4GAOA

Dcnl complex with n-terminally acetylated nedd8 e2 peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
193
structure length
193
Chain Sequence
GSKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DCN1-like protein 2
publication title Structural Conservation of Distinctive N-terminal Acetylation-Dependent Interactions across a Family of Mammalian NEDD8 Ligation Enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/peptide
total genus 57
structure length 193
sequence length 193
chains with identical sequence B, D, G
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gaoA01
1.10.238.200 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4gaoA02
2JULA 1KWOB 4MEWA 4USLA 1J1EA 1ALVA 3JVTC 2I18A 4OR9B 2KOTA 2KGBC 1IJ6A 5ER4X 1WY9A 2SCPA 5JJGA 3DD4A 2OTGC 2JNXA 1UWOA 1CM4A 1MWNA 1IKUA 3JVTB 2M1KB 3GK4X 1RFJA 2PSRA 1MUXA 4ICBA 3AKBA 3AKAA 3EVRA 1RTP1 2DOQA 4L9MA 4MN0A 4CFRA 1LKJA 1RK9A 3PN7C 5AEQA 3VGOA 2BL0C 1SKTA 1QV0A 2Y1MA 3SG3A 1CDLA 1MXEA 1QATA 1B8RA 2OTGB 2FCDA 2Q4UA 1EL4A 4ORBB 2LVKA 4QJ4B 3NSIA 1F8HA 1XFVO 3PN7B 3I5IC 2BL0B 5HKWA 2MA2A 1UHNA 1S36A 1SCMC 2BKIB 3KHEA 4MRYA 4C0LA 4FQOA 1YURA 2H61A 3JTDC 1B8LA 2LNKA 3VROA 2JZIA 4WQ2A 1PALA 1S6JA 1TNXA 2KI6C 3I5IB 1ZUZA 3TDIA 1A2XA 3TUYC 1SCMB 1J7QA 4A4BA 3JTDB 2TN4A 3PALA 3LL8B 3VRNA 3SJSA 1G33A 2MAZA 1LA0A 1D1OA 4ZCVA 1W7JB 3GOFA 3FWBA 2WC8A 3AAKA 3TUYB 3C1VA 1X02A 1EH2A 1J7PA 1HQVA 1TNPA 1FI6A 1B7TZ 2LHIA 5I2QA 1CLMA 1ZOTB 2ZNEA 2COLB 4Q04A 3DF0B 2F33A 2WCFA 1XFWO 2L4HA 1WLZA 1CDNA 1Y1AA 1S6CA 1CFDA 1IJ5A 1EG3A 1AVSA 2NCPA 3WNXB 4C0JA 3CZTX 4I5NB 2CTNA 2L2EA 1DF0A 3BUOB 2K0JA 2LP3A 2GV5A 1L2OC 1XK4A 1MQ1A 1R2UA 2G2BA 3CLNA 3KPXA 1KCYA 1Q80A 2OS8C 1JWDA 1KQMC 1ZACA 3O78A 1OQPA 4CPVA 4YGCB 1BR4B 1XVJA 3TDZA 1L2OB 3KEVA 1L7ZA 1SK6D 3OB1B 2KAYA 4D1EA 1TIZA 2LM5A 3HCMA 2HF5A 2OS8B 1KQMB 2KNEA 2B1UA 1SNLA 2KHNA 1F4QA 3EKJA 1FF1A 2Q91A 5HKZA 1IG5A 2JTTA 3DVEA 1QX7A 4N1FA 1YUSA 2WOSA 5AXIA 4GGNA 1SYMA 1KFXS 4C0KA 2F3YA 2GGZA 3LK1A 1J7RA 2KI6D 1IRJA 3FIAA 4GUKA 1F70A 2LP2A 1CTRA 2G9BA 1F71A 5PALA 3CTNA 2PALA 3BOWB 1OE9B 2EC6C 2KI4C 1CFCA 1V1FA 3VRPA 2MHHA 3PM8A 1OZSA 1QX5B 4DCKA 4WRIA 3SG6A 1UHIA 2EC6B 2F2OA 1CB1A 1QTXA 1AUIB 2NXQA 2KI4B 1QASA 4P5OE 2FCEA 1UP5A 1JFJA 1IQ5A 1W7IB 2M7NA 1C7VA 2MJWB 2QPTA 3BQ3A 2QACA 1AHRA 4GBAA 4PHMA 1AP4A 2D8NA 3M0WA 1QIWA 2AMIA 2V53A 2NLNA 3OB2B 4HSZA 2LLSA 5J3XA 1QV1A 1XFUO 1NX1A 1FPWA 1MHOA 2PRUA 3I5HC 3CGAA 1NP8A 1C07A 4MVFA 1LINA 2ZKMX 2BBMA 1YRTB 1K94A 2K2AA 4M2QA 2R2IA 1AJ4A 1WRZA 3VRQA 4A4CA 4NDBA 5FYXA 1CMGA 1YR5A 3GK2A 3I5HB 1ODBA 4PCWA 1HT9A 5KTYA 1QIVA 2JXLA 4QJ5B 1K2HA 2M0RA 1K9PA 1CMFA 1EXRA 2MLFC 1CNPA 1A75B 2LVVA 1QXPA 1YUTA 2PMYA 2M9GA 3ICBA 1CFPA 3LK0A 3CR4X 3PSRA 4FTGA 1Y0VH 4M2OA 1IGVA 3NXAA 4JQ0D 4AQIA 2F3ZA 1B1GA 1OMVA 2KGRA 3OX6A 5K89A 4PE4A 5DKQA 4YI8A 1JFKA 1WRKA 2I2RE 5HLOA 1MF8B 1IWQA 1DGVA 1A03A 4E68A 1PSRA 2Y5IA 1CKKA 1BR1B 2E30A 4PHKA 3WHUB 2KQ6A 1QVIY 2LMUA 4XJKB 2KFHA 1DJXA 1GJYA 1B7TY 2JU0A 5DKRA 2KBMA 4GGFC 2M8UA 4YGDB 1KK8C 1SY9A 2LCPA 4PALA 2O5GA 4TNCA 3PATA 1UUSA 2BECA 5CSFA 2K7BA 2M29A 3TZ1A 2BBNA 2K61A 1VRKA 5G08A 1AJ5A 1Y1XA 4GFTA 2MLEC 3RLZA 1PSBA 1KK8B 4M2PA 3EK4A 1K8UA 2JRFA 3EK8A 5DKNA 5JOLA 1QVIZ 3H4SE 1BJFA 1DJIA 4PE0A 4U8DA 2WNDA 2BKHB 5I8NA 1A4PA 3A8RA 4DUQA 2WORA 3CR2A 4GNKB 4MLWA 4MZJA 1YTZC 1IQ3A 1DJGA 2VRGA 3O6BA 1JBAA 3E3RA 1CLBA 3A4UB 1ZFSA 1F54A 1E8AA 2L50A 2BE4A 2K2FA 3IF7A 2BCBA 4OKHA 5GQQC 3SG2A 1NUBA 1SMGA 1B47A 1TNQA 1KFUL 3FS7A 4YGEB 1XFZO 1NYAA 1S1EA 1OSAA 4PE7A 4CIDA 4AQJA 2JNFA 2ZRSA 1YVLA 3CWGA 4UPGA 1WDCC 2E6WA 1NCZA 1LA3A 2LV7A 2PVBA 3D10A 1S26D 3I5GC 3TS5C 1SCVA 1RJVA 1LXFC 5KSZA 1GGZA 1OMDA 2Y4QA 2JOJA 4HRGA 4N1GA 3PFVA 5TNCA 1WDCB 2I7AA 1UHKA 4GGFA 2CXJA 3I5GB 3TS5B 1NPQA 5AERA 2IS9A 2KAVA 1XFXO 1CFFA 1SL8A 4CFQA 5AFPA 4OCIA 1TCFA 4MBEA 1SPYA 2CNPA 5CSJA 2LE9B 2MRDA 3BUMB 3DF0A 1JC2A 3SIAA 2LANA 1TTXA 2HETA 2BE6A 3KF9A 2O60A 2JXCA 4JWQA 1SBJA 1ZMZA 2LLUA 5BPJA 4GAOA 1NX0A 1CLLA 2JWWA 1SRAA 1U5IB 3QRXA 4HRHA 2GGMA 1SW8A 1IH0A 1NCYA 3PLFB 2KSPA 1S6IA 3BUXB 2JT3A 2JPTA 1M63B 1M46A 3MSEB 5B8IB 4YGAA 2LUCA 4R1EA 1B4CA 1K93D 1UHJA 3O2PA 1KSMA 1XYDA 2LVJA 3O4YA 1OZOA 2KYFA 3BYAA 1NX3A 4YBHB 4MRXA 1F55A 3K21A 1MXLC 2NCOA 2KAXA 1RROA 2AUCA 1GQMA 1BT6A 1UHHA 4ETOA 3SG5A 1CDPA 1K9UA 1EJ3A 2WCBA 4P2YB 1H8BA 2LMTA 5ER5A 1WLMA 2JC2A 1DJWA 3SIBA 3ZNIA 2HPSA 1GGWA 3BOWA 4NQGA 1DJHA 4I5KA 4ORAB 1YX8A 4YGBB 3NSKA 2EHBA 2K7CA 4PDZA 4OVNF 2LC5A 1DT7B 2SASA 4PE1A 4JPZB 1JF2A 1MR8A 3LLEA 4YI9A 1B8CA 2ISDA 1XO5A 5CSIA 1NCXA 1H4BA 2K8MB 3OX5A 1QX2A 1YUUA 3I5FC 1BG1A 1SL7A 3D0YB 1YRUB 4OV2A 1BF5A 1DJZA 1J7OA 2AAOA 1TCOB 3I5FB 2M97A 2OPOA 3CS1A 4PHNA 2F8PA 3EVVA 3TDUA 1KFXL 3EK7A 3HX4A 1RECA 1XK4C 2HQWA 1QLSA 1KK7Y 4GPLB 1PULA 3IQQA 1BODA 3RM1A 4QJ3B 2MBXA 4PHJA 3BXKA 2H2KA 1N0YA 1NSHA 2F2PA 2M7LA 4DS7A 1DF0B 4BY4A 4XYNA 2LMVA 5HKYA 1BMOA 4IL1A 1KSOA 2A4JA 5D69A 2HQ8A 5D7FA 1K96A 1TRFA 2LHLA 2RGIA 1A75A 3AAJA 3SG7A 2Y1NA 1YVHA 1NWDA 1R6PA 4I5JA 1NIWA 1KK7Z 4YRUA 2KBIA 5CSNA 1RWYA 1Y6WA 1SR6C 3BUWB 1QJTA 4AOMA 3VRRA 3OP0A 2EGDA 1G8IA 1M39A 1JSAA 1K90D 4NDDA 1PVBA 2L4IA 3D0YA 3DVKA 5CPVA 5I2OA 2P6BB 1SR6B 4XJKA 3OHMB 2KYCA 2FOTA 2JTZA 4MSPA 2LAPA 2M49B 4CLNA 5AANA 3DVJA 5IBWA 1S5GY 1G4YR 3IQOA 3CR5X 3NSOA 1DGUA 3NSLA 3SG4A 2FJUB 1PK0D 1B9AA 3ZWHA 1BLQA 2ZN8A 5HLVA 1OMRA 4HREE 1PRWA 2LLTA 1DMOA 1F4OA 1TOPA 4I5LB 2ZNDA 3EKHA 4DRWA 1AK8A 1J1DA 3F45A 1CM1A 1A29A 2LUXA 5KU1A 1QS7A 1FI5A 1K95A 2K7DA 1DVIA 1S5GZ 1PVAA 4WQ3A 2CT9A 2KFGA 1WRLA 2BCXA 1JUOA 1N2DA 1BOCA 3WXAA 1JF0A 1V1GA 1J55A 1FBVA 1UURA 3WHTB 2ZRTA 1DJYA 2M1UA 2LVIA 1TN4A 1K9KA 3BUNB 2I94A 4MZLA 5F6TA 5HYDA 2ZFDA 2KDHA 4ORCB 2K7OA 2L51A 2M3WA 1C7WA 1N65A 2PASA 1SL9A 2L0PA 1TNWA 3DVMA 4F0ZB 1YX7A 4DIRA 3FWCA 3KO0A 1NX2A 1Y1UA 1QLKA 1CDMA 1LVCD 2CCMA 1EG4A 2H61C 3EVUA 4BY5A 1ALWA 2NZ0A 4N5XA 1BU3A 1KQVA 3GK1A 1KWOC 3LCPC 1XFYO 2WCEA 1M31A 2JT8A 1FW4A 2KFFA 1KFUS 4ZCUA 2KQYA 2JT0A 2BCAA 1XA5A 1M45A 1OOJA 2CBLA 1DTLA 2JQ6A 2L5XB 4MZKA 5I2LA 1U5IA 2ZN9A 1S3PA 4NDCA 2L98A
chains in the Genus database with same CATH superfamily
2JULA 1KWOB 4MEWA 3S0EA 4USLA 1J1EA 2PQLA 2QEHA 1ALVA 1C3ZA 3N7HA 3JVTC 2I18A 4OR9B 2KOTA 2KGBC 1IJ6A 5ER4X 1WY9A 2SCPA 5JJGA 3DD4A 2OTGC 2JNXA 1UWOA 1CM4A 1MWNA 1IKUA 3JVTB 2M1KB 3GK4X 1RFJA 2PSRA 1MUXA 4ICBA 3AKBA 3AKAA 3EVRA 1RTP1 2DOQA 4L9MA 4MN0A 4CFRA 1LKJA 1RK9A 3PN7C 5AEQA 3VGOA 2BL0C 1SKTA 1QV0A 2Y1MA 3SG3A 1CDLA 1MXEA 1QATA 1B8RA 2OTGB 2FCDA 3R1OA 2Q4UA 1EL4A 4ORBB 2LVKA 4QJ4B 3CABA 3NSIA 1F8HA 1XFVO 2K60A 3O4XA 3PN7B 3I5IC 2BL0B 5HKWA 2MA2A 2WC5A 1UHNA 1S36A 1SCMC 2BKIB 3KHEA 1XFRA 4MRYA 4C0LA 4FQOA 1YURA 2H61A 3JTDC 1B8LA 3D76A 3PM2A 2LNKA 3VROA 2JZIA 4WQ2A 1PALA 1S6JA 1TNXA 2KI6C 3I5IB 1ZUZA 1IIOA 3TDIA 1A2XA 3TUYC 1SCMB 1J7QA 4A4BA 3JTDB 2TN4A 4INWA 3PALA 3BFAA 3LL8B 3VRNA 3SJSA 1G33A 2MAZA 2YGUA 1LA0A 1D1OA 4ZCVA 1W7JB 3GOFA 3FWBA 2WC8A 3AAKA 3TUYB 2JPOA 1X02A 3C1VA 3UO9A 1J7PA 1EH2A 1HQVA 3NHTA 1TNPA 1FI6A 1B7TZ 2LHIA 5I2QA 1CLMA 1ZOTB 2ZNEA 2COLB 4Q04A 3DF0B 2F33A 2WCFA 1XFWO 2L4HA 1WLZA 1CDNA 1DQEA 1Y1AA 1S6CA 3R1PA 1CFDA 1IJ5A 1EG3A 1AVSA 2NCPA 3WNXB 4C0JA 3CZTX 4I5NB 2CTNA 2L2EA 3UNWA 1DF0A 3BUOB 2K0JA 2LP3A 2GV5A 1L2OC 1XK4A 1MQ1A 1R2UA 2G2BA 3CLNA 3R1VA 4F7FA 3KPXA 1KCYA 1Q80A 2OS8C 1JWDA 1KQMC 1ZACA 3O78A 1OQPA 1OOFA 4CPVA 5FI7A 4YGCB 1BR4B 3DZTA 1XVJA 3TDZA 1L2OB 3KEVA 1L7ZA 1SK6D 3OB1B 2KAYA 4D1EA 1TIZA 2LM5A 2BAPA 3HCMA 2HF5A 2OS8B 1KQMB 2KNEA 2B1UA 1SNLA 2KHNA 2GTEA 1F4QA 3EKJA 1FF1A 2Q91A 1C3YA 5HKZA 1IG5A 2JTTA 3DVEA 1QX7A 4N1FA 3PJIA 1YUSA 2WOSA 5AXIA 4GGNA 1SYMA 1KFXS 4C0KA 2F3YA 2GGZA 3LK1A 1J7RA 3B87A 2KI6D 1IRJA 3FIAA 4GUKA 1TWOA 1F70A 2LP2A 1CTRA 2G9BA 1F71A 5PALA 3CTNA 2PALA 3BOWB 1OE9B 2EC6C 1OW4A 2KPHA 1P28A 2KLDA 2KI4C 1CFCA 1V1FA 3VRPA 2MHHA 3PM8A 2QEBA 1OZSA 1QX5B 2H8VA 4DCKA 4WRIA 3SG6A 1UHIA 2EC6B 2F2OA 1CB1A 1QTXA 1AUIB 2NXQA 2KI4B 1QASA 4P5OE 2FCEA 1UP5A 1JFJA 1IQ5A 1W7IB 2M7NA 3FE9A 1C7VA 2MJWB 2QPTA 2ERBA 2QEOA 3BQ3A 2QACA 1AHRA 4GBAA 4PHMA 1AP4A 3CYZA 2D8NA 3M0WA 1QIWA 2AMIA 2V53A 2NLNA 3OB2B 4HSZA 2LLSA 5J3XA 1QV1A 1XFUO 1NX1A 1FPWA 1MHOA 2PRUA 3I5HC 3CGAA 1NP8A 1C07A 4MVFA 1LINA 1QWVA 2ZKMX 2BBMA 3L4AA 1YRTB 1K94A 2K2AA 4M2QA 2R2IA 5HL1A 1AJ4A 1WRZA 3DY9A 3VRQA 4A4CA 3SS5A 2PYQA 5D3OA 4NDBA 5FYXA 1CMGA 1YR5A 3GK2A 3I5HB 1ODBA 4PCWA 1HT9A 5KTYA 1QIVA 3D77A 2JXLA 4QJ5B 1K2HA 2M0RA 1K9PA 1CMFA 1EXRA 2MLFC 1CNPA 1A75B 2LVVA 1QXPA 1YUTA 2PMYA 2M9GA 3ICBA 1CFPA 2L2CA 2BNXA 3CR4X 3LK0A 1Y0VH 3PSRA 1IGVA 3NXAA 4FTGA 4JQ0D 4M2OA 2F3ZA 4AQIA 1B1GA 1OMVA 1SSEB 2KGRA 3OX6A 5K89A 4PE4A 5DKQA 2QEVA 4YI8A 1JFKA 1WRKA 2I2RE 5HLOA 1MF8B 1IWQA 1DGVA 1A03A 4E68A 1PSRA 2Y5IA 1CKKA 1BR1B 2E30A 4PHKA 3WHUB 3CZ0A 2KQ6A 1QVIY 2LMUA 4XJKB 2KFHA 1DJXA 2KLEA 1GJYA 1B7TY 2JU0A 5DKRA 2KBMA 3B6XA 4GGFC 2M8UA 4YGDB 1KK8C 3L47A 1SY9A 2LCPA 4PALA 2O5GA 4TNCA 3PATA 1UUSA 2BECA 5CSFA 2K7BA 2M29A 3TZ1A 2BBNA 2K61A 1VRKA 5G08A 1AJ5A 1Y1XA 4GFTA 2MLEC 3RLZA 1PSBA 1KK8B 4M2PA 3EK4A 1K8UA 2JRFA 2L5YA 3EK8A 5DKNA 5JOLA 3QMEA 1QVIZ 3H4SE 1BJFA 1DJIA 4PE0A 3S0DA 4U8DA 2WNDA 2BKHB 3EG5B 5I8NA 5I94A 1DELA 1A4PA 3A8RA 4DUQA 2WORA 3CR2A 4GNKB 4MLWA 4MZJA 1YTZC 1IQ3A 1DJGA 2VRGA 3O6BA 1JBAA 3E3RA 1CLBA 3A4UB 1ZFSA 3B86A 1E8AA 1F54A 3VB1A 2L50A 2BE4A 2K2FA 3IF7A 2BCBA 4OKHA 5GQQC 3SG2A 1NUBA 1SMGA 1B47A 1TNQA 3B88A 1KFUL 3FS7A 4YGEB 1XFZO 3S0AA 2FJYA 1NYAA 1S1EA 1OSAA 4PE7A 4CIDA 4AQJA 2JNFA 2ZRSA 1YVLA 3CWGA 4UPGA 1WDCC 2E6WA 5EL2A 1NCZA 1LA3A 2LV7A 2PVBA 3D10A 1S26D 3I5GC 3TS5C 1SCVA 1RJVA 1LXFC 5KSZA 1GGZA 1OMDA 2Y4QA 2JOJA 4HRGA 4N1GA 3PFVA 5TNCA 1WDCB 2I7AA 1UHKA 4GGFA 2CXJA 3I5GB 2WCLA 3TS5B 1NPQA 5AERA 2WCKA 2IS9A 2KAVA 1XFXO 1CFFA 1SL8A 4CFQA 5AFPA 4OCIA 1TCFA 4MBEA 1SPYA 2CNPA 5CSJA 2LE9B 3S0FA 2MRDA 3BUMB 3DF0A 1JC2A 3SIAA 2LANA 1TTXA 2HETA 2BE6A 3KF9A 2O60A 2JXCA 3NHIA 4JWQA 1SBJA 1ZMZA 2LLUA 5BPJA 4GAOA 1NX0A 3D74A 1CLLA 2JWWA 1SRAA 1U5IB 3QRXA 4HRHA 2GGMA 1SW8A 1IH0A 1NCYA 3CZ2A 3DYEA 1TUZA 3PLFB 2KSPA 1S6IA 3BUXB 2JT3A 2JPTA 1M63B 2WCJA 1M46A 3MSEB 5B8IB 3OGNA 4YGAA 2LUCA 4R1EA 1B4CA 1K93D 1UHJA 3O2PA 1KSMA 1XYDA 2LVJA 3O4YA 1OZOA 2KYFA 3BYAA 1NX3A 4YBHB 4MRXA 1F55A 3K21A 1MXLC 2P71A 2NCOA 2KAXA 1RROA 2AUCA 1GQMA 1BT6A 1UHHA 4ETOA 5FI6A 1ORGA 3SG5A 3DXLA 1DEKA 1CDPA 1K9UA 1EJ3A 2WCBA 4P2YB 1H8BA 2LMTA 5ER5A 1Z2CB 1WLMA 2JC2A 1DJWA 3SIBA 3ZNIA 2HPSA 1GGWA 3BOWA 4NQGA 1DJHA 4I5KA 4ORAB 1YX8A 4JD9A 3FE6A 4YGBB 3NSKA 2EHBA 2K7CA 4PDZA 1TUJA 4OVNF 3CZ1A 2LC5A 1DT7B 2SASA 4PE1A 4JPZB 1JF2A 1MR8A 3IVTA 3LLEA 4YI9A 2WCHA 1B8CA 2ISDA 1XO5A 5CSIA 1NCXA 1Z4HA 2K8MB 3OX5A 1H4BA 1QX2A 1YUUA 3I5FC 3D75A 4OZDA 4IJ7A 3FE8A 1BG1A 1SL7A 3BFBA 1YRUB 3D0YB 3K1EA 4OV2A 1BF5A 1DJZA 1OOHA 1J7OA 2AAOA 1TCOB 3I5FB 2WCMA 2M97A 2OPOA 3CS1A 4FQTA 4PHNA 1OOIX 2F8PA 3BJHA 1KFXL 2P70A 3EVVA 3EK7A 3HX4A 3TDUA 1RECA 1XK4C 2HQWA 3D73A 1QLSA 1KK7Y 3D78A 4GPLB 1PULA 3IQQA 3RZSA 1BODA 3RM1A 4QJ3B 2MBXA 4PHJA 3BXKA 2H2KA 1N0YA 1NSHA 2F2PA 2M7LA 4DS7A 1DF0B 4BY4A 4XYNA 2LMVA 5HKYA 1BMOA 4IL1A 1KSOA 2A4JA 5D69A 2HQ8A 1W9ZA 5D7FA 1K96A 1TRFA 2LHLA 1OOGA 2RGIA 1A75A 3AAJA 3SG7A 2Y1NA 1YVHA 1NWDA 1R6PA 4I5JA 1NIWA 1KK7Z 4YRUA 2KBIA 5CSNA 1RWYA 1Y6WA 4JKTA 1SR6C 3BUWB 1QJTA 4AOMA 3VRRA 3OP0A 2EGDA 1G8IA 1M39A 1JSAA 1K90D 4NDDA 1PVBA 3S0GA 2L4IA 3D0YA 3DVKA 5CPVA 5I2OA 2P6BB 3L4LA 1SR6B 4XJKA 3OHMB 2KYCA 2FOTA 2JTZA 4MSPA 2LAPA 2M49B 3SS3A 4CLNA 5AANA 3DVJA 5IBWA 1S5GY 1G4YR 3IQOA 3CR5X 3NSOA 1DGUA 3NSLA 3SG4A 2FJUB 1PK0D 1B9AA 3ZWHA 1BLQA 2ZN8A 5HLVA 1OMRA 4PT1A 3NGVA 1PRWA 2LLTA 4HREE 1DMOA 3BFHA 1F4OA 1TOPA 4I5LB 2ZNDA 3EKHA 4DRWA 1AK8A 2QDIA 1J1DA 3F45A 1CM1A 1A29A 3OBVA 2LUXA 5KU1A 1QS7A 1FI5A 1K95A 2K7DA 1DVIA 1S5GZ 1PVAA 4WQ3A 2CT9A 2KFGA 1WRLA 2BCXA 1JUOA 1N2DA 1BOCA 3WXAA 1JF0A 3CDNA 1V1GA 1J55A 1FBVA 1UURA 3WHTB 2ZRTA 1DJYA 2M1UA 2LVIA 1TN4A 1K9KA 3BUNB 2I94A 3Q8IA 4MZLA 5F6TA 5HYDA 2ZFDA 2KDHA 2WC6A 3B7AA 4ORCB 2K7OA 2L51A 3S0BA 2M3WA 1C7WA 1N65A 2PASA 1SL9A 2L0PA 1TNWA 3DVMA 4F0ZB 5DICA 1YX7A 4DIRA 3FWCA 3KO0A 1NX2A 1Y1UA 1QLKA 1CDMA 1LVCD 2CCMA 1EG4A 2H61C 3EVUA 3V2LA 1GM0A 4BY5A 1ALWA 2NZ0A 3R72A 4N5XA 1BU3A 4KYNA 3GK1A 1KQVA 3SS4A 1KWOC 3LCPC 4INXA 1XFYO 1DC1A 2WCEA 1M31A 1LS8A 1FW4A 2JT8A 2KFFA 1KFUS 1T14A 4ZCUA 2KQYA 2JT0A 2BCAA 1XA5A 1M45A 1OOJA 2CBLA 1DTLA 2JQ6A 2L5XB 4MZKA 5I2LA 1U5IA 2ZN9A 1S3PA 4NDCA 5FI2A 2L98A
chains in the Genus database with same CATH topology
2JULA 1KWOB 4MEWA 4USLA 1J1EA 1ALVA 3JVTC 2I18A 4OR9B 2KOTA 2KGBC 1IJ6A 5ER4X 1WY9A 2SCPA 5JJGA 3DD4A 2OTGC 2JNXA 1UWOA 1CM4A 1MWNA 1IKUA 3JVTB 2M1KB 3GK4X 1RFJA 2PSRA 1MUXA 4ICBA 3AKBA 3AKAA 3EVRA 1RTP1 2DOQA 4L9MA 4MN0A 4CFRA 1LKJA 1RK9A 3PN7C 5AEQA 3VGOA 2BL0C 1SKTA 1QV0A 2Y1MA 3SG3A 1CDLA 1MXEA 1QATA 1B8RA 2OTGB 2FCDA 2Q4UA 1EL4A 4ORBB 2LVKA 4QJ4B 3NSIA 1F8HA 1XFVO 2K60A 3O4XA 3PN7B 3I5IC 2BL0B 5HKWA 2MA2A 1UHNA 1S36A 1SCMC 2BKIB 3KHEA 4MRYA 4C0LA 4FQOA 1YURA 2H61A 3JTDC 1B8LA 3PM2A 2LNKA 3VROA 2JZIA 4WQ2A 1PALA 1S6JA 1TNXA 2KI6C 3I5IB 1ZUZA 3TDIA 1A2XA 3TUYC 1SCMB 1J7QA 4A4BA 3JTDB 2TN4A 3PALA 3LL8B 3VRNA 3SJSA 1G33A 2MAZA 2YGUA 1LA0A 1D1OA 4ZCVA 1W7JB 3GOFA 3FWBA 2WC8A 3AAKA 3TUYB 3C1VA 1X02A 1EH2A 1J7PA 3UO9A 1HQVA 1TNPA 1FI6A 1B7TZ 2LHIA 5I2QA 1CLMA 1ZOTB 2ZNEA 2COLB 4Q04A 3DF0B 2F33A 2WCFA 1XFWO 2L4HA 1WLZA 1CDNA 1Y1AA 1S6CA 1CFDA 1IJ5A 1EG3A 1AVSA 2NCPA 3WNXB 4C0JA 3CZTX 4I5NB 2CTNA 2L2EA 3UNWA 1DF0A 3BUOB 2K0JA 2LP3A 2GV5A 1L2OC 1XK4A 1MQ1A 1R2UA 2G2BA 3CLNA 3KPXA 1KCYA 1Q80A 2OS8C 1JWDA 1KQMC 1ZACA 3O78A 1OQPA 4CPVA 5FI7A 4YGCB 1BR4B 1XVJA 3TDZA 1L2OB 3KEVA 1L7ZA 1SK6D 3OB1B 2KAYA 4D1EA 1TIZA 2LM5A 3HCMA 2BAPA 2HF5A 2OS8B 1KQMB 2KNEA 2B1UA 1SNLA 2KHNA 1F4QA 3EKJA 1FF1A 2Q91A 5HKZA 1IG5A 2JTTA 3DVEA 1QX7A 4N1FA 1YUSA 2WOSA 5AXIA 4GGNA 1SYMA 1KFXS 4C0KA 2F3YA 2GGZA 3LK1A 1J7RA 2KI6D 1IRJA 3FIAA 4GUKA 1F70A 2LP2A 1CTRA 2G9BA 1F71A 5PALA 3CTNA 2PALA 3BOWB 1OE9B 2EC6C 2KLDA 2KI4C 1CFCA 1V1FA 3VRPA 2MHHA 3PM8A 1OZSA 1QX5B 4DCKA 4WRIA 3SG6A 1UHIA 2EC6B 2F2OA 1CB1A 1QTXA 1AUIB 2NXQA 2KI4B 1QASA 4P5OE 2FCEA 1UP5A 1JFJA 1IQ5A 1W7IB 2M7NA 1C7VA 2MJWB 2QPTA 3BQ3A 2QACA 1AHRA 4GBAA 4PHMA 1AP4A 2D8NA 3M0WA 1QIWA 2AMIA 2V53A 2NLNA 3OB2B 4HSZA 2LLSA 5J3XA 1QV1A 1XFUO 1NX1A 1FPWA 1MHOA 2PRUA 3I5HC 3CGAA 1NP8A 1C07A 4MVFA 1LINA 2ZKMX 2BBMA 1YRTB 1K94A 2K2AA 4M2QA 2R2IA 5HL1A 1AJ4A 1WRZA 3VRQA 4A4CA 3SS5A 5D3OA 4NDBA 5FYXA 1CMGA 1YR5A 3GK2A 3I5HB 1ODBA 4PCWA 1HT9A 5KTYA 1QIVA 2JXLA 4QJ5B 1K2HA 2M0RA 1K9PA 1CMFA 1EXRA 2MLFC 1CNPA 1A75B 2LVVA 1QXPA 1YUTA 2PMYA 2M9GA 3ICBA 1CFPA 3LK0A 3CR4X 3PSRA 4FTGA 1Y0VH 4M2OA 1IGVA 3NXAA 4JQ0D 4AQIA 2BNXA 2F3ZA 1B1GA 1OMVA 2KGRA 3OX6A 5K89A 4PE4A 5DKQA 4YI8A 1JFKA 1WRKA 2I2RE 5HLOA 1MF8B 1IWQA 1DGVA 1A03A 4E68A 1PSRA 2Y5IA 1CKKA 1BR1B 2E30A 4PHKA 3WHUB 2KQ6A 1QVIY 2LMUA 4XJKB 2KFHA 1DJXA 2KLEA 1GJYA 1B7TY 2JU0A 5DKRA 2KBMA 4GGFC 2M8UA 4YGDB 1KK8C 1SY9A 2LCPA 4PALA 2O5GA 4TNCA 3PATA 1UUSA 2BECA 5CSFA 2K7BA 2M29A 3TZ1A 2BBNA 2K61A 1VRKA 5G08A 1AJ5A 1Y1XA 4GFTA 2MLEC 3RLZA 1PSBA 1KK8B 4M2PA 3EK4A 1K8UA 2JRFA 3EK8A 5DKNA 2L5YA 5JOLA 1QVIZ 3H4SE 1BJFA 1DJIA 4PE0A 4U8DA 2WNDA 2BKHB 3EG5B 5I8NA 5I94A 1DELA 1A4PA 3A8RA 4DUQA 2WORA 3CR2A 4GNKB 4MLWA 4MZJA 1YTZC 1IQ3A 1DJGA 2VRGA 3O6BA 1JBAA 3E3RA 1CLBA 3A4UB 1ZFSA 1F54A 1E8AA 2L50A 2BE4A 2K2FA 3IF7A 2BCBA 4OKHA 5GQQC 3SG2A 1NUBA 1SMGA 1B47A 1TNQA 1KFUL 3FS7A 4YGEB 1XFZO 1NYAA 1S1EA 1OSAA 4PE7A 4CIDA 4AQJA 2JNFA 2ZRSA 1YVLA 3CWGA 4UPGA 1WDCC 2E6WA 1NCZA 1LA3A 2LV7A 2PVBA 3D10A 1S26D 3I5GC 3TS5C 1SCVA 1RJVA 1LXFC 5KSZA 1GGZA 1OMDA 2Y4QA 2JOJA 4HRGA 4N1GA 3PFVA 5TNCA 1WDCB 2I7AA 1UHKA 4GGFA 2CXJA 3I5GB 3TS5B 1NPQA 5AERA 2IS9A 2KAVA 1XFXO 1CFFA 1SL8A 4CFQA 5AFPA 4OCIA 1TCFA 4MBEA 1SPYA 2CNPA 5CSJA 2LE9B 2MRDA 3BUMB 3DF0A 1JC2A 3SIAA 2LANA 1TTXA 2HETA 2BE6A 3KF9A 2O60A 2JXCA 4JWQA 1SBJA 1ZMZA 2LLUA 5BPJA 4GAOA 1NX0A 1CLLA 2JWWA 1SRAA 1U5IB 3QRXA 4HRHA 2GGMA 1SW8A 1IH0A 1NCYA 3PLFB 2KSPA 1S6IA 3BUXB 2JT3A 2JPTA 1M63B 1M46A 3MSEB 5B8IB 4YGAA 2LUCA 4R1EA 1B4CA 1K93D 1UHJA 3O2PA 1KSMA 1XYDA 2LVJA 3O4YA 1OZOA 2KYFA 3BYAA 1NX3A 4YBHB 4MRXA 1F55A 3K21A 1MXLC 2NCOA 2KAXA 1RROA 2AUCA 1GQMA 1BT6A 1UHHA 4ETOA 5FI6A 3SG5A 1DEKA 1CDPA 1K9UA 1EJ3A 2WCBA 4P2YB 1H8BA 2LMTA 5ER5A 1Z2CB 1WLMA 2JC2A 1DJWA 3SIBA 3ZNIA 2HPSA 1GGWA 3BOWA 4NQGA 1DJHA 4I5KA 4ORAB 1YX8A 4YGBB 3NSKA 2EHBA 2K7CA 4PDZA 4OVNF 2LC5A 1DT7B 2SASA 4PE1A 4JPZB 1JF2A 1MR8A 3LLEA 3IVTA 4YI9A 1B8CA 2ISDA 1XO5A 5CSIA 1NCXA 1H4BA 2K8MB 3OX5A 1Z4HA 1QX2A 1YUUA 3I5FC 4IJ7A 1BG1A 1SL7A 3D0YB 1YRUB 4OV2A 1BF5A 1DJZA 1J7OA 2AAOA 1TCOB 3I5FB 2M97A 2OPOA 3CS1A 4PHNA 2F8PA 3EVVA 3TDUA 1KFXL 3EK7A 3HX4A 1RECA 1XK4C 2HQWA 1QLSA 1KK7Y 4GPLB 1PULA 3IQQA 1BODA 3RM1A 4QJ3B 2MBXA 4PHJA 3BXKA 2H2KA 1N0YA 1NSHA 2F2PA 2M7LA 4DS7A 1DF0B 4BY4A 4XYNA 2LMVA 5HKYA 1BMOA 4IL1A 1KSOA 2A4JA 5D69A 2HQ8A 5D7FA 1W9ZA 1K96A 1TRFA 2LHLA 2RGIA 1A75A 3AAJA 3SG7A 2Y1NA 1YVHA 1NWDA 1R6PA 4I5JA 1NIWA 1KK7Z 4YRUA 2KBIA 5CSNA 1RWYA 1Y6WA 4JKTA 1SR6C 3BUWB 1QJTA 4AOMA 3VRRA 3OP0A 2EGDA 1G8IA 1M39A 1JSAA 1K90D 4NDDA 1PVBA 2L4IA 3D0YA 3DVKA 5CPVA 5I2OA 2P6BB 1SR6B 4XJKA 3OHMB 2KYCA 2FOTA 2JTZA 4MSPA 2LAPA 2M49B 3SS3A 4CLNA 5AANA 3DVJA 5IBWA 1S5GY 1G4YR 3IQOA 3CR5X 3NSOA 1DGUA 3NSLA 3SG4A 2FJUB 1PK0D 1B9AA 3ZWHA 1BLQA 2ZN8A 5HLVA 1OMRA 4HREE 1PRWA 2LLTA 1DMOA 1F4OA 1TOPA 4I5LB 2ZNDA 3EKHA 4DRWA 1AK8A 1J1DA 3F45A 1CM1A 1A29A 3OBVA 2LUXA 5KU1A 1QS7A 1FI5A 1K95A 2K7DA 1DVIA 1S5GZ 1PVAA 4WQ3A 2CT9A 2KFGA 1WRLA 2BCXA 1JUOA 1N2DA 1BOCA 3WXAA 1JF0A 1V1GA 1J55A 1FBVA 1UURA 3WHTB 2ZRTA 1DJYA 2M1UA 2LVIA 1TN4A 1K9KA 3BUNB 2I94A 4MZLA 5F6TA 5HYDA 2ZFDA 2KDHA 4ORCB 2K7OA 2L51A 2M3WA 1C7WA 1N65A 2PASA 1SL9A 2L0PA 1TNWA 3DVMA 4F0ZB 1YX7A 4DIRA 3FWCA 3KO0A 1NX2A 1Y1UA 1QLKA 1CDMA 1LVCD 2CCMA 1EG4A 2H61C 3EVUA 4BY5A 1ALWA 2NZ0A 4N5XA 1BU3A 1KQVA 3GK1A 4KYNA 3SS4A 1KWOC 3LCPC 1DC1A 1XFYO 2WCEA 1M31A 2JT8A 1FW4A 2KFFA 1KFUS 4ZCUA 2KQYA 2JT0A 2BCAA 1XA5A 1M45A 1OOJA 2CBLA 1DTLA 2JQ6A 2L5XB 4MZKA 5I2LA 1U5IA 2ZN9A 1S3PA 4NDCA 5FI2A 2L98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JUL A;  1KWO B;  4MEW A;  4USL A;  1J1E A;  1ALV A;  3JVT C;  2I18 A;  4OR9 B;  2KOT A;  2KGB C;  1IJ6 A;  5ER4 X;  1WY9 A;  2SCP A;  5JJG A;  3DD4 A;  2OTG C;  2JNX A;  1UWO A;  1CM4 A;  1MWN A;  1IKU A;  3JVT B;  2M1K B;  3GK4 X;  1RFJ A;  2PSR A;  1MUX A;  4ICB A;  3AKB A;  3AKA A;  3EVR A;  1RTP 1;  2DOQ A;  4L9M A;  4MN0 A;  4CFR A;  1LKJ A;  1RK9 A;  3PN7 C;  5AEQ A;  3VGO A;  2BL0 C;  1SKT A;  1QV0 A;  2Y1M A;  3SG3 A;  1CDL A;  1MXE A;  1QAT A;  1B8R A;  2OTG B;  2FCD A;  2Q4U A;  1EL4 A;  4ORB B;  2LVK A;  4QJ4 B;  3NSI A;  1F8H A;  1XFV O;  3PN7 B;  3I5I C;  2BL0 B;  5HKW A;  2MA2 A;  1UHN A;  1S36 A;  1SCM C;  2BKI B;  3KHE A;  4MRY A;  4C0L A;  4FQO A;  1YUR A;  2H61 A;  3JTD C;  1B8L A;  2LNK A;  3VRO A;  2JZI A;  4WQ2 A;  1PAL A;  1S6J A;  1TNX A;  2KI6 C;  3I5I B;  1ZUZ A;  3TDI A;  1A2X A;  3TUY C;  1SCM B;  1J7Q A;  4A4B A;  3JTD B;  2TN4 A;  3PAL A;  3LL8 B;  3VRN A;  3SJS A;  1G33 A;  2MAZ A;  1LA0 A;  1D1O A;  4ZCV A;  1W7J B;  3GOF A;  3FWB A;  2WC8 A;  3AAK A;  3TUY B;  3C1V A;  1X02 A;  1EH2 A;  1J7P A;  1HQV A;  1TNP A;  1FI6 A;  1B7T Z;  2LHI A;  5I2Q A;  1CLM A;  1ZOT B;  2ZNE A;  2COL B;  4Q04 A;  3DF0 B;  2F33 A;  2WCF A;  1XFW O;  2L4H A;  1WLZ A;  1CDN A;  1Y1A A;  1S6C A;  1CFD A;  1IJ5 A;  1EG3 A;  1AVS A;  2NCP A;  3WNX B;  4C0J A;  3CZT X;  4I5N B;  2CTN A;  2L2E A;  1DF0 A;  3BUO B;  2K0J A;  2LP3 A;  2GV5 A;  1L2O C;  1XK4 A;  1MQ1 A;  1R2U A;  2G2B A;  3CLN A;  3KPX A;  1KCY A;  1Q80 A;  2OS8 C;  1JWD A;  1KQM C;  1ZAC A;  3O78 A;  1OQP A;  4CPV A;  4YGC B;  1BR4 B;  1XVJ A;  3TDZ A;  1L2O B;  3KEV A;  1L7Z A;  1SK6 D;  3OB1 B;  2KAY A;  4D1E A;  1TIZ A;  2LM5 A;  3HCM A;  2HF5 A;  2OS8 B;  1KQM B;  2KNE A;  2B1U A;  1SNL A;  2KHN A;  1F4Q A;  3EKJ A;  1FF1 A;  2Q91 A;  5HKZ A;  1IG5 A;  2JTT A;  3DVE A;  1QX7 A;  4N1F A;  1YUS A;  2WOS A;  5AXI A;  4GGN A;  1SYM A;  1KFX S;  4C0K A;  2F3Y A;  2GGZ A;  3LK1 A;  1J7R A;  2KI6 D;  1IRJ A;  3FIA A;  4GUK A;  1F70 A;  2LP2 A;  1CTR A;  2G9B A;  1F71 A;  5PAL A;  3CTN A;  2PAL A;  3BOW B;  1OE9 B;  2EC6 C;  2KI4 C;  1CFC A;  1V1F A;  3VRP A;  2MHH A;  3PM8 A;  1OZS A;  1QX5 B;  4DCK A;  4WRI A;  3SG6 A;  1UHI A;  2EC6 B;  2F2O A;  1CB1 A;  1QTX A;  1AUI B;  2NXQ A;  2KI4 B;  1QAS A;  4P5O E;  2FCE A;  1UP5 A;  1JFJ A;  1IQ5 A;  1W7I B;  2M7N A;  1C7V A;  2MJW B;  2QPT A;  3BQ3 A;  2QAC A;  1AHR A;  4GBA A;  4PHM A;  1AP4 A;  2D8N A;  3M0W A;  1QIW A;  2AMI A;  2V53 A;  2NLN A;  3OB2 B;  4HSZ A;  2LLS A;  5J3X A;  1QV1 A;  1XFU O;  1NX1 A;  1FPW A;  1MHO A;  2PRU A;  3I5H C;  3CGA A;  1NP8 A;  1C07 A;  4MVF A;  1LIN A;  2ZKM X;  2BBM A;  1YRT B;  1K94 A;  2K2A A;  4M2Q A;  2R2I A;  1AJ4 A;  1WRZ A;  3VRQ A;  4A4C A;  4NDB A;  5FYX A;  1CMG A;  1YR5 A;  3GK2 A;  3I5H B;  1ODB A;  4PCW A;  1HT9 A;  5KTY A;  1QIV A;  2JXL A;  4QJ5 B;  1K2H A;  2M0R A;  1K9P A;  1CMF A;  1EXR A;  2MLF C;  1CNP A;  1A75 B;  2LVV A;  1QXP A;  1YUT A;  2PMY A;  2M9G A;  3ICB A;  1CFP A;  3LK0 A;  3CR4 X;  3PSR A;  4FTG A;  1Y0V H;  4M2O A;  1IGV A;  3NXA A;  4JQ0 D;  4AQI A;  2F3Z A;  1B1G A;  1OMV A;  2KGR A;  3OX6 A;  5K89 A;  4PE4 A;  5DKQ A;  4YI8 A;  1JFK A;  1WRK A;  2I2R E;  5HLO A;  1MF8 B;  1IWQ A;  1DGV A;  1A03 A;  4E68 A;  1PSR A;  2Y5I A;  1CKK A;  1BR1 B;  2E30 A;  4PHK A;  3WHU B;  2KQ6 A;  1QVI Y;  2LMU A;  4XJK B;  2KFH A;  1DJX A;  1GJY A;  1B7T Y;  2JU0 A;  5DKR A;  2KBM A;  4GGF C;  2M8U A;  4YGD B;  1KK8 C;  1SY9 A;  2LCP A;  4PAL A;  2O5G A;  4TNC A;  3PAT A;  1UUS A;  2BEC A;  5CSF A;  2K7B A;  2M29 A;  3TZ1 A;  2BBN A;  2K61 A;  1VRK A;  5G08 A;  1AJ5 A;  1Y1X A;  4GFT A;  2MLE C;  3RLZ A;  1PSB A;  1KK8 B;  4M2P A;  3EK4 A;  1K8U A;  2JRF A;  3EK8 A;  5DKN A;  5JOL A;  1QVI Z;  3H4S E;  1BJF A;  1DJI A;  4PE0 A;  4U8D A;  2WND A;  2BKH B;  5I8N A;  1A4P A;  3A8R A;  4DUQ A;  2WOR A;  3CR2 A;  4GNK B;  4MLW A;  4MZJ A;  1YTZ C;  1IQ3 A;  1DJG A;  2VRG A;  3O6B A;  1JBA A;  3E3R A;  1CLB A;  3A4U B;  1ZFS A;  1F54 A;  1E8A A;  2L50 A;  2BE4 A;  2K2F A;  3IF7 A;  2BCB A;  4OKH A;  5GQQ C;  3SG2 A;  1NUB A;  1SMG A;  1B47 A;  1TNQ A;  1KFU L;  3FS7 A;  4YGE B;  1XFZ O;  1NYA A;  1S1E A;  1OSA A;  4PE7 A;  4CID A;  4AQJ A;  2JNF A;  2ZRS A;  1YVL A;  3CWG A;  4UPG A;  1WDC C;  2E6W A;  1NCZ A;  1LA3 A;  2LV7 A;  2PVB A;  3D10 A;  1S26 D;  3I5G C;  3TS5 C;  1SCV A;  1RJV A;  1LXF C;  5KSZ A;  1GGZ A;  1OMD A;  2Y4Q A;  2JOJ A;  4HRG A;  4N1G A;  3PFV A;  5TNC A;  1WDC B;  2I7A A;  1UHK A;  4GGF A;  2CXJ A;  3I5G B;  3TS5 B;  1NPQ A;  5AER A;  2IS9 A;  2KAV A;  1XFX O;  1CFF A;  1SL8 A;  4CFQ A;  5AFP A;  4OCI A;  1TCF A;  4MBE A;  1SPY A;  2CNP A;  5CSJ A;  2LE9 B;  2MRD A;  3BUM B;  3DF0 A;  1JC2 A;  3SIA A;  2LAN A;  1TTX A;  2HET A;  2BE6 A;  3KF9 A;  2O60 A;  2JXC A;  4JWQ A;  1SBJ A;  1ZMZ A;  2LLU A;  5BPJ A;  4GAO A;  1NX0 A;  1CLL A;  2JWW A;  1SRA A;  1U5I B;  3QRX A;  4HRH A;  2GGM A;  1SW8 A;  1IH0 A;  1NCY A;  3PLF B;  2KSP A;  1S6I A;  3BUX B;  2JT3 A;  2JPT A;  1M63 B;  1M46 A;  3MSE B;  5B8I B;  4YGA A;  2LUC A;  4R1E A;  1B4C A;  1K93 D;  1UHJ A;  3O2P A;  1KSM A;  1XYD A;  2LVJ A;  3O4Y A;  1OZO A;  2KYF A;  3BYA A;  1NX3 A;  4YBH B;  4MRX A;  1F55 A;  3K21 A;  1MXL C;  2NCO A;  2KAX A;  1RRO A;  2AUC A;  1GQM A;  1BT6 A;  1UHH A;  4ETO A;  3SG5 A;  1CDP A;  1K9U A;  1EJ3 A;  2WCB A;  4P2Y B;  1H8B A;  2LMT A;  5ER5 A;  1WLM A;  2JC2 A;  1DJW A;  3SIB A;  3ZNI A;  2HPS A;  1GGW A;  3BOW A;  4NQG A;  1DJH A;  4I5K A;  4ORA B;  1YX8 A;  4YGB B;  3NSK A;  2EHB A;  2K7C A;  4PDZ A;  4OVN F;  2LC5 A;  1DT7 B;  2SAS A;  4PE1 A;  4JPZ B;  1JF2 A;  1MR8 A;  3LLE A;  4YI9 A;  1B8C A;  2ISD A;  1XO5 A;  5CSI A;  1NCX A;  1H4B A;  2K8M B;  3OX5 A;  1QX2 A;  1YUU A;  3I5F C;  1BG1 A;  1SL7 A;  3D0Y B;  1YRU B;  4OV2 A;  1BF5 A;  1DJZ A;  1J7O A;  2AAO A;  1TCO B;  3I5F B;  2M97 A;  2OPO A;  3CS1 A;  4PHN A;  2F8P A;  3EVV A;  3TDU A;  1KFX L;  3EK7 A;  3HX4 A;  1REC A;  1XK4 C;  2HQW A;  1QLS A;  1KK7 Y;  4GPL B;  1PUL A;  3IQQ A;  1BOD A;  3RM1 A;  4QJ3 B;  2MBX A;  4PHJ A;  3BXK A;  2H2K A;  1N0Y A;  1NSH A;  2F2P A;  2M7L A;  4DS7 A;  1DF0 B;  4BY4 A;  4XYN A;  2LMV A;  5HKY A;  1BMO A;  4IL1 A;  1KSO A;  2A4J A;  5D69 A;  2HQ8 A;  5D7F A;  1K96 A;  1TRF A;  2LHL A;  2RGI A;  1A75 A;  3AAJ A;  3SG7 A;  2Y1N A;  1YVH A;  1NWD A;  1R6P A;  4I5J A;  1NIW A;  1KK7 Z;  4YRU A;  2KBI A;  5CSN A;  1RWY A;  1Y6W A;  1SR6 C;  3BUW B;  1QJT A;  4AOM A;  3VRR A;  3OP0 A;  2EGD A;  1G8I A;  1M39 A;  1JSA A;  1K90 D;  4NDD A;  1PVB A;  2L4I A;  3D0Y A;  3DVK A;  5CPV A;  5I2O A;  2P6B B;  1SR6 B;  4XJK A;  3OHM B;  2KYC A;  2FOT A;  2JTZ A;  4MSP A;  2LAP A;  2M49 B;  4CLN A;  5AAN A;  3DVJ A;  5IBW A;  1S5G Y;  1G4Y R;  3IQO A;  3CR5 X;  3NSO A;  1DGU A;  3NSL A;  3SG4 A;  2FJU B;  1PK0 D;  1B9A A;  3ZWH A;  1BLQ A;  2ZN8 A;  5HLV A;  1OMR A;  4HRE E;  1PRW A;  2LLT A;  1DMO A;  1F4O A;  1TOP A;  4I5L B;  2ZND A;  3EKH A;  4DRW A;  1AK8 A;  1J1D A;  3F45 A;  1CM1 A;  1A29 A;  2LUX A;  5KU1 A;  1QS7 A;  1FI5 A;  1K95 A;  2K7D A;  1DVI A;  1S5G Z;  1PVA A;  4WQ3 A;  2CT9 A;  2KFG A;  1WRL A;  2BCX A;  1JUO A;  1N2D A;  1BOC A;  3WXA A;  1JF0 A;  1V1G A;  1J55 A;  1FBV A;  1UUR A;  3WHT B;  2ZRT A;  1DJY A;  2M1U A;  2LVI A;  1TN4 A;  1K9K A;  3BUN B;  2I94 A;  4MZL A;  5F6T A;  5HYD A;  2ZFD A;  2KDH A;  4ORC B;  2K7O A;  2L51 A;  2M3W A;  1C7W A;  1N65 A;  2PAS A;  1SL9 A;  2L0P A;  1TNW A;  3DVM A;  4F0Z B;  1YX7 A;  4DIR A;  3FWC A;  3KO0 A;  1NX2 A;  1Y1U A;  1QLK A;  1CDM A;  1LVC D;  2CCM A;  1EG4 A;  2H61 C;  3EVU A;  4BY5 A;  1ALW A;  2NZ0 A;  4N5X A;  1BU3 A;  1KQV A;  3GK1 A;  1KWO C;  3LCP C;  1XFY O;  2WCE A;  1M31 A;  2JT8 A;  1FW4 A;  2KFF A;  1KFU S;  4ZCU A;  2KQY A;  2JT0 A;  2BCA A;  1XA5 A;  1M45 A;  1OOJ A;  2CBL A;  1DTL A;  2JQ6 A;  2L5X B;  4MZK A;  5I2L A;  1U5I A;  2ZN9 A;  1S3P A;  4NDC A;  2L98 A; 
#chains in the Genus database with same CATH topology
 2JUL A;  1KWO B;  4MEW A;  3S0E A;  4USL A;  1J1E A;  2PQL A;  2QEH A;  1ALV A;  1C3Z A;  3N7H A;  3JVT C;  2I18 A;  4OR9 B;  2KOT A;  2KGB C;  1IJ6 A;  5ER4 X;  1WY9 A;  2SCP A;  5JJG A;  3DD4 A;  2OTG C;  2JNX A;  1UWO A;  1CM4 A;  1MWN A;  1IKU A;  3JVT B;  2M1K B;  3GK4 X;  1RFJ A;  2PSR A;  1MUX A;  4ICB A;  3AKB A;  3AKA A;  3EVR A;  1RTP 1;  2DOQ A;  4L9M A;  4MN0 A;  4CFR A;  1LKJ A;  1RK9 A;  3PN7 C;  5AEQ A;  3VGO A;  2BL0 C;  1SKT A;  1QV0 A;  2Y1M A;  3SG3 A;  1CDL A;  1MXE A;  1QAT A;  1B8R A;  2OTG B;  2FCD A;  3R1O A;  2Q4U A;  1EL4 A;  4ORB B;  2LVK A;  4QJ4 B;  3CAB A;  3NSI A;  1F8H A;  1XFV O;  2K60 A;  3O4X A;  3PN7 B;  3I5I C;  2BL0 B;  5HKW A;  2MA2 A;  2WC5 A;  1UHN A;  1S36 A;  1SCM C;  2BKI B;  3KHE A;  1XFR A;  4MRY A;  4C0L A;  4FQO A;  1YUR A;  2H61 A;  3JTD C;  1B8L A;  3D76 A;  3PM2 A;  2LNK A;  3VRO A;  2JZI A;  4WQ2 A;  1PAL A;  1S6J A;  1TNX A;  2KI6 C;  3I5I B;  1ZUZ A;  1IIO A;  3TDI A;  1A2X A;  3TUY C;  1SCM B;  1J7Q A;  4A4B A;  3JTD B;  2TN4 A;  4INW A;  3PAL A;  3BFA A;  3LL8 B;  3VRN A;  3SJS A;  1G33 A;  2MAZ A;  2YGU A;  1LA0 A;  1D1O A;  4ZCV A;  1W7J B;  3GOF A;  3FWB A;  2WC8 A;  3AAK A;  3TUY B;  2JPO A;  1X02 A;  3C1V A;  3UO9 A;  1J7P A;  1EH2 A;  1HQV A;  3NHT A;  1TNP A;  1FI6 A;  1B7T Z;  2LHI A;  5I2Q A;  1CLM A;  1ZOT B;  2ZNE A;  2COL B;  4Q04 A;  3DF0 B;  2F33 A;  2WCF A;  1XFW O;  2L4H A;  1WLZ A;  1CDN A;  1DQE A;  1Y1A A;  1S6C A;  3R1P A;  1CFD A;  1IJ5 A;  1EG3 A;  1AVS A;  2NCP A;  3WNX B;  4C0J A;  3CZT X;  4I5N B;  2CTN A;  2L2E A;  3UNW A;  1DF0 A;  3BUO B;  2K0J A;  2LP3 A;  2GV5 A;  1L2O C;  1XK4 A;  1MQ1 A;  1R2U A;  2G2B A;  3CLN A;  3R1V A;  4F7F A;  3KPX A;  1KCY A;  1Q80 A;  2OS8 C;  1JWD A;  1KQM C;  1ZAC A;  3O78 A;  1OQP A;  1OOF A;  4CPV A;  5FI7 A;  4YGC B;  1BR4 B;  3DZT A;  1XVJ A;  3TDZ A;  1L2O B;  3KEV A;  1L7Z A;  1SK6 D;  3OB1 B;  2KAY A;  4D1E A;  1TIZ A;  2LM5 A;  2BAP A;  3HCM A;  2HF5 A;  2OS8 B;  1KQM B;  2KNE A;  2B1U A;  1SNL A;  2KHN A;  2GTE A;  1F4Q A;  3EKJ A;  1FF1 A;  2Q91 A;  1C3Y A;  5HKZ A;  1IG5 A;  2JTT A;  3DVE A;  1QX7 A;  4N1F A;  3PJI A;  1YUS A;  2WOS A;  5AXI A;  4GGN A;  1SYM A;  1KFX S;  4C0K A;  2F3Y A;  2GGZ A;  3LK1 A;  1J7R A;  3B87 A;  2KI6 D;  1IRJ A;  3FIA A;  4GUK A;  1TWO A;  1F70 A;  2LP2 A;  1CTR A;  2G9B A;  1F71 A;  5PAL A;  3CTN A;  2PAL A;  3BOW B;  1OE9 B;  2EC6 C;  1OW4 A;  2KPH A;  1P28 A;  2KLD A;  2KI4 C;  1CFC A;  1V1F A;  3VRP A;  2MHH A;  3PM8 A;  2QEB A;  1OZS A;  1QX5 B;  2H8V A;  4DCK A;  4WRI A;  3SG6 A;  1UHI A;  2EC6 B;  2F2O A;  1CB1 A;  1QTX A;  1AUI B;  2NXQ A;  2KI4 B;  1QAS A;  4P5O E;  2FCE A;  1UP5 A;  1JFJ A;  1IQ5 A;  1W7I B;  2M7N A;  3FE9 A;  1C7V A;  2MJW B;  2QPT A;  2ERB A;  2QEO A;  3BQ3 A;  2QAC A;  1AHR A;  4GBA A;  4PHM A;  1AP4 A;  3CYZ A;  2D8N A;  3M0W A;  1QIW A;  2AMI A;  2V53 A;  2NLN A;  3OB2 B;  4HSZ A;  2LLS A;  5J3X A;  1QV1 A;  1XFU O;  1NX1 A;  1FPW A;  1MHO A;  2PRU A;  3I5H C;  3CGA A;  1NP8 A;  1C07 A;  4MVF A;  1LIN A;  1QWV A;  2ZKM X;  2BBM A;  3L4A A;  1YRT B;  1K94 A;  2K2A A;  4M2Q A;  2R2I A;  5HL1 A;  1AJ4 A;  1WRZ A;  3DY9 A;  3VRQ A;  4A4C A;  3SS5 A;  2PYQ A;  5D3O A;  4NDB A;  5FYX A;  1CMG A;  1YR5 A;  3GK2 A;  3I5H B;  1ODB A;  4PCW A;  1HT9 A;  5KTY A;  1QIV A;  3D77 A;  2JXL A;  4QJ5 B;  1K2H A;  2M0R A;  1K9P A;  1CMF A;  1EXR A;  2MLF C;  1CNP A;  1A75 B;  2LVV A;  1QXP A;  1YUT A;  2PMY A;  2M9G A;  3ICB A;  1CFP A;  2L2C A;  2BNX A;  3CR4 X;  3LK0 A;  1Y0V H;  3PSR A;  1IGV A;  3NXA A;  4FTG A;  4JQ0 D;  4M2O A;  2F3Z A;  4AQI A;  1B1G A;  1OMV A;  1SSE B;  2KGR A;  3OX6 A;  5K89 A;  4PE4 A;  5DKQ A;  2QEV A;  4YI8 A;  1JFK A;  1WRK A;  2I2R E;  5HLO A;  1MF8 B;  1IWQ A;  1DGV A;  1A03 A;  4E68 A;  1PSR A;  2Y5I A;  1CKK A;  1BR1 B;  2E30 A;  4PHK A;  3WHU B;  3CZ0 A;  2KQ6 A;  1QVI Y;  2LMU A;  4XJK B;  2KFH A;  1DJX A;  2KLE A;  1GJY A;  1B7T Y;  2JU0 A;  5DKR A;  2KBM A;  3B6X A;  4GGF C;  2M8U A;  4YGD B;  1KK8 C;  3L47 A;  1SY9 A;  2LCP A;  4PAL A;  2O5G A;  4TNC A;  3PAT A;  1UUS A;  2BEC A;  5CSF A;  2K7B A;  2M29 A;  3TZ1 A;  2BBN A;  2K61 A;  1VRK A;  5G08 A;  1AJ5 A;  1Y1X A;  4GFT A;  2MLE C;  3RLZ A;  1PSB A;  1KK8 B;  4M2P A;  3EK4 A;  1K8U A;  2JRF A;  2L5Y A;  3EK8 A;  5DKN A;  5JOL A;  3QME A;  1QVI Z;  3H4S E;  1BJF A;  1DJI A;  4PE0 A;  3S0D A;  4U8D A;  2WND A;  2BKH B;  3EG5 B;  5I8N A;  5I94 A;  1DEL A;  1A4P A;  3A8R A;  4DUQ A;  2WOR A;  3CR2 A;  4GNK B;  4MLW A;  4MZJ A;  1YTZ C;  1IQ3 A;  1DJG A;  2VRG A;  3O6B A;  1JBA A;  3E3R A;  1CLB A;  3A4U B;  1ZFS A;  3B86 A;  1E8A A;  1F54 A;  3VB1 A;  2L50 A;  2BE4 A;  2K2F A;  3IF7 A;  2BCB A;  4OKH A;  5GQQ C;  3SG2 A;  1NUB A;  1SMG A;  1B47 A;  1TNQ A;  3B88 A;  1KFU L;  3FS7 A;  4YGE B;  1XFZ O;  3S0A A;  2FJY A;  1NYA A;  1S1E A;  1OSA A;  4PE7 A;  4CID A;  4AQJ A;  2JNF A;  2ZRS A;  1YVL A;  3CWG A;  4UPG A;  1WDC C;  2E6W A;  5EL2 A;  1NCZ A;  1LA3 A;  2LV7 A;  2PVB A;  3D10 A;  1S26 D;  3I5G C;  3TS5 C;  1SCV A;  1RJV A;  1LXF C;  5KSZ A;  1GGZ A;  1OMD A;  2Y4Q A;  2JOJ A;  4HRG A;  4N1G A;  3PFV A;  5TNC A;  1WDC B;  2I7A A;  1UHK A;  4GGF A;  2CXJ A;  3I5G B;  2WCL A;  3TS5 B;  1NPQ A;  5AER A;  2WCK A;  2IS9 A;  2KAV A;  1XFX O;  1CFF A;  1SL8 A;  4CFQ A;  5AFP A;  4OCI A;  1TCF A;  4MBE A;  1SPY A;  2CNP A;  5CSJ A;  2LE9 B;  3S0F A;  2MRD A;  3BUM B;  3DF0 A;  1JC2 A;  3SIA A;  2LAN A;  1TTX A;  2HET A;  2BE6 A;  3KF9 A;  2O60 A;  2JXC A;  3NHI A;  4JWQ A;  1SBJ A;  1ZMZ A;  2LLU A;  5BPJ A;  4GAO A;  1NX0 A;  3D74 A;  1CLL A;  2JWW A;  1SRA A;  1U5I B;  3QRX A;  4HRH A;  2GGM A;  1SW8 A;  1IH0 A;  1NCY A;  3CZ2 A;  3DYE A;  1TUZ A;  3PLF B;  2KSP A;  1S6I A;  3BUX B;  2JT3 A;  2JPT A;  1M63 B;  2WCJ A;  1M46 A;  3MSE B;  5B8I B;  3OGN A;  4YGA A;  2LUC A;  4R1E A;  1B4C A;  1K93 D;  1UHJ A;  3O2P A;  1KSM A;  1XYD A;  2LVJ A;  3O4Y A;  1OZO A;  2KYF A;  3BYA A;  1NX3 A;  4YBH B;  4MRX A;  1F55 A;  3K21 A;  1MXL C;  2P71 A;  2NCO A;  2KAX A;  1RRO A;  2AUC A;  1GQM A;  1BT6 A;  1UHH A;  4ETO A;  5FI6 A;  1ORG A;  3SG5 A;  3DXL A;  1DEK A;  1CDP A;  1K9U A;  1EJ3 A;  2WCB A;  4P2Y B;  1H8B A;  2LMT A;  5ER5 A;  1Z2C B;  1WLM A;  2JC2 A;  1DJW A;  3SIB A;  3ZNI A;  2HPS A;  1GGW A;  3BOW A;  4NQG A;  1DJH A;  4I5K A;  4ORA B;  1YX8 A;  4JD9 A;  3FE6 A;  4YGB B;  3NSK A;  2EHB A;  2K7C A;  4PDZ A;  1TUJ A;  4OVN F;  3CZ1 A;  2LC5 A;  1DT7 B;  2SAS A;  4PE1 A;  4JPZ B;  1JF2 A;  1MR8 A;  3IVT A;  3LLE A;  4YI9 A;  2WCH A;  1B8C A;  2ISD A;  1XO5 A;  5CSI A;  1NCX A;  1Z4H A;  2K8M B;  3OX5 A;  1H4B A;  1QX2 A;  1YUU A;  3I5F C;  3D75 A;  4OZD A;  4IJ7 A;  3FE8 A;  1BG1 A;  1SL7 A;  3BFB A;  1YRU B;  3D0Y B;  3K1E A;  4OV2 A;  1BF5 A;  1DJZ A;  1OOH A;  1J7O A;  2AAO A;  1TCO B;  3I5F B;  2WCM A;  2M97 A;  2OPO A;  3CS1 A;  4FQT A;  4PHN A;  1OOI X;  2F8P A;  3BJH A;  1KFX L;  2P70 A;  3EVV A;  3EK7 A;  3HX4 A;  3TDU A;  1REC A;  1XK4 C;  2HQW A;  3D73 A;  1QLS A;  1KK7 Y;  3D78 A;  4GPL B;  1PUL A;  3IQQ A;  3RZS A;  1BOD A;  3RM1 A;  4QJ3 B;  2MBX A;  4PHJ A;  3BXK A;  2H2K A;  1N0Y A;  1NSH A;  2F2P A;  2M7L A;  4DS7 A;  1DF0 B;  4BY4 A;  4XYN A;  2LMV A;  5HKY A;  1BMO A;  4IL1 A;  1KSO A;  2A4J A;  5D69 A;  2HQ8 A;  1W9Z A;  5D7F A;  1K96 A;  1TRF A;  2LHL A;  1OOG A;  2RGI A;  1A75 A;  3AAJ A;  3SG7 A;  2Y1N A;  1YVH A;  1NWD A;  1R6P A;  4I5J A;  1NIW A;  1KK7 Z;  4YRU A;  2KBI A;  5CSN A;  1RWY A;  1Y6W A;  4JKT A;  1SR6 C;  3BUW B;  1QJT A;  4AOM A;  3VRR A;  3OP0 A;  2EGD A;  1G8I A;  1M39 A;  1JSA A;  1K90 D;  4NDD A;  1PVB A;  3S0G A;  2L4I A;  3D0Y A;  3DVK A;  5CPV A;  5I2O A;  2P6B B;  3L4L A;  1SR6 B;  4XJK A;  3OHM B;  2KYC A;  2FOT A;  2JTZ A;  4MSP A;  2LAP A;  2M49 B;  3SS3 A;  4CLN A;  5AAN A;  3DVJ A;  5IBW A;  1S5G Y;  1G4Y R;  3IQO A;  3CR5 X;  3NSO A;  1DGU A;  3NSL A;  3SG4 A;  2FJU B;  1PK0 D;  1B9A A;  3ZWH A;  1BLQ A;  2ZN8 A;  5HLV A;  1OMR A;  4PT1 A;  3NGV A;  1PRW A;  2LLT A;  4HRE E;  1DMO A;  3BFH A;  1F4O A;  1TOP A;  4I5L B;  2ZND A;  3EKH A;  4DRW A;  1AK8 A;  2QDI A;  1J1D A;  3F45 A;  1CM1 A;  1A29 A;  3OBV A;  2LUX A;  5KU1 A;  1QS7 A;  1FI5 A;  1K95 A;  2K7D A;  1DVI A;  1S5G Z;  1PVA A;  4WQ3 A;  2CT9 A;  2KFG A;  1WRL A;  2BCX A;  1JUO A;  1N2D A;  1BOC A;  3WXA A;  1JF0 A;  3CDN A;  1V1G A;  1J55 A;  1FBV A;  1UUR A;  3WHT B;  2ZRT A;  1DJY A;  2M1U A;  2LVI A;  1TN4 A;  1K9K A;  3BUN B;  2I94 A;  3Q8I A;  4MZL A;  5F6T A;  5HYD A;  2ZFD A;  2KDH A;  2WC6 A;  3B7A A;  4ORC B;  2K7O A;  2L51 A;  3S0B A;  2M3W A;  1C7W A;  1N65 A;  2PAS A;  1SL9 A;  2L0P A;  1TNW A;  3DVM A;  4F0Z B;  5DIC A;  1YX7 A;  4DIR A;  3FWC A;  3KO0 A;  1NX2 A;  1Y1U A;  1QLK A;  1CDM A;  1LVC D;  2CCM A;  1EG4 A;  2H61 C;  3EVU A;  3V2L A;  1GM0 A;  4BY5 A;  1ALW A;  2NZ0 A;  3R72 A;  4N5X A;  1BU3 A;  4KYN A;  3GK1 A;  1KQV A;  3SS4 A;  1KWO C;  3LCP C;  4INX A;  1XFY O;  1DC1 A;  2WCE A;  1M31 A;  1LS8 A;  1FW4 A;  2JT8 A;  2KFF A;  1KFU S;  1T14 A;  4ZCU A;  2KQY A;  2JT0 A;  2BCA A;  1XA5 A;  1M45 A;  1OOJ A;  2CBL A;  1DTL A;  2JQ6 A;  2L5X B;  4MZK A;  5I2L A;  1U5I A;  2ZN9 A;  1S3P A;  4NDC A;  5FI2 A;  2L98 A; 
#chains in the Genus database with same CATH homology
 2JUL A;  1KWO B;  4MEW A;  4USL A;  1J1E A;  1ALV A;  3JVT C;  2I18 A;  4OR9 B;  2KOT A;  2KGB C;  1IJ6 A;  5ER4 X;  1WY9 A;  2SCP A;  5JJG A;  3DD4 A;  2OTG C;  2JNX A;  1UWO A;  1CM4 A;  1MWN A;  1IKU A;  3JVT B;  2M1K B;  3GK4 X;  1RFJ A;  2PSR A;  1MUX A;  4ICB A;  3AKB A;  3AKA A;  3EVR A;  1RTP 1;  2DOQ A;  4L9M A;  4MN0 A;  4CFR A;  1LKJ A;  1RK9 A;  3PN7 C;  5AEQ A;  3VGO A;  2BL0 C;  1SKT A;  1QV0 A;  2Y1M A;  3SG3 A;  1CDL A;  1MXE A;  1QAT A;  1B8R A;  2OTG B;  2FCD A;  2Q4U A;  1EL4 A;  4ORB B;  2LVK A;  4QJ4 B;  3NSI A;  1F8H A;  1XFV O;  2K60 A;  3O4X A;  3PN7 B;  3I5I C;  2BL0 B;  5HKW A;  2MA2 A;  1UHN A;  1S36 A;  1SCM C;  2BKI B;  3KHE A;  4MRY A;  4C0L A;  4FQO A;  1YUR A;  2H61 A;  3JTD C;  1B8L A;  3PM2 A;  2LNK A;  3VRO A;  2JZI A;  4WQ2 A;  1PAL A;  1S6J A;  1TNX A;  2KI6 C;  3I5I B;  1ZUZ A;  3TDI A;  1A2X A;  3TUY C;  1SCM B;  1J7Q A;  4A4B A;  3JTD B;  2TN4 A;  3PAL A;  3LL8 B;  3VRN A;  3SJS A;  1G33 A;  2MAZ A;  2YGU A;  1LA0 A;  1D1O A;  4ZCV A;  1W7J B;  3GOF A;  3FWB A;  2WC8 A;  3AAK A;  3TUY B;  3C1V A;  1X02 A;  1EH2 A;  1J7P A;  3UO9 A;  1HQV A;  1TNP A;  1FI6 A;  1B7T Z;  2LHI A;  5I2Q A;  1CLM A;  1ZOT B;  2ZNE A;  2COL B;  4Q04 A;  3DF0 B;  2F33 A;  2WCF A;  1XFW O;  2L4H A;  1WLZ A;  1CDN A;  1Y1A A;  1S6C A;  1CFD A;  1IJ5 A;  1EG3 A;  1AVS A;  2NCP A;  3WNX B;  4C0J A;  3CZT X;  4I5N B;  2CTN A;  2L2E A;  3UNW A;  1DF0 A;  3BUO B;  2K0J A;  2LP3 A;  2GV5 A;  1L2O C;  1XK4 A;  1MQ1 A;  1R2U A;  2G2B A;  3CLN A;  3KPX A;  1KCY A;  1Q80 A;  2OS8 C;  1JWD A;  1KQM C;  1ZAC A;  3O78 A;  1OQP A;  4CPV A;  5FI7 A;  4YGC B;  1BR4 B;  1XVJ A;  3TDZ A;  1L2O B;  3KEV A;  1L7Z A;  1SK6 D;  3OB1 B;  2KAY A;  4D1E A;  1TIZ A;  2LM5 A;  3HCM A;  2BAP A;  2HF5 A;  2OS8 B;  1KQM B;  2KNE A;  2B1U A;  1SNL A;  2KHN A;  1F4Q A;  3EKJ A;  1FF1 A;  2Q91 A;  5HKZ A;  1IG5 A;  2JTT A;  3DVE A;  1QX7 A;  4N1F A;  1YUS A;  2WOS A;  5AXI A;  4GGN A;  1SYM A;  1KFX S;  4C0K A;  2F3Y A;  2GGZ A;  3LK1 A;  1J7R A;  2KI6 D;  1IRJ A;  3FIA A;  4GUK A;  1F70 A;  2LP2 A;  1CTR A;  2G9B A;  1F71 A;  5PAL A;  3CTN A;  2PAL A;  3BOW B;  1OE9 B;  2EC6 C;  2KLD A;  2KI4 C;  1CFC A;  1V1F A;  3VRP A;  2MHH A;  3PM8 A;  1OZS A;  1QX5 B;  4DCK A;  4WRI A;  3SG6 A;  1UHI A;  2EC6 B;  2F2O A;  1CB1 A;  1QTX A;  1AUI B;  2NXQ A;  2KI4 B;  1QAS A;  4P5O E;  2FCE A;  1UP5 A;  1JFJ A;  1IQ5 A;  1W7I B;  2M7N A;  1C7V A;  2MJW B;  2QPT A;  3BQ3 A;  2QAC A;  1AHR A;  4GBA A;  4PHM A;  1AP4 A;  2D8N A;  3M0W A;  1QIW A;  2AMI A;  2V53 A;  2NLN A;  3OB2 B;  4HSZ A;  2LLS A;  5J3X A;  1QV1 A;  1XFU O;  1NX1 A;  1FPW A;  1MHO A;  2PRU A;  3I5H C;  3CGA A;  1NP8 A;  1C07 A;  4MVF A;  1LIN A;  2ZKM X;  2BBM A;  1YRT B;  1K94 A;  2K2A A;  4M2Q A;  2R2I A;  5HL1 A;  1AJ4 A;  1WRZ A;  3VRQ A;  4A4C A;  3SS5 A;  5D3O A;  4NDB A;  5FYX A;  1CMG A;  1YR5 A;  3GK2 A;  3I5H B;  1ODB A;  4PCW A;  1HT9 A;  5KTY A;  1QIV A;  2JXL A;  4QJ5 B;  1K2H A;  2M0R A;  1K9P A;  1CMF A;  1EXR A;  2MLF C;  1CNP A;  1A75 B;  2LVV A;  1QXP A;  1YUT A;  2PMY A;  2M9G A;  3ICB A;  1CFP A;  3LK0 A;  3CR4 X;  3PSR A;  4FTG A;  1Y0V H;  4M2O A;  1IGV A;  3NXA A;  4JQ0 D;  4AQI A;  2BNX A;  2F3Z A;  1B1G A;  1OMV A;  2KGR A;  3OX6 A;  5K89 A;  4PE4 A;  5DKQ A;  4YI8 A;  1JFK A;  1WRK A;  2I2R E;  5HLO A;  1MF8 B;  1IWQ A;  1DGV A;  1A03 A;  4E68 A;  1PSR A;  2Y5I A;  1CKK A;  1BR1 B;  2E30 A;  4PHK A;  3WHU B;  2KQ6 A;  1QVI Y;  2LMU A;  4XJK B;  2KFH A;  1DJX A;  2KLE A;  1GJY A;  1B7T Y;  2JU0 A;  5DKR A;  2KBM A;  4GGF C;  2M8U A;  4YGD B;  1KK8 C;  1SY9 A;  2LCP A;  4PAL A;  2O5G A;  4TNC A;  3PAT A;  1UUS A;  2BEC A;  5CSF A;  2K7B A;  2M29 A;  3TZ1 A;  2BBN A;  2K61 A;  1VRK A;  5G08 A;  1AJ5 A;  1Y1X A;  4GFT A;  2MLE C;  3RLZ A;  1PSB A;  1KK8 B;  4M2P A;  3EK4 A;  1K8U A;  2JRF A;  3EK8 A;  5DKN A;  2L5Y A;  5JOL A;  1QVI Z;  3H4S E;  1BJF A;  1DJI A;  4PE0 A;  4U8D A;  2WND A;  2BKH B;  3EG5 B;  5I8N A;  5I94 A;  1DEL A;  1A4P A;  3A8R A;  4DUQ A;  2WOR A;  3CR2 A;  4GNK B;  4MLW A;  4MZJ A;  1YTZ C;  1IQ3 A;  1DJG A;  2VRG A;  3O6B A;  1JBA A;  3E3R A;  1CLB A;  3A4U B;  1ZFS A;  1F54 A;  1E8A A;  2L50 A;  2BE4 A;  2K2F A;  3IF7 A;  2BCB A;  4OKH A;  5GQQ C;  3SG2 A;  1NUB A;  1SMG A;  1B47 A;  1TNQ A;  1KFU L;  3FS7 A;  4YGE B;  1XFZ O;  1NYA A;  1S1E A;  1OSA A;  4PE7 A;  4CID A;  4AQJ A;  2JNF A;  2ZRS A;  1YVL A;  3CWG A;  4UPG A;  1WDC C;  2E6W A;  1NCZ A;  1LA3 A;  2LV7 A;  2PVB A;  3D10 A;  1S26 D;  3I5G C;  3TS5 C;  1SCV A;  1RJV A;  1LXF C;  5KSZ A;  1GGZ A;  1OMD A;  2Y4Q A;  2JOJ A;  4HRG A;  4N1G A;  3PFV A;  5TNC A;  1WDC B;  2I7A A;  1UHK A;  4GGF A;  2CXJ A;  3I5G B;  3TS5 B;  1NPQ A;  5AER A;  2IS9 A;  2KAV A;  1XFX O;  1CFF A;  1SL8 A;  4CFQ A;  5AFP A;  4OCI A;  1TCF A;  4MBE A;  1SPY A;  2CNP A;  5CSJ A;  2LE9 B;  2MRD A;  3BUM B;  3DF0 A;  1JC2 A;  3SIA A;  2LAN A;  1TTX A;  2HET A;  2BE6 A;  3KF9 A;  2O60 A;  2JXC A;  4JWQ A;  1SBJ A;  1ZMZ A;  2LLU A;  5BPJ A;  4GAO A;  1NX0 A;  1CLL A;  2JWW A;  1SRA A;  1U5I B;  3QRX A;  4HRH A;  2GGM A;  1SW8 A;  1IH0 A;  1NCY A;  3PLF B;  2KSP A;  1S6I A;  3BUX B;  2JT3 A;  2JPT A;  1M63 B;  1M46 A;  3MSE B;  5B8I B;  4YGA A;  2LUC A;  4R1E A;  1B4C A;  1K93 D;  1UHJ A;  3O2P A;  1KSM A;  1XYD A;  2LVJ A;  3O4Y A;  1OZO A;  2KYF A;  3BYA A;  1NX3 A;  4YBH B;  4MRX A;  1F55 A;  3K21 A;  1MXL C;  2NCO A;  2KAX A;  1RRO A;  2AUC A;  1GQM A;  1BT6 A;  1UHH A;  4ETO A;  5FI6 A;  3SG5 A;  1DEK A;  1CDP A;  1K9U A;  1EJ3 A;  2WCB A;  4P2Y B;  1H8B A;  2LMT A;  5ER5 A;  1Z2C B;  1WLM A;  2JC2 A;  1DJW A;  3SIB A;  3ZNI A;  2HPS A;  1GGW A;  3BOW A;  4NQG A;  1DJH A;  4I5K A;  4ORA B;  1YX8 A;  4YGB B;  3NSK A;  2EHB A;  2K7C A;  4PDZ A;  4OVN F;  2LC5 A;  1DT7 B;  2SAS A;  4PE1 A;  4JPZ B;  1JF2 A;  1MR8 A;  3LLE A;  3IVT A;  4YI9 A;  1B8C A;  2ISD A;  1XO5 A;  5CSI A;  1NCX A;  1H4B A;  2K8M B;  3OX5 A;  1Z4H A;  1QX2 A;  1YUU A;  3I5F C;  4IJ7 A;  1BG1 A;  1SL7 A;  3D0Y B;  1YRU B;  4OV2 A;  1BF5 A;  1DJZ A;  1J7O A;  2AAO A;  1TCO B;  3I5F B;  2M97 A;  2OPO A;  3CS1 A;  4PHN A;  2F8P A;  3EVV A;  3TDU A;  1KFX L;  3EK7 A;  3HX4 A;  1REC A;  1XK4 C;  2HQW A;  1QLS A;  1KK7 Y;  4GPL B;  1PUL A;  3IQQ A;  1BOD A;  3RM1 A;  4QJ3 B;  2MBX A;  4PHJ A;  3BXK A;  2H2K A;  1N0Y A;  1NSH A;  2F2P A;  2M7L A;  4DS7 A;  1DF0 B;  4BY4 A;  4XYN A;  2LMV A;  5HKY A;  1BMO A;  4IL1 A;  1KSO A;  2A4J A;  5D69 A;  2HQ8 A;  5D7F A;  1W9Z A;  1K96 A;  1TRF A;  2LHL A;  2RGI A;  1A75 A;  3AAJ A;  3SG7 A;  2Y1N A;  1YVH A;  1NWD A;  1R6P A;  4I5J A;  1NIW A;  1KK7 Z;  4YRU A;  2KBI A;  5CSN A;  1RWY A;  1Y6W A;  4JKT A;  1SR6 C;  3BUW B;  1QJT A;  4AOM A;  3VRR A;  3OP0 A;  2EGD A;  1G8I A;  1M39 A;  1JSA A;  1K90 D;  4NDD A;  1PVB A;  2L4I A;  3D0Y A;  3DVK A;  5CPV A;  5I2O A;  2P6B B;  1SR6 B;  4XJK A;  3OHM B;  2KYC A;  2FOT A;  2JTZ A;  4MSP A;  2LAP A;  2M49 B;  3SS3 A;  4CLN A;  5AAN A;  3DVJ A;  5IBW A;  1S5G Y;  1G4Y R;  3IQO A;  3CR5 X;  3NSO A;  1DGU A;  3NSL A;  3SG4 A;  2FJU B;  1PK0 D;  1B9A A;  3ZWH A;  1BLQ A;  2ZN8 A;  5HLV A;  1OMR A;  4HRE E;  1PRW A;  2LLT A;  1DMO A;  1F4O A;  1TOP A;  4I5L B;  2ZND A;  3EKH A;  4DRW A;  1AK8 A;  1J1D A;  3F45 A;  1CM1 A;  1A29 A;  3OBV A;  2LUX A;  5KU1 A;  1QS7 A;  1FI5 A;  1K95 A;  2K7D A;  1DVI A;  1S5G Z;  1PVA A;  4WQ3 A;  2CT9 A;  2KFG A;  1WRL A;  2BCX A;  1JUO A;  1N2D A;  1BOC A;  3WXA A;  1JF0 A;  1V1G A;  1J55 A;  1FBV A;  1UUR A;  3WHT B;  2ZRT A;  1DJY A;  2M1U A;  2LVI A;  1TN4 A;  1K9K A;  3BUN B;  2I94 A;  4MZL A;  5F6T A;  5HYD A;  2ZFD A;  2KDH A;  4ORC B;  2K7O A;  2L51 A;  2M3W A;  1C7W A;  1N65 A;  2PAS A;  1SL9 A;  2L0P A;  1TNW A;  3DVM A;  4F0Z B;  1YX7 A;  4DIR A;  3FWC A;  3KO0 A;  1NX2 A;  1Y1U A;  1QLK A;  1CDM A;  1LVC D;  2CCM A;  1EG4 A;  2H61 C;  3EVU A;  4BY5 A;  1ALW A;  2NZ0 A;  4N5X A;  1BU3 A;  1KQV A;  3GK1 A;  4KYN A;  3SS4 A;  1KWO C;  3LCP C;  1DC1 A;  1XFY O;  2WCE A;  1M31 A;  2JT8 A;  1FW4 A;  2KFF A;  1KFU S;  4ZCU A;  2KQY A;  2JT0 A;  2BCA A;  1XA5 A;  1M45 A;  1OOJ A;  2CBL A;  1DTL A;  2JQ6 A;  2L5X B;  4MZK A;  5I2L A;  1U5I A;  2ZN9 A;  1S3P A;  4NDC A;  5FI2 A;  2L98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...