1NX0A

Structure of calpain domain 6 in complex with calpastatin dic
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx0A00
1K2HA 3OX6A 5F6TA 3OB2B 2LV7A 1QLSA 1GJYA 1XK4A 2MRDA 3BUMB 4GBAA 4PHMA 3A4UB 1J1DA 1XK4C 3PALA 1DJXA 1QJTA 3DF0A 3O2PA 3VRRA 1NX0A 2DOQA 3LK1A 1QX5B 2KGRA 2L4IA 1U5IA 5HLVA 2F2OA 1KFXS 1M31A 1UHJA 2LP3A 1M39A 4ORCB 1TNXA 2KI4C 5BPJA 4MSPA 1TNQA 2LP2A 5DKNA 4PE4A 1BMOA 2M0RA 3I5HB 3IQOA 1K96A 3SG3A 1CKKA 1J55A 1NCXA 2JC2A 1J1EA 1QX2A 2JOJA 2K7BA 3BOWA 3CTNA 4PCWA 3WHUB 1PALA 2F3ZA 2OS8B 1SR6B 2EHBA 3CS1A 3FS7A 3LL8B 3PN7C 1FW4A 2ZRSA 4MBEA 4MLWA 3TDUA 4PALA 2BKIB 2L50A 1E8AA 1W7JB 3TDIA 1YRUB 1CFCA 4MVFA 1YX8A 3ZWHA 1AUIB 1YX7A 2E6WA 3TDZA 1NCYA 3PM8A 1B1GA 1YTZC 3O6BA 4QJ5B 4M2PA 4OR9B 5ER4X 1BODA 1RECA 1OOJA 5AERA 1CDNA 2KBMA 1RTP1 4ZCVA 1CFDA 1XO5A 1JC2A 4FTGA 2JT0A 1OMDA 1B7TZ 2COLB 3GK4X 4GGFA 3RM1A 3TUYB 3BUXB 2KAVA 2MBXA 2LUXA 4GGFC 1HT9A 5J3XA 4Q04A 1DTLA 2IS9A 3KO0A 1BF5A 4XJKA 3SG4A 2JT3A 3NSIA 1QASA 2FCEA 1D1OA 4N1GA 1DJHA 2LM5A 2M7LA 1W7IB 1HQVA 2LMTA 2Q91A 2PVBA 2BL0B 2LLUA 3JVTC 4WQ2A 2KBIA 3IF7A 1QV1A 1K9UA 2LLTA 3EK7A 1Y1UA 5GQQC 1TOPA 4CFRA 3EVVA 2WCEA 2KYCA 3F45A 1NX2A 4ZCUA 1MXLC 3O78A 3VRPA 3SIAA 3D0YA 3IQQA 3DVKA 1AK8A 5G08A 2M9GA 2G2BA 1H4BA 2LE9B 4I5NB 1CNPA 2BCAA 1PRWA 1KSOA 1JWDA 3LLEA 1DF0B 2G9BA 4PHJA 1B4CA 1N0YA 1IKUA 1S6JA 1MXEA 1DVIA 5D7FA 1NIWA 4U8DA 1CM1A 1XFWO 1TTXA 2P6BB 5JJGA 3H4SE 1KSMA 2BE4A 4NDDA 1AP4A 1SRAA 3BXKA 1IQ5A 2TN4A 4AQIA 4YGDB 1L2OB 4OVNF 4M2QA 3M0WA 2WCBA 1IRJA 2FCDA 5CPVA 1UHKA 1V1FA 3AAKA 2I94A 2CCMA 3CR4X 5AEQA 3SJSA 4C0KA 3MSEB 2AMIA 1WDCB 2L0PA 4OKHA 3AAJA 1S5GZ 2L98A 1XYDA 1ZACA 4CFQA 3VGOA 3O4YA 5HKWA 4YGEB 1RWYA 1B8RA 2NLNA 1H8BA 4I5LB 2JNFA 2NZ0A 1XFVO 2OTGB 4HRHA 1UP5A 3EK4A 4DS7A 1YRTB 1KFUS 2I18A 2H61C 2WNDA 1SBJA 2Y5IA 1PULA 1BU3A 4XYNA 1SYMA 3HX4A 1KFXL 2OS8C 1SR6C 1YURA 2LCPA 3A8RA 1CLLA 3TS5B 5I8NA 1YVHA 2H2KA 2LAPA 1MHOA 3OX5A 1JBAA 1LXFC 1A03A 5CSJA 4NDCA 1RFJA 1KQMB 2CBLA 3JTDC 2RGIA 1F70A 1S1EA 3VROA 4YBHB 1NX1A 1IG5A 2M8UA 1RROA 3C1VA 3DVMA 4GGNA 4AQJA 1JF0A 1SL7A 3BUNB 2ISDA 2BKHB 2I7AA 2BBMA 1QVIY 1MF8B 2L51A 2EC6B 1YUTA 1AVSA 1ZOTB 4NDBA 2GGZA 1LINA 1V1GA 2VRGA 1DGVA 3I5IB 3EK8A 2AAOA 1EL4A 3GK2A 1IJ6A 2F2PA 2B1UA 4GAOA 1QX7A 1QV0A 1SCMB 4MZKA 2CXJA 1IGVA 4C0JA 1UURA 2K7DA 3FWBA 4I5JA 3KF9A 3EKHA 2ZN9A 4OCIA 2QACA 4PDZA 2K0JA 3BQ3A 1KWOB 5CSNA 1CM4A 3DF0B 1M45A 2BL0C 1TIZA 2FJUB 4MZLA 1BJFA 2LNKA 4CIDA 1U5IB 2JULA 4DRWA 1BG1A 4UPGA 1UWOA 2ZNEA 1TCOB 2KGBC 2JXCA 2O60A 1BOCA 2BE6A 1IH0A 1DGUA 1NX3A 4AOMA 1L7ZA 4ICBA 4MRXA 2ZN8A 2KOTA 3BOWB 1DF0A 2WORA 1EXRA 1S3PA 1MWNA 5IBWA 5HKYA 1B8CA 1MR8A 1S6IA 1Y1XA 2LMUA 3DVEA 3LCPC 4YGCB 1RK9A 3LK0A 1JUOA 1SY9A 1K9KA 2KYFA 4PE1A 1ZUZA 2I2RE 1SL9A 2SCPA 1QLKA 1A75A 2SASA 1KK7Y 1KK8B 2ZRTA 1BR1B 3D10A 1S26D 4YGBB 3ZNIA 1B47A 2HF5A 2PASA 2HQWA 3PLFB 2CTNA 2HPSA 1QIVA 2MA2A 4MRYA 2F3YA 4BY5A 1K90D 1L2OC 1QS7A 2K8MB 4P5OE 1DJGA 1F4QA 2ZKMX 1YVLA 2Q4UA 3SG2A 3QRXA 4JPZB 2HQ8A 2D8NA 1C7VA 4BY4A 5HKZA 1IJ5A 1SPYA 1GGZA 2MAZA 2NCPA 1G4YR 1LA0A 1S36A 2EGDA 4XJKB 2V53A 1OZSA 3KHEA 4GNKB 2KDHA 4YRUA 2LVVA 1R2UA 5I2LA 4A4BA 3DD4A 4JWQA 5AANA 2LANA 1EH2A 1JSAA 3JVTB 4CLNA 1PVAA 1FF1A 1ZFSA 2WC8A 3OHMB 2LVIA 4ORAB 3SG6A 3I5FB 1NWDA 1CMGA 5I2QA 2M49B 3TZ1A 1CFPA 3CLNA 2ZNDA 3NSLA 3PSRA 2KFFA 2M97A 2FOTA 2O5GA 3SG7A 4OV2A 1K9PA 4DCKA 4ETOA 3D0YB 2LMVA 4PHNA 1A2XA 4QJ3B 1BT6A 3KPXA 4WRIA 5K89A 4YI8A 4DUQA 3CGAA 2K7OA 1K8UA 2PMYA 3BYAA 1QATA 1BR4B 3HCMA 1DJWA 1TNPA 1DJZA 2KNEA 1SK6D 2Y4QA 1KFUL 4FQOA 2LVKA 2JWWA 4GFTA 5FYXA 2H61A 2PRUA 3AKBA 1UHNA 1PK0D 2LHIA 1SKTA 1WRLA 4NQGA 4P2YB 1FPWA 1KQMC 4HSZA 3I5HC 4CPVA 4HRGA 1KCYA 1AJ5A 1QIWA 1SW8A 1YUUA 3NXAA 1IWQA 1NYAA 1SNLA 5HLOA 1J7QA 2KHNA 3AKAA 1MUXA 3KEVA 2JTZA 2EC6C 2F33A 2LHLA 3WXAA 3I5IC 3I5GB 2M1KB 1FI6A 1Y0VH 1X02A 3OP0A 1G33A 1G8IA 1JF2A 1ODBA 1CLMA 1QXPA 2BCBA 4R1EA 2JPTA 1GGWA 1B9AA 1SCMC 1Y1AA 2BECA 1OZOA 1BLQA 4MEWA 1S5GY 1MQ1A 1EJ3A 4L9MA 5D69A 1F8HA 5HYDA 2GV5A 2KFGA 1NP8A 1C7WA 5DKRA 2L5XB 1KWOC 1CB1A 3CWGA 3CR5X 4MZJA 1XFZO 3TUYC 2KQ6A 2KQYA 4E68A 2JU0A 1GQMA 4PHKA 1FI5A 2L4HA 3ICBA 2JRFA 2JT8A 2PSRA 1WY9A 3BUOB 1UHHA 5DKQA 3PATA 3CZTX 1IQ3A 2MLFC 3FWCA 1M46A 2KI6D 2R2IA 4IL1A 3DVJA 1CFFA 5CSIA 1JFKA 4D1EA 3EVRA 5AXIA 2HETA 2K2AA 5JOLA 1R6PA 1CDPA 1ZMZA 1DT7B 2LC5A 4GPLB 4N1FA 3BUWB 1WLMA 2KI4B 2GGMA 4GUKA 1K94A 2Y1MA 4HREE 3SIBA 3JTDB 4PE7A 2KSPA 1ALVA 1XFXO 5KTYA 2M3WA 1KK8C 1NCZA 5PALA 5KSZA 1DMOA 2MLEC 1M63B 1KK7Z 2E30A 1UUSA 2M29A 1YR5A 2Y1NA 3PN7B 1F54A 1XFYO 1N65A 3GK1A 2K61A 4USLA 1S6CA 1PSBA 1LA3A 2AUCA 3WHTB 1Y6WA 2MJWB 2KFHA 5ER5A 1KQVA 4DIRA 1SMGA 1J7PA 1TN4A 1QTXA 5CSFA 4YI9A 4A4CA 2NXQA 1TCFA 2LUCA 4ORBB 1ALWA 1AHRA 1CMFA 2KAXA 1B7TY 1K93D 4PE0A 1CLBA 5KU1A 1OMRA 2JNXA 1CTRA 5B8IB 3I5FC 1WRKA 1F71A 3VRQA 2KI6C 5I2OA 1LVCD 1N2DA 2LLSA 1YUSA 1XA5A 1XFUO 1JFJA 2JTTA 1A29A 1VRKA 1OE9B 1WDCC 2QPTA 1F55A 2WCFA 1A4PA 2CT9A 2M7NA 3WNXB 1PSRA 1UHIA 3EKJA 3SG5A 2KAYA 4I5KA 2K7CA 4YGAA 1SL8A 5AFPA 1OSAA 2WOSA 3GOFA 3NSOA 1SCVA 3VRNA 4M2OA 1DJYA 1TNWA 4JQ0D 1C07A 2JXLA 1TRFA 1J7RA 1NPQA 1PVBA 2OTGC 1CDLA 4C0LA 2L2EA 2K2FA 2PALA 3RLZA 1OQPA 2A4JA 1WRZA 2M1UA 1A75B 4WQ3A 2F8PA 1EG3A 1WLZA 1CDMA 3E3RA 3PFVA 3CR2A 3TS5C 1Q80A 3K21A 4QJ4B 1OMVA 1EG4A 2JQ6A 1K95A 3I5GC 2CNPA 2ZFDA 3NSKA 4MN0A 4N5XA 4F0ZB 3EVUA 1XVJA 1NSHA 1DJIA 2JZIA 5TNCA 1B8LA 2MHHA 2BCXA 3FIAA 1AJ4A 2OPOA 1FBVA 1RJVA 2BBNA 4TNCA 1LKJA 1QVIZ 2LVJA 1NUBA 1F4OA 1J7OA 3OB1B 2NCOA
chains in the Genus database with same CATH superfamily
1K2HA 3OX6A 4IJ7A 2BAPA 3N7HA 3PM2A 3OB2B 5F6TA 2LV7A 1QLSA 1GJYA 2FJYA 1XK4A 2MRDA 3BUMB 4GBAA 4PHMA 3A4UB 1J1DA 1P28A 1XK4C 2WC5A 3PALA 1DJXA 1QJTA 3DF0A 3O2PA 3R1VA 3VRRA 1NX0A 2DOQA 3LK1A 1QX5B 2KGRA 2L4IA 1U5IA 5HLVA 2F2OA 1KFXS 1M31A 1UHJA 2LP3A 1M39A 4ORCB 1TNXA 2KI4C 5BPJA 4MSPA 1TNQA 2LP2A 5DKNA 4PE4A 1BMOA 2M0RA 3I5HB 3IQOA 1K96A 3SG3A 1CKKA 1T14A 1J55A 1NCXA 2JC2A 1J1EA 1QX2A 2JOJA 2K7BA 3BOWA 3CTNA 3D75A 4PCWA 3WHUB 4F7FA 1PALA 2QEOA 2F3ZA 2OS8B 1SR6B 3CYZA 2EHBA 2WC6A 3CS1A 3FS7A 1DELA 3LL8B 3PN7C 1FW4A 2ZRSA 4MBEA 4MLWA 3TDUA 4PALA 2BKIB 2L50A 1E8AA 1W7JB 3TDIA 1YRUB 1CFCA 3UO9A 4MVFA 1YX8A 3ZWHA 1AUIB 1YX7A 2E6WA 3TDZA 1NCYA 3PM8A 3SS4A 1B1GA 1YTZC 3O6BA 4QJ5B 4M2PA 1GM0A 4OR9B 5ER4X 1BODA 1RECA 2WCLA 1OOJA 5AERA 1CDNA 2KBMA 1RTP1 4ZCVA 1CFDA 1XO5A 1OOHA 1JC2A 4FTGA 2JT0A 1OMDA 1B7TZ 2COLB 3GK4X 4GGFA 3RM1A 3TUYB 3BUXB 2KAVA 2MBXA 2LUXA 4GGFC 1HT9A 5J3XA 4Q04A 1DTLA 2IS9A 3KO0A 1BF5A 4XJKA 3SG4A 2JT3A 3S0AA 3NSIA 1QASA 1OW4A 2FCEA 1D1OA 4N1GA 1DJHA 2LM5A 2M7LA 1W7IB 2K60A 3S0DA 1OOIX 1HQVA 2LMTA 2Q91A 3CZ0A 2PVBA 2BL0B 2LLUA 3JVTC 4WQ2A 2KBIA 3IF7A 3RZSA 3SS3A 1QV1A 1K9UA 2LLTA 3EK7A 1Y1UA 5GQQC 1TOPA 4CFRA 3EVVA 2L5YA 2KYCA 2WCEA 3F45A 1NX2A 4ZCUA 1MXLC 3O78A 4JD9A 3VRPA 3SIAA 3D0YA 3IQQA 3DVKA 5FI6A 5D3OA 1AK8A 5G08A 2M9GA 3PJIA 2G2BA 1H4BA 2LE9B 4I5NB 1CNPA 2BCAA 1PRWA 1KSOA 1JWDA 3LLEA 1DF0B 2G9BA 4PHJA 3DZTA 1B4CA 1N0YA 1TUZA 1IKUA 1S6JA 1MXEA 3DYEA 1DVIA 5D7FA 1NIWA 4U8DA 1CM1A 1XFWO 1TTXA 2P6BB 5JJGA 3H4SE 3OBVA 3B7AA 1KSMA 2BE4A 2ERBA 4NDDA 1AP4A 1SRAA 3BXKA 1IQ5A 2TN4A 4AQIA 4YGDB 1L2OB 2WCMA 4OVNF 4M2QA 3M0WA 2WCBA 2WCKA 1IRJA 2FCDA 5CPVA 1UHKA 3D74A 3V2LA 3VB1A 1V1FA 3AAKA 2I94A 2CCMA 3CR4X 5AEQA 3SJSA 4C0KA 2H8VA 3MSEB 2AMIA 1WDCB 2L0PA 4OKHA 3AAJA 1S5GZ 2L98A 1XYDA 1ZACA 4CFQA 3VGOA 3O4YA 3D78A 5HKWA 4YGEB 1RWYA 1B8RA 2NLNA 1H8BA 4I5LB 2JNFA 2NZ0A 1XFVO 2OTGB 2QDIA 4HRHA 1UP5A 3EK4A 4DS7A 1YRTB 1KFUS 2I18A 2H61C 2WNDA 1SBJA 2Y5IA 1PULA 1BU3A 4XYNA 2GTEA 1SYMA 3HX4A 2L2CA 1IIOA 1KFXL 2OS8C 1SR6C 1YURA 2LCPA 3A8RA 1CLLA 3TS5B 5I8NA 1YVHA 2H2KA 2LAPA 1MHOA 3OX5A 1Z4HA 1JBAA 1LXFC 1A03A 5CSJA 4NDCA 1RFJA 1KQMB 2CBLA 3JTDC 2RGIA 1F70A 1S1EA 3VROA 4YBHB 1NX1A 1IG5A 2M8UA 1RROA 3C1VA 3DVMA 4GGNA 4AQJA 3S0FA 1JF0A 1SL7A 3BUNB 2ISDA 2BKHB 2I7AA 2BBMA 5DICA 1QVIY 1MF8B 4FQTA 2L51A 2EC6B 1YUTA 1AVSA 1ZOTB 4NDBA 2GGZA 1LINA 1V1GA 2VRGA 1DGVA 3I5IB 3EK8A 1DQEA 2AAOA 1EL4A 3GK2A 1IJ6A 2F2PA 2B1UA 4GAOA 1QX7A 1QV0A 1SCMB 4MZKA 2CXJA 1IGVA 4C0JA 1UURA 2K7DA 3FWBA 4I5JA 3KF9A 3EKHA 3B86A 3K1EA 2ZN9A 4OCIA 2KLEA 2QACA 4KYNA 4PDZA 2K0JA 3BQ3A 1KWOB 5CSNA 1CM4A 3DF0B 1M45A 2BL0C 1TIZA 2FJUB 4MZLA 1BJFA 2LNKA 2BNXA 4CIDA 5I94A 5EL2A 1U5IB 2JULA 3R1PA 4DRWA 1BG1A 2WCHA 4UPGA 1W9ZA 1UWOA 2ZNEA 1TCOB 2KGBC 2JXCA 2O60A 1BOCA 2BE6A 1IH0A 1DGUA 1NX3A 4AOMA 1L7ZA 4ICBA 4MRXA 2ZN8A 2KOTA 3BOWB 1DF0A 2WORA 1EXRA 1S3PA 1MWNA 5IBWA 5HKYA 1B8CA 1MR8A 1S6IA 1Y1XA 2LMUA 3DVEA 3LCPC 4YGCB 1RK9A 1DEKA 3LK0A 1JUOA 1SY9A 3BFBA 1K9KA 2KYFA 4PE1A 1ZUZA 2I2RE 3QMEA 1SL9A 2SCPA 1QLKA 1A75A 2SASA 1KK7Y 1KK8B 2ZRTA 1BR1B 3D10A 1S26D 4YGBB 3ZNIA 1B47A 2HF5A 3B87A 2PASA 2HQWA 3PLFB 2CTNA 2HPSA 1QIVA 2MA2A 4MRYA 2F3YA 4BY5A 1K90D 1L2OC 1QS7A 2K8MB 4P5OE 1DJGA 1F4QA 2ZKMX 1YVLA 2Q4UA 3SG2A 3QRXA 4JPZB 2HQ8A 2D8NA 1C7VA 2P71A 4BY4A 5HKZA 1IJ5A 1SPYA 1GGZA 2MAZA 2NCPA 1G4YR 1LA0A 1S36A 2P70A 2WCJA 2EGDA 4INWA 4XJKB 2V53A 1OZSA 3KHEA 4GNKB 2KDHA 4YRUA 2LVVA 1R2UA 5I2LA 1LS8A 4A4BA 3DD4A 4JWQA 5AANA 2LANA 1EH2A 1JSAA 3JVTB 4CLNA 1PVAA 1FF1A 1ZFSA 2WC8A 3OHMB 2LVIA 3NGVA 4ORAB 4PT1A 3SG6A 3L4AA 3I5FB 1NWDA 1CMGA 5I2QA 2M49B 3TZ1A 1CFPA 3CLNA 2ZNDA 3NSLA 3PSRA 2KFFA 3SS5A 3DXLA 2M97A 2FOTA 2O5GA 3SG7A 4OV2A 1K9PA 4DCKA 4ETOA 3D0YB 2LMVA 4PHNA 1A2XA 4QJ3B 1BT6A 2JPOA 3CZ1A 3KPXA 4WRIA 5K89A 4YI8A 4DUQA 3CGAA 2K7OA 1K8UA 2PMYA 3BYAA 1QATA 1BR4B 3HCMA 1DJWA 1TNPA 1DJZA 2KNEA 1SK6D 2Y4QA 1KFUL 4FQOA 2LVKA 2JWWA 4GFTA 5FYXA 2H61A 2PRUA 3AKBA 1UHNA 1PK0D 2LHIA 1SKTA 1WRLA 4NQGA 4P2YB 1FPWA 1KQMC 4HSZA 3I5HC 4CPVA 4HRGA 1KCYA 1AJ5A 1QIWA 1SW8A 1YUUA 3NXAA 1IWQA 1NYAA 1SNLA 5HLOA 1J7QA 2KHNA 3AKAA 1MUXA 3KEVA 3S0BA 2JTZA 2EC6C 2F33A 2PQLA 3DY9A 2LHLA 3WXAA 3I5IC 3I5GB 2M1KB 3D76A 3FE9A 1Y0VH 3NHTA 1X02A 3OP0A 1G33A 1G8IA 1FI6A 1SSEB 1JF2A 1ODBA 1CLMA 1QXPA 2BCBA 4R1EA 2JPTA 1GGWA 1B9AA 1SCMC 1Y1AA 2BECA 1OZOA 2QEBA 1BLQA 3NHIA 4MEWA 1S5GY 1MQ1A 1EJ3A 4L9MA 5D69A 1F8HA 5HYDA 2GV5A 2KFGA 1NP8A 1C7WA 5DKRA 2L5XB 1KWOC 1CB1A 3CWGA 3CR5X 4MZJA 2PYQA 3UNWA 1XFZO 3TUYC 2KQ6A 2KQYA 4E68A 2JU0A 1GQMA 4PHKA 1FI5A 2L4HA 3ICBA 2JRFA 2JT8A 2PSRA 1WY9A 3BUOB 5FI7A 4OZDA 1UHHA 5DKQA 3PATA 3CZTX 1IQ3A 2MLFC 3FWCA 1M46A 2KI6D 2R2IA 4IL1A 3DVJA 1CFFA 5CSIA 1JFKA 4D1EA 3EVRA 5AXIA 2HETA 2K2AA 1OOGA 2QEHA 5JOLA 1R6PA 2KPHA 1CDPA 1ZMZA 1DT7B 2LC5A 4GPLB 4N1FA 3BUWB 1WLMA 2KI4B 5HL1A 2GGMA 3L4LA 4GUKA 1K94A 2Y1MA 4HREE 3SIBA 3JTDB 4PE7A 2KSPA 1ALVA 1XFXO 3IVTA 5KTYA 2M3WA 1KK8C 1NCZA 5PALA 1ORGA 5KSZA 1DMOA 2MLEC 1M63B 1KK7Z 2E30A 1UUSA 2M29A 3L47A 3O4XA 1YR5A 2Y1NA 3PN7B 3D77A 1XFYO 1F54A 1N65A 3GK1A 2K61A 4USLA 1S6CA 1PSBA 1LA3A 1XFRA 2AUCA 3WHTB 1Y6WA 2MJWB 2KFHA 3EG5B 5ER5A 3BFHA 3CABA 4DIRA 1KQVA 1SMGA 1J7PA 1TN4A 1QTXA 4JKTA 2QEVA 5CSFA 4INXA 4YI9A 1Z2CB 4A4CA 2NXQA 1TCFA 2LUCA 2KLDA 4ORBB 1ALWA 1AHRA 1CMFA 2KAXA 1B7TY 1K93D 4PE0A 1CLBA 5KU1A 1C3ZA 1OMRA 1OOFA 2JNXA 1CTRA 1QWVA 5B8IB 3B6XA 3I5FC 1WRKA 1F71A 3VRQA 2KI6C 5I2OA 1LVCD 3CZ2A 5FI2A 1N2DA 2LLSA 1YUSA 1XA5A 1XFUO 1JFJA 2JTTA 1A29A 1VRKA 1OE9B 1WDCC 2QPTA 1F55A 2WCFA 1A4PA 2CT9A 2M7NA 3WNXB 1PSRA 1UHIA 3EKJA 3SG5A 2KAYA 1C3YA 4I5KA 3S0EA 2K7CA 4YGAA 1SL8A 5AFPA 1OSAA 2WOSA 3GOFA 3NSOA 1SCVA 3VRNA 4M2OA 1DJYA 1TNWA 4JQ0D 1C07A 2JXLA 1TRFA 1J7RA 1NPQA 1PVBA 2OTGC 3FE6A 1CDLA 3R72A 4C0LA 2L2EA 2K2FA 1TWOA 2PALA 3RLZA 1OQPA 2A4JA 3FE8A 1WRZA 2M1UA 1A75B 2YGUA 3BJHA 4WQ3A 2F8PA 1EG3A 1WLZA 1CDMA 3D73A 3E3RA 3PFVA 3CR2A 3B88A 3TS5C 1Q80A 3K21A 3S0GA 4QJ4B 1OMVA 1EG4A 3OGNA 2JQ6A 1K95A 3I5GC 2CNPA 2ZFDA 3NSKA 4MN0A 4N5XA 4F0ZB 3EVUA 3CDNA 1XVJA 1NSHA 1DJIA 2JZIA 5TNCA 1B8LA 2MHHA 1TUJA 2BCXA 3FIAA 1AJ4A 2OPOA 1FBVA 1RJVA 2BBNA 4TNCA 1LKJA 1QVIZ 2LVJA 1NUBA 1F4OA 1J7OA 3OB1B 3R1OA 2NCOA 3BFAA 3Q8IA 1DC1A
chains in the Genus database with same CATH topology
1K2HA 3OX6A 5F6TA 3OB2B 2LV7A 1QLSA 1GJYA 1XK4A 2MRDA 3BUMB 4GBAA 4PHMA 3A4UB 1J1DA 1XK4C 3PALA 1DJXA 1QJTA 3DF0A 3O2PA 3VRRA 1NX0A 2DOQA 3LK1A 1QX5B 2KGRA 2L4IA 1U5IA 5HLVA 2F2OA 1KFXS 1M31A 1UHJA 2LP3A 1M39A 4ORCB 1TNXA 2KI4C 5BPJA 4MSPA 1TNQA 2LP2A 5DKNA 4PE4A 1BMOA 2M0RA 3I5HB 3IQOA 1K96A 3SG3A 1CKKA 1J55A 1NCXA 2JC2A 1J1EA 1QX2A 2JOJA 2K7BA 3BOWA 3CTNA 4PCWA 3WHUB 1PALA 2F3ZA 2OS8B 1SR6B 2EHBA 3CS1A 3FS7A 3LL8B 3PN7C 1FW4A 2ZRSA 4MBEA 4MLWA 3TDUA 4PALA 2BKIB 2L50A 1E8AA 1W7JB 3TDIA 1YRUB 1CFCA 4MVFA 1YX8A 3ZWHA 1AUIB 1YX7A 2E6WA 3TDZA 1NCYA 3PM8A 1B1GA 1YTZC 3O6BA 4QJ5B 4M2PA 4OR9B 5ER4X 1BODA 1RECA 1OOJA 5AERA 1CDNA 2KBMA 1RTP1 4ZCVA 1CFDA 1XO5A 1JC2A 4FTGA 2JT0A 1OMDA 1B7TZ 2COLB 3GK4X 4GGFA 3RM1A 3TUYB 3BUXB 2KAVA 2MBXA 2LUXA 4GGFC 1HT9A 5J3XA 4Q04A 1DTLA 2IS9A 3KO0A 1BF5A 4XJKA 3SG4A 2JT3A 3NSIA 1QASA 2FCEA 1D1OA 4N1GA 1DJHA 2LM5A 2M7LA 1W7IB 1HQVA 2LMTA 2Q91A 2PVBA 2BL0B 2LLUA 3JVTC 4WQ2A 2KBIA 3IF7A 1QV1A 1K9UA 2LLTA 3EK7A 1Y1UA 5GQQC 1TOPA 4CFRA 3EVVA 2WCEA 2KYCA 3F45A 1NX2A 4ZCUA 1MXLC 3O78A 3VRPA 3SIAA 3D0YA 3IQQA 3DVKA 1AK8A 5G08A 2M9GA 2G2BA 1H4BA 2LE9B 4I5NB 1CNPA 2BCAA 1PRWA 1KSOA 1JWDA 3LLEA 1DF0B 2G9BA 4PHJA 1B4CA 1N0YA 1IKUA 1S6JA 1MXEA 1DVIA 5D7FA 1NIWA 4U8DA 1CM1A 1XFWO 1TTXA 2P6BB 5JJGA 3H4SE 1KSMA 2BE4A 4NDDA 1AP4A 1SRAA 3BXKA 1IQ5A 2TN4A 4AQIA 4YGDB 1L2OB 4OVNF 4M2QA 3M0WA 2WCBA 1IRJA 2FCDA 5CPVA 1UHKA 1V1FA 3AAKA 2I94A 2CCMA 3CR4X 5AEQA 3SJSA 4C0KA 3MSEB 2AMIA 1WDCB 2L0PA 4OKHA 3AAJA 1S5GZ 2L98A 1XYDA 1ZACA 4CFQA 3VGOA 3O4YA 5HKWA 4YGEB 1RWYA 1B8RA 2NLNA 1H8BA 4I5LB 2JNFA 2NZ0A 1XFVO 2OTGB 4HRHA 1UP5A 3EK4A 4DS7A 1YRTB 1KFUS 2I18A 2H61C 2WNDA 1SBJA 2Y5IA 1PULA 1BU3A 4XYNA 1SYMA 3HX4A 1KFXL 2OS8C 1SR6C 1YURA 2LCPA 3A8RA 1CLLA 3TS5B 5I8NA 1YVHA 2H2KA 2LAPA 1MHOA 3OX5A 1JBAA 1LXFC 1A03A 5CSJA 4NDCA 1RFJA 1KQMB 2CBLA 3JTDC 2RGIA 1F70A 1S1EA 3VROA 4YBHB 1NX1A 1IG5A 2M8UA 1RROA 3C1VA 3DVMA 4GGNA 4AQJA 1JF0A 1SL7A 3BUNB 2ISDA 2BKHB 2I7AA 2BBMA 1QVIY 1MF8B 2L51A 2EC6B 1YUTA 1AVSA 1ZOTB 4NDBA 2GGZA 1LINA 1V1GA 2VRGA 1DGVA 3I5IB 3EK8A 2AAOA 1EL4A 3GK2A 1IJ6A 2F2PA 2B1UA 4GAOA 1QX7A 1QV0A 1SCMB 4MZKA 2CXJA 1IGVA 4C0JA 1UURA 2K7DA 3FWBA 4I5JA 3KF9A 3EKHA 2ZN9A 4OCIA 2QACA 4PDZA 2K0JA 3BQ3A 1KWOB 5CSNA 1CM4A 3DF0B 1M45A 2BL0C 1TIZA 2FJUB 4MZLA 1BJFA 2LNKA 4CIDA 1U5IB 2JULA 4DRWA 1BG1A 4UPGA 1UWOA 2ZNEA 1TCOB 2KGBC 2JXCA 2O60A 1BOCA 2BE6A 1IH0A 1DGUA 1NX3A 4AOMA 1L7ZA 4ICBA 4MRXA 2ZN8A 2KOTA 3BOWB 1DF0A 2WORA 1EXRA 1S3PA 1MWNA 5IBWA 5HKYA 1B8CA 1MR8A 1S6IA 1Y1XA 2LMUA 3DVEA 3LCPC 4YGCB 1RK9A 3LK0A 1JUOA 1SY9A 1K9KA 2KYFA 4PE1A 1ZUZA 2I2RE 1SL9A 2SCPA 1QLKA 1A75A 2SASA 1KK7Y 1KK8B 2ZRTA 1BR1B 3D10A 1S26D 4YGBB 3ZNIA 1B47A 2HF5A 2PASA 2HQWA 3PLFB 2CTNA 2HPSA 1QIVA 2MA2A 4MRYA 2F3YA 4BY5A 1K90D 1L2OC 1QS7A 2K8MB 4P5OE 1DJGA 1F4QA 2ZKMX 1YVLA 2Q4UA 3SG2A 3QRXA 4JPZB 2HQ8A 2D8NA 1C7VA 4BY4A 5HKZA 1IJ5A 1SPYA 1GGZA 2MAZA 2NCPA 1G4YR 1LA0A 1S36A 2EGDA 4XJKB 2V53A 1OZSA 3KHEA 4GNKB 2KDHA 4YRUA 2LVVA 1R2UA 5I2LA 4A4BA 3DD4A 4JWQA 5AANA 2LANA 1EH2A 1JSAA 3JVTB 4CLNA 1PVAA 1FF1A 1ZFSA 2WC8A 3OHMB 2LVIA 4ORAB 3SG6A 3I5FB 1NWDA 1CMGA 5I2QA 2M49B 3TZ1A 1CFPA 3CLNA 2ZNDA 3NSLA 3PSRA 2KFFA 2M97A 2FOTA 2O5GA 3SG7A 4OV2A 1K9PA 4DCKA 4ETOA 3D0YB 2LMVA 4PHNA 1A2XA 4QJ3B 1BT6A 3KPXA 4WRIA 5K89A 4YI8A 4DUQA 3CGAA 2K7OA 1K8UA 2PMYA 3BYAA 1QATA 1BR4B 3HCMA 1DJWA 1TNPA 1DJZA 2KNEA 1SK6D 2Y4QA 1KFUL 4FQOA 2LVKA 2JWWA 4GFTA 5FYXA 2H61A 2PRUA 3AKBA 1UHNA 1PK0D 2LHIA 1SKTA 1WRLA 4NQGA 4P2YB 1FPWA 1KQMC 4HSZA 3I5HC 4CPVA 4HRGA 1KCYA 1AJ5A 1QIWA 1SW8A 1YUUA 3NXAA 1IWQA 1NYAA 1SNLA 5HLOA 1J7QA 2KHNA 3AKAA 1MUXA 3KEVA 2JTZA 2EC6C 2F33A 2LHLA 3WXAA 3I5IC 3I5GB 2M1KB 1FI6A 1Y0VH 1X02A 3OP0A 1G33A 1G8IA 1JF2A 1ODBA 1CLMA 1QXPA 2BCBA 4R1EA 2JPTA 1GGWA 1B9AA 1SCMC 1Y1AA 2BECA 1OZOA 1BLQA 4MEWA 1S5GY 1MQ1A 1EJ3A 4L9MA 5D69A 1F8HA 5HYDA 2GV5A 2KFGA 1NP8A 1C7WA 5DKRA 2L5XB 1KWOC 1CB1A 3CWGA 3CR5X 4MZJA 1XFZO 3TUYC 2KQ6A 2KQYA 4E68A 2JU0A 1GQMA 4PHKA 1FI5A 2L4HA 3ICBA 2JRFA 2JT8A 2PSRA 1WY9A 3BUOB 1UHHA 5DKQA 3PATA 3CZTX 1IQ3A 2MLFC 3FWCA 1M46A 2KI6D 2R2IA 4IL1A 3DVJA 1CFFA 5CSIA 1JFKA 4D1EA 3EVRA 5AXIA 2HETA 2K2AA 5JOLA 1R6PA 1CDPA 1ZMZA 1DT7B 2LC5A 4GPLB 4N1FA 3BUWB 1WLMA 2KI4B 2GGMA 4GUKA 1K94A 2Y1MA 4HREE 3SIBA 3JTDB 4PE7A 2KSPA 1ALVA 1XFXO 5KTYA 2M3WA 1KK8C 1NCZA 5PALA 5KSZA 1DMOA 2MLEC 1M63B 1KK7Z 2E30A 1UUSA 2M29A 1YR5A 2Y1NA 3PN7B 1F54A 1XFYO 1N65A 3GK1A 2K61A 4USLA 1S6CA 1PSBA 1LA3A 2AUCA 3WHTB 1Y6WA 2MJWB 2KFHA 5ER5A 1KQVA 4DIRA 1SMGA 1J7PA 1TN4A 1QTXA 5CSFA 4YI9A 4A4CA 2NXQA 1TCFA 2LUCA 4ORBB 1ALWA 1AHRA 1CMFA 2KAXA 1B7TY 1K93D 4PE0A 1CLBA 5KU1A 1OMRA 2JNXA 1CTRA 5B8IB 3I5FC 1WRKA 1F71A 3VRQA 2KI6C 5I2OA 1LVCD 1N2DA 2LLSA 1YUSA 1XA5A 1XFUO 1JFJA 2JTTA 1A29A 1VRKA 1OE9B 1WDCC 2QPTA 1F55A 2WCFA 1A4PA 2CT9A 2M7NA 3WNXB 1PSRA 1UHIA 3EKJA 3SG5A 2KAYA 4I5KA 2K7CA 4YGAA 1SL8A 5AFPA 1OSAA 2WOSA 3GOFA 3NSOA 1SCVA 3VRNA 4M2OA 1DJYA 1TNWA 4JQ0D 1C07A 2JXLA 1TRFA 1J7RA 1NPQA 1PVBA 2OTGC 1CDLA 4C0LA 2L2EA 2K2FA 2PALA 3RLZA 1OQPA 2A4JA 1WRZA 2M1UA 1A75B 4WQ3A 2F8PA 1EG3A 1WLZA 1CDMA 3E3RA 3PFVA 3CR2A 3TS5C 1Q80A 3K21A 4QJ4B 1OMVA 1EG4A 2JQ6A 1K95A 3I5GC 2CNPA 2ZFDA 3NSKA 4MN0A 4N5XA 4F0ZB 3EVUA 1XVJA 1NSHA 1DJIA 2JZIA 5TNCA 1B8LA 2MHHA 2BCXA 3FIAA 1AJ4A 2OPOA 1FBVA 1RJVA 2BBNA 4TNCA 1LKJA 1QVIZ 2LVJA 1NUBA 1F4OA 1J7OA 3OB1B 2NCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K2H A;  3OX6 A;  5F6T A;  3OB2 B;  2LV7 A;  1QLS A;  1GJY A;  1XK4 A;  2MRD A;  3BUM B;  4GBA A;  4PHM A;  3A4U B;  1J1D A;  1XK4 C;  3PAL A;  1DJX A;  1QJT A;  3DF0 A;  3O2P A;  3VRR A;  1NX0 A;  2DOQ A;  3LK1 A;  1QX5 B;  2KGR A;  2L4I A;  1U5I A;  5HLV A;  2F2O A;  1KFX S;  1M31 A;  1UHJ A;  2LP3 A;  1M39 A;  4ORC B;  1TNX A;  2KI4 C;  5BPJ A;  4MSP A;  1TNQ A;  2LP2 A;  5DKN A;  4PE4 A;  1BMO A;  2M0R A;  3I5H B;  3IQO A;  1K96 A;  3SG3 A;  1CKK A;  1J55 A;  1NCX A;  2JC2 A;  1J1E A;  1QX2 A;  2JOJ A;  2K7B A;  3BOW A;  3CTN A;  4PCW A;  3WHU B;  1PAL A;  2F3Z A;  2OS8 B;  1SR6 B;  2EHB A;  3CS1 A;  3FS7 A;  3LL8 B;  3PN7 C;  1FW4 A;  2ZRS A;  4MBE A;  4MLW A;  3TDU A;  4PAL A;  2BKI B;  2L50 A;  1E8A A;  1W7J B;  3TDI A;  1YRU B;  1CFC A;  4MVF A;  1YX8 A;  3ZWH A;  1AUI B;  1YX7 A;  2E6W A;  3TDZ A;  1NCY A;  3PM8 A;  1B1G A;  1YTZ C;  3O6B A;  4QJ5 B;  4M2P A;  4OR9 B;  5ER4 X;  1BOD A;  1REC A;  1OOJ A;  5AER A;  1CDN A;  2KBM A;  1RTP 1;  4ZCV A;  1CFD A;  1XO5 A;  1JC2 A;  4FTG A;  2JT0 A;  1OMD A;  1B7T Z;  2COL B;  3GK4 X;  4GGF A;  3RM1 A;  3TUY B;  3BUX B;  2KAV A;  2MBX A;  2LUX A;  4GGF C;  1HT9 A;  5J3X A;  4Q04 A;  1DTL A;  2IS9 A;  3KO0 A;  1BF5 A;  4XJK A;  3SG4 A;  2JT3 A;  3NSI A;  1QAS A;  2FCE A;  1D1O A;  4N1G A;  1DJH A;  2LM5 A;  2M7L A;  1W7I B;  1HQV A;  2LMT A;  2Q91 A;  2PVB A;  2BL0 B;  2LLU A;  3JVT C;  4WQ2 A;  2KBI A;  3IF7 A;  1QV1 A;  1K9U A;  2LLT A;  3EK7 A;  1Y1U A;  5GQQ C;  1TOP A;  4CFR A;  3EVV A;  2WCE A;  2KYC A;  3F45 A;  1NX2 A;  4ZCU A;  1MXL C;  3O78 A;  3VRP A;  3SIA A;  3D0Y A;  3IQQ A;  3DVK A;  1AK8 A;  5G08 A;  2M9G A;  2G2B A;  1H4B A;  2LE9 B;  4I5N B;  1CNP A;  2BCA A;  1PRW A;  1KSO A;  1JWD A;  3LLE A;  1DF0 B;  2G9B A;  4PHJ A;  1B4C A;  1N0Y A;  1IKU A;  1S6J A;  1MXE A;  1DVI A;  5D7F A;  1NIW A;  4U8D A;  1CM1 A;  1XFW O;  1TTX A;  2P6B B;  5JJG A;  3H4S E;  1KSM A;  2BE4 A;  4NDD A;  1AP4 A;  1SRA A;  3BXK A;  1IQ5 A;  2TN4 A;  4AQI A;  4YGD B;  1L2O B;  4OVN F;  4M2Q A;  3M0W A;  2WCB A;  1IRJ A;  2FCD A;  5CPV A;  1UHK A;  1V1F A;  3AAK A;  2I94 A;  2CCM A;  3CR4 X;  5AEQ A;  3SJS A;  4C0K A;  3MSE B;  2AMI A;  1WDC B;  2L0P A;  4OKH A;  3AAJ A;  1S5G Z;  2L98 A;  1XYD A;  1ZAC A;  4CFQ A;  3VGO A;  3O4Y A;  5HKW A;  4YGE B;  1RWY A;  1B8R A;  2NLN A;  1H8B A;  4I5L B;  2JNF A;  2NZ0 A;  1XFV O;  2OTG B;  4HRH A;  1UP5 A;  3EK4 A;  4DS7 A;  1YRT B;  1KFU S;  2I18 A;  2H61 C;  2WND A;  1SBJ A;  2Y5I A;  1PUL A;  1BU3 A;  4XYN A;  1SYM A;  3HX4 A;  1KFX L;  2OS8 C;  1SR6 C;  1YUR A;  2LCP A;  3A8R A;  1CLL A;  3TS5 B;  5I8N A;  1YVH A;  2H2K A;  2LAP A;  1MHO A;  3OX5 A;  1JBA A;  1LXF C;  1A03 A;  5CSJ A;  4NDC A;  1RFJ A;  1KQM B;  2CBL A;  3JTD C;  2RGI A;  1F70 A;  1S1E A;  3VRO A;  4YBH B;  1NX1 A;  1IG5 A;  2M8U A;  1RRO A;  3C1V A;  3DVM A;  4GGN A;  4AQJ A;  1JF0 A;  1SL7 A;  3BUN B;  2ISD A;  2BKH B;  2I7A A;  2BBM A;  1QVI Y;  1MF8 B;  2L51 A;  2EC6 B;  1YUT A;  1AVS A;  1ZOT B;  4NDB A;  2GGZ A;  1LIN A;  1V1G A;  2VRG A;  1DGV A;  3I5I B;  3EK8 A;  2AAO A;  1EL4 A;  3GK2 A;  1IJ6 A;  2F2P A;  2B1U A;  4GAO A;  1QX7 A;  1QV0 A;  1SCM B;  4MZK A;  2CXJ A;  1IGV A;  4C0J A;  1UUR A;  2K7D A;  3FWB A;  4I5J A;  3KF9 A;  3EKH A;  2ZN9 A;  4OCI A;  2QAC A;  4PDZ A;  2K0J A;  3BQ3 A;  1KWO B;  5CSN A;  1CM4 A;  3DF0 B;  1M45 A;  2BL0 C;  1TIZ A;  2FJU B;  4MZL A;  1BJF A;  2LNK A;  4CID A;  1U5I B;  2JUL A;  4DRW A;  1BG1 A;  4UPG A;  1UWO A;  2ZNE A;  1TCO B;  2KGB C;  2JXC A;  2O60 A;  1BOC A;  2BE6 A;  1IH0 A;  1DGU A;  1NX3 A;  4AOM A;  1L7Z A;  4ICB A;  4MRX A;  2ZN8 A;  2KOT A;  3BOW B;  1DF0 A;  2WOR A;  1EXR A;  1S3P A;  1MWN A;  5IBW A;  5HKY A;  1B8C A;  1MR8 A;  1S6I A;  1Y1X A;  2LMU A;  3DVE A;  3LCP C;  4YGC B;  1RK9 A;  3LK0 A;  1JUO A;  1SY9 A;  1K9K A;  2KYF A;  4PE1 A;  1ZUZ A;  2I2R E;  1SL9 A;  2SCP A;  1QLK A;  1A75 A;  2SAS A;  1KK7 Y;  1KK8 B;  2ZRT A;  1BR1 B;  3D10 A;  1S26 D;  4YGB B;  3ZNI A;  1B47 A;  2HF5 A;  2PAS A;  2HQW A;  3PLF B;  2CTN A;  2HPS A;  1QIV A;  2MA2 A;  4MRY A;  2F3Y A;  4BY5 A;  1K90 D;  1L2O C;  1QS7 A;  2K8M B;  4P5O E;  1DJG A;  1F4Q A;  2ZKM X;  1YVL A;  2Q4U A;  3SG2 A;  3QRX A;  4JPZ B;  2HQ8 A;  2D8N A;  1C7V A;  4BY4 A;  5HKZ A;  1IJ5 A;  1SPY A;  1GGZ A;  2MAZ A;  2NCP A;  1G4Y R;  1LA0 A;  1S36 A;  2EGD A;  4XJK B;  2V53 A;  1OZS A;  3KHE A;  4GNK B;  2KDH A;  4YRU A;  2LVV A;  1R2U A;  5I2L A;  4A4B A;  3DD4 A;  4JWQ A;  5AAN A;  2LAN A;  1EH2 A;  1JSA A;  3JVT B;  4CLN A;  1PVA A;  1FF1 A;  1ZFS A;  2WC8 A;  3OHM B;  2LVI A;  4ORA B;  3SG6 A;  3I5F B;  1NWD A;  1CMG A;  5I2Q A;  2M49 B;  3TZ1 A;  1CFP A;  3CLN A;  2ZND A;  3NSL A;  3PSR A;  2KFF A;  2M97 A;  2FOT A;  2O5G A;  3SG7 A;  4OV2 A;  1K9P A;  4DCK A;  4ETO A;  3D0Y B;  2LMV A;  4PHN A;  1A2X A;  4QJ3 B;  1BT6 A;  3KPX A;  4WRI A;  5K89 A;  4YI8 A;  4DUQ A;  3CGA A;  2K7O A;  1K8U A;  2PMY A;  3BYA A;  1QAT A;  1BR4 B;  3HCM A;  1DJW A;  1TNP A;  1DJZ A;  2KNE A;  1SK6 D;  2Y4Q A;  1KFU L;  4FQO A;  2LVK A;  2JWW A;  4GFT A;  5FYX A;  2H61 A;  2PRU A;  3AKB A;  1UHN A;  1PK0 D;  2LHI A;  1SKT A;  1WRL A;  4NQG A;  4P2Y B;  1FPW A;  1KQM C;  4HSZ A;  3I5H C;  4CPV A;  4HRG A;  1KCY A;  1AJ5 A;  1QIW A;  1SW8 A;  1YUU A;  3NXA A;  1IWQ A;  1NYA A;  1SNL A;  5HLO A;  1J7Q A;  2KHN A;  3AKA A;  1MUX A;  3KEV A;  2JTZ A;  2EC6 C;  2F33 A;  2LHL A;  3WXA A;  3I5I C;  3I5G B;  2M1K B;  1FI6 A;  1Y0V H;  1X02 A;  3OP0 A;  1G33 A;  1G8I A;  1JF2 A;  1ODB A;  1CLM A;  1QXP A;  2BCB A;  4R1E A;  2JPT A;  1GGW A;  1B9A A;  1SCM C;  1Y1A A;  2BEC A;  1OZO A;  1BLQ A;  4MEW A;  1S5G Y;  1MQ1 A;  1EJ3 A;  4L9M A;  5D69 A;  1F8H A;  5HYD A;  2GV5 A;  2KFG A;  1NP8 A;  1C7W A;  5DKR A;  2L5X B;  1KWO C;  1CB1 A;  3CWG A;  3CR5 X;  4MZJ A;  1XFZ O;  3TUY C;  2KQ6 A;  2KQY A;  4E68 A;  2JU0 A;  1GQM A;  4PHK A;  1FI5 A;  2L4H A;  3ICB A;  2JRF A;  2JT8 A;  2PSR A;  1WY9 A;  3BUO B;  1UHH A;  5DKQ A;  3PAT A;  3CZT X;  1IQ3 A;  2MLF C;  3FWC A;  1M46 A;  2KI6 D;  2R2I A;  4IL1 A;  3DVJ A;  1CFF A;  5CSI A;  1JFK A;  4D1E A;  3EVR A;  5AXI A;  2HET A;  2K2A A;  5JOL A;  1R6P A;  1CDP A;  1ZMZ A;  1DT7 B;  2LC5 A;  4GPL B;  4N1F A;  3BUW B;  1WLM A;  2KI4 B;  2GGM A;  4GUK A;  1K94 A;  2Y1M A;  4HRE E;  3SIB A;  3JTD B;  4PE7 A;  2KSP A;  1ALV A;  1XFX O;  5KTY A;  2M3W A;  1KK8 C;  1NCZ A;  5PAL A;  5KSZ A;  1DMO A;  2MLE C;  1M63 B;  1KK7 Z;  2E30 A;  1UUS A;  2M29 A;  1YR5 A;  2Y1N A;  3PN7 B;  1F54 A;  1XFY O;  1N65 A;  3GK1 A;  2K61 A;  4USL A;  1S6C A;  1PSB A;  1LA3 A;  2AUC A;  3WHT B;  1Y6W A;  2MJW B;  2KFH A;  5ER5 A;  1KQV A;  4DIR A;  1SMG A;  1J7P A;  1TN4 A;  1QTX A;  5CSF A;  4YI9 A;  4A4C A;  2NXQ A;  1TCF A;  2LUC A;  4ORB B;  1ALW A;  1AHR A;  1CMF A;  2KAX A;  1B7T Y;  1K93 D;  4PE0 A;  1CLB A;  5KU1 A;  1OMR A;  2JNX A;  1CTR A;  5B8I B;  3I5F C;  1WRK A;  1F71 A;  3VRQ A;  2KI6 C;  5I2O A;  1LVC D;  1N2D A;  2LLS A;  1YUS A;  1XA5 A;  1XFU O;  1JFJ A;  2JTT A;  1A29 A;  1VRK A;  1OE9 B;  1WDC C;  2QPT A;  1F55 A;  2WCF A;  1A4P A;  2CT9 A;  2M7N A;  3WNX B;  1PSR A;  1UHI A;  3EKJ A;  3SG5 A;  2KAY A;  4I5K A;  2K7C A;  4YGA A;  1SL8 A;  5AFP A;  1OSA A;  2WOS A;  3GOF A;  3NSO A;  1SCV A;  3VRN A;  4M2O A;  1DJY A;  1TNW A;  4JQ0 D;  1C07 A;  2JXL A;  1TRF A;  1J7R A;  1NPQ A;  1PVB A;  2OTG C;  1CDL A;  4C0L A;  2L2E A;  2K2F A;  2PAL A;  3RLZ A;  1OQP A;  2A4J A;  1WRZ A;  2M1U A;  1A75 B;  4WQ3 A;  2F8P A;  1EG3 A;  1WLZ A;  1CDM A;  3E3R A;  3PFV A;  3CR2 A;  3TS5 C;  1Q80 A;  3K21 A;  4QJ4 B;  1OMV A;  1EG4 A;  2JQ6 A;  1K95 A;  3I5G C;  2CNP A;  2ZFD A;  3NSK A;  4MN0 A;  4N5X A;  4F0Z B;  3EVU A;  1XVJ A;  1NSH A;  1DJI A;  2JZI A;  5TNC A;  1B8L A;  2MHH A;  2BCX A;  3FIA A;  1AJ4 A;  2OPO A;  1FBV A;  1RJV A;  2BBN A;  4TNC A;  1LKJ A;  1QVI Z;  2LVJ A;  1NUB A;  1F4O A;  1J7O A;  3OB1 B;  2NCO A; 
#chains in the Genus database with same CATH topology
 1K2H A;  3OX6 A;  4IJ7 A;  2BAP A;  3N7H A;  3PM2 A;  3OB2 B;  5F6T A;  2LV7 A;  1QLS A;  1GJY A;  2FJY A;  1XK4 A;  2MRD A;  3BUM B;  4GBA A;  4PHM A;  3A4U B;  1J1D A;  1P28 A;  1XK4 C;  2WC5 A;  3PAL A;  1DJX A;  1QJT A;  3DF0 A;  3O2P A;  3R1V A;  3VRR A;  1NX0 A;  2DOQ A;  3LK1 A;  1QX5 B;  2KGR A;  2L4I A;  1U5I A;  5HLV A;  2F2O A;  1KFX S;  1M31 A;  1UHJ A;  2LP3 A;  1M39 A;  4ORC B;  1TNX A;  2KI4 C;  5BPJ A;  4MSP A;  1TNQ A;  2LP2 A;  5DKN A;  4PE4 A;  1BMO A;  2M0R A;  3I5H B;  3IQO A;  1K96 A;  3SG3 A;  1CKK A;  1T14 A;  1J55 A;  1NCX A;  2JC2 A;  1J1E A;  1QX2 A;  2JOJ A;  2K7B A;  3BOW A;  3CTN A;  3D75 A;  4PCW A;  3WHU B;  4F7F A;  1PAL A;  2QEO A;  2F3Z A;  2OS8 B;  1SR6 B;  3CYZ A;  2EHB A;  2WC6 A;  3CS1 A;  3FS7 A;  1DEL A;  3LL8 B;  3PN7 C;  1FW4 A;  2ZRS A;  4MBE A;  4MLW A;  3TDU A;  4PAL A;  2BKI B;  2L50 A;  1E8A A;  1W7J B;  3TDI A;  1YRU B;  1CFC A;  3UO9 A;  4MVF A;  1YX8 A;  3ZWH A;  1AUI B;  1YX7 A;  2E6W A;  3TDZ A;  1NCY A;  3PM8 A;  3SS4 A;  1B1G A;  1YTZ C;  3O6B A;  4QJ5 B;  4M2P A;  1GM0 A;  4OR9 B;  5ER4 X;  1BOD A;  1REC A;  2WCL A;  1OOJ A;  5AER A;  1CDN A;  2KBM A;  1RTP 1;  4ZCV A;  1CFD A;  1XO5 A;  1OOH A;  1JC2 A;  4FTG A;  2JT0 A;  1OMD A;  1B7T Z;  2COL B;  3GK4 X;  4GGF A;  3RM1 A;  3TUY B;  3BUX B;  2KAV A;  2MBX A;  2LUX A;  4GGF C;  1HT9 A;  5J3X A;  4Q04 A;  1DTL A;  2IS9 A;  3KO0 A;  1BF5 A;  4XJK A;  3SG4 A;  2JT3 A;  3S0A A;  3NSI A;  1QAS A;  1OW4 A;  2FCE A;  1D1O A;  4N1G A;  1DJH A;  2LM5 A;  2M7L A;  1W7I B;  2K60 A;  3S0D A;  1OOI X;  1HQV A;  2LMT A;  2Q91 A;  3CZ0 A;  2PVB A;  2BL0 B;  2LLU A;  3JVT C;  4WQ2 A;  2KBI A;  3IF7 A;  3RZS A;  3SS3 A;  1QV1 A;  1K9U A;  2LLT A;  3EK7 A;  1Y1U A;  5GQQ C;  1TOP A;  4CFR A;  3EVV A;  2L5Y A;  2KYC A;  2WCE A;  3F45 A;  1NX2 A;  4ZCU A;  1MXL C;  3O78 A;  4JD9 A;  3VRP A;  3SIA A;  3D0Y A;  3IQQ A;  3DVK A;  5FI6 A;  5D3O A;  1AK8 A;  5G08 A;  2M9G A;  3PJI A;  2G2B A;  1H4B A;  2LE9 B;  4I5N B;  1CNP A;  2BCA A;  1PRW A;  1KSO A;  1JWD A;  3LLE A;  1DF0 B;  2G9B A;  4PHJ A;  3DZT A;  1B4C A;  1N0Y A;  1TUZ A;  1IKU A;  1S6J A;  1MXE A;  3DYE A;  1DVI A;  5D7F A;  1NIW A;  4U8D A;  1CM1 A;  1XFW O;  1TTX A;  2P6B B;  5JJG A;  3H4S E;  3OBV A;  3B7A A;  1KSM A;  2BE4 A;  2ERB A;  4NDD A;  1AP4 A;  1SRA A;  3BXK A;  1IQ5 A;  2TN4 A;  4AQI A;  4YGD B;  1L2O B;  2WCM A;  4OVN F;  4M2Q A;  3M0W A;  2WCB A;  2WCK A;  1IRJ A;  2FCD A;  5CPV A;  1UHK A;  3D74 A;  3V2L A;  3VB1 A;  1V1F A;  3AAK A;  2I94 A;  2CCM A;  3CR4 X;  5AEQ A;  3SJS A;  4C0K A;  2H8V A;  3MSE B;  2AMI A;  1WDC B;  2L0P A;  4OKH A;  3AAJ A;  1S5G Z;  2L98 A;  1XYD A;  1ZAC A;  4CFQ A;  3VGO A;  3O4Y A;  3D78 A;  5HKW A;  4YGE B;  1RWY A;  1B8R A;  2NLN A;  1H8B A;  4I5L B;  2JNF A;  2NZ0 A;  1XFV O;  2OTG B;  2QDI A;  4HRH A;  1UP5 A;  3EK4 A;  4DS7 A;  1YRT B;  1KFU S;  2I18 A;  2H61 C;  2WND A;  1SBJ A;  2Y5I A;  1PUL A;  1BU3 A;  4XYN A;  2GTE A;  1SYM A;  3HX4 A;  2L2C A;  1IIO A;  1KFX L;  2OS8 C;  1SR6 C;  1YUR A;  2LCP A;  3A8R A;  1CLL A;  3TS5 B;  5I8N A;  1YVH A;  2H2K A;  2LAP A;  1MHO A;  3OX5 A;  1Z4H A;  1JBA A;  1LXF C;  1A03 A;  5CSJ A;  4NDC A;  1RFJ A;  1KQM B;  2CBL A;  3JTD C;  2RGI A;  1F70 A;  1S1E A;  3VRO A;  4YBH B;  1NX1 A;  1IG5 A;  2M8U A;  1RRO A;  3C1V A;  3DVM A;  4GGN A;  4AQJ A;  3S0F A;  1JF0 A;  1SL7 A;  3BUN B;  2ISD A;  2BKH B;  2I7A A;  2BBM A;  5DIC A;  1QVI Y;  1MF8 B;  4FQT A;  2L51 A;  2EC6 B;  1YUT A;  1AVS A;  1ZOT B;  4NDB A;  2GGZ A;  1LIN A;  1V1G A;  2VRG A;  1DGV A;  3I5I B;  3EK8 A;  1DQE A;  2AAO A;  1EL4 A;  3GK2 A;  1IJ6 A;  2F2P A;  2B1U A;  4GAO A;  1QX7 A;  1QV0 A;  1SCM B;  4MZK A;  2CXJ A;  1IGV A;  4C0J A;  1UUR A;  2K7D A;  3FWB A;  4I5J A;  3KF9 A;  3EKH A;  3B86 A;  3K1E A;  2ZN9 A;  4OCI A;  2KLE A;  2QAC A;  4KYN A;  4PDZ A;  2K0J A;  3BQ3 A;  1KWO B;  5CSN A;  1CM4 A;  3DF0 B;  1M45 A;  2BL0 C;  1TIZ A;  2FJU B;  4MZL A;  1BJF A;  2LNK A;  2BNX A;  4CID A;  5I94 A;  5EL2 A;  1U5I B;  2JUL A;  3R1P A;  4DRW A;  1BG1 A;  2WCH A;  4UPG A;  1W9Z A;  1UWO A;  2ZNE A;  1TCO B;  2KGB C;  2JXC A;  2O60 A;  1BOC A;  2BE6 A;  1IH0 A;  1DGU A;  1NX3 A;  4AOM A;  1L7Z A;  4ICB A;  4MRX A;  2ZN8 A;  2KOT A;  3BOW B;  1DF0 A;  2WOR A;  1EXR A;  1S3P A;  1MWN A;  5IBW A;  5HKY A;  1B8C A;  1MR8 A;  1S6I A;  1Y1X A;  2LMU A;  3DVE A;  3LCP C;  4YGC B;  1RK9 A;  1DEK A;  3LK0 A;  1JUO A;  1SY9 A;  3BFB A;  1K9K A;  2KYF A;  4PE1 A;  1ZUZ A;  2I2R E;  3QME A;  1SL9 A;  2SCP A;  1QLK A;  1A75 A;  2SAS A;  1KK7 Y;  1KK8 B;  2ZRT A;  1BR1 B;  3D10 A;  1S26 D;  4YGB B;  3ZNI A;  1B47 A;  2HF5 A;  3B87 A;  2PAS A;  2HQW A;  3PLF B;  2CTN A;  2HPS A;  1QIV A;  2MA2 A;  4MRY A;  2F3Y A;  4BY5 A;  1K90 D;  1L2O C;  1QS7 A;  2K8M B;  4P5O E;  1DJG A;  1F4Q A;  2ZKM X;  1YVL A;  2Q4U A;  3SG2 A;  3QRX A;  4JPZ B;  2HQ8 A;  2D8N A;  1C7V A;  2P71 A;  4BY4 A;  5HKZ A;  1IJ5 A;  1SPY A;  1GGZ A;  2MAZ A;  2NCP A;  1G4Y R;  1LA0 A;  1S36 A;  2P70 A;  2WCJ A;  2EGD A;  4INW A;  4XJK B;  2V53 A;  1OZS A;  3KHE A;  4GNK B;  2KDH A;  4YRU A;  2LVV A;  1R2U A;  5I2L A;  1LS8 A;  4A4B A;  3DD4 A;  4JWQ A;  5AAN A;  2LAN A;  1EH2 A;  1JSA A;  3JVT B;  4CLN A;  1PVA A;  1FF1 A;  1ZFS A;  2WC8 A;  3OHM B;  2LVI A;  3NGV A;  4ORA B;  4PT1 A;  3SG6 A;  3L4A A;  3I5F B;  1NWD A;  1CMG A;  5I2Q A;  2M49 B;  3TZ1 A;  1CFP A;  3CLN A;  2ZND A;  3NSL A;  3PSR A;  2KFF A;  3SS5 A;  3DXL A;  2M97 A;  2FOT A;  2O5G A;  3SG7 A;  4OV2 A;  1K9P A;  4DCK A;  4ETO A;  3D0Y B;  2LMV A;  4PHN A;  1A2X A;  4QJ3 B;  1BT6 A;  2JPO A;  3CZ1 A;  3KPX A;  4WRI A;  5K89 A;  4YI8 A;  4DUQ A;  3CGA A;  2K7O A;  1K8U A;  2PMY A;  3BYA A;  1QAT A;  1BR4 B;  3HCM A;  1DJW A;  1TNP A;  1DJZ A;  2KNE A;  1SK6 D;  2Y4Q A;  1KFU L;  4FQO A;  2LVK A;  2JWW A;  4GFT A;  5FYX A;  2H61 A;  2PRU A;  3AKB A;  1UHN A;  1PK0 D;  2LHI A;  1SKT A;  1WRL A;  4NQG A;  4P2Y B;  1FPW A;  1KQM C;  4HSZ A;  3I5H C;  4CPV A;  4HRG A;  1KCY A;  1AJ5 A;  1QIW A;  1SW8 A;  1YUU A;  3NXA A;  1IWQ A;  1NYA A;  1SNL A;  5HLO A;  1J7Q A;  2KHN A;  3AKA A;  1MUX A;  3KEV A;  3S0B A;  2JTZ A;  2EC6 C;  2F33 A;  2PQL A;  3DY9 A;  2LHL A;  3WXA A;  3I5I C;  3I5G B;  2M1K B;  3D76 A;  3FE9 A;  1Y0V H;  3NHT A;  1X02 A;  3OP0 A;  1G33 A;  1G8I A;  1FI6 A;  1SSE B;  1JF2 A;  1ODB A;  1CLM A;  1QXP A;  2BCB A;  4R1E A;  2JPT A;  1GGW A;  1B9A A;  1SCM C;  1Y1A A;  2BEC A;  1OZO A;  2QEB A;  1BLQ A;  3NHI A;  4MEW A;  1S5G Y;  1MQ1 A;  1EJ3 A;  4L9M A;  5D69 A;  1F8H A;  5HYD A;  2GV5 A;  2KFG A;  1NP8 A;  1C7W A;  5DKR A;  2L5X B;  1KWO C;  1CB1 A;  3CWG A;  3CR5 X;  4MZJ A;  2PYQ A;  3UNW A;  1XFZ O;  3TUY C;  2KQ6 A;  2KQY A;  4E68 A;  2JU0 A;  1GQM A;  4PHK A;  1FI5 A;  2L4H A;  3ICB A;  2JRF A;  2JT8 A;  2PSR A;  1WY9 A;  3BUO B;  5FI7 A;  4OZD A;  1UHH A;  5DKQ A;  3PAT A;  3CZT X;  1IQ3 A;  2MLF C;  3FWC A;  1M46 A;  2KI6 D;  2R2I A;  4IL1 A;  3DVJ A;  1CFF A;  5CSI A;  1JFK A;  4D1E A;  3EVR A;  5AXI A;  2HET A;  2K2A A;  1OOG A;  2QEH A;  5JOL A;  1R6P A;  2KPH A;  1CDP A;  1ZMZ A;  1DT7 B;  2LC5 A;  4GPL B;  4N1F A;  3BUW B;  1WLM A;  2KI4 B;  5HL1 A;  2GGM A;  3L4L A;  4GUK A;  1K94 A;  2Y1M A;  4HRE E;  3SIB A;  3JTD B;  4PE7 A;  2KSP A;  1ALV A;  1XFX O;  3IVT A;  5KTY A;  2M3W A;  1KK8 C;  1NCZ A;  5PAL A;  1ORG A;  5KSZ A;  1DMO A;  2MLE C;  1M63 B;  1KK7 Z;  2E30 A;  1UUS A;  2M29 A;  3L47 A;  3O4X A;  1YR5 A;  2Y1N A;  3PN7 B;  3D77 A;  1XFY O;  1F54 A;  1N65 A;  3GK1 A;  2K61 A;  4USL A;  1S6C A;  1PSB A;  1LA3 A;  1XFR A;  2AUC A;  3WHT B;  1Y6W A;  2MJW B;  2KFH A;  3EG5 B;  5ER5 A;  3BFH A;  3CAB A;  4DIR A;  1KQV A;  1SMG A;  1J7P A;  1TN4 A;  1QTX A;  4JKT A;  2QEV A;  5CSF A;  4INX A;  4YI9 A;  1Z2C B;  4A4C A;  2NXQ A;  1TCF A;  2LUC A;  2KLD A;  4ORB B;  1ALW A;  1AHR A;  1CMF A;  2KAX A;  1B7T Y;  1K93 D;  4PE0 A;  1CLB A;  5KU1 A;  1C3Z A;  1OMR A;  1OOF A;  2JNX A;  1CTR A;  1QWV A;  5B8I B;  3B6X A;  3I5F C;  1WRK A;  1F71 A;  3VRQ A;  2KI6 C;  5I2O A;  1LVC D;  3CZ2 A;  5FI2 A;  1N2D A;  2LLS A;  1YUS A;  1XA5 A;  1XFU O;  1JFJ A;  2JTT A;  1A29 A;  1VRK A;  1OE9 B;  1WDC C;  2QPT A;  1F55 A;  2WCF A;  1A4P A;  2CT9 A;  2M7N A;  3WNX B;  1PSR A;  1UHI A;  3EKJ A;  3SG5 A;  2KAY A;  1C3Y A;  4I5K A;  3S0E A;  2K7C A;  4YGA A;  1SL8 A;  5AFP A;  1OSA A;  2WOS A;  3GOF A;  3NSO A;  1SCV A;  3VRN A;  4M2O A;  1DJY A;  1TNW A;  4JQ0 D;  1C07 A;  2JXL A;  1TRF A;  1J7R A;  1NPQ A;  1PVB A;  2OTG C;  3FE6 A;  1CDL A;  3R72 A;  4C0L A;  2L2E A;  2K2F A;  1TWO A;  2PAL A;  3RLZ A;  1OQP A;  2A4J A;  3FE8 A;  1WRZ A;  2M1U A;  1A75 B;  2YGU A;  3BJH A;  4WQ3 A;  2F8P A;  1EG3 A;  1WLZ A;  1CDM A;  3D73 A;  3E3R A;  3PFV A;  3CR2 A;  3B88 A;  3TS5 C;  1Q80 A;  3K21 A;  3S0G A;  4QJ4 B;  1OMV A;  1EG4 A;  3OGN A;  2JQ6 A;  1K95 A;  3I5G C;  2CNP A;  2ZFD A;  3NSK A;  4MN0 A;  4N5X A;  4F0Z B;  3EVU A;  3CDN A;  1XVJ A;  1NSH A;  1DJI A;  2JZI A;  5TNC A;  1B8L A;  2MHH A;  1TUJ A;  2BCX A;  3FIA A;  1AJ4 A;  2OPO A;  1FBV A;  1RJV A;  2BBN A;  4TNC A;  1LKJ A;  1QVI Z;  2LVJ A;  1NUB A;  1F4O A;  1J7O A;  3OB1 B;  3R1O A;  2NCO A;  3BFA A;  3Q8I A;  1DC1 A; 
#chains in the Genus database with same CATH homology
 1K2H A;  3OX6 A;  5F6T A;  3OB2 B;  2LV7 A;  1QLS A;  1GJY A;  1XK4 A;  2MRD A;  3BUM B;  4GBA A;  4PHM A;  3A4U B;  1J1D A;  1XK4 C;  3PAL A;  1DJX A;  1QJT A;  3DF0 A;  3O2P A;  3VRR A;  1NX0 A;  2DOQ A;  3LK1 A;  1QX5 B;  2KGR A;  2L4I A;  1U5I A;  5HLV A;  2F2O A;  1KFX S;  1M31 A;  1UHJ A;  2LP3 A;  1M39 A;  4ORC B;  1TNX A;  2KI4 C;  5BPJ A;  4MSP A;  1TNQ A;  2LP2 A;  5DKN A;  4PE4 A;  1BMO A;  2M0R A;  3I5H B;  3IQO A;  1K96 A;  3SG3 A;  1CKK A;  1J55 A;  1NCX A;  2JC2 A;  1J1E A;  1QX2 A;  2JOJ A;  2K7B A;  3BOW A;  3CTN A;  4PCW A;  3WHU B;  1PAL A;  2F3Z A;  2OS8 B;  1SR6 B;  2EHB A;  3CS1 A;  3FS7 A;  3LL8 B;  3PN7 C;  1FW4 A;  2ZRS A;  4MBE A;  4MLW A;  3TDU A;  4PAL A;  2BKI B;  2L50 A;  1E8A A;  1W7J B;  3TDI A;  1YRU B;  1CFC A;  4MVF A;  1YX8 A;  3ZWH A;  1AUI B;  1YX7 A;  2E6W A;  3TDZ A;  1NCY A;  3PM8 A;  1B1G A;  1YTZ C;  3O6B A;  4QJ5 B;  4M2P A;  4OR9 B;  5ER4 X;  1BOD A;  1REC A;  1OOJ A;  5AER A;  1CDN A;  2KBM A;  1RTP 1;  4ZCV A;  1CFD A;  1XO5 A;  1JC2 A;  4FTG A;  2JT0 A;  1OMD A;  1B7T Z;  2COL B;  3GK4 X;  4GGF A;  3RM1 A;  3TUY B;  3BUX B;  2KAV A;  2MBX A;  2LUX A;  4GGF C;  1HT9 A;  5J3X A;  4Q04 A;  1DTL A;  2IS9 A;  3KO0 A;  1BF5 A;  4XJK A;  3SG4 A;  2JT3 A;  3NSI A;  1QAS A;  2FCE A;  1D1O A;  4N1G A;  1DJH A;  2LM5 A;  2M7L A;  1W7I B;  1HQV A;  2LMT A;  2Q91 A;  2PVB A;  2BL0 B;  2LLU A;  3JVT C;  4WQ2 A;  2KBI A;  3IF7 A;  1QV1 A;  1K9U A;  2LLT A;  3EK7 A;  1Y1U A;  5GQQ C;  1TOP A;  4CFR A;  3EVV A;  2WCE A;  2KYC A;  3F45 A;  1NX2 A;  4ZCU A;  1MXL C;  3O78 A;  3VRP A;  3SIA A;  3D0Y A;  3IQQ A;  3DVK A;  1AK8 A;  5G08 A;  2M9G A;  2G2B A;  1H4B A;  2LE9 B;  4I5N B;  1CNP A;  2BCA A;  1PRW A;  1KSO A;  1JWD A;  3LLE A;  1DF0 B;  2G9B A;  4PHJ A;  1B4C A;  1N0Y A;  1IKU A;  1S6J A;  1MXE A;  1DVI A;  5D7F A;  1NIW A;  4U8D A;  1CM1 A;  1XFW O;  1TTX A;  2P6B B;  5JJG A;  3H4S E;  1KSM A;  2BE4 A;  4NDD A;  1AP4 A;  1SRA A;  3BXK A;  1IQ5 A;  2TN4 A;  4AQI A;  4YGD B;  1L2O B;  4OVN F;  4M2Q A;  3M0W A;  2WCB A;  1IRJ A;  2FCD A;  5CPV A;  1UHK A;  1V1F A;  3AAK A;  2I94 A;  2CCM A;  3CR4 X;  5AEQ A;  3SJS A;  4C0K A;  3MSE B;  2AMI A;  1WDC B;  2L0P A;  4OKH A;  3AAJ A;  1S5G Z;  2L98 A;  1XYD A;  1ZAC A;  4CFQ A;  3VGO A;  3O4Y A;  5HKW A;  4YGE B;  1RWY A;  1B8R A;  2NLN A;  1H8B A;  4I5L B;  2JNF A;  2NZ0 A;  1XFV O;  2OTG B;  4HRH A;  1UP5 A;  3EK4 A;  4DS7 A;  1YRT B;  1KFU S;  2I18 A;  2H61 C;  2WND A;  1SBJ A;  2Y5I A;  1PUL A;  1BU3 A;  4XYN A;  1SYM A;  3HX4 A;  1KFX L;  2OS8 C;  1SR6 C;  1YUR A;  2LCP A;  3A8R A;  1CLL A;  3TS5 B;  5I8N A;  1YVH A;  2H2K A;  2LAP A;  1MHO A;  3OX5 A;  1JBA A;  1LXF C;  1A03 A;  5CSJ A;  4NDC A;  1RFJ A;  1KQM B;  2CBL A;  3JTD C;  2RGI A;  1F70 A;  1S1E A;  3VRO A;  4YBH B;  1NX1 A;  1IG5 A;  2M8U A;  1RRO A;  3C1V A;  3DVM A;  4GGN A;  4AQJ A;  1JF0 A;  1SL7 A;  3BUN B;  2ISD A;  2BKH B;  2I7A A;  2BBM A;  1QVI Y;  1MF8 B;  2L51 A;  2EC6 B;  1YUT A;  1AVS A;  1ZOT B;  4NDB A;  2GGZ A;  1LIN A;  1V1G A;  2VRG A;  1DGV A;  3I5I B;  3EK8 A;  2AAO A;  1EL4 A;  3GK2 A;  1IJ6 A;  2F2P A;  2B1U A;  4GAO A;  1QX7 A;  1QV0 A;  1SCM B;  4MZK A;  2CXJ A;  1IGV A;  4C0J A;  1UUR A;  2K7D A;  3FWB A;  4I5J A;  3KF9 A;  3EKH A;  2ZN9 A;  4OCI A;  2QAC A;  4PDZ A;  2K0J A;  3BQ3 A;  1KWO B;  5CSN A;  1CM4 A;  3DF0 B;  1M45 A;  2BL0 C;  1TIZ A;  2FJU B;  4MZL A;  1BJF A;  2LNK A;  4CID A;  1U5I B;  2JUL A;  4DRW A;  1BG1 A;  4UPG A;  1UWO A;  2ZNE A;  1TCO B;  2KGB C;  2JXC A;  2O60 A;  1BOC A;  2BE6 A;  1IH0 A;  1DGU A;  1NX3 A;  4AOM A;  1L7Z A;  4ICB A;  4MRX A;  2ZN8 A;  2KOT A;  3BOW B;  1DF0 A;  2WOR A;  1EXR A;  1S3P A;  1MWN A;  5IBW A;  5HKY A;  1B8C A;  1MR8 A;  1S6I A;  1Y1X A;  2LMU A;  3DVE A;  3LCP C;  4YGC B;  1RK9 A;  3LK0 A;  1JUO A;  1SY9 A;  1K9K A;  2KYF A;  4PE1 A;  1ZUZ A;  2I2R E;  1SL9 A;  2SCP A;  1QLK A;  1A75 A;  2SAS A;  1KK7 Y;  1KK8 B;  2ZRT A;  1BR1 B;  3D10 A;  1S26 D;  4YGB B;  3ZNI A;  1B47 A;  2HF5 A;  2PAS A;  2HQW A;  3PLF B;  2CTN A;  2HPS A;  1QIV A;  2MA2 A;  4MRY A;  2F3Y A;  4BY5 A;  1K90 D;  1L2O C;  1QS7 A;  2K8M B;  4P5O E;  1DJG A;  1F4Q A;  2ZKM X;  1YVL A;  2Q4U A;  3SG2 A;  3QRX A;  4JPZ B;  2HQ8 A;  2D8N A;  1C7V A;  4BY4 A;  5HKZ A;  1IJ5 A;  1SPY A;  1GGZ A;  2MAZ A;  2NCP A;  1G4Y R;  1LA0 A;  1S36 A;  2EGD A;  4XJK B;  2V53 A;  1OZS A;  3KHE A;  4GNK B;  2KDH A;  4YRU A;  2LVV A;  1R2U A;  5I2L A;  4A4B A;  3DD4 A;  4JWQ A;  5AAN A;  2LAN A;  1EH2 A;  1JSA A;  3JVT B;  4CLN A;  1PVA A;  1FF1 A;  1ZFS A;  2WC8 A;  3OHM B;  2LVI A;  4ORA B;  3SG6 A;  3I5F B;  1NWD A;  1CMG A;  5I2Q A;  2M49 B;  3TZ1 A;  1CFP A;  3CLN A;  2ZND A;  3NSL A;  3PSR A;  2KFF A;  2M97 A;  2FOT A;  2O5G A;  3SG7 A;  4OV2 A;  1K9P A;  4DCK A;  4ETO A;  3D0Y B;  2LMV A;  4PHN A;  1A2X A;  4QJ3 B;  1BT6 A;  3KPX A;  4WRI A;  5K89 A;  4YI8 A;  4DUQ A;  3CGA A;  2K7O A;  1K8U A;  2PMY A;  3BYA A;  1QAT A;  1BR4 B;  3HCM A;  1DJW A;  1TNP A;  1DJZ A;  2KNE A;  1SK6 D;  2Y4Q A;  1KFU L;  4FQO A;  2LVK A;  2JWW A;  4GFT A;  5FYX A;  2H61 A;  2PRU A;  3AKB A;  1UHN A;  1PK0 D;  2LHI A;  1SKT A;  1WRL A;  4NQG A;  4P2Y B;  1FPW A;  1KQM C;  4HSZ A;  3I5H C;  4CPV A;  4HRG A;  1KCY A;  1AJ5 A;  1QIW A;  1SW8 A;  1YUU A;  3NXA A;  1IWQ A;  1NYA A;  1SNL A;  5HLO A;  1J7Q A;  2KHN A;  3AKA A;  1MUX A;  3KEV A;  2JTZ A;  2EC6 C;  2F33 A;  2LHL A;  3WXA A;  3I5I C;  3I5G B;  2M1K B;  1FI6 A;  1Y0V H;  1X02 A;  3OP0 A;  1G33 A;  1G8I A;  1JF2 A;  1ODB A;  1CLM A;  1QXP A;  2BCB A;  4R1E A;  2JPT A;  1GGW A;  1B9A A;  1SCM C;  1Y1A A;  2BEC A;  1OZO A;  1BLQ A;  4MEW A;  1S5G Y;  1MQ1 A;  1EJ3 A;  4L9M A;  5D69 A;  1F8H A;  5HYD A;  2GV5 A;  2KFG A;  1NP8 A;  1C7W A;  5DKR A;  2L5X B;  1KWO C;  1CB1 A;  3CWG A;  3CR5 X;  4MZJ A;  1XFZ O;  3TUY C;  2KQ6 A;  2KQY A;  4E68 A;  2JU0 A;  1GQM A;  4PHK A;  1FI5 A;  2L4H A;  3ICB A;  2JRF A;  2JT8 A;  2PSR A;  1WY9 A;  3BUO B;  1UHH A;  5DKQ A;  3PAT A;  3CZT X;  1IQ3 A;  2MLF C;  3FWC A;  1M46 A;  2KI6 D;  2R2I A;  4IL1 A;  3DVJ A;  1CFF A;  5CSI A;  1JFK A;  4D1E A;  3EVR A;  5AXI A;  2HET A;  2K2A A;  5JOL A;  1R6P A;  1CDP A;  1ZMZ A;  1DT7 B;  2LC5 A;  4GPL B;  4N1F A;  3BUW B;  1WLM A;  2KI4 B;  2GGM A;  4GUK A;  1K94 A;  2Y1M A;  4HRE E;  3SIB A;  3JTD B;  4PE7 A;  2KSP A;  1ALV A;  1XFX O;  5KTY A;  2M3W A;  1KK8 C;  1NCZ A;  5PAL A;  5KSZ A;  1DMO A;  2MLE C;  1M63 B;  1KK7 Z;  2E30 A;  1UUS A;  2M29 A;  1YR5 A;  2Y1N A;  3PN7 B;  1F54 A;  1XFY O;  1N65 A;  3GK1 A;  2K61 A;  4USL A;  1S6C A;  1PSB A;  1LA3 A;  2AUC A;  3WHT B;  1Y6W A;  2MJW B;  2KFH A;  5ER5 A;  1KQV A;  4DIR A;  1SMG A;  1J7P A;  1TN4 A;  1QTX A;  5CSF A;  4YI9 A;  4A4C A;  2NXQ A;  1TCF A;  2LUC A;  4ORB B;  1ALW A;  1AHR A;  1CMF A;  2KAX A;  1B7T Y;  1K93 D;  4PE0 A;  1CLB A;  5KU1 A;  1OMR A;  2JNX A;  1CTR A;  5B8I B;  3I5F C;  1WRK A;  1F71 A;  3VRQ A;  2KI6 C;  5I2O A;  1LVC D;  1N2D A;  2LLS A;  1YUS A;  1XA5 A;  1XFU O;  1JFJ A;  2JTT A;  1A29 A;  1VRK A;  1OE9 B;  1WDC C;  2QPT A;  1F55 A;  2WCF A;  1A4P A;  2CT9 A;  2M7N A;  3WNX B;  1PSR A;  1UHI A;  3EKJ A;  3SG5 A;  2KAY A;  4I5K A;  2K7C A;  4YGA A;  1SL8 A;  5AFP A;  1OSA A;  2WOS A;  3GOF A;  3NSO A;  1SCV A;  3VRN A;  4M2O A;  1DJY A;  1TNW A;  4JQ0 D;  1C07 A;  2JXL A;  1TRF A;  1J7R A;  1NPQ A;  1PVB A;  2OTG C;  1CDL A;  4C0L A;  2L2E A;  2K2F A;  2PAL A;  3RLZ A;  1OQP A;  2A4J A;  1WRZ A;  2M1U A;  1A75 B;  4WQ3 A;  2F8P A;  1EG3 A;  1WLZ A;  1CDM A;  3E3R A;  3PFV A;  3CR2 A;  3TS5 C;  1Q80 A;  3K21 A;  4QJ4 B;  1OMV A;  1EG4 A;  2JQ6 A;  1K95 A;  3I5G C;  2CNP A;  2ZFD A;  3NSK A;  4MN0 A;  4N5X A;  4F0Z B;  3EVU A;  1XVJ A;  1NSH A;  1DJI A;  2JZI A;  5TNC A;  1B8L A;  2MHH A;  2BCX A;  3FIA A;  1AJ4 A;  2OPO A;  1FBV A;  1RJV A;  2BBN A;  4TNC A;  1LKJ A;  1QVI Z;  2LVJ A;  1NUB A;  1F4O A;  1J7O A;  3OB1 B;  2NCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...