4GAOA

Dcnl complex with n-terminally acetylated nedd8 e2 peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
193
structure length
193
Chain Sequence
GSKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/peptide
molecule keywords DCN1-like protein 2
publication title Structural Conservation of Distinctive N-terminal Acetylation-Dependent Interactions across a Family of Mammalian NEDD8 Ligation Enzymes.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 193
sequence length 193
chains with identical sequence B, D, G
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4gaoA01
1.10.238.200 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 4gaoA02
2ZRSA 3BYAA 5JJGA 4MSPA 2OPOA 2JWWA 1E8AA 1NYAA 1CFPA 1A2XA 3KEVA 4N1FA 5CPVA 1MHOA 1SCMC 2KGRA 2ZNDA 1LINA 4MZKA 4GNKB 3OB2B 1TRFA 1AVSA 3EK4A 3ICBA 3VRQA 4PHMA 2CTNA 3VRPA 5AEQA 1F54A 1OSAA 1NIWA 2L5XB 2PMYA 1YX8A 1CKKA 1JF2A 2BE6A 2HQ8A 1DMOA 1IJ6A 1TNXA 1XK4A 4E68A 1JBAA 3NSOA 1S6CA 4HRGA 2LHIA 3A4UB 3EVUA 4PHJA 1J7QA 5DKQA 1K2HA 1AUIB 2KYCA 1G8IA 4MRYA 1OOJA 1CLLA 1QLKA 2JOJA 1NCYA 2MRDA 4HRHA 2EGDA 1IWQA 1GJYA 1MXLC 1NX2A 3BOWB 2KFGA 3BUNB 4MZLA 4ZCUA 1XFVO 5ER4X 1B1GA 1BF5A 3SIAA 4CLNA 1YUSA 2JTTA 1RECA 3E3RA 3VROA 4ETOA 1OMRA 5KU1A 3JTDB 3PN7B 2QPTA 1KQVA 1AJ5A 3BXKA 1B8RA 1UP5A 2LANA 3WXAA 2KNEA 1J7OA 1EG3A 2OS8B 1TCFA 3IF7A 5G08A 3BUWB 1TOPA 2KYFA 1TNQA 1NX3A 5DKNA 1A4PA 1KQMC 2MHHA 3IQQA 1F71A 2KQYA 1QATA 1XVJA 4HSZA 5I8NA 4USLA 2BBNA 2KI6C 5AFPA 1C07A 1X02A 1YX7A 3NSIA 5AXIA 2WCBA 4GGFC 2LM5A 1BJFA 4GPLB 1RROA 4XJKA 3SG7A 4I5KA 1J55A 1K9PA 4R1EA 2B1UA 3DF0B 4QJ4B 5HYDA 1BR4B 1CDLA 1QXPA 3VRRA 1SW8A 1A75A 1DJGA 1SL8A 2L4IA 4NDBA 4YI9A 1SR6B 3I5HC 2KDHA 1NCZA 3GK1A 1V1GA 3EKHA 2JRFA 2P6BB 1SKTA 2L2EA 2LVIA 1KCYA 4JWQA 3LK1A 2LV7A 1KFUL 3QRXA 2F33A 1N0YA 1DVIA 1LXFC 1OMDA 3TS5C 3EK8A 1FPWA 2Q4UA 1SY9A 3SG2A 2BCXA 2I2RE 3AAKA 2FCDA 1RJVA 1NPQA 3IQOA 2SCPA 1CFDA 3FIAA 1IH0A 1PALA 2LMVA 1J7RA 1B9AA 3WNXB 1FI5A 5ER5A 2M97A 2BCAA 4AQJA 1ZMZA 3PATA 1IQ3A 1WRLA 2HQWA 3O4YA 1SPYA 2JT8A 4PALA 1S5GY 1OE9B 2BECA 2K2FA 2EC6B 1M31A 1B7TZ 1BT6A 1DGUA 2JT0A 2LP2A 5BPJA 1SK6D 2KI4B 1QVIZ 3BUXB 1TCOB 2ZNEA 3OX5A 2MAZA 1ODBA 1Y0VH 2L51A 2HPSA 1MXEA 2NCOA 1FF1A 1C7WA 2LAPA 3SG5A 1CDPA 1OZSA 1SL9A 3I5IC 5JOLA 1IQ5A 4GBAA 3I5FB 1F8HA 2WC8A 4OV2A 4PE4A 1Y1AA 1SCVA 1YVHA 3WHUB 1PVBA 3CWGA 4DCKA 1YVLA 2F3ZA 3BUOB 1QIWA 2CBLA 3K21A 1EG4A 1NP8A 1QV0A 1M45A 2JQ6A 2KGBC 5I2OA 2LLTA 2KI6D 4C0LA 3DD4A 4YGEB 3KPXA 1WRKA 1OZOA 1W7IB 1JWDA 2BKIB 1NUBA 3D0YA 5IBWA 1BODA 1WRZA 3TZ1A 1NX1A 1YR5A 3GK2A 3AAJA 4AQIA 3TUYC 3CLNA 4YRUA 1SCMB 1DJHA 5KTYA 4WQ3A 1B7TY 1MUXA 4QJ5B 1CM1A 1YTZC 3PALA 1QVIY 1S36A 2I94A 3D10A 1LA3A 3EK7A 2KAXA 5CSNA 4D1EA 1DJWA 3O2PA 3F45A 2BCBA 2Y4QA 1F70A 2JC2A 1PK0D 3EKJA 2JPTA 1QV1A 1XK4C 1LVCD 3DVEA 2K2AA 2LLSA 2KSPA 2TN4A 1KK8C 3FWCA 1QTXA 4MZJA 4ORBB 1CTRA 3O78A 1JF0A 3PFVA 2LP3A 1K94A 3LLEA 1IG5A 2Y5IA 1TTXA 1OQPA 4I5LB 2K0JA 2MA2A 4I5NB 2L50A 1RTP1 2E30A 1G4YR 2K7OA 2M3WA 2M9GA 1D1OA 1Y6WA 2F2PA 4JQ0D 5HLOA 3PSRA 1K95A 4C0JA 5PALA 1KWOC 1MQ1A 1N65A 1CFCA 2AUCA 2K7BA 2BBMA 2JULA 3C1VA 2K61A 2L98A 2M0RA 3LCPC 4F0ZB 1UUSA 5AERA 4CFRA 3AKAA 1IKUA 1KQMB 2F3YA 1M39A 2JZIA 3M0WA 3CZTX 5CSFA 4ORCB 1S3PA 4TNCA 2R2IA 3TDZA 1GQMA 2CNPA 2H61A 1BR1B 3ZNIA 4Q04A 1RWYA 2M8UA 5HKWA 1MWNA 1FBVA 3RM1A 2NCPA 3A8RA 1Q80A 1PSBA 1WLZA 1XFZO 2LE9B 1SRAA 3TDUA 3CGAA 1S6JA 2MLFC 3CR2A 1BG1A 4XJKB 1PRWA 1A03A 2WOSA 1MF8B 3AKBA 1CFFA 2AAOA 1B8LA 3KO0A 3I5HB 3SG3A 4OVNF 1K90D 3VRNA 1CLMA 2FCEA 2QACA 2BE4A 2WNDA 1QIVA 5AANA 1RFJA 1SL7A 1A75B 2ZN8A 2PALA 2D8NA 3TS5B 2LVVA 2KAYA 1H4BA 1SNLA 1F55A 1IRJA 4MLWA 4NDDA 1QX5B 1DGVA 1DJIA 2OTGC 3EVVA 2LNKA 4BY5A 2BL0C 1EXRA 4L9MA 4GGNA 4A4CA 1N2DA 1EJ3A 1U5IA 1K8UA 3HCMA 1UHNA 1DF0A 1XFUO 2ZRTA 4GUKA 2LMUA 3RLZA 5HKYA 4PHKA 1CNPA 1WDCC 2HETA 2PASA 1M46A 3LL8B 4OKHA 2GGMA 2L4HA 1S6IA 4MVFA 1OMVA 1JSAA 2M1UA 2KOTA 1L2OC 1XA5A 2GV5A 5I2QA 4M2QA 1KFXS 1XYDA 2CXJA 2L0PA 2EHBA 2NLNA 1V1FA 3I5IB 2LVKA 1TN4A 1QS7A 3I5GC 2V53A 4UPGA 1KK7Z 1XFWO 1QX2A 3GK4X 2M29A 1J1EA 1K9KA 2K7CA 1NX0A 1UHHA 4P2YB 1EL4A 2KQ6A 1YURA 4P5OE 2Y1NA 4PE0A 5FYXA 5HKZA 2LLUA 1EH2A 5D7FA 3FWBA 1XFYO 1LA0A 1UHKA 2LHLA 3MSEB 2JNXA 5K89A 4YGDB 1CLBA 4YGCB 2G9BA 2LVJA 1JUOA 1CB1A 1AJ4A 4ICBA 5F6TA 2CT9A 4I5JA 3SJSA 1CMGA 4OCIA 3TUYB 1TNPA 2I18A 1ZUZA 1WY9A 3BQ3A 2JTZA 5I2LA 3D0YB 2M7NA 2G2BA 1FI6A 1QJTA 2FOTA 2KFHA 1GGZA 2Y1MA 4MN0A 2WCFA 1ZFSA 1BLQA 4MEWA 2DOQA 3OX6A 2ZKMX 1F4OA 4WRIA 4YI8A 1HT9A 1GGWA 1XO5A 3TDIA 1JC2A 2I7AA 1AK8A 1TNWA 3BOWA 4NDCA 4FQOA 1NSHA 1UHJA 2BKHB 1KK7Y 2F2OA 1KSMA 2SASA 1KK8B 5HLVA 1PVAA 2H2KA 4GAOA 4FTGA 3OHMB 4A4BA 5TNCA 1B8CA 3LK0A 1BMOA 2FJUB 1QASA 2M1KB 1YRTB 3OB1B 1L7ZA 4PCWA 4PE1A 4YGBB 3JTDC 3CR4X 3PN7C 4ZCVA 2KBMA 3CTNA 2E6WA 2PSRA 2WCEA 2LMTA 2O60A 2OS8C 5J3XA 4CPVA 1KWOB 1NWDA 1YUUA 1TIZA 2A4JA 5CSIA 1S1EA 4ORAB 1NCXA 1WLMA 5B8IB 1FW4A 4PE7A 2MJWB 1ZOTB 2VRGA 2JU0A 2JXLA 3FS7A 1DTLA 3DF0A 1CMFA 1ALVA 4DRWA 4GGFA 4MRXA 3H4SE 3SG6A 2JXCA 2H61C 3OP0A 1Y1XA 2MBXA 2LUCA 4M2PA 1IJ5A 4QJ3B 3NXAA 1UHIA 2F8PA 4NQGA 1SBJA 1S5GZ 3BUMB 2M7LA 2NZ0A 1AP4A 1R6PA 4M2OA 4C0KA 1K93D 1K96A 2K7DA 4YBHB 1SR6C 1UWOA 1JFKA 3DVJA 2KBIA 2M49B 3PLFB 4WQ2A 1RK9A 3O6BA 1DJZA 3HX4A 4DIRA 4XYNA 1DJXA 1LKJA 3DVKA 1PULA 3KHEA 4CIDA 1G33A 2PRUA 2ISDA 1C7VA 1JFJA 1KFXL 2KAVA 2PVBA 4DUQA 1AHRA 2ZFDA 1A29A 1H8BA 2JNFA 1S26D 3KF9A 1CM4A 1F4QA 1K9UA 3CS1A 3SG4A 1YUTA 3ZWHA 1CDNA 2HF5A 2NXQA 4PDZA 5KSZA 1BOCA 1MR8A 2KFFA 5DKRA 2OTGB 4AOMA 2BL0B 3EVRA 5D69A 4DS7A 4N1GA 2Q91A 4CFQA 2IS9A 2LCPA 1J7PA 2EC6C 4N5XA 2JT3A 1B47A 1ZACA 2K8MB 2KI4C 4PHNA 4YGAA 1BU3A 3VGOA 1DJYA 1WDCB 2CCMA 3NSKA 1R2UA 1DT7B 4JPZB 1W7JB 4BY4A 1U5IB 5GQQC 3JVTC 1DF0B 1KFUS 1J1DA 1L2OB 2MLEC 2RGIA 3GOFA 4OR9B 1UURA 4GFTA 2GGZA 3I5FC 4HREE 1IGVA 3CR5X 4U8DA 2KHNA 1HQVA 1SMGA 3I5GB 1SYMA 1VRKA 2O5GA 3JVTB 5CSJA 1YRUB 1M63B 2LC5A 1Y1UA 1XFXO 1PSRA 2COLB 4MBEA 3PM8A 3NSLA 3DVMA 1KSOA 3SIBA 1QX7A 2AMIA 2LUXA 2WORA 1CDMA 1QLSA 2ZN9A 1ALWA 3WHTB 1B4CA 4IL1A
chains in the Genus database with same CATH superfamily
2ZRSA 3BYAA 5JJGA 4MSPA 3D76A 2OPOA 2JWWA 1E8AA 1NYAA 2QEOA 1CFPA 1A2XA 3KEVA 4N1FA 5CPVA 1MHOA 1SCMC 2KGRA 2ZNDA 1LINA 4MZKA 4GNKB 3OB2B 1TRFA 1AVSA 3EK4A 3ICBA 3VRQA 4PHMA 2CTNA 3VRPA 5AEQA 3CZ2A 1F54A 1OSAA 1NIWA 2L5XB 2PMYA 1YX8A 1CKKA 3DYEA 2KLEA 1JF2A 2BE6A 2HQ8A 1DMOA 3D78A 1IJ6A 3N7HA 1TNXA 3FE8A 1XK4A 4E68A 1JBAA 3NSOA 1S6CA 4HRGA 2LHIA 3A4UB 3EVUA 4PHJA 3RZSA 5DKQA 1J7QA 1K2HA 1AUIB 2KYCA 1G8IA 4MRYA 2WCLA 1OOJA 1CLLA 1QLKA 2JOJA 1NCYA 2MRDA 4HRHA 3B87A 2EGDA 1IWQA 2ERBA 1GJYA 1MXLC 1NX2A 3BOWB 2KFGA 3BUNB 4MZLA 4ZCUA 1XFVO 5ER4X 1B1GA 1BF5A 3SIAA 4CLNA 1YUSA 2JTTA 1RECA 3E3RA 3S0GA 3VROA 4ETOA 1OMRA 5KU1A 2WCMA 3JTDB 3PN7B 2QPTA 1KQVA 1AJ5A 3BXKA 1B8RA 1UP5A 2LANA 3WXAA 2KNEA 1J7OA 1EG3A 2OS8B 1TCFA 3IF7A 4FQTA 5G08A 3BUWB 1TOPA 2KYFA 1TNQA 1NX3A 5DKNA 1A4PA 1KQMC 2MHHA 3IQQA 3NGVA 2KQYA 1F71A 1QATA 1XVJA 4HSZA 5I8NA 4USLA 2BBNA 2KI6C 5AFPA 1C07A 5FI6A 1X02A 1YX7A 3NSIA 5AXIA 2WCBA 4GGFC 2LM5A 1BJFA 4GPLB 1RROA 4XJKA 3SG7A 4I5KA 1J55A 1K9PA 4R1EA 2B1UA 3DF0B 1DEKA 4QJ4B 5HYDA 3PJIA 3L4LA 1BR4B 1CDLA 3R1PA 1QXPA 3VRRA 1SW8A 1A75A 1DJGA 1SL8A 2L4IA 4NDBA 4YI9A 3S0FA 1SR6B 2WCHA 2P71A 3I5HC 3CZ1A 2KDHA 1NCZA 3GK1A 2K60A 1V1GA 3EKHA 2JRFA 2P6BB 1SKTA 2L2EA 2LVIA 2JPOA 3S0BA 4JWQA 3LK1A 3V2LA 1KCYA 2LV7A 1KFUL 3QRXA 2F33A 1N0YA 1DVIA 1LXFC 1OMDA 3TS5C 3EK8A 1FPWA 2Q4UA 1SY9A 3SG2A 2BCXA 2I2RE 3R1VA 3AAKA 2FCDA 1RJVA 1NPQA 3IQOA 2SCPA 1CFDA 1C3ZA 3FIAA 1IH0A 1PALA 2LMVA 1J7RA 1B9AA 3WNXB 1FI5A 5ER5A 2M97A 2BCAA 4AQJA 1ZMZA 3PATA 1IQ3A 1WRLA 2HQWA 3O4YA 1SPYA 2JT8A 4PALA 1S5GY 1OE9B 2BECA 2QDIA 2K2FA 2EC6B 1M31A 1B7TZ 1BT6A 1DGUA 2JT0A 2LP2A 5BPJA 1SK6D 2KI4B 4JD9A 1QVIZ 3BUXB 1TCOB 2ZNEA 3OX5A 2MAZA 1ODBA 1Y0VH 2L51A 2HPSA 1MXEA 2NCOA 1FF1A 1C7WA 2LAPA 3SG5A 1CDPA 1OZSA 1SL9A 3I5IC 5JOLA 1IQ5A 1QWVA 4GBAA 3I5FB 1F8HA 3DXLA 2WC8A 3K1EA 4OV2A 4PE4A 1Y1AA 1SCVA 1YVHA 3WHUB 1PVBA 3CWGA 4JKTA 4DCKA 1YVLA 2F3ZA 3BUOB 1QIWA 2CBLA 3K21A 1EG4A 1NP8A 1QV0A 1M45A 1W9ZA 2JQ6A 2KGBC 2LLTA 2KI6D 4C0LA 3DD4A 4YGEB 3KPXA 1WRKA 2BNXA 1OZOA 2H8VA 1W7IB 1JWDA 2BKIB 3R1OA 1NUBA 3D0YA 5IBWA 1BODA 1WRZA 3TZ1A 1NX1A 1YR5A 3D75A 3GK2A 3AAJA 4AQIA 3TUYC 3CLNA 4YRUA 1SCMB 1DJHA 5KTYA 4WQ3A 1B7TY 2P70A 1MUXA 4QJ5B 1CM1A 1YTZC 3DY9A 1QVIY 1S36A 2I94A 3PALA 3D10A 3D73A 1LA3A 3EK7A 2KAXA 3DZTA 5CSNA 4D1EA 1DJWA 3O2PA 3F45A 2BCBA 2Y4QA 5I94A 1F70A 2JC2A 1PK0D 3EKJA 2JPTA 1QV1A 1XK4C 1LVCD 3DVEA 2K2AA 2LLSA 1TWOA 2KSPA 2TN4A 1KK8C 3FWCA 1QTXA 4MZJA 4ORBB 1CTRA 3O78A 1JF0A 3PFVA 2LP3A 3Q8IA 1K94A 3IVTA 1IG5A 3LLEA 5FI2A 2Y5IA 1TTXA 1OQPA 4I5LB 2K0JA 2MA2A 4I5NB 2L50A 1RTP1 2E30A 1G4YR 2K7OA 2M3WA 2M9GA 3BFAA 1D1OA 1Y6WA 2F2PA 4JQ0D 5HLOA 3PSRA 1K95A 4C0JA 5PALA 1KWOC 1MQ1A 1N65A 1CFCA 2AUCA 2K7BA 2BBMA 3NHTA 2JULA 5HL1A 3C1VA 2K61A 2L98A 2M0RA 3FE9A 3LCPC 2YGUA 4F0ZB 1UUSA 5AERA 4CFRA 3AKAA 1IKUA 1KQMB 2F3YA 1M39A 2JZIA 3M0WA 3CZTX 5CSFA 4ORCB 1S3PA 3FE6A 4TNCA 2R2IA 3TDZA 1GQMA 2CNPA 2H61A 2WCJA 1BR1B 3ZNIA 4Q04A 1RWYA 2M8UA 3D74A 5HKWA 1MWNA 1FBVA 3RM1A 2NCPA 3A8RA 3BFBA 1Q80A 1PSBA 1WLZA 1XFZO 2LE9B 1SRAA 3TDUA 1DC1A 3CGAA 1S6JA 1OOGA 2MLFC 3CR2A 1BG1A 4XJKB 1PRWA 1A03A 2WOSA 1DELA 1MF8B 1XFRA 3AKBA 4KYNA 2AAOA 1B8LA 3KO0A 1CFFA 3I5HB 3CDNA 4OVNF 3SG3A 1DQEA 1K90D 3VRNA 1CLMA 2FCEA 2QACA 2BE4A 2WNDA 1QIVA 5AANA 1ORGA 3L4AA 1RFJA 1SL7A 1A75B 2ZN8A 3L47A 2PALA 2D8NA 3TS5B 2LVVA 2KAYA 2WC6A 1SNLA 3UO9A 1H4BA 1F55A 1IRJA 4MLWA 4NDDA 1QX5B 1DGVA 1DJIA 2OTGC 3EVVA 2LNKA 4BY5A 2BL0C 1EXRA 4L9MA 4GGNA 4A4CA 1N2DA 4INWA 1EJ3A 1SSEB 1U5IA 1K8UA 5EL2A 3HCMA 1UHNA 1DF0A 1XFUO 2ZRTA 4GUKA 2LMUA 3RLZA 5HKYA 3O4XA 4PHKA 1CNPA 1WDCC 2HETA 2PASA 1M46A 1TUJA 3LL8B 4OKHA 2GGMA 2L4HA 1S6IA 4MVFA 1OMVA 1JSAA 2M1UA 2KOTA 1L2OC 1XA5A 2GV5A 5I2QA 4M2QA 1KFXS 1XYDA 2CXJA 2L0PA 2EHBA 2NLNA 1V1FA 3BFHA 2LVKA 3I5IB 3OGNA 1TN4A 1QS7A 3I5GC 2WCKA 2V53A 4UPGA 3SS5A 1KK7Z 3S0EA 3VB1A 1XFWO 1QX2A 4IJ7A 3GK4X 2M29A 1J1EA 1K9KA 2K7CA 1NX0A 1UHHA 4P2YB 1EL4A 2KQ6A 1OOIX 3D77A 1YURA 1OOFA 4P5OE 2Y1NA 4PE0A 5FYXA 5HKZA 2LLUA 1EH2A 5D7FA 3FWBA 1XFYO 1LA0A 1UHKA 2LHLA 3MSEB 3S0AA 2L5YA 2JNXA 2KLDA 2PYQA 5K89A 4YGDB 4PT1A 1CLBA 4YGCB 2G9BA 2LVJA 1JUOA 1CB1A 2PQLA 1AJ4A 4ICBA 5F6TA 2CT9A 4I5JA 3SJSA 1CMGA 4OCIA 1Z2CB 3TUYB 1TNPA 2I18A 1ZUZA 1WY9A 3BQ3A 2JTZA 5I2LA 3D0YB 2M7NA 2G2BA 1FI6A 1QJTA 2FOTA 2KFHA 1GGZA 3SS4A 2Y1MA 4MN0A 3CZ0A 2WCFA 1ZFSA 1BLQA 1GM0A 4MEWA 2DOQA 3OX6A 1C3YA 1IIOA 5FI7A 2ZKMX 1F4OA 4WRIA 4YI8A 1HT9A 1GGWA 1XO5A 3TDIA 1JC2A 2I7AA 1AK8A 1TNWA 3BOWA 2BAPA 4NDCA 4FQOA 1NSHA 1UHJA 3S0DA 2BKHB 1KK7Y 2F2OA 1KSMA 3NHIA 2SASA 1KK8B 5HLVA 1PVAA 2H2KA 5I2OA 3CABA 4GAOA 4FTGA 3OHMB 4A4BA 5TNCA 1B8CA 3LK0A 1BMOA 2FJUB 1QASA 2M1KB 2QEVA 1YRTB 3OB1B 1L7ZA 4PCWA 4PE1A 2WC5A 4YGBB 3JTDC 3CR4X 3PN7C 4ZCVA 2KBMA 3CTNA 2E6WA 2PSRA 2WCEA 2LMTA 2O60A 2OS8C 5J3XA 4CPVA 1Z4HA 1KWOB 3B7AA 1NWDA 3B86A 3R72A 1OW4A 1YUUA 1TIZA 2A4JA 5CSIA 1S1EA 4ORAB 1NCXA 1WLMA 5B8IB 1FW4A 4PE7A 2MJWB 1ZOTB 2VRGA 2JU0A 2JXLA 3FS7A 1DTLA 3DF0A 1CMFA 3QMEA 1ALVA 3EG5B 4DRWA 2QEBA 4GGFA 4MRXA 3H4SE 3SG6A 2JXCA 2H61C 3OP0A 1Y1XA 2MBXA 2LUCA 4M2PA 1IJ5A 4QJ3B 3NXAA 3OBVA 1UHIA 2F8PA 4NQGA 1SBJA 3UNWA 1S5GZ 3BUMB 2M7LA 2NZ0A 1AP4A 1R6PA 4INXA 4M2OA 4C0KA 1K93D 1K96A 2K7DA 4YBHB 1SR6C 1UWOA 1JFKA 3DVJA 1LS8A 2KBIA 2M49B 5D3OA 3PLFB 4WQ2A 1RK9A 3O6BA 1DJZA 3HX4A 4DIRA 4XYNA 1DJXA 1LKJA 3DVKA 1PULA 3KHEA 4CIDA 1OOHA 1G33A 2PRUA 2ISDA 1C7VA 3B6XA 1JFJA 1KFXL 2KAVA 2PVBA 4DUQA 3PM2A 1AHRA 2ZFDA 1A29A 1H8BA 2JNFA 1S26D 3KF9A 1CM4A 1F4QA 1K9UA 3CS1A 3SG4A 1YUTA 3ZWHA 1CDNA 2HF5A 1T14A 5DICA 2NXQA 4PDZA 5KSZA 1BOCA 1MR8A 2KFFA 5DKRA 2OTGB 4AOMA 2BL0B 3EVRA 5D69A 4DS7A 3B88A 4N1GA 1TUZA 2Q91A 2FJYA 4CFQA 2IS9A 2LCPA 2QEHA 1J7PA 2EC6C 4N5XA 2JT3A 1B47A 1ZACA 2K8MB 3CYZA 2KI4C 4PHNA 4YGAA 1BU3A 3VGOA 1DJYA 1WDCB 2CCMA 3NSKA 1R2UA 1DT7B 4JPZB 1W7JB 4BY4A 1U5IB 5GQQC 3JVTC 1DF0B 1KFUS 1J1DA 1L2OB 2MLEC 2RGIA 3GOFA 4OR9B 1UURA 4GFTA 2GGZA 3SS3A 1P28A 3I5FC 1IGVA 3CR5X 4HREE 4U8DA 2KHNA 1HQVA 2L2CA 1SMGA 3I5GB 1SYMA 1VRKA 2O5GA 3JVTB 5CSJA 2GTEA 1YRUB 1M63B 2LC5A 4OZDA 1Y1UA 1XFXO 1PSRA 2COLB 4MBEA 2KPHA 3PM8A 3BJHA 3NSLA 3DVMA 1KSOA 3SIBA 1QX7A 2AMIA 2LUXA 2WORA 1CDMA 1QLSA 2ZN9A 4F7FA 1ALWA 3WHTB 1B4CA 4IL1A
chains in the Genus database with same CATH topology
2ZRSA 3BYAA 5JJGA 4MSPA 2OPOA 2JWWA 1E8AA 1NYAA 1CFPA 1A2XA 3KEVA 4N1FA 5CPVA 1MHOA 1SCMC 2KGRA 2ZNDA 1LINA 4MZKA 4GNKB 3OB2B 1TRFA 1AVSA 3EK4A 3ICBA 3VRQA 4PHMA 2CTNA 3VRPA 5AEQA 1F54A 1OSAA 1NIWA 2L5XB 2PMYA 1YX8A 1CKKA 2KLEA 1JF2A 2BE6A 2HQ8A 1DMOA 1IJ6A 1TNXA 1XK4A 4E68A 1JBAA 3NSOA 1S6CA 4HRGA 2LHIA 3A4UB 3EVUA 4PHJA 1J7QA 5DKQA 1K2HA 1AUIB 2KYCA 1G8IA 4MRYA 1OOJA 1CLLA 1QLKA 2JOJA 1NCYA 2MRDA 4HRHA 2EGDA 1IWQA 1GJYA 1MXLC 1NX2A 3BOWB 2KFGA 3BUNB 4MZLA 4ZCUA 1XFVO 5ER4X 1B1GA 1BF5A 3SIAA 4CLNA 1YUSA 2JTTA 1RECA 3E3RA 3VROA 4ETOA 1OMRA 5KU1A 3JTDB 3PN7B 2QPTA 1KQVA 1AJ5A 3BXKA 1B8RA 1UP5A 2LANA 3WXAA 2KNEA 1J7OA 1EG3A 2OS8B 1TCFA 3IF7A 5G08A 3BUWB 1TOPA 2KYFA 1TNQA 1NX3A 5DKNA 1A4PA 1KQMC 2MHHA 3IQQA 1F71A 2KQYA 1QATA 1XVJA 4HSZA 5I8NA 4USLA 2BBNA 2KI6C 5AFPA 1C07A 5FI6A 1X02A 1YX7A 3NSIA 5AXIA 2WCBA 4GGFC 2LM5A 1BJFA 4GPLB 1RROA 4XJKA 3SG7A 4I5KA 1J55A 1K9PA 4R1EA 2B1UA 3DF0B 1DEKA 4QJ4B 5HYDA 1BR4B 1CDLA 1QXPA 3VRRA 1SW8A 1A75A 1DJGA 1SL8A 2L4IA 4NDBA 4YI9A 1SR6B 3I5HC 2KDHA 1NCZA 3GK1A 2K60A 1V1GA 3EKHA 2JRFA 2P6BB 1SKTA 2L2EA 2LVIA 1KCYA 4JWQA 3LK1A 2LV7A 1KFUL 3QRXA 2F33A 1N0YA 1DVIA 1LXFC 1OMDA 3TS5C 3EK8A 1FPWA 2Q4UA 1SY9A 3SG2A 2BCXA 2I2RE 3AAKA 2FCDA 1RJVA 1NPQA 3IQOA 2SCPA 1CFDA 3FIAA 1IH0A 1PALA 2LMVA 1J7RA 1B9AA 3WNXB 1FI5A 5ER5A 2M97A 2BCAA 4AQJA 1ZMZA 3PATA 1IQ3A 1WRLA 2HQWA 3O4YA 1SPYA 2JT8A 4PALA 1S5GY 1OE9B 2BECA 2K2FA 2EC6B 1M31A 1B7TZ 1BT6A 1DGUA 2JT0A 2LP2A 5BPJA 1SK6D 2KI4B 1QVIZ 3BUXB 1TCOB 2ZNEA 3OX5A 2MAZA 1ODBA 1Y0VH 2L51A 2HPSA 1MXEA 2NCOA 1FF1A 1C7WA 2LAPA 3SG5A 1CDPA 1OZSA 1SL9A 3I5IC 5JOLA 1IQ5A 4GBAA 3I5FB 1F8HA 2WC8A 4OV2A 4PE4A 1Y1AA 1SCVA 1YVHA 3WHUB 1PVBA 3CWGA 4DCKA 4JKTA 1YVLA 2F3ZA 3BUOB 1QIWA 2CBLA 3K21A 1EG4A 1NP8A 1QV0A 1M45A 2JQ6A 2KGBC 5I2OA 1W9ZA 2LLTA 2KI6D 4C0LA 3DD4A 4YGEB 3KPXA 1WRKA 2BNXA 1OZOA 1W7IB 1JWDA 2BKIB 1NUBA 3D0YA 5IBWA 1BODA 1WRZA 3TZ1A 1NX1A 1YR5A 3GK2A 3AAJA 4AQIA 3TUYC 3CLNA 4YRUA 1SCMB 1DJHA 5KTYA 4WQ3A 1B7TY 1MUXA 4QJ5B 1CM1A 1YTZC 3PALA 1QVIY 1S36A 2I94A 3D10A 1LA3A 3EK7A 2KAXA 5CSNA 4D1EA 1DJWA 3O2PA 3F45A 2BCBA 2Y4QA 1F70A 5I94A 2JC2A 1PK0D 3EKJA 2JPTA 1QV1A 1XK4C 1LVCD 3DVEA 2K2AA 2LLSA 2KSPA 2TN4A 1KK8C 3FWCA 1QTXA 4MZJA 4ORBB 1CTRA 3O78A 1JF0A 3PFVA 2LP3A 1K94A 3LLEA 1IG5A 3IVTA 5FI2A 2Y5IA 1TTXA 1OQPA 4I5LB 2K0JA 2MA2A 4I5NB 2L50A 1RTP1 2E30A 1G4YR 2K7OA 2M3WA 2M9GA 1D1OA 1Y6WA 2F2PA 4JQ0D 5HLOA 3PSRA 1K95A 4C0JA 5PALA 1KWOC 1MQ1A 1N65A 1CFCA 2AUCA 2K7BA 2BBMA 2JULA 5HL1A 3C1VA 2K61A 2L98A 2M0RA 3LCPC 2YGUA 4F0ZB 1UUSA 5AERA 4CFRA 3AKAA 1IKUA 1KQMB 2F3YA 1M39A 2JZIA 3M0WA 3CZTX 5CSFA 4ORCB 1S3PA 4TNCA 2R2IA 3TDZA 1GQMA 2CNPA 2H61A 1BR1B 3ZNIA 4Q04A 1RWYA 2M8UA 5HKWA 1MWNA 1FBVA 3RM1A 2NCPA 3A8RA 1Q80A 1PSBA 1WLZA 1XFZO 2LE9B 1SRAA 3TDUA 1DC1A 3CGAA 1S6JA 2MLFC 3CR2A 1BG1A 4XJKB 1PRWA 1A03A 2WOSA 1DELA 1MF8B 3AKBA 1CFFA 4KYNA 2AAOA 1B8LA 3KO0A 3I5HB 3SG3A 4OVNF 1K90D 3VRNA 1CLMA 2FCEA 2QACA 2BE4A 2WNDA 1QIVA 5AANA 1RFJA 1SL7A 1A75B 2ZN8A 2PALA 2D8NA 3TS5B 2LVVA 2KAYA 1H4BA 1SNLA 3UO9A 1F55A 1IRJA 4MLWA 4NDDA 1QX5B 1DGVA 1DJIA 2OTGC 3EVVA 2LNKA 4BY5A 2BL0C 1EXRA 4L9MA 4GGNA 4A4CA 1N2DA 1EJ3A 1U5IA 1K8UA 3HCMA 1UHNA 1DF0A 1XFUO 2ZRTA 4GUKA 2LMUA 3RLZA 5HKYA 4PHKA 3O4XA 1CNPA 1WDCC 2HETA 2PASA 1M46A 3LL8B 4OKHA 2GGMA 2L4HA 1S6IA 4MVFA 1OMVA 1JSAA 2M1UA 2KOTA 1L2OC 1XA5A 2GV5A 5I2QA 4M2QA 1KFXS 1XYDA 2CXJA 2L0PA 2EHBA 2NLNA 1V1FA 3I5IB 2LVKA 1TN4A 1QS7A 3I5GC 2V53A 4UPGA 3SS5A 1KK7Z 1XFWO 1QX2A 4IJ7A 3GK4X 2M29A 1J1EA 1K9KA 2K7CA 1NX0A 1UHHA 4P2YB 1EL4A 2KQ6A 1YURA 4P5OE 2Y1NA 4PE0A 5FYXA 5HKZA 2LLUA 1EH2A 5D7FA 3FWBA 1XFYO 1LA0A 1UHKA 2LHLA 3MSEB 2L5YA 2JNXA 2KLDA 5K89A 4YGDB 1CLBA 4YGCB 2G9BA 2LVJA 1JUOA 1CB1A 1AJ4A 4ICBA 5F6TA 2CT9A 4I5JA 3SJSA 1CMGA 4OCIA 3TUYB 1Z2CB 1TNPA 2I18A 1ZUZA 1WY9A 3BQ3A 2JTZA 5I2LA 3D0YB 2M7NA 2G2BA 1FI6A 1QJTA 2FOTA 2KFHA 1GGZA 3SS4A 2Y1MA 4MN0A 2WCFA 1ZFSA 1BLQA 4MEWA 2DOQA 3OX6A 5FI7A 2ZKMX 1F4OA 4WRIA 4YI8A 1HT9A 1GGWA 1XO5A 3TDIA 1JC2A 2I7AA 1AK8A 1TNWA 3BOWA 4NDCA 2BAPA 4FQOA 1NSHA 1UHJA 2BKHB 1KK7Y 2F2OA 1KSMA 2SASA 1KK8B 5HLVA 1PVAA 2H2KA 4GAOA 4FTGA 3OHMB 4A4BA 5TNCA 1B8CA 3LK0A 1BMOA 2FJUB 1QASA 2M1KB 1YRTB 3OB1B 1L7ZA 4PCWA 4PE1A 4YGBB 3JTDC 3CR4X 3PN7C 4ZCVA 2KBMA 3CTNA 2E6WA 2PSRA 2WCEA 2LMTA 2O60A 2OS8C 5J3XA 4CPVA 1Z4HA 1KWOB 1NWDA 1YUUA 1TIZA 2A4JA 5CSIA 1S1EA 4ORAB 1NCXA 1WLMA 5B8IB 1FW4A 4PE7A 2MJWB 1ZOTB 2VRGA 2JU0A 2JXLA 3FS7A 1DTLA 3DF0A 1CMFA 1ALVA 4DRWA 3EG5B 4GGFA 4MRXA 3H4SE 3SG6A 2JXCA 2H61C 3OP0A 1Y1XA 2MBXA 2LUCA 4M2PA 1IJ5A 4QJ3B 3NXAA 3OBVA 1UHIA 2F8PA 4NQGA 1SBJA 3UNWA 1S5GZ 3BUMB 2M7LA 2NZ0A 1AP4A 1R6PA 4M2OA 4C0KA 1K93D 1K96A 2K7DA 4YBHB 1SR6C 1UWOA 1JFKA 3DVJA 2KBIA 2M49B 5D3OA 3PLFB 4WQ2A 1RK9A 3O6BA 1DJZA 3HX4A 4DIRA 4XYNA 1DJXA 1LKJA 3DVKA 1PULA 3KHEA 4CIDA 1G33A 2PRUA 2ISDA 1C7VA 1JFJA 1KFXL 2KAVA 2PVBA 4DUQA 3PM2A 1AHRA 2ZFDA 1A29A 1H8BA 2JNFA 1S26D 3KF9A 1CM4A 1F4QA 1K9UA 3CS1A 3SG4A 1YUTA 3ZWHA 1CDNA 2HF5A 2NXQA 4PDZA 5KSZA 1BOCA 1MR8A 2KFFA 5DKRA 2OTGB 4AOMA 2BL0B 3EVRA 5D69A 4DS7A 4N1GA 2Q91A 4CFQA 2IS9A 2LCPA 1J7PA 2EC6C 4N5XA 2JT3A 1B47A 1ZACA 2K8MB 2KI4C 4PHNA 4YGAA 1BU3A 3VGOA 1DJYA 1WDCB 2CCMA 3NSKA 1R2UA 1DT7B 4JPZB 1W7JB 4BY4A 1U5IB 5GQQC 3JVTC 1DF0B 1KFUS 1J1DA 1L2OB 2MLEC 2RGIA 3GOFA 4OR9B 1UURA 4GFTA 2GGZA 3SS3A 3I5FC 4HREE 1IGVA 3CR5X 4U8DA 2KHNA 1HQVA 1SMGA 3I5GB 1SYMA 1VRKA 2O5GA 3JVTB 5CSJA 1YRUB 1M63B 2LC5A 1Y1UA 1XFXO 1PSRA 2COLB 4MBEA 3PM8A 3NSLA 3DVMA 1KSOA 3SIBA 1QX7A 2AMIA 2LUXA 2WORA 1CDMA 1QLSA 2ZN9A 1ALWA 3WHTB 1B4CA 4IL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZRS A;  3BYA A;  5JJG A;  4MSP A;  2OPO A;  2JWW A;  1E8A A;  1NYA A;  1CFP A;  1A2X A;  3KEV A;  4N1F A;  5CPV A;  1MHO A;  1SCM C;  2KGR A;  2ZND A;  1LIN A;  4MZK A;  4GNK B;  3OB2 B;  1TRF A;  1AVS A;  3EK4 A;  3ICB A;  3VRQ A;  4PHM A;  2CTN A;  3VRP A;  5AEQ A;  1F54 A;  1OSA A;  1NIW A;  2L5X B;  2PMY A;  1YX8 A;  1CKK A;  1JF2 A;  2BE6 A;  2HQ8 A;  1DMO A;  1IJ6 A;  1TNX A;  1XK4 A;  4E68 A;  1JBA A;  3NSO A;  1S6C A;  4HRG A;  2LHI A;  3A4U B;  3EVU A;  4PHJ A;  1J7Q A;  5DKQ A;  1K2H A;  1AUI B;  2KYC A;  1G8I A;  4MRY A;  1OOJ A;  1CLL A;  1QLK A;  2JOJ A;  1NCY A;  2MRD A;  4HRH A;  2EGD A;  1IWQ A;  1GJY A;  1MXL C;  1NX2 A;  3BOW B;  2KFG A;  3BUN B;  4MZL A;  4ZCU A;  1XFV O;  5ER4 X;  1B1G A;  1BF5 A;  3SIA A;  4CLN A;  1YUS A;  2JTT A;  1REC A;  3E3R A;  3VRO A;  4ETO A;  1OMR A;  5KU1 A;  3JTD B;  3PN7 B;  2QPT A;  1KQV A;  1AJ5 A;  3BXK A;  1B8R A;  1UP5 A;  2LAN A;  3WXA A;  2KNE A;  1J7O A;  1EG3 A;  2OS8 B;  1TCF A;  3IF7 A;  5G08 A;  3BUW B;  1TOP A;  2KYF A;  1TNQ A;  1NX3 A;  5DKN A;  1A4P A;  1KQM C;  2MHH A;  3IQQ A;  1F71 A;  2KQY A;  1QAT A;  1XVJ A;  4HSZ A;  5I8N A;  4USL A;  2BBN A;  2KI6 C;  5AFP A;  1C07 A;  1X02 A;  1YX7 A;  3NSI A;  5AXI A;  2WCB A;  4GGF C;  2LM5 A;  1BJF A;  4GPL B;  1RRO A;  4XJK A;  3SG7 A;  4I5K A;  1J55 A;  1K9P A;  4R1E A;  2B1U A;  3DF0 B;  4QJ4 B;  5HYD A;  1BR4 B;  1CDL A;  1QXP A;  3VRR A;  1SW8 A;  1A75 A;  1DJG A;  1SL8 A;  2L4I A;  4NDB A;  4YI9 A;  1SR6 B;  3I5H C;  2KDH A;  1NCZ A;  3GK1 A;  1V1G A;  3EKH A;  2JRF A;  2P6B B;  1SKT A;  2L2E A;  2LVI A;  1KCY A;  4JWQ A;  3LK1 A;  2LV7 A;  1KFU L;  3QRX A;  2F33 A;  1N0Y A;  1DVI A;  1LXF C;  1OMD A;  3TS5 C;  3EK8 A;  1FPW A;  2Q4U A;  1SY9 A;  3SG2 A;  2BCX A;  2I2R E;  3AAK A;  2FCD A;  1RJV A;  1NPQ A;  3IQO A;  2SCP A;  1CFD A;  3FIA A;  1IH0 A;  1PAL A;  2LMV A;  1J7R A;  1B9A A;  3WNX B;  1FI5 A;  5ER5 A;  2M97 A;  2BCA A;  4AQJ A;  1ZMZ A;  3PAT A;  1IQ3 A;  1WRL A;  2HQW A;  3O4Y A;  1SPY A;  2JT8 A;  4PAL A;  1S5G Y;  1OE9 B;  2BEC A;  2K2F A;  2EC6 B;  1M31 A;  1B7T Z;  1BT6 A;  1DGU A;  2JT0 A;  2LP2 A;  5BPJ A;  1SK6 D;  2KI4 B;  1QVI Z;  3BUX B;  1TCO B;  2ZNE A;  3OX5 A;  2MAZ A;  1ODB A;  1Y0V H;  2L51 A;  2HPS A;  1MXE A;  2NCO A;  1FF1 A;  1C7W A;  2LAP A;  3SG5 A;  1CDP A;  1OZS A;  1SL9 A;  3I5I C;  5JOL A;  1IQ5 A;  4GBA A;  3I5F B;  1F8H A;  2WC8 A;  4OV2 A;  4PE4 A;  1Y1A A;  1SCV A;  1YVH A;  3WHU B;  1PVB A;  3CWG A;  4DCK A;  1YVL A;  2F3Z A;  3BUO B;  1QIW A;  2CBL A;  3K21 A;  1EG4 A;  1NP8 A;  1QV0 A;  1M45 A;  2JQ6 A;  2KGB C;  5I2O A;  2LLT A;  2KI6 D;  4C0L A;  3DD4 A;  4YGE B;  3KPX A;  1WRK A;  1OZO A;  1W7I B;  1JWD A;  2BKI B;  1NUB A;  3D0Y A;  5IBW A;  1BOD A;  1WRZ A;  3TZ1 A;  1NX1 A;  1YR5 A;  3GK2 A;  3AAJ A;  4AQI A;  3TUY C;  3CLN A;  4YRU A;  1SCM B;  1DJH A;  5KTY A;  4WQ3 A;  1B7T Y;  1MUX A;  4QJ5 B;  1CM1 A;  1YTZ C;  3PAL A;  1QVI Y;  1S36 A;  2I94 A;  3D10 A;  1LA3 A;  3EK7 A;  2KAX A;  5CSN A;  4D1E A;  1DJW A;  3O2P A;  3F45 A;  2BCB A;  2Y4Q A;  1F70 A;  2JC2 A;  1PK0 D;  3EKJ A;  2JPT A;  1QV1 A;  1XK4 C;  1LVC D;  3DVE A;  2K2A A;  2LLS A;  2KSP A;  2TN4 A;  1KK8 C;  3FWC A;  1QTX A;  4MZJ A;  4ORB B;  1CTR A;  3O78 A;  1JF0 A;  3PFV A;  2LP3 A;  1K94 A;  3LLE A;  1IG5 A;  2Y5I A;  1TTX A;  1OQP A;  4I5L B;  2K0J A;  2MA2 A;  4I5N B;  2L50 A;  1RTP 1;  2E30 A;  1G4Y R;  2K7O A;  2M3W A;  2M9G A;  1D1O A;  1Y6W A;  2F2P A;  4JQ0 D;  5HLO A;  3PSR A;  1K95 A;  4C0J A;  5PAL A;  1KWO C;  1MQ1 A;  1N65 A;  1CFC A;  2AUC A;  2K7B A;  2BBM A;  2JUL A;  3C1V A;  2K61 A;  2L98 A;  2M0R A;  3LCP C;  4F0Z B;  1UUS A;  5AER A;  4CFR A;  3AKA A;  1IKU A;  1KQM B;  2F3Y A;  1M39 A;  2JZI A;  3M0W A;  3CZT X;  5CSF A;  4ORC B;  1S3P A;  4TNC A;  2R2I A;  3TDZ A;  1GQM A;  2CNP A;  2H61 A;  1BR1 B;  3ZNI A;  4Q04 A;  1RWY A;  2M8U A;  5HKW A;  1MWN A;  1FBV A;  3RM1 A;  2NCP A;  3A8R A;  1Q80 A;  1PSB A;  1WLZ A;  1XFZ O;  2LE9 B;  1SRA A;  3TDU A;  3CGA A;  1S6J A;  2MLF C;  3CR2 A;  1BG1 A;  4XJK B;  1PRW A;  1A03 A;  2WOS A;  1MF8 B;  3AKB A;  1CFF A;  2AAO A;  1B8L A;  3KO0 A;  3I5H B;  3SG3 A;  4OVN F;  1K90 D;  3VRN A;  1CLM A;  2FCE A;  2QAC A;  2BE4 A;  2WND A;  1QIV A;  5AAN A;  1RFJ A;  1SL7 A;  1A75 B;  2ZN8 A;  2PAL A;  2D8N A;  3TS5 B;  2LVV A;  2KAY A;  1H4B A;  1SNL A;  1F55 A;  1IRJ A;  4MLW A;  4NDD A;  1QX5 B;  1DGV A;  1DJI A;  2OTG C;  3EVV A;  2LNK A;  4BY5 A;  2BL0 C;  1EXR A;  4L9M A;  4GGN A;  4A4C A;  1N2D A;  1EJ3 A;  1U5I A;  1K8U A;  3HCM A;  1UHN A;  1DF0 A;  1XFU O;  2ZRT A;  4GUK A;  2LMU A;  3RLZ A;  5HKY A;  4PHK A;  1CNP A;  1WDC C;  2HET A;  2PAS A;  1M46 A;  3LL8 B;  4OKH A;  2GGM A;  2L4H A;  1S6I A;  4MVF A;  1OMV A;  1JSA A;  2M1U A;  2KOT A;  1L2O C;  1XA5 A;  2GV5 A;  5I2Q A;  4M2Q A;  1KFX S;  1XYD A;  2CXJ A;  2L0P A;  2EHB A;  2NLN A;  1V1F A;  3I5I B;  2LVK A;  1TN4 A;  1QS7 A;  3I5G C;  2V53 A;  4UPG A;  1KK7 Z;  1XFW O;  1QX2 A;  3GK4 X;  2M29 A;  1J1E A;  1K9K A;  2K7C A;  1NX0 A;  1UHH A;  4P2Y B;  1EL4 A;  2KQ6 A;  1YUR A;  4P5O E;  2Y1N A;  4PE0 A;  5FYX A;  5HKZ A;  2LLU A;  1EH2 A;  5D7F A;  3FWB A;  1XFY O;  1LA0 A;  1UHK A;  2LHL A;  3MSE B;  2JNX A;  5K89 A;  4YGD B;  1CLB A;  4YGC B;  2G9B A;  2LVJ A;  1JUO A;  1CB1 A;  1AJ4 A;  4ICB A;  5F6T A;  2CT9 A;  4I5J A;  3SJS A;  1CMG A;  4OCI A;  3TUY B;  1TNP A;  2I18 A;  1ZUZ A;  1WY9 A;  3BQ3 A;  2JTZ A;  5I2L A;  3D0Y B;  2M7N A;  2G2B A;  1FI6 A;  1QJT A;  2FOT A;  2KFH A;  1GGZ A;  2Y1M A;  4MN0 A;  2WCF A;  1ZFS A;  1BLQ A;  4MEW A;  2DOQ A;  3OX6 A;  2ZKM X;  1F4O A;  4WRI A;  4YI8 A;  1HT9 A;  1GGW A;  1XO5 A;  3TDI A;  1JC2 A;  2I7A A;  1AK8 A;  1TNW A;  3BOW A;  4NDC A;  4FQO A;  1NSH A;  1UHJ A;  2BKH B;  1KK7 Y;  2F2O A;  1KSM A;  2SAS A;  1KK8 B;  5HLV A;  1PVA A;  2H2K A;  4GAO A;  4FTG A;  3OHM B;  4A4B A;  5TNC A;  1B8C A;  3LK0 A;  1BMO A;  2FJU B;  1QAS A;  2M1K B;  1YRT B;  3OB1 B;  1L7Z A;  4PCW A;  4PE1 A;  4YGB B;  3JTD C;  3CR4 X;  3PN7 C;  4ZCV A;  2KBM A;  3CTN A;  2E6W A;  2PSR A;  2WCE A;  2LMT A;  2O60 A;  2OS8 C;  5J3X A;  4CPV A;  1KWO B;  1NWD A;  1YUU A;  1TIZ A;  2A4J A;  5CSI A;  1S1E A;  4ORA B;  1NCX A;  1WLM A;  5B8I B;  1FW4 A;  4PE7 A;  2MJW B;  1ZOT B;  2VRG A;  2JU0 A;  2JXL A;  3FS7 A;  1DTL A;  3DF0 A;  1CMF A;  1ALV A;  4DRW A;  4GGF A;  4MRX A;  3H4S E;  3SG6 A;  2JXC A;  2H61 C;  3OP0 A;  1Y1X A;  2MBX A;  2LUC A;  4M2P A;  1IJ5 A;  4QJ3 B;  3NXA A;  1UHI A;  2F8P A;  4NQG A;  1SBJ A;  1S5G Z;  3BUM B;  2M7L A;  2NZ0 A;  1AP4 A;  1R6P A;  4M2O A;  4C0K A;  1K93 D;  1K96 A;  2K7D A;  4YBH B;  1SR6 C;  1UWO A;  1JFK A;  3DVJ A;  2KBI A;  2M49 B;  3PLF B;  4WQ2 A;  1RK9 A;  3O6B A;  1DJZ A;  3HX4 A;  4DIR A;  4XYN A;  1DJX A;  1LKJ A;  3DVK A;  1PUL A;  3KHE A;  4CID A;  1G33 A;  2PRU A;  2ISD A;  1C7V A;  1JFJ A;  1KFX L;  2KAV A;  2PVB A;  4DUQ A;  1AHR A;  2ZFD A;  1A29 A;  1H8B A;  2JNF A;  1S26 D;  3KF9 A;  1CM4 A;  1F4Q A;  1K9U A;  3CS1 A;  3SG4 A;  1YUT A;  3ZWH A;  1CDN A;  2HF5 A;  2NXQ A;  4PDZ A;  5KSZ A;  1BOC A;  1MR8 A;  2KFF A;  5DKR A;  2OTG B;  4AOM A;  2BL0 B;  3EVR A;  5D69 A;  4DS7 A;  4N1G A;  2Q91 A;  4CFQ A;  2IS9 A;  2LCP A;  1J7P A;  2EC6 C;  4N5X A;  2JT3 A;  1B47 A;  1ZAC A;  2K8M B;  2KI4 C;  4PHN A;  4YGA A;  1BU3 A;  3VGO A;  1DJY A;  1WDC B;  2CCM A;  3NSK A;  1R2U A;  1DT7 B;  4JPZ B;  1W7J B;  4BY4 A;  1U5I B;  5GQQ C;  3JVT C;  1DF0 B;  1KFU S;  1J1D A;  1L2O B;  2MLE C;  2RGI A;  3GOF A;  4OR9 B;  1UUR A;  4GFT A;  2GGZ A;  3I5F C;  4HRE E;  1IGV A;  3CR5 X;  4U8D A;  2KHN A;  1HQV A;  1SMG A;  3I5G B;  1SYM A;  1VRK A;  2O5G A;  3JVT B;  5CSJ A;  1YRU B;  1M63 B;  2LC5 A;  1Y1U A;  1XFX O;  1PSR A;  2COL B;  4MBE A;  3PM8 A;  3NSL A;  3DVM A;  1KSO A;  3SIB A;  1QX7 A;  2AMI A;  2LUX A;  2WOR A;  1CDM A;  1QLS A;  2ZN9 A;  1ALW A;  3WHT B;  1B4C A;  4IL1 A; 
#chains in the Genus database with same CATH topology
 2ZRS A;  3BYA A;  5JJG A;  4MSP A;  3D76 A;  2OPO A;  2JWW A;  1E8A A;  1NYA A;  2QEO A;  1CFP A;  1A2X A;  3KEV A;  4N1F A;  5CPV A;  1MHO A;  1SCM C;  2KGR A;  2ZND A;  1LIN A;  4MZK A;  4GNK B;  3OB2 B;  1TRF A;  1AVS A;  3EK4 A;  3ICB A;  3VRQ A;  4PHM A;  2CTN A;  3VRP A;  5AEQ A;  3CZ2 A;  1F54 A;  1OSA A;  1NIW A;  2L5X B;  2PMY A;  1YX8 A;  1CKK A;  3DYE A;  2KLE A;  1JF2 A;  2BE6 A;  2HQ8 A;  1DMO A;  3D78 A;  1IJ6 A;  3N7H A;  1TNX A;  3FE8 A;  1XK4 A;  4E68 A;  1JBA A;  3NSO A;  1S6C A;  4HRG A;  2LHI A;  3A4U B;  3EVU A;  4PHJ A;  3RZS A;  5DKQ A;  1J7Q A;  1K2H A;  1AUI B;  2KYC A;  1G8I A;  4MRY A;  2WCL A;  1OOJ A;  1CLL A;  1QLK A;  2JOJ A;  1NCY A;  2MRD A;  4HRH A;  3B87 A;  2EGD A;  1IWQ A;  2ERB A;  1GJY A;  1MXL C;  1NX2 A;  3BOW B;  2KFG A;  3BUN B;  4MZL A;  4ZCU A;  1XFV O;  5ER4 X;  1B1G A;  1BF5 A;  3SIA A;  4CLN A;  1YUS A;  2JTT A;  1REC A;  3E3R A;  3S0G A;  3VRO A;  4ETO A;  1OMR A;  5KU1 A;  2WCM A;  3JTD B;  3PN7 B;  2QPT A;  1KQV A;  1AJ5 A;  3BXK A;  1B8R A;  1UP5 A;  2LAN A;  3WXA A;  2KNE A;  1J7O A;  1EG3 A;  2OS8 B;  1TCF A;  3IF7 A;  4FQT A;  5G08 A;  3BUW B;  1TOP A;  2KYF A;  1TNQ A;  1NX3 A;  5DKN A;  1A4P A;  1KQM C;  2MHH A;  3IQQ A;  3NGV A;  2KQY A;  1F71 A;  1QAT A;  1XVJ A;  4HSZ A;  5I8N A;  4USL A;  2BBN A;  2KI6 C;  5AFP A;  1C07 A;  5FI6 A;  1X02 A;  1YX7 A;  3NSI A;  5AXI A;  2WCB A;  4GGF C;  2LM5 A;  1BJF A;  4GPL B;  1RRO A;  4XJK A;  3SG7 A;  4I5K A;  1J55 A;  1K9P A;  4R1E A;  2B1U A;  3DF0 B;  1DEK A;  4QJ4 B;  5HYD A;  3PJI A;  3L4L A;  1BR4 B;  1CDL A;  3R1P A;  1QXP A;  3VRR A;  1SW8 A;  1A75 A;  1DJG A;  1SL8 A;  2L4I A;  4NDB A;  4YI9 A;  3S0F A;  1SR6 B;  2WCH A;  2P71 A;  3I5H C;  3CZ1 A;  2KDH A;  1NCZ A;  3GK1 A;  2K60 A;  1V1G A;  3EKH A;  2JRF A;  2P6B B;  1SKT A;  2L2E A;  2LVI A;  2JPO A;  3S0B A;  4JWQ A;  3LK1 A;  3V2L A;  1KCY A;  2LV7 A;  1KFU L;  3QRX A;  2F33 A;  1N0Y A;  1DVI A;  1LXF C;  1OMD A;  3TS5 C;  3EK8 A;  1FPW A;  2Q4U A;  1SY9 A;  3SG2 A;  2BCX A;  2I2R E;  3R1V A;  3AAK A;  2FCD A;  1RJV A;  1NPQ A;  3IQO A;  2SCP A;  1CFD A;  1C3Z A;  3FIA A;  1IH0 A;  1PAL A;  2LMV A;  1J7R A;  1B9A A;  3WNX B;  1FI5 A;  5ER5 A;  2M97 A;  2BCA A;  4AQJ A;  1ZMZ A;  3PAT A;  1IQ3 A;  1WRL A;  2HQW A;  3O4Y A;  1SPY A;  2JT8 A;  4PAL A;  1S5G Y;  1OE9 B;  2BEC A;  2QDI A;  2K2F A;  2EC6 B;  1M31 A;  1B7T Z;  1BT6 A;  1DGU A;  2JT0 A;  2LP2 A;  5BPJ A;  1SK6 D;  2KI4 B;  4JD9 A;  1QVI Z;  3BUX B;  1TCO B;  2ZNE A;  3OX5 A;  2MAZ A;  1ODB A;  1Y0V H;  2L51 A;  2HPS A;  1MXE A;  2NCO A;  1FF1 A;  1C7W A;  2LAP A;  3SG5 A;  1CDP A;  1OZS A;  1SL9 A;  3I5I C;  5JOL A;  1IQ5 A;  1QWV A;  4GBA A;  3I5F B;  1F8H A;  3DXL A;  2WC8 A;  3K1E A;  4OV2 A;  4PE4 A;  1Y1A A;  1SCV A;  1YVH A;  3WHU B;  1PVB A;  3CWG A;  4JKT A;  4DCK A;  1YVL A;  2F3Z A;  3BUO B;  1QIW A;  2CBL A;  3K21 A;  1EG4 A;  1NP8 A;  1QV0 A;  1M45 A;  1W9Z A;  2JQ6 A;  2KGB C;  2LLT A;  2KI6 D;  4C0L A;  3DD4 A;  4YGE B;  3KPX A;  1WRK A;  2BNX A;  1OZO A;  2H8V A;  1W7I B;  1JWD A;  2BKI B;  3R1O A;  1NUB A;  3D0Y A;  5IBW A;  1BOD A;  1WRZ A;  3TZ1 A;  1NX1 A;  1YR5 A;  3D75 A;  3GK2 A;  3AAJ A;  4AQI A;  3TUY C;  3CLN A;  4YRU A;  1SCM B;  1DJH A;  5KTY A;  4WQ3 A;  1B7T Y;  2P70 A;  1MUX A;  4QJ5 B;  1CM1 A;  1YTZ C;  3DY9 A;  1QVI Y;  1S36 A;  2I94 A;  3PAL A;  3D10 A;  3D73 A;  1LA3 A;  3EK7 A;  2KAX A;  3DZT A;  5CSN A;  4D1E A;  1DJW A;  3O2P A;  3F45 A;  2BCB A;  2Y4Q A;  5I94 A;  1F70 A;  2JC2 A;  1PK0 D;  3EKJ A;  2JPT A;  1QV1 A;  1XK4 C;  1LVC D;  3DVE A;  2K2A A;  2LLS A;  1TWO A;  2KSP A;  2TN4 A;  1KK8 C;  3FWC A;  1QTX A;  4MZJ A;  4ORB B;  1CTR A;  3O78 A;  1JF0 A;  3PFV A;  2LP3 A;  3Q8I A;  1K94 A;  3IVT A;  1IG5 A;  3LLE A;  5FI2 A;  2Y5I A;  1TTX A;  1OQP A;  4I5L B;  2K0J A;  2MA2 A;  4I5N B;  2L50 A;  1RTP 1;  2E30 A;  1G4Y R;  2K7O A;  2M3W A;  2M9G A;  3BFA A;  1D1O A;  1Y6W A;  2F2P A;  4JQ0 D;  5HLO A;  3PSR A;  1K95 A;  4C0J A;  5PAL A;  1KWO C;  1MQ1 A;  1N65 A;  1CFC A;  2AUC A;  2K7B A;  2BBM A;  3NHT A;  2JUL A;  5HL1 A;  3C1V A;  2K61 A;  2L98 A;  2M0R A;  3FE9 A;  3LCP C;  2YGU A;  4F0Z B;  1UUS A;  5AER A;  4CFR A;  3AKA A;  1IKU A;  1KQM B;  2F3Y A;  1M39 A;  2JZI A;  3M0W A;  3CZT X;  5CSF A;  4ORC B;  1S3P A;  3FE6 A;  4TNC A;  2R2I A;  3TDZ A;  1GQM A;  2CNP A;  2H61 A;  2WCJ A;  1BR1 B;  3ZNI A;  4Q04 A;  1RWY A;  2M8U A;  3D74 A;  5HKW A;  1MWN A;  1FBV A;  3RM1 A;  2NCP A;  3A8R A;  3BFB A;  1Q80 A;  1PSB A;  1WLZ A;  1XFZ O;  2LE9 B;  1SRA A;  3TDU A;  1DC1 A;  3CGA A;  1S6J A;  1OOG A;  2MLF C;  3CR2 A;  1BG1 A;  4XJK B;  1PRW A;  1A03 A;  2WOS A;  1DEL A;  1MF8 B;  1XFR A;  3AKB A;  4KYN A;  2AAO A;  1B8L A;  3KO0 A;  1CFF A;  3I5H B;  3CDN A;  4OVN F;  3SG3 A;  1DQE A;  1K90 D;  3VRN A;  1CLM A;  2FCE A;  2QAC A;  2BE4 A;  2WND A;  1QIV A;  5AAN A;  1ORG A;  3L4A A;  1RFJ A;  1SL7 A;  1A75 B;  2ZN8 A;  3L47 A;  2PAL A;  2D8N A;  3TS5 B;  2LVV A;  2KAY A;  2WC6 A;  1SNL A;  3UO9 A;  1H4B A;  1F55 A;  1IRJ A;  4MLW A;  4NDD A;  1QX5 B;  1DGV A;  1DJI A;  2OTG C;  3EVV A;  2LNK A;  4BY5 A;  2BL0 C;  1EXR A;  4L9M A;  4GGN A;  4A4C A;  1N2D A;  4INW A;  1EJ3 A;  1SSE B;  1U5I A;  1K8U A;  5EL2 A;  3HCM A;  1UHN A;  1DF0 A;  1XFU O;  2ZRT A;  4GUK A;  2LMU A;  3RLZ A;  5HKY A;  3O4X A;  4PHK A;  1CNP A;  1WDC C;  2HET A;  2PAS A;  1M46 A;  1TUJ A;  3LL8 B;  4OKH A;  2GGM A;  2L4H A;  1S6I A;  4MVF A;  1OMV A;  1JSA A;  2M1U A;  2KOT A;  1L2O C;  1XA5 A;  2GV5 A;  5I2Q A;  4M2Q A;  1KFX S;  1XYD A;  2CXJ A;  2L0P A;  2EHB A;  2NLN A;  1V1F A;  3BFH A;  2LVK A;  3I5I B;  3OGN A;  1TN4 A;  1QS7 A;  3I5G C;  2WCK A;  2V53 A;  4UPG A;  3SS5 A;  1KK7 Z;  3S0E A;  3VB1 A;  1XFW O;  1QX2 A;  4IJ7 A;  3GK4 X;  2M29 A;  1J1E A;  1K9K A;  2K7C A;  1NX0 A;  1UHH A;  4P2Y B;  1EL4 A;  2KQ6 A;  1OOI X;  3D77 A;  1YUR A;  1OOF A;  4P5O E;  2Y1N A;  4PE0 A;  5FYX A;  5HKZ A;  2LLU A;  1EH2 A;  5D7F A;  3FWB A;  1XFY O;  1LA0 A;  1UHK A;  2LHL A;  3MSE B;  3S0A A;  2L5Y A;  2JNX A;  2KLD A;  2PYQ A;  5K89 A;  4YGD B;  4PT1 A;  1CLB A;  4YGC B;  2G9B A;  2LVJ A;  1JUO A;  1CB1 A;  2PQL A;  1AJ4 A;  4ICB A;  5F6T A;  2CT9 A;  4I5J A;  3SJS A;  1CMG A;  4OCI A;  1Z2C B;  3TUY B;  1TNP A;  2I18 A;  1ZUZ A;  1WY9 A;  3BQ3 A;  2JTZ A;  5I2L A;  3D0Y B;  2M7N A;  2G2B A;  1FI6 A;  1QJT A;  2FOT A;  2KFH A;  1GGZ A;  3SS4 A;  2Y1M A;  4MN0 A;  3CZ0 A;  2WCF A;  1ZFS A;  1BLQ A;  1GM0 A;  4MEW A;  2DOQ A;  3OX6 A;  1C3Y A;  1IIO A;  5FI7 A;  2ZKM X;  1F4O A;  4WRI A;  4YI8 A;  1HT9 A;  1GGW A;  1XO5 A;  3TDI A;  1JC2 A;  2I7A A;  1AK8 A;  1TNW A;  3BOW A;  2BAP A;  4NDC A;  4FQO A;  1NSH A;  1UHJ A;  3S0D A;  2BKH B;  1KK7 Y;  2F2O A;  1KSM A;  3NHI A;  2SAS A;  1KK8 B;  5HLV A;  1PVA A;  2H2K A;  5I2O A;  3CAB A;  4GAO A;  4FTG A;  3OHM B;  4A4B A;  5TNC A;  1B8C A;  3LK0 A;  1BMO A;  2FJU B;  1QAS A;  2M1K B;  2QEV A;  1YRT B;  3OB1 B;  1L7Z A;  4PCW A;  4PE1 A;  2WC5 A;  4YGB B;  3JTD C;  3CR4 X;  3PN7 C;  4ZCV A;  2KBM A;  3CTN A;  2E6W A;  2PSR A;  2WCE A;  2LMT A;  2O60 A;  2OS8 C;  5J3X A;  4CPV A;  1Z4H A;  1KWO B;  3B7A A;  1NWD A;  3B86 A;  3R72 A;  1OW4 A;  1YUU A;  1TIZ A;  2A4J A;  5CSI A;  1S1E A;  4ORA B;  1NCX A;  1WLM A;  5B8I B;  1FW4 A;  4PE7 A;  2MJW B;  1ZOT B;  2VRG A;  2JU0 A;  2JXL A;  3FS7 A;  1DTL A;  3DF0 A;  1CMF A;  3QME A;  1ALV A;  3EG5 B;  4DRW A;  2QEB A;  4GGF A;  4MRX A;  3H4S E;  3SG6 A;  2JXC A;  2H61 C;  3OP0 A;  1Y1X A;  2MBX A;  2LUC A;  4M2P A;  1IJ5 A;  4QJ3 B;  3NXA A;  3OBV A;  1UHI A;  2F8P A;  4NQG A;  1SBJ A;  3UNW A;  1S5G Z;  3BUM B;  2M7L A;  2NZ0 A;  1AP4 A;  1R6P A;  4INX A;  4M2O A;  4C0K A;  1K93 D;  1K96 A;  2K7D A;  4YBH B;  1SR6 C;  1UWO A;  1JFK A;  3DVJ A;  1LS8 A;  2KBI A;  2M49 B;  5D3O A;  3PLF B;  4WQ2 A;  1RK9 A;  3O6B A;  1DJZ A;  3HX4 A;  4DIR A;  4XYN A;  1DJX A;  1LKJ A;  3DVK A;  1PUL A;  3KHE A;  4CID A;  1OOH A;  1G33 A;  2PRU A;  2ISD A;  1C7V A;  3B6X A;  1JFJ A;  1KFX L;  2KAV A;  2PVB A;  4DUQ A;  3PM2 A;  1AHR A;  2ZFD A;  1A29 A;  1H8B A;  2JNF A;  1S26 D;  3KF9 A;  1CM4 A;  1F4Q A;  1K9U A;  3CS1 A;  3SG4 A;  1YUT A;  3ZWH A;  1CDN A;  2HF5 A;  1T14 A;  5DIC A;  2NXQ A;  4PDZ A;  5KSZ A;  1BOC A;  1MR8 A;  2KFF A;  5DKR A;  2OTG B;  4AOM A;  2BL0 B;  3EVR A;  5D69 A;  4DS7 A;  3B88 A;  4N1G A;  1TUZ A;  2Q91 A;  2FJY A;  4CFQ A;  2IS9 A;  2LCP A;  2QEH A;  1J7P A;  2EC6 C;  4N5X A;  2JT3 A;  1B47 A;  1ZAC A;  2K8M B;  3CYZ A;  2KI4 C;  4PHN A;  4YGA A;  1BU3 A;  3VGO A;  1DJY A;  1WDC B;  2CCM A;  3NSK A;  1R2U A;  1DT7 B;  4JPZ B;  1W7J B;  4BY4 A;  1U5I B;  5GQQ C;  3JVT C;  1DF0 B;  1KFU S;  1J1D A;  1L2O B;  2MLE C;  2RGI A;  3GOF A;  4OR9 B;  1UUR A;  4GFT A;  2GGZ A;  3SS3 A;  1P28 A;  3I5F C;  1IGV A;  3CR5 X;  4HRE E;  4U8D A;  2KHN A;  1HQV A;  2L2C A;  1SMG A;  3I5G B;  1SYM A;  1VRK A;  2O5G A;  3JVT B;  5CSJ A;  2GTE A;  1YRU B;  1M63 B;  2LC5 A;  4OZD A;  1Y1U A;  1XFX O;  1PSR A;  2COL B;  4MBE A;  2KPH A;  3PM8 A;  3BJH A;  3NSL A;  3DVM A;  1KSO A;  3SIB A;  1QX7 A;  2AMI A;  2LUX A;  2WOR A;  1CDM A;  1QLS A;  2ZN9 A;  4F7F A;  1ALW A;  3WHT B;  1B4C A;  4IL1 A; 
#chains in the Genus database with same CATH homology
 2ZRS A;  3BYA A;  5JJG A;  4MSP A;  2OPO A;  2JWW A;  1E8A A;  1NYA A;  1CFP A;  1A2X A;  3KEV A;  4N1F A;  5CPV A;  1MHO A;  1SCM C;  2KGR A;  2ZND A;  1LIN A;  4MZK A;  4GNK B;  3OB2 B;  1TRF A;  1AVS A;  3EK4 A;  3ICB A;  3VRQ A;  4PHM A;  2CTN A;  3VRP A;  5AEQ A;  1F54 A;  1OSA A;  1NIW A;  2L5X B;  2PMY A;  1YX8 A;  1CKK A;  2KLE A;  1JF2 A;  2BE6 A;  2HQ8 A;  1DMO A;  1IJ6 A;  1TNX A;  1XK4 A;  4E68 A;  1JBA A;  3NSO A;  1S6C A;  4HRG A;  2LHI A;  3A4U B;  3EVU A;  4PHJ A;  1J7Q A;  5DKQ A;  1K2H A;  1AUI B;  2KYC A;  1G8I A;  4MRY A;  1OOJ A;  1CLL A;  1QLK A;  2JOJ A;  1NCY A;  2MRD A;  4HRH A;  2EGD A;  1IWQ A;  1GJY A;  1MXL C;  1NX2 A;  3BOW B;  2KFG A;  3BUN B;  4MZL A;  4ZCU A;  1XFV O;  5ER4 X;  1B1G A;  1BF5 A;  3SIA A;  4CLN A;  1YUS A;  2JTT A;  1REC A;  3E3R A;  3VRO A;  4ETO A;  1OMR A;  5KU1 A;  3JTD B;  3PN7 B;  2QPT A;  1KQV A;  1AJ5 A;  3BXK A;  1B8R A;  1UP5 A;  2LAN A;  3WXA A;  2KNE A;  1J7O A;  1EG3 A;  2OS8 B;  1TCF A;  3IF7 A;  5G08 A;  3BUW B;  1TOP A;  2KYF A;  1TNQ A;  1NX3 A;  5DKN A;  1A4P A;  1KQM C;  2MHH A;  3IQQ A;  1F71 A;  2KQY A;  1QAT A;  1XVJ A;  4HSZ A;  5I8N A;  4USL A;  2BBN A;  2KI6 C;  5AFP A;  1C07 A;  5FI6 A;  1X02 A;  1YX7 A;  3NSI A;  5AXI A;  2WCB A;  4GGF C;  2LM5 A;  1BJF A;  4GPL B;  1RRO A;  4XJK A;  3SG7 A;  4I5K A;  1J55 A;  1K9P A;  4R1E A;  2B1U A;  3DF0 B;  1DEK A;  4QJ4 B;  5HYD A;  1BR4 B;  1CDL A;  1QXP A;  3VRR A;  1SW8 A;  1A75 A;  1DJG A;  1SL8 A;  2L4I A;  4NDB A;  4YI9 A;  1SR6 B;  3I5H C;  2KDH A;  1NCZ A;  3GK1 A;  2K60 A;  1V1G A;  3EKH A;  2JRF A;  2P6B B;  1SKT A;  2L2E A;  2LVI A;  1KCY A;  4JWQ A;  3LK1 A;  2LV7 A;  1KFU L;  3QRX A;  2F33 A;  1N0Y A;  1DVI A;  1LXF C;  1OMD A;  3TS5 C;  3EK8 A;  1FPW A;  2Q4U A;  1SY9 A;  3SG2 A;  2BCX A;  2I2R E;  3AAK A;  2FCD A;  1RJV A;  1NPQ A;  3IQO A;  2SCP A;  1CFD A;  3FIA A;  1IH0 A;  1PAL A;  2LMV A;  1J7R A;  1B9A A;  3WNX B;  1FI5 A;  5ER5 A;  2M97 A;  2BCA A;  4AQJ A;  1ZMZ A;  3PAT A;  1IQ3 A;  1WRL A;  2HQW A;  3O4Y A;  1SPY A;  2JT8 A;  4PAL A;  1S5G Y;  1OE9 B;  2BEC A;  2K2F A;  2EC6 B;  1M31 A;  1B7T Z;  1BT6 A;  1DGU A;  2JT0 A;  2LP2 A;  5BPJ A;  1SK6 D;  2KI4 B;  1QVI Z;  3BUX B;  1TCO B;  2ZNE A;  3OX5 A;  2MAZ A;  1ODB A;  1Y0V H;  2L51 A;  2HPS A;  1MXE A;  2NCO A;  1FF1 A;  1C7W A;  2LAP A;  3SG5 A;  1CDP A;  1OZS A;  1SL9 A;  3I5I C;  5JOL A;  1IQ5 A;  4GBA A;  3I5F B;  1F8H A;  2WC8 A;  4OV2 A;  4PE4 A;  1Y1A A;  1SCV A;  1YVH A;  3WHU B;  1PVB A;  3CWG A;  4DCK A;  4JKT A;  1YVL A;  2F3Z A;  3BUO B;  1QIW A;  2CBL A;  3K21 A;  1EG4 A;  1NP8 A;  1QV0 A;  1M45 A;  2JQ6 A;  2KGB C;  5I2O A;  1W9Z A;  2LLT A;  2KI6 D;  4C0L A;  3DD4 A;  4YGE B;  3KPX A;  1WRK A;  2BNX A;  1OZO A;  1W7I B;  1JWD A;  2BKI B;  1NUB A;  3D0Y A;  5IBW A;  1BOD A;  1WRZ A;  3TZ1 A;  1NX1 A;  1YR5 A;  3GK2 A;  3AAJ A;  4AQI A;  3TUY C;  3CLN A;  4YRU A;  1SCM B;  1DJH A;  5KTY A;  4WQ3 A;  1B7T Y;  1MUX A;  4QJ5 B;  1CM1 A;  1YTZ C;  3PAL A;  1QVI Y;  1S36 A;  2I94 A;  3D10 A;  1LA3 A;  3EK7 A;  2KAX A;  5CSN A;  4D1E A;  1DJW A;  3O2P A;  3F45 A;  2BCB A;  2Y4Q A;  1F70 A;  5I94 A;  2JC2 A;  1PK0 D;  3EKJ A;  2JPT A;  1QV1 A;  1XK4 C;  1LVC D;  3DVE A;  2K2A A;  2LLS A;  2KSP A;  2TN4 A;  1KK8 C;  3FWC A;  1QTX A;  4MZJ A;  4ORB B;  1CTR A;  3O78 A;  1JF0 A;  3PFV A;  2LP3 A;  1K94 A;  3LLE A;  1IG5 A;  3IVT A;  5FI2 A;  2Y5I A;  1TTX A;  1OQP A;  4I5L B;  2K0J A;  2MA2 A;  4I5N B;  2L50 A;  1RTP 1;  2E30 A;  1G4Y R;  2K7O A;  2M3W A;  2M9G A;  1D1O A;  1Y6W A;  2F2P A;  4JQ0 D;  5HLO A;  3PSR A;  1K95 A;  4C0J A;  5PAL A;  1KWO C;  1MQ1 A;  1N65 A;  1CFC A;  2AUC A;  2K7B A;  2BBM A;  2JUL A;  5HL1 A;  3C1V A;  2K61 A;  2L98 A;  2M0R A;  3LCP C;  2YGU A;  4F0Z B;  1UUS A;  5AER A;  4CFR A;  3AKA A;  1IKU A;  1KQM B;  2F3Y A;  1M39 A;  2JZI A;  3M0W A;  3CZT X;  5CSF A;  4ORC B;  1S3P A;  4TNC A;  2R2I A;  3TDZ A;  1GQM A;  2CNP A;  2H61 A;  1BR1 B;  3ZNI A;  4Q04 A;  1RWY A;  2M8U A;  5HKW A;  1MWN A;  1FBV A;  3RM1 A;  2NCP A;  3A8R A;  1Q80 A;  1PSB A;  1WLZ A;  1XFZ O;  2LE9 B;  1SRA A;  3TDU A;  1DC1 A;  3CGA A;  1S6J A;  2MLF C;  3CR2 A;  1BG1 A;  4XJK B;  1PRW A;  1A03 A;  2WOS A;  1DEL A;  1MF8 B;  3AKB A;  1CFF A;  4KYN A;  2AAO A;  1B8L A;  3KO0 A;  3I5H B;  3SG3 A;  4OVN F;  1K90 D;  3VRN A;  1CLM A;  2FCE A;  2QAC A;  2BE4 A;  2WND A;  1QIV A;  5AAN A;  1RFJ A;  1SL7 A;  1A75 B;  2ZN8 A;  2PAL A;  2D8N A;  3TS5 B;  2LVV A;  2KAY A;  1H4B A;  1SNL A;  3UO9 A;  1F55 A;  1IRJ A;  4MLW A;  4NDD A;  1QX5 B;  1DGV A;  1DJI A;  2OTG C;  3EVV A;  2LNK A;  4BY5 A;  2BL0 C;  1EXR A;  4L9M A;  4GGN A;  4A4C A;  1N2D A;  1EJ3 A;  1U5I A;  1K8U A;  3HCM A;  1UHN A;  1DF0 A;  1XFU O;  2ZRT A;  4GUK A;  2LMU A;  3RLZ A;  5HKY A;  4PHK A;  3O4X A;  1CNP A;  1WDC C;  2HET A;  2PAS A;  1M46 A;  3LL8 B;  4OKH A;  2GGM A;  2L4H A;  1S6I A;  4MVF A;  1OMV A;  1JSA A;  2M1U A;  2KOT A;  1L2O C;  1XA5 A;  2GV5 A;  5I2Q A;  4M2Q A;  1KFX S;  1XYD A;  2CXJ A;  2L0P A;  2EHB A;  2NLN A;  1V1F A;  3I5I B;  2LVK A;  1TN4 A;  1QS7 A;  3I5G C;  2V53 A;  4UPG A;  3SS5 A;  1KK7 Z;  1XFW O;  1QX2 A;  4IJ7 A;  3GK4 X;  2M29 A;  1J1E A;  1K9K A;  2K7C A;  1NX0 A;  1UHH A;  4P2Y B;  1EL4 A;  2KQ6 A;  1YUR A;  4P5O E;  2Y1N A;  4PE0 A;  5FYX A;  5HKZ A;  2LLU A;  1EH2 A;  5D7F A;  3FWB A;  1XFY O;  1LA0 A;  1UHK A;  2LHL A;  3MSE B;  2L5Y A;  2JNX A;  2KLD A;  5K89 A;  4YGD B;  1CLB A;  4YGC B;  2G9B A;  2LVJ A;  1JUO A;  1CB1 A;  1AJ4 A;  4ICB A;  5F6T A;  2CT9 A;  4I5J A;  3SJS A;  1CMG A;  4OCI A;  3TUY B;  1Z2C B;  1TNP A;  2I18 A;  1ZUZ A;  1WY9 A;  3BQ3 A;  2JTZ A;  5I2L A;  3D0Y B;  2M7N A;  2G2B A;  1FI6 A;  1QJT A;  2FOT A;  2KFH A;  1GGZ A;  3SS4 A;  2Y1M A;  4MN0 A;  2WCF A;  1ZFS A;  1BLQ A;  4MEW A;  2DOQ A;  3OX6 A;  5FI7 A;  2ZKM X;  1F4O A;  4WRI A;  4YI8 A;  1HT9 A;  1GGW A;  1XO5 A;  3TDI A;  1JC2 A;  2I7A A;  1AK8 A;  1TNW A;  3BOW A;  4NDC A;  2BAP A;  4FQO A;  1NSH A;  1UHJ A;  2BKH B;  1KK7 Y;  2F2O A;  1KSM A;  2SAS A;  1KK8 B;  5HLV A;  1PVA A;  2H2K A;  4GAO A;  4FTG A;  3OHM B;  4A4B A;  5TNC A;  1B8C A;  3LK0 A;  1BMO A;  2FJU B;  1QAS A;  2M1K B;  1YRT B;  3OB1 B;  1L7Z A;  4PCW A;  4PE1 A;  4YGB B;  3JTD C;  3CR4 X;  3PN7 C;  4ZCV A;  2KBM A;  3CTN A;  2E6W A;  2PSR A;  2WCE A;  2LMT A;  2O60 A;  2OS8 C;  5J3X A;  4CPV A;  1Z4H A;  1KWO B;  1NWD A;  1YUU A;  1TIZ A;  2A4J A;  5CSI A;  1S1E A;  4ORA B;  1NCX A;  1WLM A;  5B8I B;  1FW4 A;  4PE7 A;  2MJW B;  1ZOT B;  2VRG A;  2JU0 A;  2JXL A;  3FS7 A;  1DTL A;  3DF0 A;  1CMF A;  1ALV A;  4DRW A;  3EG5 B;  4GGF A;  4MRX A;  3H4S E;  3SG6 A;  2JXC A;  2H61 C;  3OP0 A;  1Y1X A;  2MBX A;  2LUC A;  4M2P A;  1IJ5 A;  4QJ3 B;  3NXA A;  3OBV A;  1UHI A;  2F8P A;  4NQG A;  1SBJ A;  3UNW A;  1S5G Z;  3BUM B;  2M7L A;  2NZ0 A;  1AP4 A;  1R6P A;  4M2O A;  4C0K A;  1K93 D;  1K96 A;  2K7D A;  4YBH B;  1SR6 C;  1UWO A;  1JFK A;  3DVJ A;  2KBI A;  2M49 B;  5D3O A;  3PLF B;  4WQ2 A;  1RK9 A;  3O6B A;  1DJZ A;  3HX4 A;  4DIR A;  4XYN A;  1DJX A;  1LKJ A;  3DVK A;  1PUL A;  3KHE A;  4CID A;  1G33 A;  2PRU A;  2ISD A;  1C7V A;  1JFJ A;  1KFX L;  2KAV A;  2PVB A;  4DUQ A;  3PM2 A;  1AHR A;  2ZFD A;  1A29 A;  1H8B A;  2JNF A;  1S26 D;  3KF9 A;  1CM4 A;  1F4Q A;  1K9U A;  3CS1 A;  3SG4 A;  1YUT A;  3ZWH A;  1CDN A;  2HF5 A;  2NXQ A;  4PDZ A;  5KSZ A;  1BOC A;  1MR8 A;  2KFF A;  5DKR A;  2OTG B;  4AOM A;  2BL0 B;  3EVR A;  5D69 A;  4DS7 A;  4N1G A;  2Q91 A;  4CFQ A;  2IS9 A;  2LCP A;  1J7P A;  2EC6 C;  4N5X A;  2JT3 A;  1B47 A;  1ZAC A;  2K8M B;  2KI4 C;  4PHN A;  4YGA A;  1BU3 A;  3VGO A;  1DJY A;  1WDC B;  2CCM A;  3NSK A;  1R2U A;  1DT7 B;  4JPZ B;  1W7J B;  4BY4 A;  1U5I B;  5GQQ C;  3JVT C;  1DF0 B;  1KFU S;  1J1D A;  1L2O B;  2MLE C;  2RGI A;  3GOF A;  4OR9 B;  1UUR A;  4GFT A;  2GGZ A;  3SS3 A;  3I5F C;  4HRE E;  1IGV A;  3CR5 X;  4U8D A;  2KHN A;  1HQV A;  1SMG A;  3I5G B;  1SYM A;  1VRK A;  2O5G A;  3JVT B;  5CSJ A;  1YRU B;  1M63 B;  2LC5 A;  1Y1U A;  1XFX O;  1PSR A;  2COL B;  4MBE A;  3PM8 A;  3NSL A;  3DVM A;  1KSO A;  3SIB A;  1QX7 A;  2AMI A;  2LUX A;  2WOR A;  1CDM A;  1QLS A;  2ZN9 A;  1ALW A;  3WHT B;  1B4C A;  4IL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...