AAO A;  2K2A A;  2I2R E;  1QIW A;  1F70 A;  1L7Z A;  5G08 A;  1OE9 B;  3AAJ A;  4CLN A;  3OB1 B;  1L2O B;  2BKI B;  2IS9 A;  2M49 B;  2BL0 C;  1QS7 A;  1KQM C;  2GGZ A;  1Y1X A;  4PE0 A;  1N0Y A;  1CFF A;  2MLF C;  3GK4 X;  1K93 D;  4N1F A;  4QJ3 B;  3WHT B;  1NP8 A;  1CNP A;  2O5G A;  2SAS A;  2NCO A;  1NCZ A;  1OMV A;  3EK4 A;  2F3Y A;  1KCY A;  1K9P A;  1OQP A;  1SR6 C;  2KGR A;  2QPT A;  1IQ3 A;  2LVK A;  1ZOT B;  3OP0 A;  1RTP 1;  2CXJ A;  4HSZ A;  1CM1 A;  1OMR A;  2LUX A;  1SCM C;  2MAZ A;  3DVK A;  4PE7 A;  1CFC A;  5KU1 A;  3O4Y A;  1KFX L;  4OR9 B;  2L50 A;  2M3W A;  4OVN F;  5CSJ A;  3SJS A;  1ZAC A;  2Y1M A;  1KQV A;  2LM5 A;  1SL8 A;  1SY9 A;  3SIB A;  1IGV A;  2SCP A;  1LXF C;  1YR5 A;  2L51 A;  2BEC A;  2HET A;  1A2X A;  4OKH A;  1SCV A;  3KHE A;  1XFY O;  3I5I B;  3IQQ A;  1AP4 A;  1A75 A;  3CLN A;  1S6J A;  3VRR A;  1JSA A;  4L9M A;  5KTY A;  2M7N A;  1DJY A;  4OCI A;  3ZWH A;  5IBW A;  1CFP A;  2M1K B;  3SG6 A;  4PCW A;  1KK7 Z;  4PAL A;  1XA5 A;  2WCF A;  2ZRT A;  2Y1N A;  1NX3 A;  2CTN A;  4MRY A;  5K89 A;  3LCP C;  2MA2 A;  3F45 A;  1TRF A;  1YVL A;  1XO5 A;  2FJU B;  1JC2 A;  1WDC B;  2LHL A;  2K0J A;  2WCB A;  1G4Y R;  2LE9 B;  4GGF C;  1F4Q A;  1S3P A;  4GGF A;  1SYM A;  4ICB A;  3LK1 A;  1A4P A;  5HLO A;  2OPO A;  1QVI Y;  2Q4U A;  3TS5 C;  1DJX A;  3SG5 A;  3VGO A;  3SG3 A;  1S26 D;  3I5F C;  1TIZ A;  1JF0 A;  3CS1 A;  2V53 A;  1IG5 A;  2JNX A;  2LMU A;  4C0K A;  3OB2 B;  3K21 A;  3SG4 A;  1B8R A;  1OMD A;  1J7R A;  1CB1 A;  1B47 A;  1QV0 A;  4MEW A;  3DD4 A;  1CTR A;  4YRU A;  1EJ3 A;  3JTD C;  3LL8 B;  4ORB B;  1KQM B;  2ZN8 A;  3KF9 A;  2LLU A;  1SMG A;  1CFD A;  4CFQ A;  2AMI A;  2KDH A;  2LV7 A;  3VRP A;  4QJ4 B;  2WC8 A;  4BY5 A;  1UHN A;  2JT0 A;  2ISD A;  3TDI A;  4PE4 A;  1G8I A;  1QAS A;  1IKU A;  3CZT X;  1IJ6 A;  3CTN A;  3JVT C;  5HKZ A;  1RWY A;  1MXE A;  1DF0 B;  2BCX A;  1MUX A;  2NXQ A;  1NSH A;  3TDZ A;  1J1E A;  2PMY A;  4MZK A;  4A4B A;  5D69 A;  4Q04 A;  1N65 A;  1D1O A;  1DJZ A;  3VRN A;  1KK7 Y;  1SW8 A;  2EHB A;  1NPQ A;  1ODB A;  1SPY A;  3CGA A;  2E6W A;  2M1U A;  3D0Y A;  1TNX A;  1XVJ A;  2M97 A;  2K8M B;  2NCP A;  3DF0 A;  2KYC A;  3GOF A;  3SG7 A;  2LLT A;  4MZL A;  2K7C A;  4GAO A;  4HRH A;  1WRL A;  2Y4Q A;  1QLK A;  3A4U B;  2KAX A;  3BUM B;  3IF7 A;  1F4O A;  2RGI A;  4ZCV A;  1K94 A;  2I7A A;  2B1U A;  1C7W A;  3NSL A;  1KWO C;  1UHI A;  3I5G C;  4PHN A;  4WRI A;  1Y6W A;  2BCB A;  2COL B;  4PHK A;  1QAT A;  3WHU B;  4M2O A;  1QX2 A;  2OTG C;  5I2Q A;  3BOW A;  1R2U A;  1QIV A;  2JT8 A;  1QX7 A;  1NX1 A;  1NX0 A;  4P5O E;  4DUQ A;  4GUK A;  3EK8 A;  1NYA A;  1PAL A;  1QLS A;  2JTZ A;  1PVA A;  2Y5I A;  5ER4 X;  1PSR A;  1ZUZ A;  1TNP A;  1XFZ O;  2JZI A;  3O78 A;  2H61 A;  4JQ0 D;  5AEQ A;  1ALW A;  4HRE E;  1K90 D;  2BCA A;  4USL A;  1PUL A;  1J55 A;  3DVM A;  1M39 A;  1KSO A;  1N2D A;  2MRD A;  3IQO A;  1WRZ A;  5GQQ C;  3PN7 C;  3KEV A;  2BKH B;  4M2Q A;  1S6I A;  2BBM A;  3TS5 B;  1GJY A;  2JPT A;  1OOJ A;  3I5H B;  4DIR A;  1KK8 C;  3EK7 A;  1TNW A;  1XFV O;  1EH2 A;  3BUW B;  4IL1 A;  1U5I B;  4ZCU A;  3TUY B;  1GGW A;  4ORC B;  1CLB A;  1S36 A;  2WCE A;  2PRU A;  1JF2 A;  1PVB A;  4XJK B;  1E8A A;  4R1E A;  1R6P A;  2KQY A;  1YUR A;  2FOT A;  3TDU A;  3D10 A;  1AHR A;  1A03 A;  1PSB A;  1M31 A;  1MXL C;  1BR1 B;  1RJV A;  1HT9 A;  4YGC B;  2L98 A;  1IQ5 A;  1HQV A;  2MJW B;  2CT9 A;  4YGD B;  1S5G Z;  3WNX B;  2I94 A;  3JVT B;  2I18 A;  4CFR A;  1LKJ A;  2LC5 A;  3EVU A;  4DS7 A;  2L4I A;  5AER A;  4TNC A;  4YGB B;  5I2O A;  1YTZ C;  1VRK A;  4MVF A;  1BOD A;  2KOT A;  1UUR A;  4BY4 A;  5CSI A;  2FCE A;  1K9K A;  1IJ5 A;  1K9U A;  2WOS A;  4FQO A;  2HPS A;  4NDC A;  3OX6 A;  5ER5 A;  5I2L A;  2M29 A;  4DRW A;  3BQ3 A;  2QAC A;  2KI4 B;  2JQ6 A;  1JFK A;  2HQ8 A;  1L2O C;  2MHH A;  4GPL B;  3RLZ A;  2LMT A;  4YGE B;  3H4S E;  5FYX A;  4ORA B;  1B1G A;  3VRQ A;  1JBA A;  2JT3 A;  2OS8 C;  2F2P A;  1EG3 A;  3EKH A;  1IWQ A;  5AFP A;  3DVE A;  1MF8 B;  3OHM B;  1W7I B;  5JJG A;  1XK4 C;  1XK4 A;  2Q91 A;  2BL0 B;  2K7O A;  2KBI A;  1MWN A;  3OX5 A;  1WLM A;  1SRA A;  2HQW A;  1S1E A;  2LAN A;  3CR4 X;  2ZKM X;  5DKN A;  4AQI A;  2LNK A;  4JWQ A;  1DTL A;  2JXL A;  1BJF A;  2LLS A;  4I5J A;  4YGA A;  4GFT A;  1LA0 A;  5DKR A;  1UUS A;  1FF1 A;  4MN0 A;  4U8D A;  1QX5 B;  1YUT A;  4PHJ A;  1AJ4 A;  3AKB A;  5HLV A;  1BT6 A;  2CBL A;  3EVR A;  4FTG A;  1K95 A;  4MZJ A;  1NCX A;  1SR6 B;  1REC A;  1RFJ A;  3NSK A;  1S5G Y;  2KNE A;  4I5K A;  4PE1 A;  5B8I B;  2KI6 D;  1DT7 B;  1J7P A;  1F55 A;  3FWC A;  4YI9 A;  1PRW A;  4MRX A;  3M0W A;  2AUC A;  2MLE C;  4F0Z B;  1EL4 A;  1SCM B;  1DJI A;  3NXA A;  3PFV A;  4P2Y B;  1JWD A;  2NLN A;  2DOQ A;  3I5I C;  5AAN A;  1RRO A;  2LUC A;  1J1D A;  1NIW A;  2M9G A;  2ZNE A;  3A8R A;  1BG1 A;  4MSP A;  1CM4 A;  5KSZ A;  3LK0 A;  1H8B A;  1KSM A;  2D8N A;  1XFX O;  2CCM A;  2LMV A;  1A75 B;  2L2E A;  4AQJ A;  4CID A;  3RM1 A;  4A4C A;  1KFU L;  3BYA A;  1TTX A;  1GGZ A;  1DJG A;  1WDC C;  3PAL A;  2PVB A;  2GGM A;  2FCD A;  1WLZ A;  2ZRS A;  1TN4 A;  1DMO A;  1EXR A;  1Y1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...