1NX0A

Structure of calpain domain 6 in complex with calpastatin dic
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-dependent protease, small subunit
publication title A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1nx0A00
1DJIA 5CSFA 1IQ5A 2HQ8A 3EK8A 1NWDA 2LLTA 1F4OA 1HT9A 1PSRA 2Q4UA 3CGAA 1UHNA 5CSIA 4I5KA 1ZACA 1JFJA 1CTRA 2WC8A 2JOJA 2H61A 2M29A 2MLEC 4XJKB 4BY5A 2LP2A 4OKHA 2JNFA 2M7NA 2F33A 2P6BB 2Y4QA 1WRLA 1TNWA 1QTXA 4QJ5B 2OS8C 1SNLA 5I2OA 1SR6C 1W7IB 3JVTC 1K94A 4I5JA 4NDDA 4C0LA 1OOJA 3HX4A 1A75B 1BG1A 2F3YA 1NX3A 1S1EA 2K7OA 1XK4C 1VRKA 4NDCA 1J7PA 2LVVA 1JWDA 4GGNA 1TNPA 1EXRA 3CR4X 3EK7A 2Y1NA 1YX7A 1PVBA 1F55A 4P5OE 1NCXA 2KQYA 4CIDA 1KSMA 1JSAA 2KNEA 3SG3A 2LMUA 1A4PA 3PFVA 1MUXA 1WRZA 1M63B 1S6JA 1DJXA 1TOPA 4CFQA 3OB1B 1QX2A 1N0YA 1DGUA 4PHJA 5PALA 2HETA 4PALA 2BE4A 2JXLA 2L4IA 3BUWB 2CT9A 1J1DA 2LANA 2JT8A 1FBVA 3D0YA 3AKAA 2LMVA 1UURA 4ZCUA 1DMOA 1B8CA 1G33A 3NSLA 1QLKA 1DJWA 1K9UA 2F8PA 4YGCB 2BECA 3HCMA 1CLMA 1ZUZA 1RROA 1WLZA 2FOTA 3NSKA 1N2DA 1ALWA 2JTTA 2B1UA 2M97A 1B8RA 1S3PA 1YUUA 4YI9A 1V1GA 1KFUL 1CDNA 1CFPA 1KSOA 1JBAA 1QVIZ 2F2OA 1NP8A 4YGEB 1LINA 3WXAA 2OS8B 2KAVA 4HRGA 5ER5A 1SR6B 1V1FA 4OR9B 1XO5A 2PRUA 4CFRA 1KFXL 3K21A 1PSBA 2WORA 5KU1A 4YRUA 2ZFDA 4MZKA 1S5GY 4MSPA 1NCYA 3RLZA 4JQ0D 4UPGA 2VRGA 1NSHA 4I5NB 1IRJA 3BOWA 3O6BA 3PN7B 3VROA 2CCMA 2LHLA 2MLFC 5F6TA 1CFFA 2K61A 3IQOA 5BPJA 1M31A 1CMGA 2KBMA 1R6PA 2EHBA 1B1GA 1AHRA 1RJVA 1TRFA 3F45A 2BCBA 3D10A 1K93D 1UHHA 1SYMA 3VGOA 3VRPA 1MWNA 1WLMA 1CDPA 1GQMA 2MAZA 1X02A 1DVIA 3SG2A 3SIAA 1N65A 2WCFA 2LNKA 1NX2A 1YTZC 1KQMC 3M0WA 4YGAA 2NCOA 3DVJA 1B8LA 2LUXA 4HSZA 4OVNF 3OB2B 1MHOA 2KGRA 3BUMB 2JT0A 2KSPA 4ETOA 5I8NA 1JF2A 2HQWA 4R1EA 1EJ3A 1J7QA 2M3WA 2KI4B 2BCXA 2BL0B 3LK0A 2KI6D 2Q91A 4GGFA 1IG5A 3KPXA 1CM4A 1LKJA 3CR2A 1SCVA 1RFJA 3EVUA 2ZKMX 3MSEB 4MN0A 5CPVA 3BUOB 1EG4A 2LLUA 1J1EA 1KQVA 2WCBA 1ZMZA 1GGWA 3KHEA 4N1GA 2ZN8A 2I94A 1J7OA 2O60A 1OMVA 5JJGA 4GPLB 1B9AA 3TZ1A 3OX5A 4A4BA 2I18A 3I5HC 5KSZA 4P2YB 1BF5A 1UWOA 1XFUO 1AUIB 4AOMA 1QS7A 1IJ5A 1WDCC 3BXKA 3NSOA 5D7FA 1PVAA 3IF7A 1C07A 3AKBA 2KOTA 2NLNA 2K7DA 3SJSA 5DKNA 1XFVO 3PALA 2ZRTA 2COLB 4M2PA 4N1FA 1U5IA 1QV0A 1QV1A 1IQ3A 3NSIA 2L2EA 3BUXB 2KQ6A 5B8IB 1RK9A 1OQPA 2H61C 1GJYA 1A2XA 3QRXA 3WNXB 1BR4B 1QATA 2K8MB 5HKYA 1Y6WA 1MR8A 3SG4A 1G4YR 1K96A 4FQOA 2MA2A 3CLNA 2ZNEA 3DF0B 4N5XA 3EVVA 1L2OC 1CFCA 1KQMB 1K90D 2GGMA 2G9BA 4ORAB 2IS9A 1LA3A 1JFKA 1UUSA 2H2KA 5HLOA 2HPSA 3AAKA 2M9GA 1LA0A 1B47A 2LVJA 1BR1B 3E3RA 3O78A 4M2OA 4ZCVA 2JQ6A 1D1OA 4GNKB 5HKZA 1SY9A 3KF9A 2NCPA 1CKKA 1AJ4A 1FPWA 2R2IA 3EKJA 1BMOA 2JZIA 3I5FC 1AK8A 1S6IA 1K9PA 1YVHA 2LV7A 4MVFA 1H4BA 1A03A 1NYAA 2KFFA 4MRYA 1KK7Z 1E8AA 1J7RA 1NIWA 2MHHA 2GGZA 2L50A 2JTZA 3I5HB 4GAOA 2LP3A 2LHIA 1DF0B 4PHMA 1G8IA 1SMGA 2BKIB 3FWCA 4NQGA 1KK8C 1BODA 2KAYA 2I7AA 2LE9B 4XJKA 1S5GZ 4QJ3B 2JRFA 3TS5C 3JVTB 4PDZA 1RWYA 1YVLA 4NDBA 1J55A 2MBXA 1IWQA 5AEQA 2FJUB 2M1UA 2TN4A 1IH0A 2CNPA 3VRRA 1SL7A 2KDHA 1QIVA 3CS1A 4ORCB 1A75A 1OE9B 1BLQA 2PVBA 2M7LA 2AMIA 2WNDA 2KFHA 4GBAA 2LC5A 1YUSA 2EC6C 2ZNDA 1FI6A 1OMDA 1QXPA 1SL9A 2FCDA 2PSRA 4GUKA 4DRWA 4AQIA 3SIBA 1EH2A 2D8NA 3EVRA 2SCPA 5IBWA 1CDLA 2WCEA 3TDZA 1FI5A 2F2PA 1QX5B 1SK6D 2JXCA 2K0JA 3JTDC 1CLLA 4AQJA 4ORBB 2O5GA 2ZRSA 1JC2A 2AAOA 2OPOA 3DVKA 1IJ6A 2SASA 2Y5IA 4DCKA 1NUBA 1WRKA 2JU0A 3DD4A 4U8DA 4YGBB 5G08A 1F70A 3OP0A 3FS7A 1ZOTB 4QJ4B 1Q80A 4JPZB 2AUCA 4MLWA 4USLA 3I5FB 3SG6A 1FF1A 1B7TY 1XFYO 2LCPA 2JT3A 3BQ3A 4PE4A 1XA5A 1WY9A 4MBEA 1YURA 1PULA 4Q04A 4A4CA 3I5IC 4E68A 2L98A 1B4CA 1SBJA 2MJWB 1DJZA 1CDMA 2M49B 1UHKA 1TIZA 2E30A 1MXLC 1PRWA 2NXQA 2F3ZA 5ER4X 1TTXA 2BKHB 1K2HA 3WHTB 3TUYC 1AJ5A 5CSNA 1CLBA 1CM1A 3ZNIA 1KK8B 2JC2A 3O2PA 1QASA 1F8HA 1S26D 2LM5A 3LL8B 1K9KA 2CBLA 2K2FA 3D0YB 5DKRA 5HLVA 4D1EA 1BOCA 1F71A 5JOLA 2LMTA 2MRDA 3TS5B 2JWWA 2M8UA 4M2QA 4DUQA 4TNCA 1HQVA 4GGFC 2LVIA 1C7WA 1KWOC 3O4YA 4OV2A 1UHIA 3LK1A 4MZLA 5CSJA 3DVEA 4YI8A 5AERA 1TCFA 2JULA 2EC6B 4PE7A 1XK4A 3A4UB 3PM8A 1W7JB 2G2BA 4WQ2A 4C0KA 1DTLA 3I5GC 5KTYA 4C0JA 3FIAA 2JNXA 2M1KB 3WHUB 2JPTA 3BYAA 1K8UA 2KGBC 5J3XA 1YRUB 5HYDA 1QIWA 2EGDA 3GK2A 2K2AA 2QPTA 3JTDB 1ZFSA 3KEVA 1KCYA 1CFDA 1IKUA 1TN4A 2LUCA 2A4JA 3VRQA 1CMFA 2L0PA 3BOWB 3GK4X 1TNQA 4CLNA 2ISDA 1GGZA 3IQQA 1BT6A 2ZN9A 1YUTA 3PN7C 1MF8B 2GV5A 4L9MA 1AP4A 4JWQA 5DKQA 3I5IB 2KYFA 1MQ1A 2I2RE 3VRNA 1S36A 2BCAA 4F0ZB 1SCMC 1H8BA 2L51A 3LCPC 1SW8A 3GK1A 1BJFA 1SL8A 3ICBA 3TUYB 1CB1A 2DOQA 1QLSA 1DJGA 4WRIA 1SPYA 1Y1UA 2PASA 1DJHA 4ICBA 1SRAA 3H4SE 3C1VA 1PALA 1TNXA 3CZTX 1FW4A 3RM1A 3PATA 1OMRA 1C7VA 4HREE 1M46A 2KI6C 1MXEA 2OTGC 2K7BA 1QJTA 1WDCB 1KWOB 1XFZO 4I5LB 2HF5A 4CPVA 4FTGA 5FYXA 2KI4C 1K95A 2BL0C 3A8RA 1DGVA 1EG3A 2PMYA 5AFPA 1OSAA 5AANA 4DIRA 1TCOB 1OZSA 3NXAA 5AXIA 2KAXA 3SG7A 5HKWA 1EL4A 1OZOA 1XFXO 2WOSA 3LLEA 1Y0VH 1YRTB 1KFUS 1BU3A 3I5GB 1L7ZA 1Y1XA 5D69A 4MEWA 3BUNB 3FWBA 3EK4A 1XFWO 5GQQC 1KK7Y 2BBNA 4YGDB 1XYDA 2LAPA 3SG5A 1DJYA 1UHJA 1PK0D 1YR5A 1M39A 1NX0A 3OX6A 4IL1A 4OCIA 1S6CA 1F54A 1KFXS 1QVIY 4PCWA 1LXFC 2Y1MA 1L2OB 2NZ0A 3CR5X 4MZJA 2V53A 4GFTA 1ALVA 1ODBA 4YBHB 1IGVA 2CXJA 3DF0A 4PE1A 2CTNA 1XVJA 2LVKA 1CNPA 4XYNA 1U5IB 3CWGA 1JF0A 1B7TZ 1JUOA 2L4HA 5I2LA 3TDUA 1NCZA 2LLSA 2BBMA 2QACA 3AAJA 4PHKA 1M45A 3CTNA 2M0RA 2BE6A 1SKTA 2E6WA 2KYCA 1A29A 2KBIA 1QX7A 1SCMB 1LVCD 1R2UA 1NX1A 1AVSA 3EKHA 2L5XB 3TDIA 4PHNA 4WQ3A 2KHNA 1NPQA 1Y1AA 3PLFB 2FCEA 5TNCA 1RECA 1RTP1 5K89A 3PSRA 1F4QA 5I2QA 3GOFA 4HRHA 2OTGB 1UP5A 3OHMB 1DF0A 2KFGA 3ZWHA 2K7CA 4PE0A 1DT7B 2PALA 4DS7A 3DVMA 1YX8A 2RGIA 3KO0A 4MRXA 4BY4A
chains in the Genus database with same CATH superfamily
1DJIA 5CSFA 1IQ5A 2JPOA 2HQ8A 3EK8A 1NWDA 2LLTA 1GM0A 1F4OA 1HT9A 1PSRA 2L5YA 2Q4UA 2PQLA 3CGAA 1UHNA 5CSIA 4I5KA 1ZACA 1JFJA 1CTRA 2WC8A 2JOJA 2H61A 3DY9A 2M29A 2MLEC 4XJKB 4BY5A 2LP2A 4OKHA 2JNFA 2M7NA 2F33A 2P6BB 2H8VA 1WRLA 1TNWA 1QTXA 2Y4QA 3S0BA 4QJ5B 2OS8C 1SNLA 1P28A 5I2OA 1SR6C 1W7IB 3JVTC 5FI2A 1K94A 3VB1A 4I5JA 4NDDA 4C0LA 1OOJA 3HX4A 1A75B 1BG1A 1XFRA 2F3YA 1NX3A 1S1EA 2K7OA 1XK4C 3CABA 1VRKA 4NDCA 1J7PA 1TUJA 2LVVA 1C3YA 1JWDA 4GGNA 1TNPA 1EXRA 3CR4X 3EK7A 2Y1NA 1YX7A 1PVBA 3BFHA 1F55A 4P5OE 1NCXA 2KQYA 4CIDA 1KSMA 1JSAA 2KNEA 3SG3A 2LMUA 1SSEB 1OW4A 1A4PA 3PFVA 3EG5B 1MUXA 1WRZA 1M63B 1S6JA 1DJXA 1TOPA 4CFQA 3OB1B 1QX2A 1N0YA 1DGUA 4PHJA 5PALA 3SS4A 3B88A 2HETA 4PALA 5FI7A 2BE4A 3NHTA 2JXLA 2L4IA 3BUWB 2CT9A 1J1DA 2LANA 2JT8A 1FBVA 3D0YA 3AKAA 2LMVA 1UURA 4ZCUA 1DMOA 1B8CA 1G33A 3NSLA 1QLKA 3Q8IA 1DJWA 1K9UA 2F8PA 3L4LA 3N7HA 4YGCB 2BECA 3HCMA 1CLMA 1ZUZA 1RROA 1WLZA 2FOTA 4INWA 3NSKA 1N2DA 1ALWA 2JTTA 2B1UA 2M97A 1B8RA 1S3PA 1YUUA 4YI9A 1V1GA 1KFUL 1CDNA 1CFPA 1KSOA 1JBAA 3R1PA 3R72A 1QVIZ 2F2OA 1NP8A 4YGEB 3SS5A 1LINA 3WXAA 2OS8B 2KAVA 4HRGA 5ER5A 1SR6B 1V1FA 4OR9B 1XO5A 2PRUA 4CFRA 1KFXL 2FJYA 3K21A 1PSBA 2WORA 5KU1A 4YRUA 2ZFDA 4MZKA 1S5GY 4MSPA 1NCYA 3RLZA 4JQ0D 4UPGA 2VRGA 1NSHA 4I5NB 1IRJA 3BOWA 3O6BA 3PN7B 3VROA 3CZ0A 2CCMA 2LHLA 4OZDA 2BNXA 2MLFC 5F6TA 3UNWA 1CFFA 2K61A 3IQOA 5BPJA 1M31A 1OOGA 2KBMA 1CMGA 3S0DA 4IJ7A 1R6PA 2EHBA 1B1GA 1AHRA 1RJVA 1TRFA 3F45A 2BCBA 3D10A 1K93D 1UHHA 1SYMA 2WC5A 3VGOA 3VRPA 1MWNA 1WLMA 1CDPA 1GQMA 2MAZA 1X02A 1DVIA 1W9ZA 3SG2A 3SIAA 1N65A 2WCFA 2LNKA 1NX2A 1YTZC 1KQMC 3R1VA 3M0WA 4YGAA 2NCOA 3DVJA 1B8LA 2LUXA 4HSZA 4OVNF 3OB2B 3PM2A 1MHOA 2KGRA 3BUMB 2JT0A 2KSPA 4ETOA 5I8NA 1JF2A 2HQWA 4R1EA 1EJ3A 4INXA 2M3WA 1C3ZA 2KI4B 2BCXA 2BL0B 3LK0A 2KI6D 5D3OA 1J7QA 2Q91A 4GGFA 1IG5A 3KPXA 1CM4A 1LKJA 3CR2A 1SCVA 1RFJA 3EVUA 2ZKMX 2K60A 3MSEB 4MN0A 5CPVA 3DYEA 3BUOB 1EG4A 2LLUA 1J1EA 1KQVA 2WCBA 4JKTA 1ZMZA 1GGWA 3KHEA 4N1GA 2ZN8A 3K1EA 2I94A 1J7OA 2O60A 2WCHA 1OMVA 4PCWA 5JJGA 4GPLB 1B9AA 3L47A 3TZ1A 3OX5A 4A4BA 2I18A 3I5HC 5KSZA 4P2YB 1BF5A 1UWOA 1XFUO 1AUIB 4AOMA 1QS7A 1IJ5A 1WDCC 3BXKA 3NSOA 5D7FA 1PVAA 3IF7A 1C07A 3AKBA 2KOTA 2NLNA 2K7DA 3SJSA 5DKNA 1XFVO 3PALA 2ZRTA 2COLB 4M2PA 1DEKA 4N1FA 1U5IA 1QV0A 2PYQA 1QV1A 1IQ3A 2QDIA 2L2EA 3BUXB 3NSIA 2KQ6A 5B8IB 1RK9A 1T14A 1OQPA 2H61C 1GJYA 1A2XA 3QRXA 3WNXB 1BR4B 1QATA 2K8MB 5HKYA 1Y6WA 1MR8A 3SG4A 1G4YR 1K96A 4FQOA 2MA2A 3CLNA 2ZNEA 3NHIA 3S0EA 3DF0B 4N5XA 3EVVA 1L2OC 1CFCA 1KQMB 1K90D 2GGMA 2G9BA 4ORAB 2IS9A 1LA3A 1JFKA 1UUSA 2H2KA 5HLOA 2HPSA 3AAKA 2M9GA 1LA0A 1B47A 2LVJA 1BR1B 3E3RA 3O78A 4M2OA 2WCLA 2JQ6A 4ZCVA 1D1OA 1OOFA 3B6XA 4GNKB 5HKZA 1SY9A 3KF9A 2NCPA 1CKKA 1AJ4A 1FPWA 2R2IA 3EKJA 1BMOA 2JZIA 3I5FC 1AK8A 1S6IA 3S0GA 1K9PA 1YVHA 2LV7A 4MVFA 3S0FA 1A03A 1H4BA 1NYAA 2KFFA 4MRYA 1KK7Z 1E8AA 1J7RA 1NIWA 2MHHA 2GGZA 2L50A 2JTZA 3I5HB 4GAOA 2LP3A 2LHIA 1DF0B 4PHMA 1G8IA 1SMGA 2BKIB 3FWCA 4NQGA 1KK8C 1BODA 2KAYA 2I7AA 2LE9B 4XJKA 1S5GZ 4PT1A 4QJ3B 2JRFA 3DZTA 3TS5C 3CDNA 3JVTB 4PDZA 1RWYA 1YVLA 4NDBA 1J55A 2MBXA 3O4XA 1IWQA 5AEQA 2FJUB 2KPHA 2M1UA 2TN4A 1IH0A 2CNPA 3UO9A 3VRRA 1SL7A 2KDHA 1QIVA 3CS1A 4ORCB 1A75A 1OE9B 1BLQA 2PVBA 2M7LA 2AMIA 2WCMA 2WNDA 2KFHA 4GBAA 2LC5A 1YUSA 2EC6C 2ZNDA 5DICA 1FI6A 1OMDA 1QXPA 1SL9A 2FCDA 2PSRA 4GUKA 4DRWA 3CYZA 4AQIA 3SIBA 1EH2A 2D8NA 3FE6A 3EVRA 2SCPA 5IBWA 1CDLA 2WCEA 3TDZA 1FI5A 3CZ1A 1ORGA 2F2PA 1QX5B 1SK6D 1TWOA 2JXCA 2K0JA 1CLLA 3JTDC 4AQJA 4ORBB 2O5GA 2ZRSA 1JC2A 2AAOA 2OPOA 3DVKA 1IJ6A 2SASA 2WCKA 2Y5IA 4DCKA 1NUBA 1WRKA 2JU0A 3BFBA 3DD4A 4U8DA 4YGBB 5G08A 1F70A 2L2CA 3OP0A 3FS7A 5EL2A 1ZOTB 4QJ4B 1Q80A 2ERBA 4JPZB 2AUCA 4MLWA 4USLA 3I5FB 3NGVA 3SG6A 5HL1A 1B7TY 1FF1A 1XFYO 2LCPA 2JT3A 3BQ3A 4PE4A 1XA5A 1WY9A 2YGUA 4MBEA 1YURA 1PULA 4Q04A 4A4CA 3I5IC 4E68A 2L98A 1B4CA 1SBJA 2MJWB 1DJZA 1CDMA 2M49B 1UHKA 1TIZA 2E30A 1MXLC 1PRWA 2NXQA 2F3ZA 5ER4X 1TTXA 2BKHB 1K2HA 3WHTB 3TUYC 1AJ5A 5CSNA 1CLBA 1CM1A 3ZNIA 1KK8B 2KLDA 2JC2A 4F7FA 3O2PA 1QASA 1F8HA 1S26D 2LM5A 3LL8B 1K9KA 2CBLA 2K2FA 3D0YB 5DKRA 5HLVA 4D1EA 1BOCA 1F71A 5JOLA 2LMTA 2MRDA 3TS5B 2JWWA 2M8UA 4M2QA 4KYNA 4DUQA 4TNCA 1HQVA 4GGFC 2LVIA 1C7WA 1KWOC 3O4YA 4OV2A 1UHIA 3LK1A 4MZLA 5CSJA 2BAPA 3DVEA 4YI8A 5AERA 1TCFA 2JULA 2EC6B 2KLEA 4PE7A 3SS3A 1XK4A 3A4UB 3PM8A 1W7JB 2G2BA 4WQ2A 4C0KA 1DTLA 3I5GC 3B87A 3S0AA 5KTYA 4C0JA 2QEHA 2JNXA 2M1KB 3FIAA 3WHUB 2JPTA 3BYAA 1K8UA 3B7AA 2KGBC 5J3XA 1YRUB 3BJHA 5HYDA 1QIWA 2EGDA 3GK2A 2K2AA 2QPTA 3JTDB 1ZFSA 3KEVA 1KCYA 1CFDA 1IKUA 2QEBA 1TN4A 2LUCA 2A4JA 3VRQA 3R1OA 1CMFA 3RZSA 1LS8A 2L0PA 3BOWB 3CZ2A 3GK4X 1TNQA 4CLNA 2ISDA 1GGZA 3IQQA 1BT6A 2ZN9A 4JD9A 1YUTA 3PN7C 1MF8B 3PJIA 2GV5A 4L9MA 1AP4A 4JWQA 5DKQA 3OBVA 3I5IB 2KYFA 1MQ1A 2I2RE 3VRNA 1S36A 2BCAA 2WC6A 1Z4HA 4F0ZB 1SCMC 1H8BA 4FQTA 1OOIX 2L51A 3LCPC 1SW8A 3GK1A 1QWVA 3L4AA 1BJFA 1SL8A 3B86A 3ICBA 3TUYB 1CB1A 2DOQA 1QLSA 1DJGA 4WRIA 1SPYA 1Y1UA 2PASA 1DJHA 4ICBA 1SRAA 3H4SE 3C1VA 1PALA 1TNXA 3CZTX 1FW4A 3RM1A 3PATA 1OMRA 1C7VA 4HREE 1M46A 2KI6C 1MXEA 2OTGC 2K7BA 3D74A 1QJTA 1WDCB 1KWOB 2QEVA 1XFZO 4I5LB 1TUZA 3DXLA 2HF5A 4CPVA 4FTGA 5FYXA 2KI4C 1K95A 2BL0C 3A8RA 1DGVA 1EG3A 2PMYA 1OOHA 5AFPA 1OSAA 5AANA 3OGNA 4DIRA 1TCOB 2P71A 3D73A 1OZSA 3NXAA 5AXIA 2KAXA 3SG7A 5HKWA 1EL4A 1OZOA 1XFXO 2WOSA 3LLEA 1Y0VH 1YRTB 1KFUS 1BU3A 3I5GB 1L7ZA 1Y1XA 5D69A 4MEWA 3BUNB 3FWBA 3EK4A 1XFWO 3BFAA 1KK7Y 2BBNA 4YGDB 5GQQC 1XYDA 2LAPA 3SG5A 1DJYA 3IVTA 1UHJA 3D76A 1DC1A 1PK0D 1YR5A 1M39A 1NX0A 3OX6A 4IL1A 4OCIA 1S6CA 2GTEA 1F54A 1KFXS 1QVIY 1DELA 2WCJA 1LXFC 2Y1MA 1L2OB 2NZ0A 3CR5X 4MZJA 2QEOA 2V53A 1ALVA 1ODBA 4GFTA 4YBHB 1IGVA 2CXJA 3D75A 3DF0A 3FE9A 2CTNA 4PE1A 1XVJA 2LVKA 1CNPA 4XYNA 1U5IB 3CWGA 1JF0A 1B7TZ 1JUOA 2L4HA 5I2LA 3TDUA 1NCZA 2LLSA 2BBMA 2QACA 3AAJA 4PHKA 1M45A 3CTNA 2M0RA 2BE6A 3FE8A 1Z2CB 1SKTA 2E6WA 2KYCA 1A29A 2KBIA 1QX7A 1SCMB 1DQEA 1LVCD 5FI6A 1R2UA 1NX1A 1AVSA 3EKHA 2L5XB 3D77A 3TDIA 4PHNA 4WQ3A 2KHNA 1NPQA 1Y1AA 3PLFB 2FCEA 5TNCA 1RECA 1RTP1 3V2LA 5K89A 3PSRA 1F4QA 5I2QA 3GOFA 1IIOA 4HRHA 2OTGB 2P70A 1UP5A 3D78A 3OHMB 1DF0A 2KFGA 3QMEA 2K7CA 4PE0A 3ZWHA 1DT7B 2PALA 4DS7A 3DVMA 5I94A 1YX8A 2RGIA 3KO0A 4MRXA 4BY4A
chains in the Genus database with same CATH topology
1DJIA 5CSFA 1IQ5A 2HQ8A 3EK8A 1NWDA 2LLTA 1F4OA 1HT9A 1PSRA 2Q4UA 3CGAA 1UHNA 5CSIA 4I5KA 1ZACA 1JFJA 1CTRA 2WC8A 2JOJA 2H61A 2M29A 2MLEC 4XJKB 4BY5A 2LP2A 4OKHA 2JNFA 2M7NA 2F33A 2P6BB 2Y4QA 1WRLA 1TNWA 1QTXA 4QJ5B 2OS8C 1SNLA 5I2OA 1SR6C 1W7IB 3JVTC 1K94A 4I5JA 4NDDA 4C0LA 1OOJA 3HX4A 1A75B 1BG1A 2F3YA 1NX3A 1S1EA 2K7OA 1XK4C 1VRKA 4NDCA 1J7PA 2LVVA 1JWDA 4GGNA 1TNPA 1EXRA 3CR4X 3EK7A 2Y1NA 1YX7A 1PVBA 1F55A 4P5OE 1NCXA 2KQYA 4CIDA 1KSMA 1JSAA 2KNEA 3SG3A 2LMUA 1A4PA 3PFVA 1MUXA 1WRZA 1M63B 1S6JA 1DJXA 1TOPA 4CFQA 3OB1B 1QX2A 1N0YA 1DGUA 4PHJA 5PALA 2HETA 4PALA 2BE4A 2JXLA 2L4IA 3BUWB 2CT9A 1J1DA 2LANA 2JT8A 1FBVA 3D0YA 3AKAA 2LMVA 1UURA 4ZCUA 1DMOA 1B8CA 1G33A 3NSLA 1QLKA 1DJWA 1K9UA 2F8PA 4YGCB 2BECA 3HCMA 1CLMA 1ZUZA 1RROA 1WLZA 2FOTA 3NSKA 1N2DA 1ALWA 2JTTA 2B1UA 2M97A 1B8RA 1S3PA 1YUUA 4YI9A 1V1GA 1KFUL 1CDNA 1CFPA 1KSOA 1JBAA 1QVIZ 2F2OA 1NP8A 4YGEB 1LINA 3WXAA 2OS8B 2KAVA 4HRGA 5ER5A 1SR6B 1V1FA 4OR9B 1XO5A 2PRUA 4CFRA 1KFXL 3K21A 1PSBA 2WORA 5KU1A 4YRUA 2ZFDA 4MZKA 1S5GY 4MSPA 1NCYA 3RLZA 4JQ0D 4UPGA 2VRGA 1NSHA 4I5NB 1IRJA 3BOWA 3O6BA 3PN7B 3VROA 2CCMA 2LHLA 2MLFC 5F6TA 1CFFA 2K61A 3IQOA 5BPJA 1M31A 1CMGA 2KBMA 1R6PA 2EHBA 1B1GA 1AHRA 1RJVA 1TRFA 3F45A 2BCBA 3D10A 1K93D 1UHHA 1SYMA 3VGOA 3VRPA 1MWNA 1WLMA 1CDPA 1GQMA 2MAZA 1X02A 1DVIA 3SG2A 3SIAA 1N65A 2WCFA 2LNKA 1NX2A 1YTZC 1KQMC 3M0WA 4YGAA 2NCOA 3DVJA 1B8LA 2LUXA 4HSZA 4OVNF 3OB2B 1MHOA 2KGRA 3BUMB 2JT0A 2KSPA 4ETOA 5I8NA 1JF2A 2HQWA 4R1EA 1EJ3A 1J7QA 2M3WA 2KI4B 2BCXA 2BL0B 3LK0A 2KI6D 2Q91A 4GGFA 1IG5A 3KPXA 1CM4A 1LKJA 3CR2A 1SCVA 1RFJA 3EVUA 2ZKMX 3MSEB 4MN0A 5CPVA 3BUOB 1EG4A 2LLUA 1J1EA 1KQVA 2WCBA 1ZMZA 1GGWA 3KHEA 4N1GA 2ZN8A 2I94A 1J7OA 2O60A 1OMVA 5JJGA 4GPLB 1B9AA 3TZ1A 3OX5A 4A4BA 2I18A 3I5HC 5KSZA 4P2YB 1BF5A 1UWOA 1XFUO 1AUIB 4AOMA 1QS7A 1IJ5A 1WDCC 3BXKA 3NSOA 5D7FA 1PVAA 3IF7A 1C07A 3AKBA 2KOTA 2NLNA 2K7DA 3SJSA 5DKNA 1XFVO 3PALA 2ZRTA 2COLB 4M2PA 4N1FA 1U5IA 1QV0A 1QV1A 1IQ3A 3NSIA 2L2EA 3BUXB 2KQ6A 5B8IB 1RK9A 1OQPA 2H61C 1GJYA 1A2XA 3QRXA 3WNXB 1BR4B 1QATA 2K8MB 5HKYA 1Y6WA 1MR8A 3SG4A 1G4YR 1K96A 4FQOA 2MA2A 3CLNA 2ZNEA 3DF0B 4N5XA 3EVVA 1L2OC 1CFCA 1KQMB 1K90D 2GGMA 2G9BA 4ORAB 2IS9A 1LA3A 1JFKA 1UUSA 2H2KA 5HLOA 2HPSA 3AAKA 2M9GA 1LA0A 1B47A 2LVJA 1BR1B 3E3RA 3O78A 4M2OA 4ZCVA 2JQ6A 1D1OA 4GNKB 5HKZA 1SY9A 3KF9A 2NCPA 1CKKA 1AJ4A 1FPWA 2R2IA 3EKJA 1BMOA 2JZIA 3I5FC 1AK8A 1S6IA 1K9PA 1YVHA 2LV7A 4MVFA 1H4BA 1A03A 1NYAA 2KFFA 4MRYA 1KK7Z 1E8AA 1J7RA 1NIWA 2MHHA 2GGZA 2L50A 2JTZA 3I5HB 4GAOA 2LP3A 2LHIA 1DF0B 4PHMA 1G8IA 1SMGA 2BKIB 3FWCA 4NQGA 1KK8C 1BODA 2KAYA 2I7AA 2LE9B 4XJKA 1S5GZ 4QJ3B 2JRFA 3TS5C 3JVTB 4PDZA 1RWYA 1YVLA 4NDBA 1J55A 2MBXA 1IWQA 5AEQA 2FJUB 2M1UA 2TN4A 1IH0A 2CNPA 3VRRA 1SL7A 2KDHA 1QIVA 3CS1A 4ORCB 1A75A 1OE9B 1BLQA 2PVBA 2M7LA 2AMIA 2WNDA 2KFHA 4GBAA 2LC5A 1YUSA 2EC6C 2ZNDA 1FI6A 1OMDA 1QXPA 1SL9A 2FCDA 2PSRA 4GUKA 4DRWA 4AQIA 3SIBA 1EH2A 2D8NA 3EVRA 2SCPA 5IBWA 1CDLA 2WCEA 3TDZA 1FI5A 2F2PA 1QX5B 1SK6D 2JXCA 2K0JA 3JTDC 1CLLA 4AQJA 4ORBB 2O5GA 2ZRSA 1JC2A 2AAOA 2OPOA 3DVKA 1IJ6A 2SASA 2Y5IA 4DCKA 1NUBA 1WRKA 2JU0A 3DD4A 4U8DA 4YGBB 5G08A 1F70A 3OP0A 3FS7A 1ZOTB 4QJ4B 1Q80A 4JPZB 2AUCA 4MLWA 4USLA 3I5FB 3SG6A 1FF1A 1B7TY 1XFYO 2LCPA 2JT3A 3BQ3A 4PE4A 1XA5A 1WY9A 4MBEA 1YURA 1PULA 4Q04A 4A4CA 3I5IC 4E68A 2L98A 1B4CA 1SBJA 2MJWB 1DJZA 1CDMA 2M49B 1UHKA 1TIZA 2E30A 1MXLC 1PRWA 2NXQA 2F3ZA 5ER4X 1TTXA 2BKHB 1K2HA 3WHTB 3TUYC 1AJ5A 5CSNA 1CLBA 1CM1A 3ZNIA 1KK8B 2JC2A 3O2PA 1QASA 1F8HA 1S26D 2LM5A 3LL8B 1K9KA 2CBLA 2K2FA 3D0YB 5DKRA 5HLVA 4D1EA 1BOCA 1F71A 5JOLA 2LMTA 2MRDA 3TS5B 2JWWA 2M8UA 4M2QA 4DUQA 4TNCA 1HQVA 4GGFC 2LVIA 1C7WA 1KWOC 3O4YA 4OV2A 1UHIA 3LK1A 4MZLA 5CSJA 3DVEA 4YI8A 5AERA 1TCFA 2JULA 2EC6B 4PE7A 1XK4A 3A4UB 3PM8A 1W7JB 2G2BA 4WQ2A 4C0KA 1DTLA 3I5GC 5KTYA 4C0JA 3FIAA 2JNXA 2M1KB 3WHUB 2JPTA 3BYAA 1K8UA 2KGBC 5J3XA 1YRUB 5HYDA 1QIWA 2EGDA 3GK2A 2K2AA 2QPTA 3JTDB 1ZFSA 3KEVA 1KCYA 1CFDA 1IKUA 1TN4A 2LUCA 2A4JA 3VRQA 1CMFA 2L0PA 3BOWB 3GK4X 1TNQA 4CLNA 2ISDA 1GGZA 3IQQA 1BT6A 2ZN9A 1YUTA 3PN7C 1MF8B 2GV5A 4L9MA 1AP4A 4JWQA 5DKQA 3I5IB 2KYFA 1MQ1A 2I2RE 3VRNA 1S36A 2BCAA 4F0ZB 1SCMC 1H8BA 2L51A 3LCPC 1SW8A 3GK1A 1BJFA 1SL8A 3ICBA 3TUYB 1CB1A 2DOQA 1QLSA 1DJGA 4WRIA 1SPYA 1Y1UA 2PASA 1DJHA 4ICBA 1SRAA 3H4SE 3C1VA 1PALA 1TNXA 3CZTX 1FW4A 3RM1A 3PATA 1OMRA 1C7VA 4HREE 1M46A 2KI6C 1MXEA 2OTGC 2K7BA 1QJTA 1WDCB 1KWOB 1XFZO 4I5LB 2HF5A 4CPVA 4FTGA 5FYXA 2KI4C 1K95A 2BL0C 3A8RA 1DGVA 1EG3A 2PMYA 5AFPA 1OSAA 5AANA 4DIRA 1TCOB 1OZSA 3NXAA 5AXIA 2KAXA 3SG7A 5HKWA 1EL4A 1OZOA 1XFXO 2WOSA 3LLEA 1Y0VH 1YRTB 1KFUS 1BU3A 3I5GB 1L7ZA 1Y1XA 5D69A 4MEWA 3BUNB 3FWBA 3EK4A 1XFWO 5GQQC 1KK7Y 2BBNA 4YGDB 1XYDA 2LAPA 3SG5A 1DJYA 1UHJA 1PK0D 1YR5A 1M39A 1NX0A 3OX6A 4IL1A 4OCIA 1S6CA 1F54A 1KFXS 1QVIY 4PCWA 1LXFC 2Y1MA 1L2OB 2NZ0A 3CR5X 4MZJA 2V53A 4GFTA 1ALVA 1ODBA 4YBHB 1IGVA 2CXJA 3DF0A 4PE1A 2CTNA 1XVJA 2LVKA 1CNPA 4XYNA 1U5IB 3CWGA 1JF0A 1B7TZ 1JUOA 2L4HA 5I2LA 3TDUA 1NCZA 2LLSA 2BBMA 2QACA 3AAJA 4PHKA 1M45A 3CTNA 2M0RA 2BE6A 1SKTA 2E6WA 2KYCA 1A29A 2KBIA 1QX7A 1SCMB 1LVCD 1R2UA 1NX1A 1AVSA 3EKHA 2L5XB 3TDIA 4PHNA 4WQ3A 2KHNA 1NPQA 1Y1AA 3PLFB 2FCEA 5TNCA 1RECA 1RTP1 5K89A 3PSRA 1F4QA 5I2QA 3GOFA 4HRHA 2OTGB 1UP5A 3OHMB 1DF0A 2KFGA 3ZWHA 2K7CA 4PE0A 1DT7B 2PALA 4DS7A 3DVMA 1YX8A 2RGIA 3KO0A 4MRXA 4BY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJI A;  5CSF A;  1IQ5 A;  2HQ8 A;  3EK8 A;  1NWD A;  2LLT A;  1F4O A;  1HT9 A;  1PSR A;  2Q4U A;  3CGA A;  1UHN A;  5CSI A;  4I5K A;  1ZAC A;  1JFJ A;  1CTR A;  2WC8 A;  2JOJ A;  2H61 A;  2M29 A;  2MLE C;  4XJK B;  4BY5 A;  2LP2 A;  4OKH A;  2JNF A;  2M7N A;  2F33 A;  2P6B B;  2Y4Q A;  1WRL A;  1TNW A;  1QTX A;  4QJ5 B;  2OS8 C;  1SNL A;  5I2O A;  1SR6 C;  1W7I B;  3JVT C;  1K94 A;  4I5J A;  4NDD A;  4C0L A;  1OOJ A;  3HX4 A;  1A75 B;  1BG1 A;  2F3Y A;  1NX3 A;  1S1E A;  2K7O A;  1XK4 C;  1VRK A;  4NDC A;  1J7P A;  2LVV A;  1JWD A;  4GGN A;  1TNP A;  1EXR A;  3CR4 X;  3EK7 A;  2Y1N A;  1YX7 A;  1PVB A;  1F55 A;  4P5O E;  1NCX A;  2KQY A;  4CID A;  1KSM A;  1JSA A;  2KNE A;  3SG3 A;  2LMU A;  1A4P A;  3PFV A;  1MUX A;  1WRZ A;  1M63 B;  1S6J A;  1DJX A;  1TOP A;  4CFQ A;  3OB1 B;  1QX2 A;  1N0Y A;  1DGU A;  4PHJ A;  5PAL A;  2HET A;  4PAL A;  2BE4 A;  2JXL A;  2L4I A;  3BUW B;  2CT9 A;  1J1D A;  2LAN A;  2JT8 A;  1FBV A;  3D0Y A;  3AKA A;  2LMV A;  1UUR A;  4ZCU A;  1DMO A;  1B8C A;  1G33 A;  3NSL A;  1QLK A;  1DJW A;  1K9U A;  2F8P A;  4YGC B;  2BEC A;  3HCM A;  1CLM A;  1ZUZ A;  1RRO A;  1WLZ A;  2FOT A;  3NSK A;  1N2D A;  1ALW A;  2JTT A;  2B1U A;  2M97 A;  1B8R A;  1S3P A;  1YUU A;  4YI9 A;  1V1G A;  1KFU L;  1CDN A;  1CFP A;  1KSO A;  1JBA A;  1QVI Z;  2F2O A;  1NP8 A;  4YGE B;  1LIN A;  3WXA A;  2OS8 B;  2KAV A;  4HRG A;  5ER5 A;  1SR6 B;  1V1F A;  4OR9 B;  1XO5 A;  2PRU A;  4CFR A;  1KFX L;  3K21 A;  1PSB A;  2WOR A;  5KU1 A;  4YRU A;  2ZFD A;  4MZK A;  1S5G Y;  4MSP A;  1NCY A;  3RLZ A;  4JQ0 D;  4UPG A;  2VRG A;  1NSH A;  4I5N B;  1IRJ A;  3BOW A;  3O6B A;  3PN7 B;  3VRO A;  2CCM A;  2LHL A;  2MLF C;  5F6T A;  1CFF A;  2K61 A;  3IQO A;  5BPJ A;  1M31 A;  1CMG A;  2KBM A;  1R6P A;  2EHB A;  1B1G A;  1AHR A;  1RJV A;  1TRF A;  3F45 A;  2BCB A;  3D10 A;  1K93 D;  1UHH A;  1SYM A;  3VGO A;  3VRP A;  1MWN A;  1WLM A;  1CDP A;  1GQM A;  2MAZ A;  1X02 A;  1DVI A;  3SG2 A;  3SIA A;  1N65 A;  2WCF A;  2LNK A;  1NX2 A;  1YTZ C;  1KQM C;  3M0W A;  4YGA A;  2NCO A;  3DVJ A;  1B8L A;  2LUX A;  4HSZ A;  4OVN F;  3OB2 B;  1MHO A;  2KGR A;  3BUM B;  2JT0 A;  2KSP A;  4ETO A;  5I8N A;  1JF2 A;  2HQW A;  4R1E A;  1EJ3 A;  1J7Q A;  2M3W A;  2KI4 B;  2BCX A;  2BL0 B;  3LK0 A;  2KI6 D;  2Q91 A;  4GGF A;  1IG5 A;  3KPX A;  1CM4 A;  1LKJ A;  3CR2 A;  1SCV A;  1RFJ A;  3EVU A;  2ZKM X;  3MSE B;  4MN0 A;  5CPV A;  3BUO B;  1EG4 A;  2LLU A;  1J1E A;  1KQV A;  2WCB A;  1ZMZ A;  1GGW A;  3KHE A;  4N1G A;  2ZN8 A;  2I94 A;  1J7O A;  2O60 A;  1OMV A;  5JJG A;  4GPL B;  1B9A A;  3TZ1 A;  3OX5 A;  4A4B A;  2I18 A;  3I5H C;  5KSZ A;  4P2Y B;  1BF5 A;  1UWO A;  1XFU O;  1AUI B;  4AOM A;  1QS7 A;  1IJ5 A;  1WDC C;  3BXK A;  3NSO A;  5D7F A;  1PVA A;  3IF7 A;  1C07 A;  3AKB A;  2KOT A;  2NLN A;  2K7D A;  3SJS A;  5DKN A;  1XFV O;  3PAL A;  2ZRT A;  2COL B;  4M2P A;  4N1F A;  1U5I A;  1QV0 A;  1QV1 A;  1IQ3 A;  3NSI A;  2L2E A;  3BUX B;  2KQ6 A;  5B8I B;  1RK9 A;  1OQP A;  2H61 C;  1GJY A;  1A2X A;  3QRX A;  3WNX B;  1BR4 B;  1QAT A;  2K8M B;  5HKY A;  1Y6W A;  1MR8 A;  3SG4 A;  1G4Y R;  1K96 A;  4FQO A;  2MA2 A;  3CLN A;  2ZNE A;  3DF0 B;  4N5X A;  3EVV A;  1L2O C;  1CFC A;  1KQM B;  1K90 D;  2GGM A;  2G9B A;  4ORA B;  2IS9 A;  1LA3 A;  1JFK A;  1UUS A;  2H2K A;  5HLO A;  2HPS A;  3AAK A;  2M9G A;  1LA0 A;  1B47 A;  2LVJ A;  1BR1 B;  3E3R A;  3O78 A;  4M2O A;  4ZCV A;  2JQ6 A;  1D1O A;  4GNK B;  5HKZ A;  1SY9 A;  3KF9 A;  2NCP A;  1CKK A;  1AJ4 A;  1FPW A;  2R2I A;  3EKJ A;  1BMO A;  2JZI A;  3I5F C;  1AK8 A;  1S6I A;  1K9P A;  1YVH A;  2LV7 A;  4MVF A;  1H4B A;  1A03 A;  1NYA A;  2KFF A;  4MRY A;  1KK7 Z;  1E8A A;  1J7R A;  1NIW A;  2MHH A;  2GGZ A;  2L50 A;  2JTZ A;  3I5H B;  4GAO A;  2LP3 A;  2LHI A;  1DF0 B;  4PHM A;  1G8I A;  1SMG A;  2BKI B;  3FWC A;  4NQG A;  1KK8 C;  1BOD A;  2KAY A;  2I7A A;  2LE9 B;  4XJK A;  1S5G Z;  4QJ3 B;  2JRF A;  3TS5 C;  3JVT B;  4PDZ A;  1RWY A;  1YVL A;  4NDB A;  1J55 A;  2MBX A;  1IWQ A;  5AEQ A;  2FJU B;  2M1U A;  2TN4 A;  1IH0 A;  2CNP A;  3VRR A;  1SL7 A;  2KDH A;  1QIV A;  3CS1 A;  4ORC B;  1A75 A;  1OE9 B;  1BLQ A;  2PVB A;  2M7L A;  2AMI A;  2WND A;  2KFH A;  4GBA A;  2LC5 A;  1YUS A;  2EC6 C;  2ZND A;  1FI6 A;  1OMD A;  1QXP A;  1SL9 A;  2FCD A;  2PSR A;  4GUK A;  4DRW A;  4AQI A;  3SIB A;  1EH2 A;  2D8N A;  3EVR A;  2SCP A;  5IBW A;  1CDL A;  2WCE A;  3TDZ A;  1FI5 A;  2F2P A;  1QX5 B;  1SK6 D;  2JXC A;  2K0J A;  3JTD C;  1CLL A;  4AQJ A;  4ORB B;  2O5G A;  2ZRS A;  1JC2 A;  2AAO A;  2OPO A;  3DVK A;  1IJ6 A;  2SAS A;  2Y5I A;  4DCK A;  1NUB A;  1WRK A;  2JU0 A;  3DD4 A;  4U8D A;  4YGB B;  5G08 A;  1F70 A;  3OP0 A;  3FS7 A;  1ZOT B;  4QJ4 B;  1Q80 A;  4JPZ B;  2AUC A;  4MLW A;  4USL A;  3I5F B;  3SG6 A;  1FF1 A;  1B7T Y;  1XFY O;  2LCP A;  2JT3 A;  3BQ3 A;  4PE4 A;  1XA5 A;  1WY9 A;  4MBE A;  1YUR A;  1PUL A;  4Q04 A;  4A4C A;  3I5I C;  4E68 A;  2L98 A;  1B4C A;  1SBJ A;  2MJW B;  1DJZ A;  1CDM A;  2M49 B;  1UHK A;  1TIZ A;  2E30 A;  1MXL C;  1PRW A;  2NXQ A;  2F3Z A;  5ER4 X;  1TTX A;  2BKH B;  1K2H A;  3WHT B;  3TUY C;  1AJ5 A;  5CSN A;  1CLB A;  1CM1 A;  3ZNI A;  1KK8 B;  2JC2 A;  3O2P A;  1QAS A;  1F8H A;  1S26 D;  2LM5 A;  3LL8 B;  1K9K A;  2CBL A;  2K2F A;  3D0Y B;  5DKR A;  5HLV A;  4D1E A;  1BOC A;  1F71 A;  5JOL A;  2LMT A;  2MRD A;  3TS5 B;  2JWW A;  2M8U A;  4M2Q A;  4DUQ A;  4TNC A;  1HQV A;  4GGF C;  2LVI A;  1C7W A;  1KWO C;  3O4Y A;  4OV2 A;  1UHI A;  3LK1 A;  4MZL A;  5CSJ A;  3DVE A;  4YI8 A;  5AER A;  1TCF A;  2JUL A;  2EC6 B;  4PE7 A;  1XK4 A;  3A4U B;  3PM8 A;  1W7J B;  2G2B A;  4WQ2 A;  4C0K A;  1DTL A;  3I5G C;  5KTY A;  4C0J A;  3FIA A;  2JNX A;  2M1K B;  3WHU B;  2JPT A;  3BYA A;  1K8U A;  2KGB C;  5J3X A;  1YRU B;  5HYD A;  1QIW A;  2EGD A;  3GK2 A;  2K2A A;  2QPT A;  3JTD B;  1ZFS A;  3KEV A;  1KCY A;  1CFD A;  1IKU A;  1TN4 A;  2LUC A;  2A4J A;  3VRQ A;  1CMF A;  2L0P A;  3BOW B;  3GK4 X;  1TNQ A;  4CLN A;  2ISD A;  1GGZ A;  3IQQ A;  1BT6 A;  2ZN9 A;  1YUT A;  3PN7 C;  1MF8 B;  2GV5 A;  4L9M A;  1AP4 A;  4JWQ A;  5DKQ A;  3I5I B;  2KYF A;  1MQ1 A;  2I2R E;  3VRN A;  1S36 A;  2BCA A;  4F0Z B;  1SCM C;  1H8B A;  2L51 A;  3LCP C;  1SW8 A;  3GK1 A;  1BJF A;  1SL8 A;  3ICB A;  3TUY B;  1CB1 A;  2DOQ A;  1QLS A;  1DJG A;  4WRI A;  1SPY A;  1Y1U A;  2PAS A;  1DJH A;  4ICB A;  1SRA A;  3H4S E;  3C1V A;  1PAL A;  1TNX A;  3CZT X;  1FW4 A;  3RM1 A;  3PAT A;  1OMR A;  1C7V A;  4HRE E;  1M46 A;  2KI6 C;  1MXE A;  2OTG C;  2K7B A;  1QJT A;  1WDC B;  1KWO B;  1XFZ O;  4I5L B;  2HF5 A;  4CPV A;  4FTG A;  5FYX A;  2KI4 C;  1K95 A;  2BL0 C;  3A8R A;  1DGV A;  1EG3 A;  2PMY A;  5AFP A;  1OSA A;  5AAN A;  4DIR A;  1TCO B;  1OZS A;  3NXA A;  5AXI A;  2KAX A;  3SG7 A;  5HKW A;  1EL4 A;  1OZO A;  1XFX O;  2WOS A;  3LLE A;  1Y0V H;  1YRT B;  1KFU S;  1BU3 A;  3I5G B;  1L7Z A;  1Y1X A;  5D69 A;  4MEW A;  3BUN B;  3FWB A;  3EK4 A;  1XFW O;  5GQQ C;  1KK7 Y;  2BBN A;  4YGD B;  1XYD A;  2LAP A;  3SG5 A;  1DJY A;  1UHJ A;  1PK0 D;  1YR5 A;  1M39 A;  1NX0 A;  3OX6 A;  4IL1 A;  4OCI A;  1S6C A;  1F54 A;  1KFX S;  1QVI Y;  4PCW A;  1LXF C;  2Y1M A;  1L2O B;  2NZ0 A;  3CR5 X;  4MZJ A;  2V53 A;  4GFT A;  1ALV A;  1ODB A;  4YBH B;  1IGV A;  2CXJ A;  3DF0 A;  4PE1 A;  2CTN A;  1XVJ A;  2LVK A;  1CNP A;  4XYN A;  1U5I B;  3CWG A;  1JF0 A;  1B7T Z;  1JUO A;  2L4H A;  5I2L A;  3TDU A;  1NCZ A;  2LLS A;  2BBM A;  2QAC A;  3AAJ A;  4PHK A;  1M45 A;  3CTN A;  2M0R A;  2BE6 A;  1SKT A;  2E6W A;  2KYC A;  1A29 A;  2KBI A;  1QX7 A;  1SCM B;  1LVC D;  1R2U A;  1NX1 A;  1AVS A;  3EKH A;  2L5X B;  3TDI A;  4PHN A;  4WQ3 A;  2KHN A;  1NPQ A;  1Y1A A;  3PLF B;  2FCE A;  5TNC A;  1REC A;  1RTP 1;  5K89 A;  3PSR A;  1F4Q A;  5I2Q A;  3GOF A;  4HRH A;  2OTG B;  1UP5 A;  3OHM B;  1DF0 A;  2KFG A;  3ZWH A;  2K7C A;  4PE0 A;  1DT7 B;  2PAL A;  4DS7 A;  3DVM A;  1YX8 A;  2RGI A;  3KO0 A;  4MRX A;  4BY4 A; 
#chains in the Genus database with same CATH topology
 1DJI A;  5CSF A;  1IQ5 A;  2JPO A;  2HQ8 A;  3EK8 A;  1NWD A;  2LLT A;  1GM0 A;  1F4O A;  1HT9 A;  1PSR A;  2L5Y A;  2Q4U A;  2PQL A;  3CGA A;  1UHN A;  5CSI A;  4I5K A;  1ZAC A;  1JFJ A;  1CTR A;  2WC8 A;  2JOJ A;  2H61 A;  3DY9 A;  2M29 A;  2MLE C;  4XJK B;  4BY5 A;  2LP2 A;  4OKH A;  2JNF A;  2M7N A;  2F33 A;  2P6B B;  2H8V A;  1WRL A;  1TNW A;  1QTX A;  2Y4Q A;  3S0B A;  4QJ5 B;  2OS8 C;  1SNL A;  1P28 A;  5I2O A;  1SR6 C;  1W7I B;  3JVT C;  5FI2 A;  1K94 A;  3VB1 A;  4I5J A;  4NDD A;  4C0L A;  1OOJ A;  3HX4 A;  1A75 B;  1BG1 A;  1XFR A;  2F3Y A;  1NX3 A;  1S1E A;  2K7O A;  1XK4 C;  3CAB A;  1VRK A;  4NDC A;  1J7P A;  1TUJ A;  2LVV A;  1C3Y A;  1JWD A;  4GGN A;  1TNP A;  1EXR A;  3CR4 X;  3EK7 A;  2Y1N A;  1YX7 A;  1PVB A;  3BFH A;  1F55 A;  4P5O E;  1NCX A;  2KQY A;  4CID A;  1KSM A;  1JSA A;  2KNE A;  3SG3 A;  2LMU A;  1SSE B;  1OW4 A;  1A4P A;  3PFV A;  3EG5 B;  1MUX A;  1WRZ A;  1M63 B;  1S6J A;  1DJX A;  1TOP A;  4CFQ A;  3OB1 B;  1QX2 A;  1N0Y A;  1DGU A;  4PHJ A;  5PAL A;  3SS4 A;  3B88 A;  2HET A;  4PAL A;  5FI7 A;  2BE4 A;  3NHT A;  2JXL A;  2L4I A;  3BUW B;  2CT9 A;  1J1D A;  2LAN A;  2JT8 A;  1FBV A;  3D0Y A;  3AKA A;  2LMV A;  1UUR A;  4ZCU A;  1DMO A;  1B8C A;  1G33 A;  3NSL A;  1QLK A;  3Q8I A;  1DJW A;  1K9U A;  2F8P A;  3L4L A;  3N7H A;  4YGC B;  2BEC A;  3HCM A;  1CLM A;  1ZUZ A;  1RRO A;  1WLZ A;  2FOT A;  4INW A;  3NSK A;  1N2D A;  1ALW A;  2JTT A;  2B1U A;  2M97 A;  1B8R A;  1S3P A;  1YUU A;  4YI9 A;  1V1G A;  1KFU L;  1CDN A;  1CFP A;  1KSO A;  1JBA A;  3R1P A;  3R72 A;  1QVI Z;  2F2O A;  1NP8 A;  4YGE B;  3SS5 A;  1LIN A;  3WXA A;  2OS8 B;  2KAV A;  4HRG A;  5ER5 A;  1SR6 B;  1V1F A;  4OR9 B;  1XO5 A;  2PRU A;  4CFR A;  1KFX L;  2FJY A;  3K21 A;  1PSB A;  2WOR A;  5KU1 A;  4YRU A;  2ZFD A;  4MZK A;  1S5G Y;  4MSP A;  1NCY A;  3RLZ A;  4JQ0 D;  4UPG A;  2VRG A;  1NSH A;  4I5N B;  1IRJ A;  3BOW A;  3O6B A;  3PN7 B;  3VRO A;  3CZ0 A;  2CCM A;  2LHL A;  4OZD A;  2BNX A;  2MLF C;  5F6T A;  3UNW A;  1CFF A;  2K61 A;  3IQO A;  5BPJ A;  1M31 A;  1OOG A;  2KBM A;  1CMG A;  3S0D A;  4IJ7 A;  1R6P A;  2EHB A;  1B1G A;  1AHR A;  1RJV A;  1TRF A;  3F45 A;  2BCB A;  3D10 A;  1K93 D;  1UHH A;  1SYM A;  2WC5 A;  3VGO A;  3VRP A;  1MWN A;  1WLM A;  1CDP A;  1GQM A;  2MAZ A;  1X02 A;  1DVI A;  1W9Z A;  3SG2 A;  3SIA A;  1N65 A;  2WCF A;  2LNK A;  1NX2 A;  1YTZ C;  1KQM C;  3R1V A;  3M0W A;  4YGA A;  2NCO A;  3DVJ A;  1B8L A;  2LUX A;  4HSZ A;  4OVN F;  3OB2 B;  3PM2 A;  1MHO A;  2KGR A;  3BUM B;  2JT0 A;  2KSP A;  4ETO A;  5I8N A;  1JF2 A;  2HQW A;  4R1E A;  1EJ3 A;  4INX A;  2M3W A;  1C3Z A;  2KI4 B;  2BCX A;  2BL0 B;  3LK0 A;  2KI6 D;  5D3O A;  1J7Q A;  2Q91 A;  4GGF A;  1IG5 A;  3KPX A;  1CM4 A;  1LKJ A;  3CR2 A;  1SCV A;  1RFJ A;  3EVU A;  2ZKM X;  2K60 A;  3MSE B;  4MN0 A;  5CPV A;  3DYE A;  3BUO B;  1EG4 A;  2LLU A;  1J1E A;  1KQV A;  2WCB A;  4JKT A;  1ZMZ A;  1GGW A;  3KHE A;  4N1G A;  2ZN8 A;  3K1E A;  2I94 A;  1J7O A;  2O60 A;  2WCH A;  1OMV A;  4PCW A;  5JJG A;  4GPL B;  1B9A A;  3L47 A;  3TZ1 A;  3OX5 A;  4A4B A;  2I18 A;  3I5H C;  5KSZ A;  4P2Y B;  1BF5 A;  1UWO A;  1XFU O;  1AUI B;  4AOM A;  1QS7 A;  1IJ5 A;  1WDC C;  3BXK A;  3NSO A;  5D7F A;  1PVA A;  3IF7 A;  1C07 A;  3AKB A;  2KOT A;  2NLN A;  2K7D A;  3SJS A;  5DKN A;  1XFV O;  3PAL A;  2ZRT A;  2COL B;  4M2P A;  1DEK A;  4N1F A;  1U5I A;  1QV0 A;  2PYQ A;  1QV1 A;  1IQ3 A;  2QDI A;  2L2E A;  3BUX B;  3NSI A;  2KQ6 A;  5B8I B;  1RK9 A;  1T14 A;  1OQP A;  2H61 C;  1GJY A;  1A2X A;  3QRX A;  3WNX B;  1BR4 B;  1QAT A;  2K8M B;  5HKY A;  1Y6W A;  1MR8 A;  3SG4 A;  1G4Y R;  1K96 A;  4FQO A;  2MA2 A;  3CLN A;  2ZNE A;  3NHI A;  3S0E A;  3DF0 B;  4N5X A;  3EVV A;  1L2O C;  1CFC A;  1KQM B;  1K90 D;  2GGM A;  2G9B A;  4ORA B;  2IS9 A;  1LA3 A;  1JFK A;  1UUS A;  2H2K A;  5HLO A;  2HPS A;  3AAK A;  2M9G A;  1LA0 A;  1B47 A;  2LVJ A;  1BR1 B;  3E3R A;  3O78 A;  4M2O A;  2WCL A;  2JQ6 A;  4ZCV A;  1D1O A;  1OOF A;  3B6X A;  4GNK B;  5HKZ A;  1SY9 A;  3KF9 A;  2NCP A;  1CKK A;  1AJ4 A;  1FPW A;  2R2I A;  3EKJ A;  1BMO A;  2JZI A;  3I5F C;  1AK8 A;  1S6I A;  3S0G A;  1K9P A;  1YVH A;  2LV7 A;  4MVF A;  3S0F A;  1A03 A;  1H4B A;  1NYA A;  2KFF A;  4MRY A;  1KK7 Z;  1E8A A;  1J7R A;  1NIW A;  2MHH A;  2GGZ A;  2L50 A;  2JTZ A;  3I5H B;  4GAO A;  2LP3 A;  2LHI A;  1DF0 B;  4PHM A;  1G8I A;  1SMG A;  2BKI B;  3FWC A;  4NQG A;  1KK8 C;  1BOD A;  2KAY A;  2I7A A;  2LE9 B;  4XJK A;  1S5G Z;  4PT1 A;  4QJ3 B;  2JRF A;  3DZT A;  3TS5 C;  3CDN A;  3JVT B;  4PDZ A;  1RWY A;  1YVL A;  4NDB A;  1J55 A;  2MBX A;  3O4X A;  1IWQ A;  5AEQ A;  2FJU B;  2KPH A;  2M1U A;  2TN4 A;  1IH0 A;  2CNP A;  3UO9 A;  3VRR A;  1SL7 A;  2KDH A;  1QIV A;  3CS1 A;  4ORC B;  1A75 A;  1OE9 B;  1BLQ A;  2PVB A;  2M7L A;  2AMI A;  2WCM A;  2WND A;  2KFH A;  4GBA A;  2LC5 A;  1YUS A;  2EC6 C;  2ZND A;  5DIC A;  1FI6 A;  1OMD A;  1QXP A;  1SL9 A;  2FCD A;  2PSR A;  4GUK A;  4DRW A;  3CYZ A;  4AQI A;  3SIB A;  1EH2 A;  2D8N A;  3FE6 A;  3EVR A;  2SCP A;  5IBW A;  1CDL A;  2WCE A;  3TDZ A;  1FI5 A;  3CZ1 A;  1ORG A;  2F2P A;  1QX5 B;  1SK6 D;  1TWO A;  2JXC A;  2K0J A;  1CLL A;  3JTD C;  4AQJ A;  4ORB B;  2O5G A;  2ZRS A;  1JC2 A;  2AAO A;  2OPO A;  3DVK A;  1IJ6 A;  2SAS A;  2WCK A;  2Y5I A;  4DCK A;  1NUB A;  1WRK A;  2JU0 A;  3BFB A;  3DD4 A;  4U8D A;  4YGB B;  5G08 A;  1F70 A;  2L2C A;  3OP0 A;  3FS7 A;  5EL2 A;  1ZOT B;  4QJ4 B;  1Q80 A;  2ERB A;  4JPZ B;  2AUC A;  4MLW A;  4USL A;  3I5F B;  3NGV A;  3SG6 A;  5HL1 A;  1B7T Y;  1FF1 A;  1XFY O;  2LCP A;  2JT3 A;  3BQ3 A;  4PE4 A;  1XA5 A;  1WY9 A;  2YGU A;  4MBE A;  1YUR A;  1PUL A;  4Q04 A;  4A4C A;  3I5I C;  4E68 A;  2L98 A;  1B4C A;  1SBJ A;  2MJW B;  1DJZ A;  1CDM A;  2M49 B;  1UHK A;  1TIZ A;  2E30 A;  1MXL C;  1PRW A;  2NXQ A;  2F3Z A;  5ER4 X;  1TTX A;  2BKH B;  1K2H A;  3WHT B;  3TUY C;  1AJ5 A;  5CSN A;  1CLB A;  1CM1 A;  3ZNI A;  1KK8 B;  2KLD A;  2JC2 A;  4F7F A;  3O2P A;  1QAS A;  1F8H A;  1S26 D;  2LM5 A;  3LL8 B;  1K9K A;  2CBL A;  2K2F A;  3D0Y B;  5DKR A;  5HLV A;  4D1E A;  1BOC A;  1F71 A;  5JOL A;  2LMT A;  2MRD A;  3TS5 B;  2JWW A;  2M8U A;  4M2Q A;  4KYN A;  4DUQ A;  4TNC A;  1HQV A;  4GGF C;  2LVI A;  1C7W A;  1KWO C;  3O4Y A;  4OV2 A;  1UHI A;  3LK1 A;  4MZL A;  5CSJ A;  2BAP A;  3DVE A;  4YI8 A;  5AER A;  1TCF A;  2JUL A;  2EC6 B;  2KLE A;  4PE7 A;  3SS3 A;  1XK4 A;  3A4U B;  3PM8 A;  1W7J B;  2G2B A;  4WQ2 A;  4C0K A;  1DTL A;  3I5G C;  3B87 A;  3S0A A;  5KTY A;  4C0J A;  2QEH A;  2JNX A;  2M1K B;  3FIA A;  3WHU B;  2JPT A;  3BYA A;  1K8U A;  3B7A A;  2KGB C;  5J3X A;  1YRU B;  3BJH A;  5HYD A;  1QIW A;  2EGD A;  3GK2 A;  2K2A A;  2QPT A;  3JTD B;  1ZFS A;  3KEV A;  1KCY A;  1CFD A;  1IKU A;  2QEB A;  1TN4 A;  2LUC A;  2A4J A;  3VRQ A;  3R1O A;  1CMF A;  3RZS A;  1LS8 A;  2L0P A;  3BOW B;  3CZ2 A;  3GK4 X;  1TNQ A;  4CLN A;  2ISD A;  1GGZ A;  3IQQ A;  1BT6 A;  2ZN9 A;  4JD9 A;  1YUT A;  3PN7 C;  1MF8 B;  3PJI A;  2GV5 A;  4L9M A;  1AP4 A;  4JWQ A;  5DKQ A;  3OBV A;  3I5I B;  2KYF A;  1MQ1 A;  2I2R E;  3VRN A;  1S36 A;  2BCA A;  2WC6 A;  1Z4H A;  4F0Z B;  1SCM C;  1H8B A;  4FQT A;  1OOI X;  2L51 A;  3LCP C;  1SW8 A;  3GK1 A;  1QWV A;  3L4A A;  1BJF A;  1SL8 A;  3B86 A;  3ICB A;  3TUY B;  1CB1 A;  2DOQ A;  1QLS A;  1DJG A;  4WRI A;  1SPY A;  1Y1U A;  2PAS A;  1DJH A;  4ICB A;  1SRA A;  3H4S E;  3C1V A;  1PAL A;  1TNX A;  3CZT X;  1FW4 A;  3RM1 A;  3PAT A;  1OMR A;  1C7V A;  4HRE E;  1M46 A;  2KI6 C;  1MXE A;  2OTG C;  2K7B A;  3D74 A;  1QJT A;  1WDC B;  1KWO B;  2QEV A;  1XFZ O;  4I5L B;  1TUZ A;  3DXL A;  2HF5 A;  4CPV A;  4FTG A;  5FYX A;  2KI4 C;  1K95 A;  2BL0 C;  3A8R A;  1DGV A;  1EG3 A;  2PMY A;  1OOH A;  5AFP A;  1OSA A;  5AAN A;  3OGN A;  4DIR A;  1TCO B;  2P71 A;  3D73 A;  1OZS A;  3NXA A;  5AXI A;  2KAX A;  3SG7 A;  5HKW A;  1EL4 A;  1OZO A;  1XFX O;  2WOS A;  3LLE A;  1Y0V H;  1YRT B;  1KFU S;  1BU3 A;  3I5G B;  1L7Z A;  1Y1X A;  5D69 A;  4MEW A;  3BUN B;  3FWB A;  3EK4 A;  1XFW O;  3BFA A;  1KK7 Y;  2BBN A;  4YGD B;  5GQQ C;  1XYD A;  2LAP A;  3SG5 A;  1DJY A;  3IVT A;  1UHJ A;  3D76 A;  1DC1 A;  1PK0 D;  1YR5 A;  1M39 A;  1NX0 A;  3OX6 A;  4IL1 A;  4OCI A;  1S6C A;  2GTE A;  1F54 A;  1KFX S;  1QVI Y;  1DEL A;  2WCJ A;  1LXF C;  2Y1M A;  1L2O B;  2NZ0 A;  3CR5 X;  4MZJ A;  2QEO A;  2V53 A;  1ALV A;  1ODB A;  4GFT A;  4YBH B;  1IGV A;  2CXJ A;  3D75 A;  3DF0 A;  3FE9 A;  2CTN A;  4PE1 A;  1XVJ A;  2LVK A;  1CNP A;  4XYN A;  1U5I B;  3CWG A;  1JF0 A;  1B7T Z;  1JUO A;  2L4H A;  5I2L A;  3TDU A;  1NCZ A;  2LLS A;  2BBM A;  2QAC A;  3AAJ A;  4PHK A;  1M45 A;  3CTN A;  2M0R A;  2BE6 A;  3FE8 A;  1Z2C B;  1SKT A;  2E6W A;  2KYC A;  1A29 A;  2KBI A;  1QX7 A;  1SCM B;  1DQE A;  1LVC D;  5FI6 A;  1R2U A;  1NX1 A;  1AVS A;  3EKH A;  2L5X B;  3D77 A;  3TDI A;  4PHN A;  4WQ3 A;  2KHN A;  1NPQ A;  1Y1A A;  3PLF B;  2FCE A;  5TNC A;  1REC A;  1RTP 1;  3V2L A;  5K89 A;  3PSR A;  1F4Q A;  5I2Q A;  3GOF A;  1IIO A;  4HRH A;  2OTG B;  2P70 A;  1UP5 A;  3D78 A;  3OHM B;  1DF0 A;  2KFG A;  3QME A;  2K7C A;  4PE0 A;  3ZWH A;  1DT7 B;  2PAL A;  4DS7 A;  3DVM A;  5I94 A;  1YX8 A;  2RGI A;  3KO0 A;  4MRX A;  4BY4 A; 
#chains in the Genus database with same CATH homology
 1DJI A;  5CSF A;  1IQ5 A;  2HQ8 A;  3EK8 A;  1NWD A;  2LLT A;  1F4O A;  1HT9 A;  1PSR A;  2Q4U A;  3CGA A;  1UHN A;  5CSI A;  4I5K A;  1ZAC A;  1JFJ A;  1CTR A;  2WC8 A;  2JOJ A;  2H61 A;  2M29 A;  2MLE C;  4XJK B;  4BY5 A;  2LP2 A;  4OKH A;  2JNF A;  2M7N A;  2F33 A;  2P6B B;  2Y4Q A;  1WRL A;  1TNW A;  1QTX A;  4QJ5 B;  2OS8 C;  1SNL A;  5I2O A;  1SR6 C;  1W7I B;  3JVT C;  1K94 A;  4I5J A;  4NDD A;  4C0L A;  1OOJ A;  3HX4 A;  1A75 B;  1BG1 A;  2F3Y A;  1NX3 A;  1S1E A;  2K7O A;  1XK4 C;  1VRK A;  4NDC A;  1J7P A;  2LVV A;  1JWD A;  4GGN A;  1TNP A;  1EXR A;  3CR4 X;  3EK7 A;  2Y1N A;  1YX7 A;  1PVB A;  1F55 A;  4P5O E;  1NCX A;  2KQY A;  4CID A;  1KSM A;  1JSA A;  2KNE A;  3SG3 A;  2LMU A;  1A4P A;  3PFV A;  1MUX A;  1WRZ A;  1M63 B;  1S6J A;  1DJX A;  1TOP A;  4CFQ A;  3OB1 B;  1QX2 A;  1N0Y A;  1DGU A;  4PHJ A;  5PAL A;  2HET A;  4PAL A;  2BE4 A;  2JXL A;  2L4I A;  3BUW B;  2CT9 A;  1J1D A;  2LAN A;  2JT8 A;  1FBV A;  3D0Y A;  3AKA A;  2LMV A;  1UUR A;  4ZCU A;  1DMO A;  1B8C A;  1G33 A;  3NSL A;  1QLK A;  1DJW A;  1K9U A;  2F8P A;  4YGC B;  2BEC A;  3HCM A;  1CLM A;  1ZUZ A;  1RRO A;  1WLZ A;  2FOT A;  3NSK A;  1N2D A;  1ALW A;  2JTT A;  2B1U A;  2M97 A;  1B8R A;  1S3P A;  1YUU A;  4YI9 A;  1V1G A;  1KFU L;  1CDN A;  1CFP A;  1KSO A;  1JBA A;  1QVI Z;  2F2O A;  1NP8 A;  4YGE B;  1LIN A;  3WXA A;  2OS8 B;  2KAV A;  4HRG A;  5ER5 A;  1SR6 B;  1V1F A;  4OR9 B;  1XO5 A;  2PRU A;  4CFR A;  1KFX L;  3K21 A;  1PSB A;  2WOR A;  5KU1 A;  4YRU A;  2ZFD A;  4MZK A;  1S5G Y;  4MSP A;  1NCY A;  3RLZ A;  4JQ0 D;  4UPG A;  2VRG A;  1NSH A;  4I5N B;  1IRJ A;  3BOW A;  3O6B A;  3PN7 B;  3VRO A;  2CCM A;  2LHL A;  2MLF C;  5F6T A;  1CFF A;  2K61 A;  3IQO A;  5BPJ A;  1M31 A;  1CMG A;  2KBM A;  1R6P A;  2EHB A;  1B1G A;  1AHR A;  1RJV A;  1TRF A;  3F45 A;  2BCB A;  3D10 A;  1K93 D;  1UHH A;  1SYM A;  3VGO A;  3VRP A;  1MWN A;  1WLM A;  1CDP A;  1GQM A;  2MAZ A;  1X02 A;  1DVI A;  3SG2 A;  3SIA A;  1N65 A;  2WCF A;  2LNK A;  1NX2 A;  1YTZ C;  1KQM C;  3M0W A;  4YGA A;  2NCO A;  3DVJ A;  1B8L A;  2LUX A;  4HSZ A;  4OVN F;  3OB2 B;  1MHO A;  2KGR A;  3BUM B;  2JT0 A;  2KSP A;  4ETO A;  5I8N A;  1JF2 A;  2HQW A;  4R1E A;  1EJ3 A;  1J7Q A;  2M3W A;  2KI4 B;  2BCX A;  2BL0 B;  3LK0 A;  2KI6 D;  2Q91 A;  4GGF A;  1IG5 A;  3KPX A;  1CM4 A;  1LKJ A;  3CR2 A;  1SCV A;  1RFJ A;  3EVU A;  2ZKM X;  3MSE B;  4MN0 A;  5CPV A;  3BUO B;  1EG4 A;  2LLU A;  1J1E A;  1KQV A;  2WCB A;  1ZMZ A;  1GGW A;  3KHE A;  4N1G A;  2ZN8 A;  2I94 A;  1J7O A;  2O60 A;  1OMV A;  5JJG A;  4GPL B;  1B9A A;  3TZ1 A;  3OX5 A;  4A4B A;  2I18 A;  3I5H C;  5KSZ A;  4P2Y B;  1BF5 A;  1UWO A;  1XFU O;  1AUI B;  4AOM A;  1QS7 A;  1IJ5 A;  1WDC C;  3BXK A;  3NSO A;  5D7F A;  1PVA A;  3IF7 A;  1C07 A;  3AKB A;  2KOT A;  2NLN A;  2K7D A;  3SJS A;  5DKN A;  1XFV O;  3PAL A;  2ZRT A;  2COL B;  4M2P A;  4N1F A;  1U5I A;  1QV0 A;  1QV1 A;  1IQ3 A;  3NSI A;  2L2E A;  3BUX B;  2KQ6 A;  5B8I B;  1RK9 A;  1OQP A;  2H61 C;  1GJY A;  1A2X A;  3QRX A;  3WNX B;  1BR4 B;  1QAT A;  2K8M B;  5HKY A;  1Y6W A;  1MR8 A;  3SG4 A;  1G4Y R;  1K96 A;  4FQO A;  2MA2 A;  3CLN A;  2ZNE A;  3DF0 B;  4N5X A;  3EVV A;  1L2O C;  1CFC A;  1KQM B;  1K90 D;  2GGM A;  2G9B A;  4ORA B;  2IS9 A;  1LA3 A;  1JFK A;  1UUS A;  2H2K A;  5HLO A;  2HPS A;  3AAK A;  2M9G A;  1LA0 A;  1B47 A;  2LVJ A;  1BR1 B;  3E3R A;  3O78 A;  4M2O A;  4ZCV A;  2JQ6 A;  1D1O A;  4GNK B;  5HKZ A;  1SY9 A;  3KF9 A;  2NCP A;  1CKK A;  1AJ4 A;  1FPW A;  2R2I A;  3EKJ A;  1BMO A;  2JZI A;  3I5F C;  1AK8 A;  1S6I A;  1K9P A;  1YVH A;  2LV7 A;  4MVF A;  1H4B A;  1A03 A;  1NYA A;  2KFF A;  4MRY A;  1KK7 Z;  1E8A A;  1J7R A;  1NIW A;  2MHH A;  2GGZ A;  2L50 A;  2JTZ A;  3I5H B;  4GAO A;  2LP3 A;  2LHI A;  1DF0 B;  4PHM A;  1G8I A;  1SMG A;  2BKI B;  3FWC A;  4NQG A;  1KK8 C;  1BOD A;  2KAY A;  2I7A A;  2LE9 B;  4XJK A;  1S5G Z;  4QJ3 B;  2JRF A;  3TS5 C;  3JVT B;  4PDZ A;  1RWY A;  1YVL A;  4NDB A;  1J55 A;  2MBX A;  1IWQ A;  5AEQ A;  2FJU B;  2M1U A;  2TN4 A;  1IH0 A;  2CNP A;  3VRR A;  1SL7 A;  2KDH A;  1QIV A;  3CS1 A;  4ORC B;  1A75 A;  1OE9 B;  1BLQ A;  2PVB A;  2M7L A;  2AMI A;  2WND A;  2KFH A;  4GBA A;  2LC5 A;  1YUS A;  2EC6 C;  2ZND A;  1FI6 A;  1OMD A;  1QXP A;  1SL9 A;  2FCD A;  2PSR A;  4GUK A;  4DRW A;  4AQI A;  3SIB A;  1EH2 A;  2D8N A;  3EVR A;  2SCP A;  5IBW A;  1CDL A;  2WCE A;  3TDZ A;  1FI5 A;  2F2P A;  1QX5 B;  1SK6 D;  2JXC A;  2K0J A;  3JTD C;  1CLL A;  4AQJ A;  4ORB B;  2O5G A;  2ZRS A;  1JC2 A;  2AAO A;  2OPO A;  3DVK A;  1IJ6 A;  2SAS A;  2Y5I A;  4DCK A;  1NUB A;  1WRK A;  2JU0 A;  3DD4 A;  4U8D A;  4YGB B;  5G08 A;  1F70 A;  3OP0 A;  3FS7 A;  1ZOT B;  4QJ4 B;  1Q80 A;  4JPZ B;  2AUC A;  4MLW A;  4USL A;  3I5F B;  3SG6 A;  1FF1 A;  1B7T Y;  1XFY O;  2LCP A;  2JT3 A;  3BQ3 A;  4PE4 A;  1XA5 A;  1WY9 A;  4MBE A;  1YUR A;  1PUL A;  4Q04 A;  4A4C A;  3I5I C;  4E68 A;  2L98 A;  1B4C A;  1SBJ A;  2MJW B;  1DJZ A;  1CDM A;  2M49 B;  1UHK A;  1TIZ A;  2E30 A;  1MXL C;  1PRW A;  2NXQ A;  2F3Z A;  5ER4 X;  1TTX A;  2BKH B;  1K2H A;  3WHT B;  3TUY C;  1AJ5 A;  5CSN A;  1CLB A;  1CM1 A;  3ZNI A;  1KK8 B;  2JC2 A;  3O2P A;  1QAS A;  1F8H A;  1S26 D;  2LM5 A;  3LL8 B;  1K9K A;  2CBL A;  2K2F A;  3D0Y B;  5DKR A;  5HLV A;  4D1E A;  1BOC A;  1F71 A;  5JOL A;  2LMT A;  2MRD A;  3TS5 B;  2JWW A;  2M8U A;  4M2Q A;  4DUQ A;  4TNC A;  1HQV A;  4GGF C;  2LVI A;  1C7W A;  1KWO C;  3O4Y A;  4OV2 A;  1UHI A;  3LK1 A;  4MZL A;  5CSJ A;  3DVE A;  4YI8 A;  5AER A;  1TCF A;  2JUL A;  2EC6 B;  4PE7 A;  1XK4 A;  3A4U B;  3PM8 A;  1W7J B;  2G2B A;  4WQ2 A;  4C0K A;  1DTL A;  3I5G C;  5KTY A;  4C0J A;  3FIA A;  2JNX A;  2M1K B;  3WHU B;  2JPT A;  3BYA A;  1K8U A;  2KGB C;  5J3X A;  1YRU B;  5HYD A;  1QIW A;  2EGD A;  3GK2 A;  2K2A A;  2QPT A;  3JTD B;  1ZFS A;  3KEV A;  1KCY A;  1CFD A;  1IKU A;  1TN4 A;  2LUC A;  2A4J A;  3VRQ A;  1CMF A;  2L0P A;  3BOW B;  3GK4 X;  1TNQ A;  4CLN A;  2ISD A;  1GGZ A;  3IQQ A;  1BT6 A;  2ZN9 A;  1YUT A;  3PN7 C;  1MF8 B;  2GV5 A;  4L9M A;  1AP4 A;  4JWQ A;  5DKQ A;  3I5I B;  2KYF A;  1MQ1 A;  2I2R E;  3VRN A;  1S36 A;  2BCA A;  4F0Z B;  1SCM C;  1H8B A;  2L51 A;  3LCP C;  1SW8 A;  3GK1 A;  1BJF A;  1SL8 A;  3ICB A;  3TUY B;  1CB1 A;  2DOQ A;  1QLS A;  1DJG A;  4WRI A;  1SPY A;  1Y1U A;  2PAS A;  1DJH A;  4ICB A;  1SRA A;  3H4S E;  3C1V A;  1PAL A;  1TNX A;  3CZT X;  1FW4 A;  3RM1 A;  3PAT A;  1OMR A;  1C7V A;  4HRE E;  1M46 A;  2KI6 C;  1MXE A;  2OTG C;  2K7B A;  1QJT A;  1WDC B;  1KWO B;  1XFZ O;  4I5L B;  2HF5 A;  4CPV A;  4FTG A;  5FYX A;  2KI4 C;  1K95 A;  2BL0 C;  3A8R A;  1DGV A;  1EG3 A;  2PMY A;  5AFP A;  1OSA A;  5AAN A;  4DIR A;  1TCO B;  1OZS A;  3NXA A;  5AXI A;  2KAX A;  3SG7 A;  5HKW A;  1EL4 A;  1OZO A;  1XFX O;  2WOS A;  3LLE A;  1Y0V H;  1YRT B;  1KFU S;  1BU3 A;  3I5G B;  1L7Z A;  1Y1X A;  5D69 A;  4MEW A;  3BUN B;  3FWB A;  3EK4 A;  1XFW O;  5GQQ C;  1KK7 Y;  2BBN A;  4YGD B;  1XYD A;  2LAP A;  3SG5 A;  1DJY A;  1UHJ A;  1PK0 D;  1YR5 A;  1M39 A;  1NX0 A;  3OX6 A;  4IL1 A;  4OCI A;  1S6C A;  1F54 A;  1KFX S;  1QVI Y;  4PCW A;  1LXF C;  2Y1M A;  1L2O B;  2NZ0 A;  3CR5 X;  4MZJ A;  2V53 A;  4GFT A;  1ALV A;  1ODB A;  4YBH B;  1IGV A;  2CXJ A;  3DF0 A;  4PE1 A;  2CTN A;  1XVJ A;  2LVK A;  1CNP A;  4XYN A;  1U5I B;  3CWG A;  1JF0 A;  1B7T Z;  1JUO A;  2L4H A;  5I2L A;  3TDU A;  1NCZ A;  2LLS A;  2BBM A;  2QAC A;  3AAJ A;  4PHK A;  1M45 A;  3CTN A;  2M0R A;  2BE6 A;  1SKT A;  2E6W A;  2KYC A;  1A29 A;  2KBI A;  1QX7 A;  1SCM B;  1LVC D;  1R2U A;  1NX1 A;  1AVS A;  3EKH A;  2L5X B;  3TDI A;  4PHN A;  4WQ3 A;  2KHN A;  1NPQ A;  1Y1A A;  3PLF B;  2FCE A;  5TNC A;  1REC A;  1RTP 1;  5K89 A;  3PSR A;  1F4Q A;  5I2Q A;  3GOF A;  4HRH A;  2OTG B;  1UP5 A;  3OHM B;  1DF0 A;  2KFG A;  3ZWH A;  2K7C A;  4PE0 A;  1DT7 B;  2PAL A;  4DS7 A;  3DVM A;  1YX8 A;  2RGI A;  3KO0 A;  4MRX A;  4BY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...