1NX0A

Structure of calpain domain 6 in complex with calpastatin dic
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Calcium-dependent protease, small subunit
total genus 60
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx0A00
1SL7A 1J55A 2I7AA 1QX5B 4GGFA 5AFPA 4YRUA 4PE1A 1F8HA 2LHLA 4BY4A 2JT8A 1DJHA 2KSPA 1TNQA 4YGAA 3I5FB 2PALA 4PALA 3JTDC 1BG1A 3TUYB 2NXQA 1CNPA 3PN7B 3KEVA 1RECA 4XJKB 1FI5A 1K9KA 2EHBA 1DJIA 1XVJA 1LA3A 2LM5A 1SK6D 2JPTA 2HF5A 2K7CA 4I5JA 3DF0A 1RWYA 2LAPA 4F0ZB 1ZFSA 5CSIA 1QATA 5TNCA 4MBEA 3D10A 1PULA 1SR6C 1KK7Y 1K9UA 1SNLA 1TNPA 1B9AA 5CSJA 2BKIB 1XFVO 2LVKA 3CLNA 3BXKA 1KSOA 1CTRA 1IJ5A 1BLQA 1UHJA 1F54A 1DTLA 1JF2A 1SCMB 3EVUA 1YX7A 1U5IA 1R6PA 2I2RE 3JVTB 5AXIA 1UHHA 1K8UA 2ZFDA 1IJ6A 2COLB 1AVSA 1TNXA 3BUMB 1AJ4A 1CMFA 3FWCA 3SG2A 1KWOB 2LUXA 1NX0A 2GGMA 2K8MB 3LLEA 4GPLB 5KSZA 2MHHA 1MWNA 2KI6D 1NWDA 2EC6B 2F2PA 3I5IB 4M2OA 3VRQA 1L2OC 2KQYA 4OVNF 5KTYA 1XFZO 2LLUA 2MAZA 2Q4UA 1CDNA 1EH2A 3JVTC 1XFUO 2M8UA 1MR8A 2KI6C 4MZKA 3TDZA 2VRGA 1C07A 1DT7B 1JF0A 3DF0B 2F3ZA 2Y1NA 3A4UB 3TZ1A 3PM8A 2MBXA 2H61A 5F6TA 3A8RA 2KYFA 2EC6C 2WCFA 3I5IC 1NCZA 3JTDB 4MN0A 4ETOA 1CMGA 1YR5A 1AJ5A 2M49B 3NSLA 5KU1A 1JFKA 2M1KB 1N2DA 1XA5A 2JQ6A 2KAYA 2PVBA 1CLMA 5GQQC 4C0JA 3BUXB 4CPVA 5JJGA 3RM1A 1RTP1 3CWGA 5I2QA 2JNFA 2Y5IA 3HX4A 3BUNB 1SR6B 4GNKB 2FJUB 5FYXA 1F71A 2ZN8A 3ZNIA 2Y1MA 4BY5A 3CZTX 1B7TZ 3OP0A 3BQ3A 3IF7A 3AAKA 5HYDA 1UHKA 3SG7A 1SCVA 1J7PA 1PVAA 1PALA 1BR4B 3H4SE 2L5XB 1SCMC 4JPZB 3LL8B 4MZJA 5AANA 3VRPA 2BCBA 2KAVA 3ZWHA 1C7VA 1JUOA 3D0YB 1KFUL 4C0LA 3EVRA 4MRXA 2MLFC 2K2AA 1K93D 4PHNA 3BUOB 1WLZA 4JQ0D 1BODA 2K2FA 1BOCA 1CDLA 2WORA 5I2LA 2LVJA 1ODBA 4A4BA 4AQJA 1B1GA 5ER4X 4D1EA 1L2OB 4MZLA 1SW8A 3EK8A 2AMIA 2M3WA 1W7IB 2CTNA 4YGEB 3DVKA 2KHNA 1EXRA 4ZCUA 4GBAA 1QV0A 1L7ZA 1S5GZ 1QIWA 2MLEC 3SG4A 1CDMA 1J7RA 1SBJA 1TTXA 3O78A 2B1UA 2KYCA 2KQ6A 1BU3A 3CR2A 4NQGA 2JTZA 1YVHA 1Q80A 2HQWA 2NLNA 2LCPA 3CR4X 2LANA 2L51A 2PASA 1YUSA 2JT0A 1J7QA 2LNKA 3FIAA 3DD4A 2LUCA 3F45A 2LMUA 3CGAA 1YURA 2LMTA 1SL8A 2LVVA 1LA0A 1QVIZ 4OV2A 1DF0A 3LK0A 1QXPA 1DJWA 1C7WA 3O4YA 3E3RA 2CT9A 2M7NA 4YGBB 1TCOB 1IQ5A 1NX1A 3IQOA 1S6IA 1WDCB 4HREE 2M97A 4M2PA 1YRUB 1RK9A 4GFTA 4R1EA 1DMOA 3QRXA 1FI6A 1QTXA 2M1UA 1NUBA 2AUCA 2KNEA 4XYNA 5HKWA 2LP2A 1A29A 3WHUB 1KQVA 1AK8A 2I94A 3I5HB 4XJKA 2LVIA 5JOLA 1F70A 4NDCA 2JWWA 1MXLC 4HRHA 1CFFA 2HPSA 4MLWA 2LMVA 1U5IB 1E8AA 2A4JA 1GJYA 3PLFB 3C1VA 4GGFC 1JFJA 1KSMA 2WNDA 1ALVA 3BOWA 3WHTB 2KDHA 4HRGA 2MA2A 1DGVA 1S5GY 2L98A 3HCMA 1V1FA 1QVIY 1X02A 2G2BA 1EG4A 1KK8B 1SPYA 2KI4C 1M31A 1S1EA 4DUQA 2NZ0A 1TNWA 1K95A 1TN4A 2R2IA 2SCPA 1Y1UA 1YUUA 2JNXA 2LP3A 1A75B 1NX2A 1MQ1A 3OX5A 3RLZA 3CTNA 1DGUA 1OQPA 2FCDA 2KFGA 4WRIA 4N1FA 3M0WA 2P6BB 1QLSA 2KI4B 1OZSA 2L2EA 1SRAA 1TOPA 1RROA 1ZACA 4YI8A 2OS8C 1G8IA 5I8NA 4WQ3A 2K0JA 2FOTA 2L50A 2I18A 4YBHB 1SYMA 1WDCC 1M39A 5HLVA 1UHNA 3DVMA 1WLMA 3SG3A 4MVFA 1G33A 1A75A 1QV1A 2WCEA 1K96A 1MXEA 2WCBA 2JT3A 4GUKA 4CFRA 1QIVA 3MSEB 1CLBA 2JU0A 4YGDB 1IWQA 3BOWB 4M2QA 3I5HC 2HETA 2M9GA 3SG6A 2E6WA 4PHKA 1R2UA 1KQMB 1OMDA 1JC2A 4TNCA 1BT6A 2KGBC 2SASA 2BBNA 1BMOA 1SMGA 2RGIA 3PALA 1W7JB 1XK4A 3KPXA 3TDUA 1NIWA 2BKHB 1B7TY 4DRWA 5BPJA 3SJSA 3D0YA 1HQVA 4USLA 1YUTA 2NCPA 1QX7A 2WOSA 4PE7A 1UURA 3GK1A 5AERA 1KK8C 4N1GA 1QASA 2F3YA 1ZMZA 1UWOA 2ZNDA 1A03A 3GK2A 1TIZA 2K7OA 1KQMC 3ICBA 2LHIA 1B8RA 5D7FA 1KFXL 1OZOA 3AKBA 3NXAA 1CDPA 1CLLA 4PE4A 1FBVA 1UP5A 4MEWA 1GGZA 2ZNEA 1EJ3A 1KCYA 2L0PA 1QX2A 2Q91A 1B8LA 1MUXA 3EK7A 2D8NA 1CM4A 1OMRA 2LV7A 5DKQA 2BE4A 1PVBA 1Y1XA 2K61A 2PMYA 1DF0B 2JXLA 2K7BA 2BBMA 4ORAB 3SIAA 3WNXB 4DCKA 3LCPC 1IH0A 2M7LA 4DS7A 1OOJA 1K94A 3EKHA 2IS9A 2OS8B 3CR5X 3NSOA 1BF5A 2Y4QA 1A4PA 1CFDA 3KHEA 4DIRA 2JZIA 1XFXO 1DVIA 2JTTA 1QLKA 1NSHA 2ISDA 4CFQA 1Y6WA 2GGZA 5J3XA 3TDIA 1NYAA 3VGOA 4QJ4B 4P2YB 5HKYA 4MRYA 2BL0C 2KAXA 3CS1A 4QJ5B 1OSAA 4PDZA 3SG5A 2KFHA 1K90D 2NCOA 5AEQA 4I5NB 2E30A 4U8DA 1S36A 2BCXA 4PHMA 1NX3A 1JWDA 5HLOA 1GQMA 3NSKA 5G08A 2V53A 5IBWA 5ER5A 2ZN9A 3OB2B 2K7DA 2BECA 1RJVA 5CPVA 1JBAA 2LLSA 2GV5A 2BL0B 1NCXA 2KGRA 2LLTA 3O2PA 2JULA 1YVLA 2AAOA 4PHJA 2G9BA 2HQ8A 1IKUA 1N65A 3PSRA 1M45A 1J1EA 2LC5A 5CSNA 1S6JA 3EVVA 2OTGB 4PCWA 4WQ2A 1F4QA 1WY9A 2KOTA 1DJGA 4CLNA 1CB1A 1B4CA 2CNPA 2F33A 1PSBA 1PSRA 1N0YA 3FS7A 5I2OA 1QS7A 1CKKA 1KFXS 1MF8B 4QJ3B 4ORCB 2JOJA 2TN4A 1CFPA 4N5XA 1EL4A 4AOMA 5K89A 2LE9B 4OKHA 1XFYO 1F4OA 1LKJA 2L4IA 3VRNA 1IQ3A 1FPWA 1LVCD 1MHOA 1KK7Z 1AP4A 2M29A 3AKAA 1KFUS 2CBLA 3SIBA 1TCFA 1CFCA 1EG3A 1UUSA 4PE0A 4AQIA 2JXCA 1CM1A 4E68A 1J7OA 4C0KA 2CXJA 3GK4X 1SL9A 1S3PA 4NDDA 3DVEA 3PATA 1DJZA 2BCAA 1HT9A 2M0RA 2L4HA 2KFFA 2ZRSA 1NCYA 4GGNA 4OCIA 2H2KA 1ZUZA 1S26D 1YX8A 3EK4A 1XO5A 1V1GA 1GGWA 1SY9A 2O5GA 3BUWB 4I5LB 4NDBA 4YI9A 3I5GC 3LK1A 1ZOTB 4L9MA 4A4CA 3O6BA 1K2HA 1S6CA 3FWBA 1UHIA 1NPQA 1LXFC 5B8IB 1M46A 5CSFA 4YGCB 1H8BA 2MRDA 1J1DA 4I5KA 2PRUA 1QJTA 4CIDA 2QACA 1YTZC 2O60A 3OB1B 4ZCVA 2OTGC 3EKJA 2MJWB 1BR1B 3KO0A 1IGVA 3IQQA 1PRWA 1FF1A 3I5FC 1AHRA 3BYAA 2DOQA 3KF9A 4ICBA 2OPOA 1IG5A 5DKNA 1OMVA 3PN7C 4Q04A 3VROA 4GAOA 5DKRA 1DJYA 1Y0VH 1B47A 2ZKMX 3TS5C 3WXAA 1YRTB 2KBIA 2F8PA 1XYDA 1VRKA 4JWQA 3PFVA 1WRLA 4UPGA 5D69A 1Y1AA 1SKTA 1PK0D 1B8CA 1IRJA 2PSRA 1XK4C 3K21A 4IL1A 1OE9B 2H61C 1JSAA 3GOFA 2JRFA 3AAJA 1NP8A 2FCEA 4P5OE 4HSZA 2ZRTA 1DJXA 3NSIA 1XFWO 4ORBB 3TS5B 5HKZA 1RFJA 2JC2A 2QPTA 3OHMB 1WRKA 1A2XA 4OR9B 3VRRA 1KWOC 4MSPA 2EGDA 1LINA 5PALA 1D1OA 2F2OA 3OX6A 1TRFA 1F55A 1M63B 3DVJA 2BE6A 2KBMA 3TUYC 3I5GB 4FTGA 2CCMA 4FQOA 1G4YR 1WRZA 1H4BA 2WC8A 1FW4A 1K9PA 1AUIB 1BJFA 1ALWA
chains in the Genus database with same CATH superfamily
1SL7A 1J55A 2I7AA 1QX5B 4GGFA 5AFPA 4YRUA 4PE1A 1F8HA 2LHLA 4BY4A 2JT8A 1DJHA 2KSPA 1TNQA 4YGAA 2PYQA 2PALA 3I5FB 4PALA 3JTDC 1BG1A 2QDIA 3TUYB 2NXQA 2WC6A 3S0GA 1CNPA 3PN7B 3KEVA 1DEKA 1RECA 3B88A 4XJKB 1K9KA 2EHBA 3UO9A 1FI5A 1DJIA 1XVJA 5I94A 5D3OA 2WCLA 1LA3A 2LM5A 1SK6D 2JPTA 2HF5A 2K7CA 4I5JA 3DF0A 1RWYA 2LAPA 4F0ZB 1ZFSA 5CSIA 1QATA 5TNCA 4MBEA 3D10A 1PULA 1SR6C 1KK7Y 1K9UA 1SNLA 1TNPA 1B9AA 1T14A 5CSJA 2BKIB 1XFVO 3FE9A 2LVKA 3CLNA 3BXKA 1KSOA 1CTRA 1IJ5A 4FQTA 1BLQA 1UHJA 3EG5B 1F54A 1DTLA 1JF2A 1OOHA 1SCMB 1YX7A 1U5IA 1R6PA 2I2RE 3EVUA 3JVTB 4KYNA 5AXIA 1UHHA 1K8UA 2ZFDA 1IJ6A 2COLB 3UNWA 1AVSA 1TNXA 3BUMB 1AJ4A 1CMFA 5FI7A 3FWCA 2WCJA 3B87A 3SG2A 3PJIA 1KWOB 2LUXA 1NX0A 2GGMA 3D76A 2K8MB 3LLEA 4GPLB 5KSZA 2MHHA 1MWNA 2KI6D 1NWDA 2EC6B 2F2PA 3I5IB 1C3YA 4M2OA 3VRQA 1L2OC 2KQYA 4OVNF 5KTYA 1XFZO 1KQVA 2L2CA 2LLUA 2MAZA 2Q4UA 1CDNA 2KPHA 1EH2A 3JVTC 1XFUO 2M8UA 1MR8A 2KI6C 4MZKA 3TDZA 1OW4A 2VRGA 1C07A 1DT7B 1JF0A 3DF0B 2F3ZA 2Y1NA 3A4UB 3TZ1A 3PM8A 1ORGA 3DYEA 2H61A 2MBXA 5F6TA 3A8RA 2KYFA 2EC6C 2WCFA 3I5IC 1NCZA 3JTDB 4MN0A 4ETOA 1CMGA 1YR5A 1AJ5A 2M49B 3NSLA 5KU1A 1JFKA 2M1KB 1N2DA 3SS5A 1XA5A 2JQ6A 2KAYA 2PVBA 1CLMA 5GQQC 4C0JA 3BUXB 4CPVA 5JJGA 3RM1A 1RTP1 3CWGA 5I2QA 2JNFA 2Y5IA 3HX4A 5EL2A 3BUNB 3D78A 3R1VA 1SR6B 4GNKB 2FJUB 5FYXA 1XFRA 3SS3A 1F71A 2ZN8A 3ZNIA 2Y1MA 4BY5A 3CZTX 2GTEA 1B7TZ 3OP0A 3BQ3A 3CABA 3IF7A 3AAKA 5HYDA 1UHKA 3SG7A 1SCVA 1J7PA 1PVAA 1PALA 1BR4B 3H4SE 2L5XB 1SCMC 4JPZB 3LL8B 4MZJA 5AANA 3VRPA 2BCBA 2KAVA 3ZWHA 2KLEA 1C7VA 1JUOA 3D0YB 1KFUL 4C0LA 3EVRA 4MRXA 2L5YA 2MLFC 2K2AA 1K93D 4PHNA 3BUOB 1WLZA 4JQ0D 1BODA 2K2FA 1BOCA 1IH0A 1C3ZA 1CDLA 2WORA 5I2LA 2LVJA 1ODBA 4A4BA 4AQJA 1B1GA 5ER4X 4D1EA 1L2OB 4MZLA 1SW8A 3EK8A 1OOGA 2AMIA 2M3WA 1W7IB 2CTNA 3CZ0A 4YGEB 3DVKA 2KHNA 3N7HA 1EXRA 4ZCUA 4GBAA 1QV0A 1SSEB 1L7ZA 1S5GZ 1QIWA 2MLEC 3SG4A 1CDMA 1J7RA 1IIOA 1DQEA 1SBJA 1TTXA 3O78A 2B1UA 4INXA 2KYCA 2KQ6A 2QEVA 3FE8A 2WC5A 1BU3A 3CR2A 4NQGA 2JTZA 1YVHA 1Q80A 2HQWA 2NLNA 3Q8IA 2LCPA 3CR4X 2LANA 2L51A 2PASA 1TUJA 1YUSA 2JT0A 3NGVA 1J7QA 1OOFA 2LNKA 3FIAA 3S0AA 3DD4A 2LUCA 3F45A 2LMUA 3CGAA 1YURA 2LMTA 1SL8A 2LVVA 3B7AA 1LA0A 1QVIZ 4OV2A 1DF0A 3LK0A 1QXPA 1DJWA 1C7WA 3O4YA 3E3RA 2CT9A 2M7NA 4YGBB 1TCOB 1IQ5A 1NX1A 3IQOA 1S6IA 1WDCB 4HREE 1DC1A 2M97A 4M2PA 3PM2A 1YRUB 1RK9A 4GFTA 4R1EA 1DMOA 3QRXA 1FI6A 1QTXA 3L4LA 2M1UA 3CYZA 1NUBA 2AUCA 2KNEA 4XYNA 5HKWA 2LP2A 1A29A 1Z2CB 3WHUB 1AK8A 2I94A 3I5HB 4XJKA 2LVIA 3SS4A 5JOLA 1F70A 4NDCA 2JWWA 3BFAA 1GM0A 1MXLC 3R1PA 4HRHA 1CFFA 2HPSA 4MLWA 2LMVA 1U5IB 1E8AA 2A4JA 1GJYA 2BNXA 3D75A 3C1VA 3PLFB 4GGFC 1JFJA 1KSMA 2WNDA 3BFHA 1ALVA 3BOWA 3WHTB 2KDHA 4HRGA 1LS8A 2MA2A 1DGVA 1S5GY 2L98A 3HCMA 1V1FA 1QVIY 1X02A 2G2BA 1EG4A 3DY9A 1KK8B 1SPYA 2KI4C 1M31A 1S1EA 3B86A 2QEBA 4DUQA 2NZ0A 3S0EA 1TNWA 1K95A 1W9ZA 1TN4A 3R72A 2R2IA 2SCPA 1Y1UA 1YUUA 2JNXA 2LP3A 1A75B 1NX2A 1MQ1A 2WCKA 3OX5A 3RLZA 3CTNA 1DGUA 1OQPA 2FCDA 2KFGA 4WRIA 4N1FA 3M0WA 2P6BB 1QLSA 2KI4B 1OZSA 2L2EA 1SRAA 1TOPA 1RROA 1ZACA 4YI8A 2OS8C 1G8IA 5I8NA 4WQ3A 2K0JA 2FOTA 2L50A 2I18A 4IJ7A 4YBHB 4F7FA 1SYMA 1WDCC 1M39A 5HLVA 1UHNA 3DVMA 1WLMA 3SG3A 4MVFA 1G33A 1A75A 1QV1A 2WCEA 1K96A 1MXEA 2WCBA 2JT3A 3NHTA 4GUKA 4CFRA 1QIVA 3MSEB 1CLBA 2JU0A 4YGDB 1IWQA 3BOWB 4M2QA 3I5HC 2HETA 2M9GA 3SG6A 2E6WA 3IVTA 4PHKA 1R2UA 1KQMB 1OMDA 4JKTA 4TNCA 1JC2A 1BT6A 2KGBC 2SASA 2BBNA 3CDNA 1BMOA 1SMGA 2RGIA 3PALA 1W7JB 1XK4A 3KPXA 3TDUA 1NIWA 2BKHB 1B7TY 4DRWA 5BPJA 3SJSA 3D0YA 1HQVA 4USLA 1YUTA 2NCPA 1QX7A 2BAPA 2WOSA 4PE7A 1UURA 2QEHA 3GK1A 5AERA 1KK8C 3R1OA 1QASA 4N1GA 2F3YA 1ZMZA 4PT1A 1UWOA 2ZNDA 1A03A 3GK2A 1TIZA 2K7OA 1KQMC 2P71A 4OZDA 3ICBA 2LHIA 3BFBA 3D77A 1B8RA 5D7FA 1KFXL 1OZOA 3AKBA 3NXAA 1CDPA 1CLLA 4PE4A 1FBVA 1UP5A 4MEWA 1GGZA 2ZNEA 1EJ3A 1KCYA 1QWVA 2L0PA 1QX2A 2Q91A 1B8LA 1MUXA 3EK7A 2D8NA 1CM4A 1OMRA 2LV7A 5DKQA 2BE4A 1PVBA 1Y1XA 2K61A 2PMYA 1DF0B 2JXLA 2K7BA 2BBMA 4ORAB 3SIAA 3S0DA 3WNXB 3LCPC 4DCKA 2M7LA 4DS7A 1OOJA 1K94A 3EKHA 2IS9A 2OS8B 3CR5X 3NSOA 1BF5A 3DZTA 2Y4QA 1A4PA 1CFDA 3KHEA 4DIRA 2JZIA 1XFXO 3CZ1A 3CZ2A 1DVIA 2JTTA 1QLKA 1NSHA 2ISDA 4CFQA 1Y6WA 2GGZA 5J3XA 3B6XA 3TDIA 1NYAA 3VGOA 4QJ4B 4P2YB 5HKYA 2FJYA 4MRYA 2BL0C 2KAXA 3CS1A 3QMEA 4QJ5B 1OSAA 4PDZA 3SG5A 2KFHA 4INWA 1DELA 1K90D 2NCOA 5AEQA 4I5NB 2E30A 4U8DA 1S36A 2BCXA 4PHMA 1NX3A 1JWDA 5HLOA 1GQMA 3NSKA 5G08A 2V53A 5IBWA 1P28A 5ER5A 2ZN9A 3OB2B 2K7DA 2BECA 1RJVA 3NHIA 5CPVA 1JBAA 2LLSA 2GV5A 2BL0B 2H8VA 1NCXA 2KGRA 2LLTA 3O2PA 2JULA 1YVLA 2AAOA 4PHJA 2G9BA 2HQ8A 1IKUA 1N65A 3PSRA 1M45A 2K60A 1J1EA 2LC5A 5CSNA 1S6JA 3EVVA 3OBVA 2OTGB 4PCWA 4WQ2A 1F4QA 1WY9A 2KOTA 3L4AA 1DJGA 4CLNA 3O4XA 3RZSA 1CB1A 1B4CA 2CNPA 1PSBA 2F33A 1PSRA 1N0YA 3FS7A 5I2OA 1QS7A 1CKKA 1KFXS 1MF8B 4QJ3B 4ORCB 2JOJA 2TN4A 1CFPA 4N5XA 1EL4A 3BJHA 4AOMA 5K89A 2LE9B 4OKHA 1XFYO 1F4OA 1LKJA 2L4IA 3VRNA 1IQ3A 3DXLA 1FPWA 1LVCD 1MHOA 1KK7Z 1AP4A 2M29A 3AKAA 1KFUS 2CBLA 2JPOA 1TCFA 3SIBA 1CFCA 1EG3A 1UUSA 4PE0A 3K1EA 2JXCA 4AQIA 1CM1A 4E68A 1J7OA 3V2LA 1TUZA 4C0KA 2CXJA 3GK4X 1SL9A 1S3PA 4NDDA 1OOIX 3DVEA 3PATA 1DJZA 2BCAA 1HT9A 2M0RA 2L4HA 2KFFA 2ZRSA 1NCYA 4GGNA 4OCIA 5DICA 2H2KA 1ZUZA 1S26D 1YX8A 3EK4A 1XO5A 1TWOA 1V1GA 1GGWA 1SY9A 2O5GA 3BUWB 4I5LB 4NDBA 4YI9A 3I5GC 3LK1A 1ZOTB 4L9MA 4A4CA 3O6BA 1K2HA 1S6CA 3FWBA 1UHIA 1NPQA 1LXFC 5B8IB 1M46A 5CSFA 4YGCB 1H8BA 2MRDA 1J1DA 4I5KA 3S0BA 2PRUA 1QJTA 4CIDA 2QACA 1YTZC 2O60A 3OB1B 4ZCVA 2OTGC 3EKJA 2MJWB 1BR1B 3KO0A 1IGVA 3IQQA 1PRWA 1FF1A 3I5FC 1AHRA 3BYAA 2DOQA 3KF9A 4ICBA 5FI2A 2OPOA 1IG5A 5DKNA 2ERBA 1OMVA 3PN7C 4Q04A 3VROA 4GAOA 5DKRA 1DJYA 1Y0VH 1B47A 2ZKMX 3D74A 3TS5C 3WXAA 3S0FA 2YGUA 1YRTB 2PQLA 3VB1A 2KBIA 1Z4HA 2F8PA 1XYDA 1VRKA 4JWQA 3PFVA 1WRLA 2WCMA 4UPGA 5D69A 1Y1AA 1SKTA 1PK0D 1B8CA 1IRJA 2PSRA 1XK4C 3K21A 4IL1A 1OE9B 2H61C 1JSAA 3GOFA 2JRFA 2QEOA 3AAJA 1NP8A 2FCEA 3D73A 4P5OE 4HSZA 2ZRTA 1DJXA 3NSIA 1XFWO 4ORBB 3TS5B 5HL1A 5HKZA 1RFJA 2JC2A 2P70A 2QPTA 2KLDA 3OGNA 3OHMB 1WRKA 1A2XA 4OR9B 3FE6A 3VRRA 1KWOC 2WCHA 4JD9A 2EGDA 1LINA 4MSPA 5PALA 2F2OA 3OX6A 1TRFA 1D1OA 1F55A 1M63B 3DVJA 2BE6A 2KBMA 3TUYC 3I5GB 4FTGA 2CCMA 4FQOA 1G4YR 1WRZA 3L47A 1H4BA 2WC8A 1FW4A 1K9PA 1AUIB 1BJFA 1ALWA 5FI6A
chains in the Genus database with same CATH topology
1SL7A 1J55A 2I7AA 1QX5B 4GGFA 5AFPA 4YRUA 4PE1A 1F8HA 2LHLA 4BY4A 2JT8A 1DJHA 2KSPA 1TNQA 4YGAA 3I5FB 2PALA 4PALA 3JTDC 1BG1A 3TUYB 2NXQA 1CNPA 3PN7B 3KEVA 1RECA 4XJKB 1FI5A 1K9KA 2EHBA 1DJIA 1XVJA 1LA3A 2LM5A 1SK6D 2JPTA 2HF5A 2K7CA 4I5JA 3DF0A 1RWYA 2LAPA 4F0ZB 1ZFSA 5CSIA 1QATA 5TNCA 4MBEA 3D10A 1PULA 1SR6C 1KK7Y 1K9UA 1SNLA 1TNPA 1B9AA 5CSJA 2BKIB 1XFVO 2LVKA 3CLNA 3BXKA 1KSOA 1CTRA 1IJ5A 1BLQA 1UHJA 1F54A 1DTLA 1JF2A 1SCMB 3EVUA 1YX7A 1U5IA 1R6PA 2I2RE 3JVTB 5AXIA 1UHHA 1K8UA 2ZFDA 1IJ6A 2COLB 1AVSA 1TNXA 3BUMB 1AJ4A 1CMFA 3FWCA 3SG2A 1KWOB 2LUXA 1NX0A 2GGMA 2K8MB 3LLEA 4GPLB 5KSZA 2MHHA 1MWNA 2KI6D 1NWDA 2EC6B 2F2PA 3I5IB 4M2OA 3VRQA 1L2OC 2KQYA 4OVNF 5KTYA 1XFZO 2LLUA 2MAZA 2Q4UA 1CDNA 1EH2A 3JVTC 1XFUO 2M8UA 1MR8A 2KI6C 4MZKA 3TDZA 2VRGA 1C07A 1DT7B 1JF0A 3DF0B 2F3ZA 2Y1NA 3A4UB 3TZ1A 3PM8A 2MBXA 2H61A 5F6TA 3A8RA 2KYFA 2EC6C 2WCFA 3I5IC 1NCZA 3JTDB 4MN0A 4ETOA 1CMGA 1YR5A 1AJ5A 2M49B 3NSLA 5KU1A 1JFKA 2M1KB 1N2DA 1XA5A 2JQ6A 2KAYA 2PVBA 1CLMA 5GQQC 4C0JA 3BUXB 4CPVA 5JJGA 3RM1A 1RTP1 3CWGA 5I2QA 2JNFA 2Y5IA 3HX4A 3BUNB 1SR6B 4GNKB 2FJUB 5FYXA 1F71A 2ZN8A 3ZNIA 2Y1MA 4BY5A 3CZTX 1B7TZ 3OP0A 3BQ3A 3IF7A 3AAKA 5HYDA 1UHKA 3SG7A 1SCVA 1J7PA 1PVAA 1PALA 1BR4B 3H4SE 2L5XB 1SCMC 4JPZB 3LL8B 4MZJA 5AANA 3VRPA 2BCBA 2KAVA 3ZWHA 1C7VA 1JUOA 3D0YB 1KFUL 4C0LA 3EVRA 4MRXA 2MLFC 2K2AA 1K93D 4PHNA 3BUOB 1WLZA 4JQ0D 1BODA 2K2FA 1BOCA 1CDLA 2WORA 5I2LA 2LVJA 1ODBA 4A4BA 4AQJA 1B1GA 5ER4X 4D1EA 1L2OB 4MZLA 1SW8A 3EK8A 2AMIA 2M3WA 1W7IB 2CTNA 4YGEB 3DVKA 2KHNA 1EXRA 4ZCUA 4GBAA 1QV0A 1L7ZA 1S5GZ 1QIWA 2MLEC 3SG4A 1CDMA 1J7RA 1SBJA 1TTXA 3O78A 2B1UA 2KYCA 2KQ6A 1BU3A 3CR2A 4NQGA 2JTZA 1YVHA 1Q80A 2HQWA 2NLNA 2LCPA 3CR4X 2LANA 2L51A 2PASA 1YUSA 2JT0A 1J7QA 2LNKA 3FIAA 3DD4A 2LUCA 3F45A 2LMUA 3CGAA 1YURA 2LMTA 1SL8A 2LVVA 1LA0A 1QVIZ 4OV2A 1DF0A 3LK0A 1QXPA 1DJWA 1C7WA 3O4YA 3E3RA 2CT9A 2M7NA 4YGBB 1TCOB 1IQ5A 1NX1A 3IQOA 1S6IA 1WDCB 4HREE 2M97A 4M2PA 1YRUB 1RK9A 4GFTA 4R1EA 1DMOA 3QRXA 1FI6A 1QTXA 2M1UA 1NUBA 2AUCA 2KNEA 4XYNA 5HKWA 2LP2A 1A29A 3WHUB 1KQVA 1AK8A 2I94A 3I5HB 4XJKA 2LVIA 5JOLA 1F70A 4NDCA 2JWWA 1MXLC 4HRHA 1CFFA 2HPSA 4MLWA 2LMVA 1U5IB 1E8AA 2A4JA 1GJYA 3PLFB 3C1VA 4GGFC 1JFJA 1KSMA 2WNDA 1ALVA 3BOWA 3WHTB 2KDHA 4HRGA 2MA2A 1DGVA 1S5GY 2L98A 3HCMA 1V1FA 1QVIY 1X02A 2G2BA 1EG4A 1KK8B 1SPYA 2KI4C 1M31A 1S1EA 4DUQA 2NZ0A 1TNWA 1K95A 1TN4A 2R2IA 2SCPA 1Y1UA 1YUUA 2JNXA 2LP3A 1A75B 1NX2A 1MQ1A 3OX5A 3RLZA 3CTNA 1DGUA 1OQPA 2FCDA 2KFGA 4WRIA 4N1FA 3M0WA 2P6BB 1QLSA 2KI4B 1OZSA 2L2EA 1SRAA 1TOPA 1RROA 1ZACA 4YI8A 2OS8C 1G8IA 5I8NA 4WQ3A 2K0JA 2FOTA 2L50A 2I18A 4YBHB 1SYMA 1WDCC 1M39A 5HLVA 1UHNA 3DVMA 1WLMA 3SG3A 4MVFA 1G33A 1A75A 1QV1A 2WCEA 1K96A 1MXEA 2WCBA 2JT3A 4GUKA 4CFRA 1QIVA 3MSEB 1CLBA 2JU0A 4YGDB 1IWQA 3BOWB 4M2QA 3I5HC 2HETA 2M9GA 3SG6A 2E6WA 4PHKA 1R2UA 1KQMB 1OMDA 1JC2A 4TNCA 1BT6A 2KGBC 2SASA 2BBNA 1BMOA 1SMGA 2RGIA 3PALA 1W7JB 1XK4A 3KPXA 3TDUA 1NIWA 2BKHB 1B7TY 4DRWA 5BPJA 3SJSA 3D0YA 1HQVA 4USLA 1YUTA 2NCPA 1QX7A 2WOSA 4PE7A 1UURA 3GK1A 5AERA 1KK8C 4N1GA 1QASA 2F3YA 1ZMZA 1UWOA 2ZNDA 1A03A 3GK2A 1TIZA 2K7OA 1KQMC 3ICBA 2LHIA 1B8RA 5D7FA 1KFXL 1OZOA 3AKBA 3NXAA 1CDPA 1CLLA 4PE4A 1FBVA 1UP5A 4MEWA 1GGZA 2ZNEA 1EJ3A 1KCYA 2L0PA 1QX2A 2Q91A 1B8LA 1MUXA 3EK7A 2D8NA 1CM4A 1OMRA 2LV7A 5DKQA 2BE4A 1PVBA 1Y1XA 2K61A 2PMYA 1DF0B 2JXLA 2K7BA 2BBMA 4ORAB 3SIAA 3WNXB 4DCKA 3LCPC 1IH0A 2M7LA 4DS7A 1OOJA 1K94A 3EKHA 2IS9A 2OS8B 3CR5X 3NSOA 1BF5A 2Y4QA 1A4PA 1CFDA 3KHEA 4DIRA 2JZIA 1XFXO 1DVIA 2JTTA 1QLKA 1NSHA 2ISDA 4CFQA 1Y6WA 2GGZA 5J3XA 3TDIA 1NYAA 3VGOA 4QJ4B 4P2YB 5HKYA 4MRYA 2BL0C 2KAXA 3CS1A 4QJ5B 1OSAA 4PDZA 3SG5A 2KFHA 1K90D 2NCOA 5AEQA 4I5NB 2E30A 4U8DA 1S36A 2BCXA 4PHMA 1NX3A 1JWDA 5HLOA 1GQMA 3NSKA 5G08A 2V53A 5IBWA 5ER5A 2ZN9A 3OB2B 2K7DA 2BECA 1RJVA 5CPVA 1JBAA 2LLSA 2GV5A 2BL0B 1NCXA 2KGRA 2LLTA 3O2PA 2JULA 1YVLA 2AAOA 4PHJA 2G9BA 2HQ8A 1IKUA 1N65A 3PSRA 1M45A 1J1EA 2LC5A 5CSNA 1S6JA 3EVVA 2OTGB 4PCWA 4WQ2A 1F4QA 1WY9A 2KOTA 1DJGA 4CLNA 1CB1A 1B4CA 2CNPA 2F33A 1PSBA 1PSRA 1N0YA 3FS7A 5I2OA 1QS7A 1CKKA 1KFXS 1MF8B 4QJ3B 4ORCB 2JOJA 2TN4A 1CFPA 4N5XA 1EL4A 4AOMA 5K89A 2LE9B 4OKHA 1XFYO 1F4OA 1LKJA 2L4IA 3VRNA 1IQ3A 1FPWA 1LVCD 1MHOA 1KK7Z 1AP4A 2M29A 3AKAA 1KFUS 2CBLA 3SIBA 1TCFA 1CFCA 1EG3A 1UUSA 4PE0A 4AQIA 2JXCA 1CM1A 4E68A 1J7OA 4C0KA 2CXJA 3GK4X 1SL9A 1S3PA 4NDDA 3DVEA 3PATA 1DJZA 2BCAA 1HT9A 2M0RA 2L4HA 2KFFA 2ZRSA 1NCYA 4GGNA 4OCIA 2H2KA 1ZUZA 1S26D 1YX8A 3EK4A 1XO5A 1V1GA 1GGWA 1SY9A 2O5GA 3BUWB 4I5LB 4NDBA 4YI9A 3I5GC 3LK1A 1ZOTB 4L9MA 4A4CA 3O6BA 1K2HA 1S6CA 3FWBA 1UHIA 1NPQA 1LXFC 5B8IB 1M46A 5CSFA 4YGCB 1H8BA 2MRDA 1J1DA 4I5KA 2PRUA 1QJTA 4CIDA 2QACA 1YTZC 2O60A 3OB1B 4ZCVA 2OTGC 3EKJA 2MJWB 1BR1B 3KO0A 1IGVA 3IQQA 1PRWA 1FF1A 3I5FC 1AHRA 3BYAA 2DOQA 3KF9A 4ICBA 2OPOA 1IG5A 5DKNA 1OMVA 3PN7C 4Q04A 3VROA 4GAOA 5DKRA 1DJYA 1Y0VH 1B47A 2ZKMX 3TS5C 3WXAA 1YRTB 2KBIA 2F8PA 1XYDA 1VRKA 4JWQA 3PFVA 1WRLA 4UPGA 5D69A 1Y1AA 1SKTA 1PK0D 1B8CA 1IRJA 2PSRA 1XK4C 3K21A 4IL1A 1OE9B 2H61C 1JSAA 3GOFA 2JRFA 3AAJA 1NP8A 2FCEA 4P5OE 4HSZA 2ZRTA 1DJXA 3NSIA 1XFWO 4ORBB 3TS5B 5HKZA 1RFJA 2JC2A 2QPTA 3OHMB 1WRKA 1A2XA 4OR9B 3VRRA 1KWOC 4MSPA 2EGDA 1LINA 5PALA 1D1OA 2F2OA 3OX6A 1TRFA 1F55A 1M63B 3DVJA 2BE6A 2KBMA 3TUYC 3I5GB 4FTGA 2CCMA 4FQOA 1G4YR 1WRZA 1H4BA 2WC8A 1FW4A 1K9PA 1AUIB 1BJFA 1ALWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL7 A;  1J55 A;  2I7A A;  1QX5 B;  4GGF A;  5AFP A;  4YRU A;  4PE1 A;  1F8H A;  2LHL A;  4BY4 A;  2JT8 A;  1DJH A;  2KSP A;  1TNQ A;  4YGA A;  3I5F B;  2PAL A;  4PAL A;  3JTD C;  1BG1 A;  3TUY B;  2NXQ A;  1CNP A;  3PN7 B;  3KEV A;  1REC A;  4XJK B;  1FI5 A;  1K9K A;  2EHB A;  1DJI A;  1XVJ A;  1LA3 A;  2LM5 A;  1SK6 D;  2JPT A;  2HF5 A;  2K7C A;  4I5J A;  3DF0 A;  1RWY A;  2LAP A;  4F0Z B;  1ZFS A;  5CSI A;  1QAT A;  5TNC A;  4MBE A;  3D10 A;  1PUL A;  1SR6 C;  1KK7 Y;  1K9U A;  1SNL A;  1TNP A;  1B9A A;  5CSJ A;  2BKI B;  1XFV O;  2LVK A;  3CLN A;  3BXK A;  1KSO A;  1CTR A;  1IJ5 A;  1BLQ A;  1UHJ A;  1F54 A;  1DTL A;  1JF2 A;  1SCM B;  3EVU A;  1YX7 A;  1U5I A;  1R6P A;  2I2R E;  3JVT B;  5AXI A;  1UHH A;  1K8U A;  2ZFD A;  1IJ6 A;  2COL B;  1AVS A;  1TNX A;  3BUM B;  1AJ4 A;  1CMF A;  3FWC A;  3SG2 A;  1KWO B;  2LUX A;  1NX0 A;  2GGM A;  2K8M B;  3LLE A;  4GPL B;  5KSZ A;  2MHH A;  1MWN A;  2KI6 D;  1NWD A;  2EC6 B;  2F2P A;  3I5I B;  4M2O A;  3VRQ A;  1L2O C;  2KQY A;  4OVN F;  5KTY A;  1XFZ O;  2LLU A;  2MAZ A;  2Q4U A;  1CDN A;  1EH2 A;  3JVT C;  1XFU O;  2M8U A;  1MR8 A;  2KI6 C;  4MZK A;  3TDZ A;  2VRG A;  1C07 A;  1DT7 B;  1JF0 A;  3DF0 B;  2F3Z A;  2Y1N A;  3A4U B;  3TZ1 A;  3PM8 A;  2MBX A;  2H61 A;  5F6T A;  3A8R A;  2KYF A;  2EC6 C;  2WCF A;  3I5I C;  1NCZ A;  3JTD B;  4MN0 A;  4ETO A;  1CMG A;  1YR5 A;  1AJ5 A;  2M49 B;  3NSL A;  5KU1 A;  1JFK A;  2M1K B;  1N2D A;  1XA5 A;  2JQ6 A;  2KAY A;  2PVB A;  1CLM A;  5GQQ C;  4C0J A;  3BUX B;  4CPV A;  5JJG A;  3RM1 A;  1RTP 1;  3CWG A;  5I2Q A;  2JNF A;  2Y5I A;  3HX4 A;  3BUN B;  1SR6 B;  4GNK B;  2FJU B;  5FYX A;  1F71 A;  2ZN8 A;  3ZNI A;  2Y1M A;  4BY5 A;  3CZT X;  1B7T Z;  3OP0 A;  3BQ3 A;  3IF7 A;  3AAK A;  5HYD A;  1UHK A;  3SG7 A;  1SCV A;  1J7P A;  1PVA A;  1PAL A;  1BR4 B;  3H4S E;  2L5X B;  1SCM C;  4JPZ B;  3LL8 B;  4MZJ A;  5AAN A;  3VRP A;  2BCB A;  2KAV A;  3ZWH A;  1C7V A;  1JUO A;  3D0Y B;  1KFU L;  4C0L A;  3EVR A;  4MRX A;  2MLF C;  2K2A A;  1K93 D;  4PHN A;  3BUO B;  1WLZ A;  4JQ0 D;  1BOD A;  2K2F A;  1BOC A;  1CDL A;  2WOR A;  5I2L A;  2LVJ A;  1ODB A;  4A4B A;  4AQJ A;  1B1G A;  5ER4 X;  4D1E A;  1L2O B;  4MZL A;  1SW8 A;  3EK8 A;  2AMI A;  2M3W A;  1W7I B;  2CTN A;  4YGE B;  3DVK A;  2KHN A;  1EXR A;  4ZCU A;  4GBA A;  1QV0 A;  1L7Z A;  1S5G Z;  1QIW A;  2MLE C;  3SG4 A;  1CDM A;  1J7R A;  1SBJ A;  1TTX A;  3O78 A;  2B1U A;  2KYC A;  2KQ6 A;  1BU3 A;  3CR2 A;  4NQG A;  2JTZ A;  1YVH A;  1Q80 A;  2HQW A;  2NLN A;  2LCP A;  3CR4 X;  2LAN A;  2L51 A;  2PAS A;  1YUS A;  2JT0 A;  1J7Q A;  2LNK A;  3FIA A;  3DD4 A;  2LUC A;  3F45 A;  2LMU A;  3CGA A;  1YUR A;  2LMT A;  1SL8 A;  2LVV A;  1LA0 A;  1QVI Z;  4OV2 A;  1DF0 A;  3LK0 A;  1QXP A;  1DJW A;  1C7W A;  3O4Y A;  3E3R A;  2CT9 A;  2M7N A;  4YGB B;  1TCO B;  1IQ5 A;  1NX1 A;  3IQO A;  1S6I A;  1WDC B;  4HRE E;  2M97 A;  4M2P A;  1YRU B;  1RK9 A;  4GFT A;  4R1E A;  1DMO A;  3QRX A;  1FI6 A;  1QTX A;  2M1U A;  1NUB A;  2AUC A;  2KNE A;  4XYN A;  5HKW A;  2LP2 A;  1A29 A;  3WHU B;  1KQV A;  1AK8 A;  2I94 A;  3I5H B;  4XJK A;  2LVI A;  5JOL A;  1F70 A;  4NDC A;  2JWW A;  1MXL C;  4HRH A;  1CFF A;  2HPS A;  4MLW A;  2LMV A;  1U5I B;  1E8A A;  2A4J A;  1GJY A;  3PLF B;  3C1V A;  4GGF C;  1JFJ A;  1KSM A;  2WND A;  1ALV A;  3BOW A;  3WHT B;  2KDH A;  4HRG A;  2MA2 A;  1DGV A;  1S5G Y;  2L98 A;  3HCM A;  1V1F A;  1QVI Y;  1X02 A;  2G2B A;  1EG4 A;  1KK8 B;  1SPY A;  2KI4 C;  1M31 A;  1S1E A;  4DUQ A;  2NZ0 A;  1TNW A;  1K95 A;  1TN4 A;  2R2I A;  2SCP A;  1Y1U A;  1YUU A;  2JNX A;  2LP3 A;  1A75 B;  1NX2 A;  1MQ1 A;  3OX5 A;  3RLZ A;  3CTN A;  1DGU A;  1OQP A;  2FCD A;  2KFG A;  4WRI A;  4N1F A;  3M0W A;  2P6B B;  1QLS A;  2KI4 B;  1OZS A;  2L2E A;  1SRA A;  1TOP A;  1RRO A;  1ZAC A;  4YI8 A;  2OS8 C;  1G8I A;  5I8N A;  4WQ3 A;  2K0J A;  2FOT A;  2L50 A;  2I18 A;  4YBH B;  1SYM A;  1WDC C;  1M39 A;  5HLV A;  1UHN A;  3DVM A;  1WLM A;  3SG3 A;  4MVF A;  1G33 A;  1A75 A;  1QV1 A;  2WCE A;  1K96 A;  1MXE A;  2WCB A;  2JT3 A;  4GUK A;  4CFR A;  1QIV A;  3MSE B;  1CLB A;  2JU0 A;  4YGD B;  1IWQ A;  3BOW B;  4M2Q A;  3I5H C;  2HET A;  2M9G A;  3SG6 A;  2E6W A;  4PHK A;  1R2U A;  1KQM B;  1OMD A;  1JC2 A;  4TNC A;  1BT6 A;  2KGB C;  2SAS A;  2BBN A;  1BMO A;  1SMG A;  2RGI A;  3PAL A;  1W7J B;  1XK4 A;  3KPX A;  3TDU A;  1NIW A;  2BKH B;  1B7T Y;  4DRW A;  5BPJ A;  3SJS A;  3D0Y A;  1HQV A;  4USL A;  1YUT A;  2NCP A;  1QX7 A;  2WOS A;  4PE7 A;  1UUR A;  3GK1 A;  5AER A;  1KK8 C;  4N1G A;  1QAS A;  2F3Y A;  1ZMZ A;  1UWO A;  2ZND A;  1A03 A;  3GK2 A;  1TIZ A;  2K7O A;  1KQM C;  3ICB A;  2LHI A;  1B8R A;  5D7F A;  1KFX L;  1OZO A;  3AKB A;  3NXA A;  1CDP A;  1CLL A;  4PE4 A;  1FBV A;  1UP5 A;  4MEW A;  1GGZ A;  2ZNE A;  1EJ3 A;  1KCY A;  2L0P A;  1QX2 A;  2Q91 A;  1B8L A;  1MUX A;  3EK7 A;  2D8N A;  1CM4 A;  1OMR A;  2LV7 A;  5DKQ A;  2BE4 A;  1PVB A;  1Y1X A;  2K61 A;  2PMY A;  1DF0 B;  2JXL A;  2K7B A;  2BBM A;  4ORA B;  3SIA A;  3WNX B;  4DCK A;  3LCP C;  1IH0 A;  2M7L A;  4DS7 A;  1OOJ A;  1K94 A;  3EKH A;  2IS9 A;  2OS8 B;  3CR5 X;  3NSO A;  1BF5 A;  2Y4Q A;  1A4P A;  1CFD A;  3KHE A;  4DIR A;  2JZI A;  1XFX O;  1DVI A;  2JTT A;  1QLK A;  1NSH A;  2ISD A;  4CFQ A;  1Y6W A;  2GGZ A;  5J3X A;  3TDI A;  1NYA A;  3VGO A;  4QJ4 B;  4P2Y B;  5HKY A;  4MRY A;  2BL0 C;  2KAX A;  3CS1 A;  4QJ5 B;  1OSA A;  4PDZ A;  3SG5 A;  2KFH A;  1K90 D;  2NCO A;  5AEQ A;  4I5N B;  2E30 A;  4U8D A;  1S36 A;  2BCX A;  4PHM A;  1NX3 A;  1JWD A;  5HLO A;  1GQM A;  3NSK A;  5G08 A;  2V53 A;  5IBW A;  5ER5 A;  2ZN9 A;  3OB2 B;  2K7D A;  2BEC A;  1RJV A;  5CPV A;  1JBA A;  2LLS A;  2GV5 A;  2BL0 B;  1NCX A;  2KGR A;  2LLT A;  3O2P A;  2JUL A;  1YVL A;  2AAO A;  4PHJ A;  2G9B A;  2HQ8 A;  1IKU A;  1N65 A;  3PSR A;  1M45 A;  1J1E A;  2LC5 A;  5CSN A;  1S6J A;  3EVV A;  2OTG B;  4PCW A;  4WQ2 A;  1F4Q A;  1WY9 A;  2KOT A;  1DJG A;  4CLN A;  1CB1 A;  1B4C A;  2CNP A;  2F33 A;  1PSB A;  1PSR A;  1N0Y A;  3FS7 A;  5I2O A;  1QS7 A;  1CKK A;  1KFX S;  1MF8 B;  4QJ3 B;  4ORC B;  2JOJ A;  2TN4 A;  1CFP A;  4N5X A;  1EL4 A;  4AOM A;  5K89 A;  2LE9 B;  4OKH A;  1XFY O;  1F4O A;  1LKJ A;  2L4I A;  3VRN A;  1IQ3 A;  1FPW A;  1LVC D;  1MHO A;  1KK7 Z;  1AP4 A;  2M29 A;  3AKA A;  1KFU S;  2CBL A;  3SIB A;  1TCF A;  1CFC A;  1EG3 A;  1UUS A;  4PE0 A;  4AQI A;  2JXC A;  1CM1 A;  4E68 A;  1J7O A;  4C0K A;  2CXJ A;  3GK4 X;  1SL9 A;  1S3P A;  4NDD A;  3DVE A;  3PAT A;  1DJZ A;  2BCA A;  1HT9 A;  2M0R A;  2L4H A;  2KFF A;  2ZRS A;  1NCY A;  4GGN A;  4OCI A;  2H2K A;  1ZUZ A;  1S26 D;  1YX8 A;  3EK4 A;  1XO5 A;  1V1G A;  1GGW A;  1SY9 A;  2O5G A;  3BUW B;  4I5L B;  4NDB A;  4YI9 A;  3I5G C;  3LK1 A;  1ZOT B;  4L9M A;  4A4C A;  3O6B A;  1K2H A;  1S6C A;  3FWB A;  1UHI A;  1NPQ A;  1LXF C;  5B8I B;  1M46 A;  5CSF A;  4YGC B;  1H8B A;  2MRD A;  1J1D A;  4I5K A;  2PRU A;  1QJT A;  4CID A;  2QAC A;  1YTZ C;  2O60 A;  3OB1 B;  4ZCV A;  2OTG C;  3EKJ A;  2MJW B;  1BR1 B;  3KO0 A;  1IGV A;  3IQQ A;  1PRW A;  1FF1 A;  3I5F C;  1AHR A;  3BYA A;  2DOQ A;  3KF9 A;  4ICB A;  2OPO A;  1IG5 A;  5DKN A;  1OMV A;  3PN7 C;  4Q04 A;  3VRO A;  4GAO A;  5DKR A;  1DJY A;  1Y0V H;  1B47 A;  2ZKM X;  3TS5 C;  3WXA A;  1YRT B;  2KBI A;  2F8P A;  1XYD A;  1VRK A;  4JWQ A;  3PFV A;  1WRL A;  4UPG A;  5D69 A;  1Y1A A;  1SKT A;  1PK0 D;  1B8C A;  1IRJ A;  2PSR A;  1XK4 C;  3K21 A;  4IL1 A;  1OE9 B;  2H61 C;  1JSA A;  3GOF A;  2JRF A;  3AAJ A;  1NP8 A;  2FCE A;  4P5O E;  4HSZ A;  2ZRT A;  1DJX A;  3NSI A;  1XFW O;  4ORB B;  3TS5 B;  5HKZ A;  1RFJ A;  2JC2 A;  2QPT A;  3OHM B;  1WRK A;  1A2X A;  4OR9 B;  3VRR A;  1KWO C;  4MSP A;  2EGD A;  1LIN A;  5PAL A;  1D1O A;  2F2O A;  3OX6 A;  1TRF A;  1F55 A;  1M63 B;  3DVJ A;  2BE6 A;  2KBM A;  3TUY C;  3I5G B;  4FTG A;  2CCM A;  4FQO A;  1G4Y R;  1WRZ A;  1H4B A;  2WC8 A;  1FW4 A;  1K9P A;  1AUI B;  1BJF A;  1ALW A; 
#chains in the Genus database with same CATH topology
 1SL7 A;  1J55 A;  2I7A A;  1QX5 B;  4GGF A;  5AFP A;  4YRU A;  4PE1 A;  1F8H A;  2LHL A;  4BY4 A;  2JT8 A;  1DJH A;  2KSP A;  1TNQ A;  4YGA A;  2PYQ A;  2PAL A;  3I5F B;  4PAL A;  3JTD C;  1BG1 A;  2QDI A;  3TUY B;  2NXQ A;  2WC6 A;  3S0G A;  1CNP A;  3PN7 B;  3KEV A;  1DEK A;  1REC A;  3B88 A;  4XJK B;  1K9K A;  2EHB A;  3UO9 A;  1FI5 A;  1DJI A;  1XVJ A;  5I94 A;  5D3O A;  2WCL A;  1LA3 A;  2LM5 A;  1SK6 D;  2JPT A;  2HF5 A;  2K7C A;  4I5J A;  3DF0 A;  1RWY A;  2LAP A;  4F0Z B;  1ZFS A;  5CSI A;  1QAT A;  5TNC A;  4MBE A;  3D10 A;  1PUL A;  1SR6 C;  1KK7 Y;  1K9U A;  1SNL A;  1TNP A;  1B9A A;  1T14 A;  5CSJ A;  2BKI B;  1XFV O;  3FE9 A;  2LVK A;  3CLN A;  3BXK A;  1KSO A;  1CTR A;  1IJ5 A;  4FQT A;  1BLQ A;  1UHJ A;  3EG5 B;  1F54 A;  1DTL A;  1JF2 A;  1OOH A;  1SCM B;  1YX7 A;  1U5I A;  1R6P A;  2I2R E;  3EVU A;  3JVT B;  4KYN A;  5AXI A;  1UHH A;  1K8U A;  2ZFD A;  1IJ6 A;  2COL B;  3UNW A;  1AVS A;  1TNX A;  3BUM B;  1AJ4 A;  1CMF A;  5FI7 A;  3FWC A;  2WCJ A;  3B87 A;  3SG2 A;  3PJI A;  1KWO B;  2LUX A;  1NX0 A;  2GGM A;  3D76 A;  2K8M B;  3LLE A;  4GPL B;  5KSZ A;  2MHH A;  1MWN A;  2KI6 D;  1NWD A;  2EC6 B;  2F2P A;  3I5I B;  1C3Y A;  4M2O A;  3VRQ A;  1L2O C;  2KQY A;  4OVN F;  5KTY A;  1XFZ O;  1KQV A;  2L2C A;  2LLU A;  2MAZ A;  2Q4U A;  1CDN A;  2KPH A;  1EH2 A;  3JVT C;  1XFU O;  2M8U A;  1MR8 A;  2KI6 C;  4MZK A;  3TDZ A;  1OW4 A;  2VRG A;  1C07 A;  1DT7 B;  1JF0 A;  3DF0 B;  2F3Z A;  2Y1N A;  3A4U B;  3TZ1 A;  3PM8 A;  1ORG A;  3DYE A;  2H61 A;  2MBX A;  5F6T A;  3A8R A;  2KYF A;  2EC6 C;  2WCF A;  3I5I C;  1NCZ A;  3JTD B;  4MN0 A;  4ETO A;  1CMG A;  1YR5 A;  1AJ5 A;  2M49 B;  3NSL A;  5KU1 A;  1JFK A;  2M1K B;  1N2D A;  3SS5 A;  1XA5 A;  2JQ6 A;  2KAY A;  2PVB A;  1CLM A;  5GQQ C;  4C0J A;  3BUX B;  4CPV A;  5JJG A;  3RM1 A;  1RTP 1;  3CWG A;  5I2Q A;  2JNF A;  2Y5I A;  3HX4 A;  5EL2 A;  3BUN B;  3D78 A;  3R1V A;  1SR6 B;  4GNK B;  2FJU B;  5FYX A;  1XFR A;  3SS3 A;  1F71 A;  2ZN8 A;  3ZNI A;  2Y1M A;  4BY5 A;  3CZT X;  2GTE A;  1B7T Z;  3OP0 A;  3BQ3 A;  3CAB A;  3IF7 A;  3AAK A;  5HYD A;  1UHK A;  3SG7 A;  1SCV A;  1J7P A;  1PVA A;  1PAL A;  1BR4 B;  3H4S E;  2L5X B;  1SCM C;  4JPZ B;  3LL8 B;  4MZJ A;  5AAN A;  3VRP A;  2BCB A;  2KAV A;  3ZWH A;  2KLE A;  1C7V A;  1JUO A;  3D0Y B;  1KFU L;  4C0L A;  3EVR A;  4MRX A;  2L5Y A;  2MLF C;  2K2A A;  1K93 D;  4PHN A;  3BUO B;  1WLZ A;  4JQ0 D;  1BOD A;  2K2F A;  1BOC A;  1IH0 A;  1C3Z A;  1CDL A;  2WOR A;  5I2L A;  2LVJ A;  1ODB A;  4A4B A;  4AQJ A;  1B1G A;  5ER4 X;  4D1E A;  1L2O B;  4MZL A;  1SW8 A;  3EK8 A;  1OOG A;  2AMI A;  2M3W A;  1W7I B;  2CTN A;  3CZ0 A;  4YGE B;  3DVK A;  2KHN A;  3N7H A;  1EXR A;  4ZCU A;  4GBA A;  1QV0 A;  1SSE B;  1L7Z A;  1S5G Z;  1QIW A;  2MLE C;  3SG4 A;  1CDM A;  1J7R A;  1IIO A;  1DQE A;  1SBJ A;  1TTX A;  3O78 A;  2B1U A;  4INX A;  2KYC A;  2KQ6 A;  2QEV A;  3FE8 A;  2WC5 A;  1BU3 A;  3CR2 A;  4NQG A;  2JTZ A;  1YVH A;  1Q80 A;  2HQW A;  2NLN A;  3Q8I A;  2LCP A;  3CR4 X;  2LAN A;  2L51 A;  2PAS A;  1TUJ A;  1YUS A;  2JT0 A;  3NGV A;  1J7Q A;  1OOF A;  2LNK A;  3FIA A;  3S0A A;  3DD4 A;  2LUC A;  3F45 A;  2LMU A;  3CGA A;  1YUR A;  2LMT A;  1SL8 A;  2LVV A;  3B7A A;  1LA0 A;  1QVI Z;  4OV2 A;  1DF0 A;  3LK0 A;  1QXP A;  1DJW A;  1C7W A;  3O4Y A;  3E3R A;  2CT9 A;  2M7N A;  4YGB B;  1TCO B;  1IQ5 A;  1NX1 A;  3IQO A;  1S6I A;  1WDC B;  4HRE E;  1DC1 A;  2M97 A;  4M2P A;  3PM2 A;  1YRU B;  1RK9 A;  4GFT A;  4R1E A;  1DMO A;  3QRX A;  1FI6 A;  1QTX A;  3L4L A;  2M1U A;  3CYZ A;  1NUB A;  2AUC A;  2KNE A;  4XYN A;  5HKW A;  2LP2 A;  1A29 A;  1Z2C B;  3WHU B;  1AK8 A;  2I94 A;  3I5H B;  4XJK A;  2LVI A;  3SS4 A;  5JOL A;  1F70 A;  4NDC A;  2JWW A;  3BFA A;  1GM0 A;  1MXL C;  3R1P A;  4HRH A;  1CFF A;  2HPS A;  4MLW A;  2LMV A;  1U5I B;  1E8A A;  2A4J A;  1GJY A;  2BNX A;  3D75 A;  3C1V A;  3PLF B;  4GGF C;  1JFJ A;  1KSM A;  2WND A;  3BFH A;  1ALV A;  3BOW A;  3WHT B;  2KDH A;  4HRG A;  1LS8 A;  2MA2 A;  1DGV A;  1S5G Y;  2L98 A;  3HCM A;  1V1F A;  1QVI Y;  1X02 A;  2G2B A;  1EG4 A;  3DY9 A;  1KK8 B;  1SPY A;  2KI4 C;  1M31 A;  1S1E A;  3B86 A;  2QEB A;  4DUQ A;  2NZ0 A;  3S0E A;  1TNW A;  1K95 A;  1W9Z A;  1TN4 A;  3R72 A;  2R2I A;  2SCP A;  1Y1U A;  1YUU A;  2JNX A;  2LP3 A;  1A75 B;  1NX2 A;  1MQ1 A;  2WCK A;  3OX5 A;  3RLZ A;  3CTN A;  1DGU A;  1OQP A;  2FCD A;  2KFG A;  4WRI A;  4N1F A;  3M0W A;  2P6B B;  1QLS A;  2KI4 B;  1OZS A;  2L2E A;  1SRA A;  1TOP A;  1RRO A;  1ZAC A;  4YI8 A;  2OS8 C;  1G8I A;  5I8N A;  4WQ3 A;  2K0J A;  2FOT A;  2L50 A;  2I18 A;  4IJ7 A;  4YBH B;  4F7F A;  1SYM A;  1WDC C;  1M39 A;  5HLV A;  1UHN A;  3DVM A;  1WLM A;  3SG3 A;  4MVF A;  1G33 A;  1A75 A;  1QV1 A;  2WCE A;  1K96 A;  1MXE A;  2WCB A;  2JT3 A;  3NHT A;  4GUK A;  4CFR A;  1QIV A;  3MSE B;  1CLB A;  2JU0 A;  4YGD B;  1IWQ A;  3BOW B;  4M2Q A;  3I5H C;  2HET A;  2M9G A;  3SG6 A;  2E6W A;  3IVT A;  4PHK A;  1R2U A;  1KQM B;  1OMD A;  4JKT A;  4TNC A;  1JC2 A;  1BT6 A;  2KGB C;  2SAS A;  2BBN A;  3CDN A;  1BMO A;  1SMG A;  2RGI A;  3PAL A;  1W7J B;  1XK4 A;  3KPX A;  3TDU A;  1NIW A;  2BKH B;  1B7T Y;  4DRW A;  5BPJ A;  3SJS A;  3D0Y A;  1HQV A;  4USL A;  1YUT A;  2NCP A;  1QX7 A;  2BAP A;  2WOS A;  4PE7 A;  1UUR A;  2QEH A;  3GK1 A;  5AER A;  1KK8 C;  3R1O A;  1QAS A;  4N1G A;  2F3Y A;  1ZMZ A;  4PT1 A;  1UWO A;  2ZND A;  1A03 A;  3GK2 A;  1TIZ A;  2K7O A;  1KQM C;  2P71 A;  4OZD A;  3ICB A;  2LHI A;  3BFB A;  3D77 A;  1B8R A;  5D7F A;  1KFX L;  1OZO A;  3AKB A;  3NXA A;  1CDP A;  1CLL A;  4PE4 A;  1FBV A;  1UP5 A;  4MEW A;  1GGZ A;  2ZNE A;  1EJ3 A;  1KCY A;  1QWV A;  2L0P A;  1QX2 A;  2Q91 A;  1B8L A;  1MUX A;  3EK7 A;  2D8N A;  1CM4 A;  1OMR A;  2LV7 A;  5DKQ A;  2BE4 A;  1PVB A;  1Y1X A;  2K61 A;  2PMY A;  1DF0 B;  2JXL A;  2K7B A;  2BBM A;  4ORA B;  3SIA A;  3S0D A;  3WNX B;  3LCP C;  4DCK A;  2M7L A;  4DS7 A;  1OOJ A;  1K94 A;  3EKH A;  2IS9 A;  2OS8 B;  3CR5 X;  3NSO A;  1BF5 A;  3DZT A;  2Y4Q A;  1A4P A;  1CFD A;  3KHE A;  4DIR A;  2JZI A;  1XFX O;  3CZ1 A;  3CZ2 A;  1DVI A;  2JTT A;  1QLK A;  1NSH A;  2ISD A;  4CFQ A;  1Y6W A;  2GGZ A;  5J3X A;  3B6X A;  3TDI A;  1NYA A;  3VGO A;  4QJ4 B;  4P2Y B;  5HKY A;  2FJY A;  4MRY A;  2BL0 C;  2KAX A;  3CS1 A;  3QME A;  4QJ5 B;  1OSA A;  4PDZ A;  3SG5 A;  2KFH A;  4INW A;  1DEL A;  1K90 D;  2NCO A;  5AEQ A;  4I5N B;  2E30 A;  4U8D A;  1S36 A;  2BCX A;  4PHM A;  1NX3 A;  1JWD A;  5HLO A;  1GQM A;  3NSK A;  5G08 A;  2V53 A;  5IBW A;  1P28 A;  5ER5 A;  2ZN9 A;  3OB2 B;  2K7D A;  2BEC A;  1RJV A;  3NHI A;  5CPV A;  1JBA A;  2LLS A;  2GV5 A;  2BL0 B;  2H8V A;  1NCX A;  2KGR A;  2LLT A;  3O2P A;  2JUL A;  1YVL A;  2AAO A;  4PHJ A;  2G9B A;  2HQ8 A;  1IKU A;  1N65 A;  3PSR A;  1M45 A;  2K60 A;  1J1E A;  2LC5 A;  5CSN A;  1S6J A;  3EVV A;  3OBV A;  2OTG B;  4PCW A;  4WQ2 A;  1F4Q A;  1WY9 A;  2KOT A;  3L4A A;  1DJG A;  4CLN A;  3O4X A;  3RZS A;  1CB1 A;  1B4C A;  2CNP A;  1PSB A;  2F33 A;  1PSR A;  1N0Y A;  3FS7 A;  5I2O A;  1QS7 A;  1CKK A;  1KFX S;  1MF8 B;  4QJ3 B;  4ORC B;  2JOJ A;  2TN4 A;  1CFP A;  4N5X A;  1EL4 A;  3BJH A;  4AOM A;  5K89 A;  2LE9 B;  4OKH A;  1XFY O;  1F4O A;  1LKJ A;  2L4I A;  3VRN A;  1IQ3 A;  3DXL A;  1FPW A;  1LVC D;  1MHO A;  1KK7 Z;  1AP4 A;  2M29 A;  3AKA A;  1KFU S;  2CBL A;  2JPO A;  1TCF A;  3SIB A;  1CFC A;  1EG3 A;  1UUS A;  4PE0 A;  3K1E A;  2JXC A;  4AQI A;  1CM1 A;  4E68 A;  1J7O A;  3V2L A;  1TUZ A;  4C0K A;  2CXJ A;  3GK4 X;  1SL9 A;  1S3P A;  4NDD A;  1OOI X;  3DVE A;  3PAT A;  1DJZ A;  2BCA A;  1HT9 A;  2M0R A;  2L4H A;  2KFF A;  2ZRS A;  1NCY A;  4GGN A;  4OCI A;  5DIC A;  2H2K A;  1ZUZ A;  1S26 D;  1YX8 A;  3EK4 A;  1XO5 A;  1TWO A;  1V1G A;  1GGW A;  1SY9 A;  2O5G A;  3BUW B;  4I5L B;  4NDB A;  4YI9 A;  3I5G C;  3LK1 A;  1ZOT B;  4L9M A;  4A4C A;  3O6B A;  1K2H A;  1S6C A;  3FWB A;  1UHI A;  1NPQ A;  1LXF C;  5B8I B;  1M46 A;  5CSF A;  4YGC B;  1H8B A;  2MRD A;  1J1D A;  4I5K A;  3S0B A;  2PRU A;  1QJT A;  4CID A;  2QAC A;  1YTZ C;  2O60 A;  3OB1 B;  4ZCV A;  2OTG C;  3EKJ A;  2MJW B;  1BR1 B;  3KO0 A;  1IGV A;  3IQQ A;  1PRW A;  1FF1 A;  3I5F C;  1AHR A;  3BYA A;  2DOQ A;  3KF9 A;  4ICB A;  5FI2 A;  2OPO A;  1IG5 A;  5DKN A;  2ERB A;  1OMV A;  3PN7 C;  4Q04 A;  3VRO A;  4GAO A;  5DKR A;  1DJY A;  1Y0V H;  1B47 A;  2ZKM X;  3D74 A;  3TS5 C;  3WXA A;  3S0F A;  2YGU A;  1YRT B;  2PQL A;  3VB1 A;  2KBI A;  1Z4H A;  2F8P A;  1XYD A;  1VRK A;  4JWQ A;  3PFV A;  1WRL A;  2WCM A;  4UPG A;  5D69 A;  1Y1A A;  1SKT A;  1PK0 D;  1B8C A;  1IRJ A;  2PSR A;  1XK4 C;  3K21 A;  4IL1 A;  1OE9 B;  2H61 C;  1JSA A;  3GOF A;  2JRF A;  2QEO A;  3AAJ A;  1NP8 A;  2FCE A;  3D73 A;  4P5O E;  4HSZ A;  2ZRT A;  1DJX A;  3NSI A;  1XFW O;  4ORB B;  3TS5 B;  5HL1 A;  5HKZ A;  1RFJ A;  2JC2 A;  2P70 A;  2QPT A;  2KLD A;  3OGN A;  3OHM B;  1WRK A;  1A2X A;  4OR9 B;  3FE6 A;  3VRR A;  1KWO C;  2WCH A;  4JD9 A;  2EGD A;  1LIN A;  4MSP A;  5PAL A;  2F2O A;  3OX6 A;  1TRF A;  1D1O A;  1F55 A;  1M63 B;  3DVJ A;  2BE6 A;  2KBM A;  3TUY C;  3I5G B;  4FTG A;  2CCM A;  4FQO A;  1G4Y R;  1WRZ A;  3L47 A;  1H4B A;  2WC8 A;  1FW4 A;  1K9P A;  1AUI B;  1BJF A;  1ALW A;  5FI6 A; 
#chains in the Genus database with same CATH homology
 1SL7 A;  1J55 A;  2I7A A;  1QX5 B;  4GGF A;  5AFP A;  4YRU A;  4PE1 A;  1F8H A;  2LHL A;  4BY4 A;  2JT8 A;  1DJH A;  2KSP A;  1TNQ A;  4YGA A;  3I5F B;  2PAL A;  4PAL A;  3JTD C;  1BG1 A;  3TUY B;  2NXQ A;  1CNP A;  3PN7 B;  3KEV A;  1REC A;  4XJK B;  1FI5 A;  1K9K A;  2EHB A;  1DJI A;  1XVJ A;  1LA3 A;  2LM5 A;  1SK6 D;  2JPT A;  2HF5 A;  2K7C A;  4I5J A;  3DF0 A;  1RWY A;  2LAP A;  4F0Z B;  1ZFS A;  5CSI A;  1QAT A;  5TNC A;  4MBE A;  3D10 A;  1PUL A;  1SR6 C;  1KK7 Y;  1K9U A;  1SNL A;  1TNP A;  1B9A A;  5CSJ A;  2BKI B;  1XFV O;  2LVK A;  3CLN A;  3BXK A;  1KSO A;  1CTR A;  1IJ5 A;  1BLQ A;  1UHJ A;  1F54 A;  1DTL A;  1JF2 A;  1SCM B;  3EVU A;  1YX7 A;  1U5I A;  1R6P A;  2I2R E;  3JVT B;  5AXI A;  1UHH A;  1K8U A;  2ZFD A;  1IJ6 A;  2COL B;  1AVS A;  1TNX A;  3BUM B;  1AJ4 A;  1CMF A;  3FWC A;  3SG2 A;  1KWO B;  2LUX A;  1NX0 A;  2GGM A;  2K8M B;  3LLE A;  4GPL B;  5KSZ A;  2MHH A;  1MWN A;  2KI6 D;  1NWD A;  2EC6 B;  2F2P A;  3I5I B;  4M2O A;  3VRQ A;  1L2O C;  2KQY A;  4OVN F;  5KTY A;  1XFZ O;  2LLU A;  2MAZ A;  2Q4U A;  1CDN A;  1EH2 A;  3JVT C;  1XFU O;  2M8U A;  1MR8 A;  2KI6 C;  4MZK A;  3TDZ A;  2VRG A;  1C07 A;  1DT7 B;  1JF0 A;  3DF0 B;  2F3Z A;  2Y1N A;  3A4U B;  3TZ1 A;  3PM8 A;  2MBX A;  2H61 A;  5F6T A;  3A8R A;  2KYF A;  2EC6 C;  2WCF A;  3I5I C;  1NCZ A;  3JTD B;  4MN0 A;  4ETO A;  1CMG A;  1YR5 A;  1AJ5 A;  2M49 B;  3NSL A;  5KU1 A;  1JFK A;  2M1K B;  1N2D A;  1XA5 A;  2JQ6 A;  2KAY A;  2PVB A;  1CLM A;  5GQQ C;  4C0J A;  3BUX B;  4CPV A;  5JJG A;  3RM1 A;  1RTP 1;  3CWG A;  5I2Q A;  2JNF A;  2Y5I A;  3HX4 A;  3BUN B;  1SR6 B;  4GNK B;  2FJU B;  5FYX A;  1F71 A;  2ZN8 A;  3ZNI A;  2Y1M A;  4BY5 A;  3CZT X;  1B7T Z;  3OP0 A;  3BQ3 A;  3IF7 A;  3AAK A;  5HYD A;  1UHK A;  3SG7 A;  1SCV A;  1J7P A;  1PVA A;  1PAL A;  1BR4 B;  3H4S E;  2L5X B;  1SCM C;  4JPZ B;  3LL8 B;  4MZJ A;  5AAN A;  3VRP A;  2BCB A;  2KAV A;  3ZWH A;  1C7V A;  1JUO A;  3D0Y B;  1KFU L;  4C0L A;  3EVR A;  4MRX A;  2MLF C;  2K2A A;  1K93 D;  4PHN A;  3BUO B;  1WLZ A;  4JQ0 D;  1BOD A;  2K2F A;  1BOC A;  1CDL A;  2WOR A;  5I2L A;  2LVJ A;  1ODB A;  4A4B A;  4AQJ A;  1B1G A;  5ER4 X;  4D1E A;  1L2O B;  4MZL A;  1SW8 A;  3EK8 A;  2AMI A;  2M3W A;  1W7I B;  2CTN A;  4YGE B;  3DVK A;  2KHN A;  1EXR A;  4ZCU A;  4GBA A;  1QV0 A;  1L7Z A;  1S5G Z;  1QIW A;  2MLE C;  3SG4 A;  1CDM A;  1J7R A;  1SBJ A;  1TTX A;  3O78 A;  2B1U A;  2KYC A;  2KQ6 A;  1BU3 A;  3CR2 A;  4NQG A;  2JTZ A;  1YVH A;  1Q80 A;  2HQW A;  2NLN A;  2LCP A;  3CR4 X;  2LAN A;  2L51 A;  2PAS A;  1YUS A;  2JT0 A;  1J7Q A;  2LNK A;  3FIA A;  3DD4 A;  2LUC A;  3F45 A;  2LMU A;  3CGA A;  1YUR A;  2LMT A;  1SL8 A;  2LVV A;  1LA0 A;  1QVI Z;  4OV2 A;  1DF0 A;  3LK0 A;  1QXP A;  1DJW A;  1C7W A;  3O4Y A;  3E3R A;  2CT9 A;  2M7N A;  4YGB B;  1TCO B;  1IQ5 A;  1NX1 A;  3IQO A;  1S6I A;  1WDC B;  4HRE E;  2M97 A;  4M2P A;  1YRU B;  1RK9 A;  4GFT A;  4R1E A;  1DMO A;  3QRX A;  1FI6 A;  1QTX A;  2M1U A;  1NUB A;  2AUC A;  2KNE A;  4XYN A;  5HKW A;  2LP2 A;  1A29 A;  3WHU B;  1KQV A;  1AK8 A;  2I94 A;  3I5H B;  4XJK A;  2LVI A;  5JOL A;  1F70 A;  4NDC A;  2JWW A;  1MXL C;  4HRH A;  1CFF A;  2HPS A;  4MLW A;  2LMV A;  1U5I B;  1E8A A;  2A4J A;  1GJY A;  3PLF B;  3C1V A;  4GGF C;  1JFJ A;  1KSM A;  2WND A;  1ALV A;  3BOW A;  3WHT B;  2KDH A;  4HRG A;  2MA2 A;  1DGV A;  1S5G Y;  2L98 A;  3HCM A;  1V1F A;  1QVI Y;  1X02 A;  2G2B A;  1EG4 A;  1KK8 B;  1SPY A;  2KI4 C;  1M31 A;  1S1E A;  4DUQ A;  2NZ0 A;  1TNW A;  1K95 A;  1TN4 A;  2R2I A;  2SCP A;  1Y1U A;  1YUU A;  2JNX A;  2LP3 A;  1A75 B;  1NX2 A;  1MQ1 A;  3OX5 A;  3RLZ A;  3CTN A;  1DGU A;  1OQP A;  2FCD A;  2KFG A;  4WRI A;  4N1F A;  3M0W A;  2P6B B;  1QLS A;  2KI4 B;  1OZS A;  2L2E A;  1SRA A;  1TOP A;  1RRO A;  1ZAC A;  4YI8 A;  2OS8 C;  1G8I A;  5I8N A;  4WQ3 A;  2K0J A;  2FOT A;  2L50 A;  2I18 A;  4YBH B;  1SYM A;  1WDC C;  1M39 A;  5HLV A;  1UHN A;  3DVM A;  1WLM A;  3SG3 A;  4MVF A;  1G33 A;  1A75 A;  1QV1 A;  2WCE A;  1K96 A;  1MXE A;  2WCB A;  2JT3 A;  4GUK A;  4CFR A;  1QIV A;  3MSE B;  1CLB A;  2JU0 A;  4YGD B;  1IWQ A;  3BOW B;  4M2Q A;  3I5H C;  2HET A;  2M9G A;  3SG6 A;  2E6W A;  4PHK A;  1R2U A;  1KQM B;  1OMD A;  1JC2 A;  4TNC A;  1BT6 A;  2KGB C;  2SAS A;  2BBN A;  1BMO A;  1SMG A;  2RGI A;  3PAL A;  1W7J B;  1XK4 A;  3KPX A;  3TDU A;  1NIW A;  2BKH B;  1B7T Y;  4DRW A;  5BPJ A;  3SJS A;  3D0Y A;  1HQV A;  4USL A;  1YUT A;  2NCP A;  1QX7 A;  2WOS A;  4PE7 A;  1UUR A;  3GK1 A;  5AER A;  1KK8 C;  4N1G A;  1QAS A;  2F3Y A;  1ZMZ A;  1UWO A;  2ZND A;  1A03 A;  3GK2 A;  1TIZ A;  2K7O A;  1KQM C;  3ICB A;  2LHI A;  1B8R A;  5D7F A;  1KFX L;  1OZO A;  3AKB A;  3NXA A;  1CDP A;  1CLL A;  4PE4 A;  1FBV A;  1UP5 A;  4MEW A;  1GGZ A;  2ZNE A;  1EJ3 A;  1KCY A;  2L0P A;  1QX2 A;  2Q91 A;  1B8L A;  1MUX A;  3EK7 A;  2D8N A;  1CM4 A;  1OMR A;  2LV7 A;  5DKQ A;  2BE4 A;  1PVB A;  1Y1X A;  2K61 A;  2PMY A;  1DF0 B;  2JXL A;  2K7B A;  2BBM A;  4ORA B;  3SIA A;  3WNX B;  4DCK A;  3LCP C;  1IH0 A;  2M7L A;  4DS7 A;  1OOJ A;  1K94 A;  3EKH A;  2IS9 A;  2OS8 B;  3CR5 X;  3NSO A;  1BF5 A;  2Y4Q A;  1A4P A;  1CFD A;  3KHE A;  4DIR A;  2JZI A;  1XFX O;  1DVI A;  2JTT A;  1QLK A;  1NSH A;  2ISD A;  4CFQ A;  1Y6W A;  2GGZ A;  5J3X A;  3TDI A;  1NYA A;  3VGO A;  4QJ4 B;  4P2Y B;  5HKY A;  4MRY A;  2BL0 C;  2KAX A;  3CS1 A;  4QJ5 B;  1OSA A;  4PDZ A;  3SG5 A;  2KFH A;  1K90 D;  2NCO A;  5AEQ A;  4I5N B;  2E30 A;  4U8D A;  1S36 A;  2BCX A;  4PHM A;  1NX3 A;  1JWD A;  5HLO A;  1GQM A;  3NSK A;  5G08 A;  2V53 A;  5IBW A;  5ER5 A;  2ZN9 A;  3OB2 B;  2K7D A;  2BEC A;  1RJV A;  5CPV A;  1JBA A;  2LLS A;  2GV5 A;  2BL0 B;  1NCX A;  2KGR A;  2LLT A;  3O2P A;  2JUL A;  1YVL A;  2AAO A;  4PHJ A;  2G9B A;  2HQ8 A;  1IKU A;  1N65 A;  3PSR A;  1M45 A;  1J1E A;  2LC5 A;  5CSN A;  1S6J A;  3EVV A;  2OTG B;  4PCW A;  4WQ2 A;  1F4Q A;  1WY9 A;  2KOT A;  1DJG A;  4CLN A;  1CB1 A;  1B4C A;  2CNP A;  2F33 A;  1PSB A;  1PSR A;  1N0Y A;  3FS7 A;  5I2O A;  1QS7 A;  1CKK A;  1KFX S;  1MF8 B;  4QJ3 B;  4ORC B;  2JOJ A;  2TN4 A;  1CFP A;  4N5X A;  1EL4 A;  4AOM A;  5K89 A;  2LE9 B;  4OKH A;  1XFY O;  1F4O A;  1LKJ A;  2L4I A;  3VRN A;  1IQ3 A;  1FPW A;  1LVC D;  1MHO A;  1KK7 Z;  1AP4 A;  2M29 A;  3AKA A;  1KFU S;  2CBL A;  3SIB A;  1TCF A;  1CFC A;  1EG3 A;  1UUS A;  4PE0 A;  4AQI A;  2JXC A;  1CM1 A;  4E68 A;  1J7O A;  4C0K A;  2CXJ A;  3GK4 X;  1SL9 A;  1S3P A;  4NDD A;  3DVE A;  3PAT A;  1DJZ A;  2BCA A;  1HT9 A;  2M0R A;  2L4H A;  2KFF A;  2ZRS A;  1NCY A;  4GGN A;  4OCI A;  2H2K A;  1ZUZ A;  1S26 D;  1YX8 A;  3EK4 A;  1XO5 A;  1V1G A;  1GGW A;  1SY9 A;  2O5G A;  3BUW B;  4I5L B;  4NDB A;  4YI9 A;  3I5G C;  3LK1 A;  1ZOT B;  4L9M A;  4A4C A;  3O6B A;  1K2H A;  1S6C A;  3FWB A;  1UHI A;  1NPQ A;  1LXF C;  5B8I B;  1M46 A;  5CSF A;  4YGC B;  1H8B A;  2MRD A;  1J1D A;  4I5K A;  2PRU A;  1QJT A;  4CID A;  2QAC A;  1YTZ C;  2O60 A;  3OB1 B;  4ZCV A;  2OTG C;  3EKJ A;  2MJW B;  1BR1 B;  3KO0 A;  1IGV A;  3IQQ A;  1PRW A;  1FF1 A;  3I5F C;  1AHR A;  3BYA A;  2DOQ A;  3KF9 A;  4ICB A;  2OPO A;  1IG5 A;  5DKN A;  1OMV A;  3PN7 C;  4Q04 A;  3VRO A;  4GAO A;  5DKR A;  1DJY A;  1Y0V H;  1B47 A;  2ZKM X;  3TS5 C;  3WXA A;  1YRT B;  2KBI A;  2F8P A;  1XYD A;  1VRK A;  4JWQ A;  3PFV A;  1WRL A;  4UPG A;  5D69 A;  1Y1A A;  1SKT A;  1PK0 D;  1B8C A;  1IRJ A;  2PSR A;  1XK4 C;  3K21 A;  4IL1 A;  1OE9 B;  2H61 C;  1JSA A;  3GOF A;  2JRF A;  3AAJ A;  1NP8 A;  2FCE A;  4P5O E;  4HSZ A;  2ZRT A;  1DJX A;  3NSI A;  1XFW O;  4ORB B;  3TS5 B;  5HKZ A;  1RFJ A;  2JC2 A;  2QPT A;  3OHM B;  1WRK A;  1A2X A;  4OR9 B;  3VRR A;  1KWO C;  4MSP A;  2EGD A;  1LIN A;  5PAL A;  1D1O A;  2F2O A;  3OX6 A;  1TRF A;  1F55 A;  1M63 B;  3DVJ A;  2BE6 A;  2KBM A;  3TUY C;  3I5G B;  4FTG A;  2CCM A;  4FQO A;  1G4Y R;  1WRZ A;  1H4B A;  2WC8 A;  1FW4 A;  1K9P A;  1AUI B;  1BJF A;  1ALW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...