1YUSA

Solution structure of apo-s100a13
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yusA00
3IF7A 1KFXL 2CBLA 2LV7A 5HKYA 1DJHA 3C1VA 1CMFA 5I8NA 4A4BA 4AQIA 5HKWA 3SG7A 4YRUA 2FCEA 1PSRA 4FTGA 1QVIZ 2RGIA 5CSNA 2H2KA 1LA0A 1PULA 1YRUB 4YGDB 4CFQA 1RWYA 3MSEB 5DKRA 4ORBB 4XYNA 5G08A 1KSMA 3CR4X 3PALA 3I5FC 2KI6C 3SIAA 2E30A 3TUYB 3O4YA 1K94A 2ZNEA 1J7PA 1FW4A 2Y1NA 2Y4QA 1YTZC 2QPTA 1BF5A 3BXKA 4YGAA 1TCOB 3GK2A 1JBAA 2EC6C 1MQ1A 2LVKA 1LA3A 1N65A 2MLFC 5CSFA 3EK7A 1TRFA 1K90D 1RJVA 1SKTA 3I5FB 5CSIA 1DT7B 2K2FA 5HLVA 1A2XA 1MHOA 2FCDA 2BCAA 1XK4C 1EG4A 2GGZA 2JC2A 4L9MA 4XJKB 1B1GA 3HX4A 1M31A 1NCYA 1UHNA 1UHKA 2NXQA 3OB1B 4MLWA 5J3XA 4ETOA 1B8CA 3O78A 2JXCA 2KGBC 4E68A 1OQPA 3KEVA 1TN4A 1IWQA 2JNXA 3LLEA 2WC8A 3DVEA 3SG3A 1GGWA 4MZLA 3TDIA 3A8RA 1BMOA 1KFXS 4P2YB 1ZUZA 4NDBA 3D10A 2K2AA 1B8RA 2WCBA 2LLTA 4PE4A 1L7ZA 3LCPC 2KSPA 3CS1A 1IRJA 2K8MB 5HYDA 1BR4B 1OMRA 1CLMA 3NSIA 1XA5A 1PRWA 2LUCA 3DVMA 1NYAA 2F3ZA 2JRFA 3FIAA 2E6WA 4YBHB 1J7OA 2KYCA 4MBEA 2KYFA 1SPYA 1ALWA 1AVSA 1CMGA 3ICBA 1BODA 1KCYA 4MRXA 4GAOA 3IQQA 4HRHA 4YGBB 2LMTA 4MRYA 1CFCA 1XVJA 1NPQA 5I2QA 3SG4A 1EG3A 3CGAA 2QACA 1SMGA 1QV0A 3HCMA 3K21A 1CDLA 2JZIA 1CKKA 1J7QA 1BU3A 1IQ3A 1SYMA 1Y1UA 2LNKA 4PHJA 4CFRA 1XFZO 3GOFA 1DGUA 1NIWA 2BKIB 1UHIA 2K0JA 3TDZA 2PSRA 3DVJA 4UPGA 4ZCUA 2CNPA 1OZSA 1FPWA 2LVIA 3NSKA 1V1GA 2KI4C 2LMUA 1UHJA 4XJKA 3AKBA 4PCWA 3OX6A 3CTNA 3WXAA 4PE7A 4C0LA 2ZRTA 3EKHA 1KFUS 2LCPA 4DRWA 5BPJA 2M8UA 1TTXA 4MVFA 1CTRA 2BL0C 1C7WA 2KBIA 1WY9A 5CSJA 1PK0D 1DVIA 4PHKA 2B1UA 1RTP1 1TCFA 2KNEA 2HF5A 3TDUA 1H8BA 3PM8A 1ALVA 2BKHB 3TS5C 2HETA 1SR6C 1B4CA 1D1OA 2MHHA 1PSBA 1S6JA 1JUOA 1ZMZA 2KDHA 1L2OB 4JPZB 1DJIA 1IJ5A 2BE6A 2Y1MA 2GV5A 3GK4X 1K95A 1N2DA 2L2EA 1CLBA 2EGDA 3I5GB 3CZTX 2MAZA 2BE4A 2H61C 1Q80A 1YURA 1W7JB 3JTDC 1MUXA 1IG5A 1R2UA 2OTGC 4ORAB 3WHTB 1DJWA 1GGZA 4GPLB 3VRPA 5AFPA 2EHBA 5AXIA 1FI5A 1AJ5A 4GGFC 1CM4A 1S6CA 4QJ5B 2LUXA 2L4HA 4NDCA 1FI6A 4CLNA 2AMIA 2JT8A 4I5NB 3LL8B 1A75B 4YGEB 1BR1B 4I5LB 5D7FA 1NX0A 1A29A 1RECA 3BOWB 3AAKA 2HPSA 3PN7C 1DJGA 2O5GA 3BUNB 2WCFA 1WLMA 3KPXA 2AUCA 4PE1A 3EKJA 1LVCD 1WDCC 1QX5B 2BCXA 1HQVA 1AP4A 1QATA 1R6PA 1K9KA 1X02A 4MEWA 3EK4A 1UWOA 1JF2A 1NX1A 1JSAA 1Y1AA 2F2PA 2ZKMX 5CPVA 1MXLC 1U5IB 2F3YA 2LAPA 1A03A 4BY5A 1WDCB 2EC6B 5JJGA 1TNWA 1UURA 2MLEC 2ZN8A 3DD4A 2KQ6A 1EL4A 5B8IB 3D0YB 1FBVA 3KO0A 1B8LA 2JWWA 5I2OA 1XFVO 1KFUL 1SK6D 1KQVA 1DF0A 1GQMA 1S5GY 2K7DA 5DKNA 4CPVA 1SY9A 1ZFSA 1B7TZ 2R2IA 3FWBA 4PDZA 4GBAA 1SL9A 2Y5IA 4YI9A 1F55A 1S1EA 2WORA 1NSHA 1S36A 2BBNA 2MA2A 2L0PA 1Y6WA 2M97A 2M49B 5I2LA 1F70A 1YUSA 4N1GA 1WRZA 3F45A 4JWQA 4DS7A 1J1EA 1F8HA 2KBMA 1CFFA 5AANA 2MRDA 3OHMB 1AK8A 1M46A 2K7CA 1TNQA 1QX2A 3I5IC 1MF8B 3FWCA 2KOTA 1M45A 1MR8A 2L98A 2L50A 3SIBA 2G9BA 4AOMA 2M29A 3TZ1A 3VRQA 2CT9A 1A75A 1NUBA 4GUKA 2FOTA 3BOWA 1QS7A 2ISDA 1XO5A 1YX7A 4R1EA 5IBWA 1SW8A 1RFJA 1J7RA 1YVLA 2KFGA 1KWOC 3I5IB 3RM1A 1IJ6A 2SASA 1TNPA 4GFTA 2TN4A 2F2OA 1KK7Y 3O2PA 1CFDA 1DJXA 1WLZA 2ZRSA 4WQ3A 3DVKA 3KHEA 3SG2A 2F8PA 2LM5A 4GNKB 1UHHA 4YGCB 1G8IA 2BBMA 2JULA 2LMVA 1SBJA 2LP2A 3A4UB 4OKHA 2M9GA 1A4PA 2LP3A 3I5HC 5ER5A 2LANA 2LHLA 5TNCA 2O60A 4DCKA 2NZ0A 3NSLA 1U5IA 3BUOB 1KQMC 2LVVA 2PASA 2JU0A 2JT0A 1OSAA 2KI6D 1QASA 2WOSA 4TNCA 4HREE 1Y1XA 3DF0B 1RK9A 2KI4B 2KAXA 2DOQA 1MWNA 1IH0A 1XK4A 1YX8A 3I5HB 2LVJA 2PRUA 1SRAA 2V53A 2HQ8A 1AUIB 3KF9A 1V1FA 2KFHA 1KK8C 1K96A 5F6TA 1KQMB 1SL7A 2L5XB 2I18A 4YI8A 3ZWHA 1ODBA 1QV1A 1LXFC 2P6BB 3AAJA 2BL0B 4MN0A 3BUMB 2JNFA 1YUUA 5HKZA 4HSZA 4PHNA 4USLA 1QXPA 1XFYO 3JVTC 3TS5B 2SCPA 1SR6B 2AAOA 4F0ZB 5KU1A 2OPOA 1BG1A 4D1EA 5HLOA 2LLSA 1NX3A 1S6IA 3M0WA 1CDNA 1OMVA 1WRLA 2JOJA 4PE0A 1K93D 5JOLA 4ICBA 1S5GZ 1F71A 3WHUB 2VRGA 2LC5A 1DJYA 4IL1A 1K9PA 2JPTA 3JTDB 2OTGB 3VROA 1BLQA 2KAYA 2I94A 3EK8A 1N0YA 4ORCB 1PVAA 2A4JA 3TUYC 1CLLA 1W7IB 4Q04A 1SL8A 4OVNF 2JTTA 2GGMA 1S3PA 3PSRA 5AEQA 2JXLA 5ER4X 1GJYA 1PALA 3SJSA 3CLNA 2Q4UA 1CDMA 3PN7B 2I2RE 1CFPA 2M3WA 1QJTA 1JFJA 4I5KA 4C0JA 1C7VA 1YRTB 1BJFA 2L4IA 3DF0A 1NCXA 2F33A 1J1DA 3LK0A 4CIDA 3PFVA 2K61A 4DIRA 1Y0VH 4WRIA 1SNLA 4U8DA 4C0KA 3OB2B 1TOPA 1SCMC 1SCVA 1BOCA 1G33A 3GK1A 1UUSA 1G4YR 1KK7Z 3BUXB 3LK1A 2M7NA 3OX5A 1OMDA 4M2QA 1K9UA 4N1FA 4OCIA 1DMOA 2PALA 2JTZA 1S26D 2PMYA 1F4QA 2PVBA 1QVIY 1E8AA 1SCMB 1QLKA 1NP8A 3O6BA 1XFWO 5D69A 2MJWB 4DUQA 2JQ6A 2BCBA 2FJUB 2ZNDA 1C07A 1AHRA 4WQ2A 1IQ5A 1OZOA 4JQ0D 2LE9B 2JT3A 1OE9B 2OS8C 3BYAA 2ZFDA 4ZCVA 3CR5X 4OV2A 1JF0A 1PVBA 2H61A 3SG5A 4I5JA 2K7OA 1YR5A 4QJ3B 1QIVA 2LHIA 2KAVA 4M2PA 1F54A 1YVHA 1XFUO 2NLNA 1ZOTB 3FS7A 4GGFA 2NCPA 3ZNIA 1EJ3A 2OS8B 1LKJA 1UP5A 3OP0A 5FYXA 3NSOA 2Q91A 1F4OA 2ZN9A 1ZACA 2M1UA 4QJ4B 5AERA 5GQQC 4NDDA 4PHMA 2M7LA 3E3RA 1B9AA 2WNDA 4MSPA 4OR9B 2G2BA 3WNXB 4P5OE 1JFKA 2KFFA 1J55A 1NX2A 3EVUA 1EH2A 1KWOB 2WCEA 4FQOA 1K2HA 2KQYA 3VRNA 3VGOA 5K89A 3PLFB 2M0RA 1DJZA 3EVVA 1IKUA 3CR2A 3IQOA 1JC2A 4BY4A 1B47A 2CTNA 5DKQA 3D0YA 1TIZA 4HRGA 4A4CA 2K7BA 1DGVA 3AKAA 1M63B 1WRKA 1QIWA 1QTXA 1B7TY 2IS9A 1DTLA 3EVRA 1LINA 3H4SE 4AQJA 2CXJA 2L51A 1KSOA 4N5XA 3VRRA 1JWDA 1CNPA 1NWDA 2KGRA 2D8NA 1XYDA 1FF1A 1IGVA 2CCMA 4MZKA 3NXAA 2LLUA 1BT6A 4PALA 3RLZA 3QRXA 5KSZA 1QLSA 2KHNA 1OOJA 1YUTA 1L2OC 3CWGA 4NQGA 1KK8B 2BECA 1CB1A 1TNXA 2I7AA 4MZJA 1RROA 1QX7A 1EXRA 3I5GC 5PALA 4GGNA 2MBXA 1XFXO 1H4BA 3BQ3A 1MXEA 1NCZA 1DF0B 2NCOA 1CM1A 1CDPA 2M1KB 4M2OA 1K8UA 2COLB 3PATA 1HT9A 5KTYA 1M39A 1AJ4A 3BUWB 3JVTB 2HQWA 1VRKA 3SG6A
chains in the Genus database with same CATH superfamily
3IF7A 1KFXL 2CBLA 2PYQA 2LV7A 5HKYA 1IIOA 1DJHA 3C1VA 1CMFA 5I8NA 3SG2A 3D73A 4A4BA 1SSEB 5HKWA 4AQIA 3SG7A 4YRUA 2FCEA 1PSRA 4FTGA 1QVIZ 2RGIA 5CSNA 2H2KA 1LA0A 1PULA 3S0BA 1YRUB 2QEHA 4YGDB 1RWYA 3MSEB 5DKRA 4CFQA 3PM2A 4ORBB 4XYNA 5G08A 1KSMA 3D75A 3CR4X 3PALA 5FI7A 1W9ZA 3I5FC 2KI6C 3SIAA 2E30A 3TUYB 3O4YA 1K94A 2ZNEA 1J7PA 3UO9A 1FW4A 2Y1NA 2Y4QA 1YTZC 2QPTA 1BF5A 3BXKA 3B6XA 4YGAA 1TCOB 3GK2A 1JBAA 2EC6C 1MQ1A 2LVKA 1LA3A 1N65A 2MLFC 2KLEA 5CSFA 3EK7A 1TRFA 1K90D 1RJVA 1SKTA 3I5FB 5CSIA 1DT7B 2K2FA 5HLVA 1A2XA 3S0FA 1MHOA 2FCDA 2BCAA 1XK4C 1EG4A 2GGZA 2JC2A 4L9MA 4XJKB 1B1GA 3HX4A 1M31A 1NCYA 1UHNA 1UHKA 2NXQA 3CABA 3OB1B 4MLWA 5J3XA 4ETOA 1B8CA 3O78A 2JXCA 2KGBC 4E68A 1OQPA 3KEVA 1TN4A 1IWQA 2JNXA 3LLEA 2WC8A 3DVEA 3SG3A 2P70A 3L4AA 4JD9A 1LS8A 1GGWA 4MZLA 3TDIA 1OW4A 3A8RA 3CZ0A 1BMOA 4KYNA 1KFXS 4P2YB 1ZUZA 4NDBA 3D10A 2K2AA 1B8RA 2WCBA 2LLTA 4PE4A 3CZ2A 1L7ZA 3LCPC 2KSPA 3CS1A 1IRJA 2K8MB 5HYDA 1BR4B 1OMRA 1CLMA 3NSIA 1XA5A 1PRWA 2LUCA 3DVMA 1NYAA 2F3ZA 2JRFA 2PQLA 2E6WA 3FIAA 3OGNA 4YBHB 1J7OA 2KYCA 4MBEA 2KYFA 3D76A 1SPYA 3FE8A 5DICA 1ALWA 1AVSA 1CMGA 3ICBA 1BODA 1KCYA 4MRXA 4GAOA 3D78A 3IQQA 4HRHA 4YGBB 2LMTA 4MRYA 1CFCA 3R1PA 3N7HA 1XVJA 1DEKA 1NPQA 5I2QA 3SG4A 1EG3A 3CGAA 2QACA 3SS3A 2WCKA 5I94A 1SMGA 1QV0A 3HCMA 3K21A 1CDLA 2JZIA 4JKTA 1CKKA 1BU3A 3DY9A 1IQ3A 1SYMA 1J7QA 1Y1UA 2K60A 2L5YA 2LNKA 4PHJA 3S0DA 1XFZO 3GOFA 3NGVA 1DGUA 1NIWA 2BKIB 1UHIA 2K0JA 2JPOA 2PSRA 3TDZA 3DVJA 3D74A 4F7FA 5HL1A 4UPGA 4ZCUA 2CNPA 1OZSA 1FPWA 2LVIA 3NSKA 1V1GA 1P28A 2KI4C 3B88A 2LMUA 1UHJA 2P71A 4XJKA 3AKBA 4PCWA 3OX6A 3CTNA 3WXAA 4PE7A 4C0LA 2ZRTA 3S0AA 3EKHA 1KFUS 2WCHA 2LCPA 4DRWA 5BPJA 2M8UA 1TTXA 2GTEA 3NHTA 4MVFA 1CTRA 3RZSA 2BL0C 1C7WA 2KBIA 1WY9A 5CSJA 1PK0D 1DVIA 4PHKA 2B1UA 1RTP1 1TCFA 2KNEA 2HF5A 3TDUA 1H8BA 3PM8A 2YGUA 1ALVA 3BFBA 3NHIA 2BKHB 2WC6A 4INXA 2HETA 3TS5C 1SR6C 1B4CA 1D1OA 2MHHA 1PSBA 1S6JA 1JUOA 1ZMZA 3IVTA 2KDHA 1L2OB 4JPZB 1DJIA 1IJ5A 2BE6A 2Y1MA 2GV5A 3GK4X 1K95A 1N2DA 2L2EA 3CZ1A 1CLBA 2EGDA 3I5GB 1OOIX 2KPHA 3CZTX 2MAZA 2BE4A 2H61C 1Q80A 4FQTA 1YURA 2QDIA 1W7JB 1Z4HA 1MUXA 1IG5A 1R2UA 2OTGC 2WCJA 3JTDC 4ORAB 1DJWA 3WHTB 1GGZA 4GPLB 3VRPA 5AFPA 2EHBA 5AXIA 1FI5A 1AJ5A 4GGFC 1CM4A 1S6CA 4QJ5B 4OZDA 2LUXA 2L4HA 4NDCA 1FI6A 4CLNA 2AMIA 2WCLA 2JT8A 4I5NB 3LL8B 1A75B 4YGEB 1BR1B 4I5LB 5D7FA 1NX0A 1A29A 1RECA 3BOWB 3AAKA 2HPSA 3PN7C 1DJGA 2O5GA 3BUNB 2WCFA 1WLMA 3KPXA 2AUCA 4PE1A 3EKJA 1LVCD 1WDCC 1T14A 1QX5B 2BCXA 2H8VA 1HQVA 1AP4A 1QATA 1R6PA 2QEBA 1K9KA 1X02A 4MEWA 3EK4A 1UWOA 1JF2A 1OOFA 1NX1A 3UNWA 1JSAA 1GM0A 1Y1AA 2F2PA 2ZKMX 5CPVA 1MXLC 1U5IB 2F3YA 2LAPA 1A03A 4BY5A 1WDCB 2EC6B 1OOGA 5JJGA 1TNWA 1UURA 2MLEC 2ZN8A 3DD4A 2KQ6A 1EL4A 5B8IB 3D0YB 1FBVA 3KO0A 1B8LA 2JWWA 5I2OA 1XFVO 1KFUL 1SK6D 3R72A 1KQVA 1DF0A 1GQMA 1S5GY 2K7DA 5DKNA 5FI2A 4CPVA 1SY9A 1ZFSA 1B7TZ 2R2IA 3FWBA 4PDZA 4GBAA 1SL9A 2Y5IA 4YI9A 1F55A 1C3YA 1S1EA 2WORA 1NSHA 2ERBA 1S36A 3O4XA 3DYEA 2BBNA 3V2LA 2MA2A 2L0PA 1Y6WA 2M97A 2M49B 5I2LA 1F70A 1YUSA 4N1GA 1WRZA 3F45A 4JWQA 4DS7A 1J1EA 1F8HA 2KBMA 1CFFA 5AANA 2MRDA 3OHMB 1AK8A 3OBVA 1M46A 2K7CA 1TNQA 1QX2A 3I5IC 1MF8B 3FWCA 2KOTA 1M45A 1MR8A 2L98A 2L50A 3SIBA 2G9BA 4AOMA 2M29A 3VB1A 3TZ1A 3VRQA 2CT9A 1A75A 1NUBA 4GUKA 2FOTA 3O2PA 3BOWA 1QS7A 3B7AA 2ISDA 1XO5A 1YX7A 4R1EA 5IBWA 1SW8A 1RFJA 1J7RA 1YVLA 2KFGA 1KWOC 3I5IB 3RM1A 1IJ6A 2SASA 1TNPA 4GFTA 1TUJA 2F2OA 1KK7Y 2TN4A 1CFDA 1DJXA 1OOHA 1WLZA 2ZRSA 3DVKA 3KHEA 4WQ3A 2F8PA 2LM5A 4GNKB 1UHHA 4YGCB 1G8IA 2BBMA 2QEVA 2JULA 2LMVA 1SBJA 2LP2A 3A4UB 4OKHA 2M9GA 1A4PA 2LP3A 3I5HC 5ER5A 2FJYA 2LANA 2LHLA 5TNCA 2O60A 4DCKA 2NZ0A 3NSLA 1U5IA 1Z2CB 3QMEA 5FI6A 3BJHA 3BUOB 1KQMC 2LVVA 2PASA 2JU0A 3D77A 2JT0A 1OSAA 2KI6D 1QASA 2WOSA 4TNCA 4HREE 1Y1XA 3DF0B 1RK9A 2KI4B 2KAXA 2DOQA 1MWNA 3SS4A 1IH0A 1XK4A 1YX8A 4PT1A 3I5HB 2LVJA 2PRUA 1SRAA 3S0GA 2V53A 2HQ8A 3SS5A 1AUIB 3KF9A 1V1FA 3K1EA 2KFHA 1KK8C 1K96A 5F6TA 1KQMB 1SL7A 2L5XB 1C3ZA 2I18A 1XFRA 3R1OA 4YI8A 3ZWHA 1ODBA 1QV1A 1LXFC 2P6BB 3AAJA 2BL0B 4MN0A 3BUMB 2JNFA 1YUUA 5HKZA 3PJIA 4HSZA 4PHNA 4USLA 1QXPA 1XFYO 3JVTC 3TS5B 2SCPA 1SR6B 2AAOA 3BFHA 4F0ZB 5KU1A 5EL2A 2OPOA 3S0EA 1BG1A 4D1EA 5HLOA 2LLSA 1NX3A 1S6IA 3M0WA 1CDNA 1OMVA 1WRLA 2JOJA 3CDNA 4PE0A 1K93D 5JOLA 4ICBA 1S5GZ 1F71A 3WHUB 2VRGA 2LC5A 1DJYA 4IL1A 1K9PA 2JPTA 3JTDB 2OTGB 3VROA 1BLQA 2KAYA 2I94A 3EG5B 3EK8A 1N0YA 4ORCB 2BNXA 1PVAA 2A4JA 3TUYC 3FE6A 1CLLA 1W7IB 4Q04A 1SL8A 4OVNF 2JTTA 2GGMA 1S3PA 2WC5A 3PSRA 5AEQA 2JXLA 5ER4X 1GJYA 1PALA 3SJSA 3CLNA 2Q4UA 1CDMA 3PN7B 2I2RE 1CFPA 2M3WA 1QJTA 3R1VA 1JFJA 4I5KA 4C0JA 1C7VA 1YRTB 1BJFA 2L4IA 3L4LA 3DF0A 1NCXA 2F33A 1J1DA 3LK0A 4CIDA 2L2CA 3PFVA 2K61A 2WCMA 4DIRA 1Y0VH 4WRIA 1SNLA 4U8DA 4C0KA 3OB2B 4IJ7A 1TOPA 1SCMC 1SCVA 1BOCA 1G33A 3GK1A 1UUSA 1G4YR 1KK7Z 3BUXB 3LK1A 2M7NA 3OX5A 1OMDA 4M2QA 1K9UA 4N1FA 4OCIA 1DMOA 2PALA 2JTZA 5D3OA 1S26D 2PMYA 1F4QA 1TUZA 1QVIY 1E8AA 1SCMB 2KLDA 2PVBA 1QLKA 1NP8A 3O6BA 1XFWO 5D69A 1ORGA 2MJWB 4CFRA 4DUQA 2JQ6A 2BCBA 3FE9A 2FJUB 2ZNDA 1C07A 1AHRA 4WQ2A 1IQ5A 1OZOA 4JQ0D 2LE9B 2JT3A 1OE9B 2OS8C 3BYAA 2ZFDA 4ZCVA 3CR5X 4OV2A 3DZTA 1JF0A 1PVBA 2H61A 3SG5A 4I5JA 2K7OA 1YR5A 4QJ3B 1DELA 1QIVA 2KAVA 2LHIA 4M2PA 1F54A 1YVHA 1XFUO 2NLNA 1ZOTB 3FS7A 4GGFA 2NCPA 3ZNIA 1DQEA 1EJ3A 2OS8B 1LKJA 1UP5A 1TWOA 3OP0A 5FYXA 3NSOA 2Q91A 1F4OA 2ZN9A 1ZACA 2M1UA 4QJ4B 5AERA 5GQQC 4NDDA 4PHMA 2M7LA 3E3RA 1B9AA 2WNDA 4MSPA 4OR9B 2G2BA 3WNXB 3B86A 4P5OE 1JFKA 2KFFA 1J55A 1NX2A 3EVUA 1EH2A 1KWOB 2WCEA 4FQOA 1K2HA 1QWVA 2KQYA 3VRNA 3VGOA 5K89A 3PLFB 2M0RA 1DJZA 3EVVA 2BAPA 1IKUA 3CR2A 3IQOA 1JC2A 4BY4A 3DXLA 1B47A 2CTNA 5DKQA 3D0YA 1TIZA 3CYZA 4HRGA 4A4CA 2K7BA 1DGVA 3AKAA 3BFAA 1M63B 1WRKA 1QIWA 1QTXA 1B7TY 2IS9A 1DTLA 3EVRA 1LINA 3H4SE 4AQJA 2CXJA 2L51A 1KSOA 3Q8IA 4N5XA 3VRRA 1JWDA 1CNPA 1NWDA 2KGRA 2D8NA 1XYDA 1FF1A 1IGVA 2CCMA 4MZKA 3NXAA 4INWA 2LLUA 1BT6A 4PALA 3RLZA 3QRXA 5KSZA 1QLSA 2KHNA 1OOJA 1YUTA 1L2OC 3L47A 3CWGA 4NQGA 1KK8B 2BECA 1CB1A 1TNXA 2I7AA 4MZJA 1RROA 1QX7A 1EXRA 3I5GC 5PALA 4GGNA 2MBXA 1XFXO 1H4BA 3BQ3A 1MXEA 1NCZA 1DF0B 2NCOA 1DC1A 1CM1A 1CDPA 2M1KB 4M2OA 1K8UA 2COLB 3PATA 1HT9A 5KTYA 1M39A 2QEOA 1AJ4A 3B87A 3BUWB 3JVTB 2HQWA 1VRKA 3SG6A
chains in the Genus database with same CATH topology
3IF7A 1KFXL 2CBLA 2LV7A 5HKYA 1DJHA 3C1VA 1CMFA 5I8NA 4A4BA 4AQIA 5HKWA 3SG7A 4YRUA 2FCEA 1PSRA 4FTGA 1QVIZ 2RGIA 5CSNA 2H2KA 1LA0A 1PULA 1YRUB 4YGDB 4CFQA 1RWYA 3MSEB 5DKRA 4ORBB 4XYNA 5G08A 1KSMA 3CR4X 3PALA 3I5FC 2KI6C 3SIAA 2E30A 3TUYB 3O4YA 1K94A 2ZNEA 1J7PA 1FW4A 2Y1NA 2Y4QA 1YTZC 2QPTA 1BF5A 3BXKA 4YGAA 1TCOB 3GK2A 1JBAA 2EC6C 1MQ1A 2LVKA 1LA3A 1N65A 2MLFC 5CSFA 3EK7A 1TRFA 1K90D 1RJVA 1SKTA 3I5FB 5CSIA 1DT7B 2K2FA 5HLVA 1A2XA 1MHOA 2FCDA 2BCAA 1XK4C 1EG4A 2GGZA 2JC2A 4L9MA 4XJKB 1B1GA 3HX4A 1M31A 1NCYA 1UHNA 1UHKA 2NXQA 3OB1B 4MLWA 5J3XA 4ETOA 1B8CA 3O78A 2JXCA 2KGBC 4E68A 1OQPA 3KEVA 1TN4A 1IWQA 2JNXA 3LLEA 2WC8A 3DVEA 3SG3A 1GGWA 4MZLA 3TDIA 3A8RA 1BMOA 1KFXS 4P2YB 1ZUZA 4NDBA 3D10A 2K2AA 1B8RA 2WCBA 2LLTA 4PE4A 1L7ZA 3LCPC 2KSPA 3CS1A 1IRJA 2K8MB 5HYDA 1BR4B 1OMRA 1CLMA 3NSIA 1XA5A 1PRWA 2LUCA 3DVMA 1NYAA 2F3ZA 2JRFA 3FIAA 2E6WA 4YBHB 1J7OA 2KYCA 4MBEA 2KYFA 1SPYA 1ALWA 1AVSA 1CMGA 3ICBA 1BODA 1KCYA 4MRXA 4GAOA 3IQQA 4HRHA 4YGBB 2LMTA 4MRYA 1CFCA 1XVJA 1NPQA 5I2QA 3SG4A 1EG3A 3CGAA 2QACA 1SMGA 1QV0A 3HCMA 3K21A 1CDLA 2JZIA 1CKKA 1J7QA 1BU3A 1IQ3A 1SYMA 1Y1UA 2LNKA 4PHJA 4CFRA 1XFZO 3GOFA 1DGUA 1NIWA 2BKIB 1UHIA 2K0JA 3TDZA 2PSRA 3DVJA 4UPGA 4ZCUA 2CNPA 1OZSA 1FPWA 2LVIA 3NSKA 1V1GA 2KI4C 2LMUA 1UHJA 4XJKA 3AKBA 4PCWA 3OX6A 3CTNA 3WXAA 4PE7A 4C0LA 2ZRTA 3EKHA 1KFUS 2LCPA 4DRWA 5BPJA 2M8UA 1TTXA 4MVFA 1CTRA 2BL0C 1C7WA 2KBIA 1WY9A 5CSJA 1PK0D 1DVIA 4PHKA 2B1UA 1RTP1 1TCFA 2KNEA 2HF5A 3TDUA 1H8BA 3PM8A 1ALVA 2BKHB 3TS5C 2HETA 1SR6C 1B4CA 1D1OA 2MHHA 1PSBA 1S6JA 1JUOA 1ZMZA 2KDHA 1L2OB 4JPZB 1DJIA 1IJ5A 2BE6A 2Y1MA 2GV5A 3GK4X 1K95A 1N2DA 2L2EA 1CLBA 2EGDA 3I5GB 3CZTX 2MAZA 2BE4A 2H61C 1Q80A 1YURA 1W7JB 3JTDC 1MUXA 1IG5A 1R2UA 2OTGC 4ORAB 3WHTB 1DJWA 1GGZA 4GPLB 3VRPA 5AFPA 2EHBA 5AXIA 1FI5A 1AJ5A 4GGFC 1CM4A 1S6CA 4QJ5B 2LUXA 2L4HA 4NDCA 1FI6A 4CLNA 2AMIA 2JT8A 4I5NB 3LL8B 1A75B 4YGEB 1BR1B 4I5LB 5D7FA 1NX0A 1A29A 1RECA 3BOWB 3AAKA 2HPSA 3PN7C 1DJGA 2O5GA 3BUNB 2WCFA 1WLMA 3KPXA 2AUCA 4PE1A 3EKJA 1LVCD 1WDCC 1QX5B 2BCXA 1HQVA 1AP4A 1QATA 1R6PA 1K9KA 1X02A 4MEWA 3EK4A 1UWOA 1JF2A 1NX1A 1JSAA 1Y1AA 2F2PA 2ZKMX 5CPVA 1MXLC 1U5IB 2F3YA 2LAPA 1A03A 4BY5A 1WDCB 2EC6B 5JJGA 1TNWA 1UURA 2MLEC 2ZN8A 3DD4A 2KQ6A 1EL4A 5B8IB 3D0YB 1FBVA 3KO0A 1B8LA 2JWWA 5I2OA 1XFVO 1KFUL 1SK6D 1KQVA 1DF0A 1GQMA 1S5GY 2K7DA 5DKNA 4CPVA 1SY9A 1ZFSA 1B7TZ 2R2IA 3FWBA 4PDZA 4GBAA 1SL9A 2Y5IA 4YI9A 1F55A 1S1EA 2WORA 1NSHA 1S36A 2BBNA 2MA2A 2L0PA 1Y6WA 2M97A 2M49B 5I2LA 1F70A 1YUSA 4N1GA 1WRZA 3F45A 4JWQA 4DS7A 1J1EA 1F8HA 2KBMA 1CFFA 5AANA 2MRDA 3OHMB 1AK8A 1M46A 2K7CA 1TNQA 1QX2A 3I5IC 1MF8B 3FWCA 2KOTA 1M45A 1MR8A 2L98A 2L50A 3SIBA 2G9BA 4AOMA 2M29A 3TZ1A 3VRQA 2CT9A 1A75A 1NUBA 4GUKA 2FOTA 3BOWA 1QS7A 2ISDA 1XO5A 1YX7A 4R1EA 5IBWA 1SW8A 1RFJA 1J7RA 1YVLA 2KFGA 1KWOC 3I5IB 3RM1A 1IJ6A 2SASA 1TNPA 4GFTA 2TN4A 2F2OA 1KK7Y 3O2PA 1CFDA 1DJXA 1WLZA 2ZRSA 4WQ3A 3DVKA 3KHEA 3SG2A 2F8PA 2LM5A 4GNKB 1UHHA 4YGCB 1G8IA 2BBMA 2JULA 2LMVA 1SBJA 2LP2A 3A4UB 4OKHA 2M9GA 1A4PA 2LP3A 3I5HC 5ER5A 2LANA 2LHLA 5TNCA 2O60A 4DCKA 2NZ0A 3NSLA 1U5IA 3BUOB 1KQMC 2LVVA 2PASA 2JU0A 2JT0A 1OSAA 2KI6D 1QASA 2WOSA 4TNCA 4HREE 1Y1XA 3DF0B 1RK9A 2KI4B 2KAXA 2DOQA 1MWNA 1IH0A 1XK4A 1YX8A 3I5HB 2LVJA 2PRUA 1SRAA 2V53A 2HQ8A 1AUIB 3KF9A 1V1FA 2KFHA 1KK8C 1K96A 5F6TA 1KQMB 1SL7A 2L5XB 2I18A 4YI8A 3ZWHA 1ODBA 1QV1A 1LXFC 2P6BB 3AAJA 2BL0B 4MN0A 3BUMB 2JNFA 1YUUA 5HKZA 4HSZA 4PHNA 4USLA 1QXPA 1XFYO 3JVTC 3TS5B 2SCPA 1SR6B 2AAOA 4F0ZB 5KU1A 2OPOA 1BG1A 4D1EA 5HLOA 2LLSA 1NX3A 1S6IA 3M0WA 1CDNA 1OMVA 1WRLA 2JOJA 4PE0A 1K93D 5JOLA 4ICBA 1S5GZ 1F71A 3WHUB 2VRGA 2LC5A 1DJYA 4IL1A 1K9PA 2JPTA 3JTDB 2OTGB 3VROA 1BLQA 2KAYA 2I94A 3EK8A 1N0YA 4ORCB 1PVAA 2A4JA 3TUYC 1CLLA 1W7IB 4Q04A 1SL8A 4OVNF 2JTTA 2GGMA 1S3PA 3PSRA 5AEQA 2JXLA 5ER4X 1GJYA 1PALA 3SJSA 3CLNA 2Q4UA 1CDMA 3PN7B 2I2RE 1CFPA 2M3WA 1QJTA 1JFJA 4I5KA 4C0JA 1C7VA 1YRTB 1BJFA 2L4IA 3DF0A 1NCXA 2F33A 1J1DA 3LK0A 4CIDA 3PFVA 2K61A 4DIRA 1Y0VH 4WRIA 1SNLA 4U8DA 4C0KA 3OB2B 1TOPA 1SCMC 1SCVA 1BOCA 1G33A 3GK1A 1UUSA 1G4YR 1KK7Z 3BUXB 3LK1A 2M7NA 3OX5A 1OMDA 4M2QA 1K9UA 4N1FA 4OCIA 1DMOA 2PALA 2JTZA 1S26D 2PMYA 1F4QA 2PVBA 1QVIY 1E8AA 1SCMB 1QLKA 1NP8A 3O6BA 1XFWO 5D69A 2MJWB 4DUQA 2JQ6A 2BCBA 2FJUB 2ZNDA 1C07A 1AHRA 4WQ2A 1IQ5A 1OZOA 4JQ0D 2LE9B 2JT3A 1OE9B 2OS8C 3BYAA 2ZFDA 4ZCVA 3CR5X 4OV2A 1JF0A 1PVBA 2H61A 3SG5A 4I5JA 2K7OA 1YR5A 4QJ3B 1QIVA 2LHIA 2KAVA 4M2PA 1F54A 1YVHA 1XFUO 2NLNA 1ZOTB 3FS7A 4GGFA 2NCPA 3ZNIA 1EJ3A 2OS8B 1LKJA 1UP5A 3OP0A 5FYXA 3NSOA 2Q91A 1F4OA 2ZN9A 1ZACA 2M1UA 4QJ4B 5AERA 5GQQC 4NDDA 4PHMA 2M7LA 3E3RA 1B9AA 2WNDA 4MSPA 4OR9B 2G2BA 3WNXB 4P5OE 1JFKA 2KFFA 1J55A 1NX2A 3EVUA 1EH2A 1KWOB 2WCEA 4FQOA 1K2HA 2KQYA 3VRNA 3VGOA 5K89A 3PLFB 2M0RA 1DJZA 3EVVA 1IKUA 3CR2A 3IQOA 1JC2A 4BY4A 1B47A 2CTNA 5DKQA 3D0YA 1TIZA 4HRGA 4A4CA 2K7BA 1DGVA 3AKAA 1M63B 1WRKA 1QIWA 1QTXA 1B7TY 2IS9A 1DTLA 3EVRA 1LINA 3H4SE 4AQJA 2CXJA 2L51A 1KSOA 4N5XA 3VRRA 1JWDA 1CNPA 1NWDA 2KGRA 2D8NA 1XYDA 1FF1A 1IGVA 2CCMA 4MZKA 3NXAA 2LLUA 1BT6A 4PALA 3RLZA 3QRXA 5KSZA 1QLSA 2KHNA 1OOJA 1YUTA 1L2OC 3CWGA 4NQGA 1KK8B 2BECA 1CB1A 1TNXA 2I7AA 4MZJA 1RROA 1QX7A 1EXRA 3I5GC 5PALA 4GGNA 2MBXA 1XFXO 1H4BA 3BQ3A 1MXEA 1NCZA 1DF0B 2NCOA 1CM1A 1CDPA 2M1KB 4M2OA 1K8UA 2COLB 3PATA 1HT9A 5KTYA 1M39A 1AJ4A 3BUWB 3JVTB 2HQWA 1VRKA 3SG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF7 A;  1KFX L;  2CBL A;  2LV7 A;  5HKY A;  1DJH A;  3C1V A;  1CMF A;  5I8N A;  4A4B A;  4AQI A;  5HKW A;  3SG7 A;  4YRU A;  2FCE A;  1PSR A;  4FTG A;  1QVI Z;  2RGI A;  5CSN A;  2H2K A;  1LA0 A;  1PUL A;  1YRU B;  4YGD B;  4CFQ A;  1RWY A;  3MSE B;  5DKR A;  4ORB B;  4XYN A;  5G08 A;  1KSM A;  3CR4 X;  3PAL A;  3I5F C;  2KI6 C;  3SIA A;  2E30 A;  3TUY B;  3O4Y A;  1K94 A;  2ZNE A;  1J7P A;  1FW4 A;  2Y1N A;  2Y4Q A;  1YTZ C;  2QPT A;  1BF5 A;  3BXK A;  4YGA A;  1TCO B;  3GK2 A;  1JBA A;  2EC6 C;  1MQ1 A;  2LVK A;  1LA3 A;  1N65 A;  2MLF C;  5CSF A;  3EK7 A;  1TRF A;  1K90 D;  1RJV A;  1SKT A;  3I5F B;  5CSI A;  1DT7 B;  2K2F A;  5HLV A;  1A2X A;  1MHO A;  2FCD A;  2BCA A;  1XK4 C;  1EG4 A;  2GGZ A;  2JC2 A;  4L9M A;  4XJK B;  1B1G A;  3HX4 A;  1M31 A;  1NCY A;  1UHN A;  1UHK A;  2NXQ A;  3OB1 B;  4MLW A;  5J3X A;  4ETO A;  1B8C A;  3O78 A;  2JXC A;  2KGB C;  4E68 A;  1OQP A;  3KEV A;  1TN4 A;  1IWQ A;  2JNX A;  3LLE A;  2WC8 A;  3DVE A;  3SG3 A;  1GGW A;  4MZL A;  3TDI A;  3A8R A;  1BMO A;  1KFX S;  4P2Y B;  1ZUZ A;  4NDB A;  3D10 A;  2K2A A;  1B8R A;  2WCB A;  2LLT A;  4PE4 A;  1L7Z A;  3LCP C;  2KSP A;  3CS1 A;  1IRJ A;  2K8M B;  5HYD A;  1BR4 B;  1OMR A;  1CLM A;  3NSI A;  1XA5 A;  1PRW A;  2LUC A;  3DVM A;  1NYA A;  2F3Z A;  2JRF A;  3FIA A;  2E6W A;  4YBH B;  1J7O A;  2KYC A;  4MBE A;  2KYF A;  1SPY A;  1ALW A;  1AVS A;  1CMG A;  3ICB A;  1BOD A;  1KCY A;  4MRX A;  4GAO A;  3IQQ A;  4HRH A;  4YGB B;  2LMT A;  4MRY A;  1CFC A;  1XVJ A;  1NPQ A;  5I2Q A;  3SG4 A;  1EG3 A;  3CGA A;  2QAC A;  1SMG A;  1QV0 A;  3HCM A;  3K21 A;  1CDL A;  2JZI A;  1CKK A;  1J7Q A;  1BU3 A;  1IQ3 A;  1SYM A;  1Y1U A;  2LNK A;  4PHJ A;  4CFR A;  1XFZ O;  3GOF A;  1DGU A;  1NIW A;  2BKI B;  1UHI A;  2K0J A;  3TDZ A;  2PSR A;  3DVJ A;  4UPG A;  4ZCU A;  2CNP A;  1OZS A;  1FPW A;  2LVI A;  3NSK A;  1V1G A;  2KI4 C;  2LMU A;  1UHJ A;  4XJK A;  3AKB A;  4PCW A;  3OX6 A;  3CTN A;  3WXA A;  4PE7 A;  4C0L A;  2ZRT A;  3EKH A;  1KFU S;  2LCP A;  4DRW A;  5BPJ A;  2M8U A;  1TTX A;  4MVF A;  1CTR A;  2BL0 C;  1C7W A;  2KBI A;  1WY9 A;  5CSJ A;  1PK0 D;  1DVI A;  4PHK A;  2B1U A;  1RTP 1;  1TCF A;  2KNE A;  2HF5 A;  3TDU A;  1H8B A;  3PM8 A;  1ALV A;  2BKH B;  3TS5 C;  2HET A;  1SR6 C;  1B4C A;  1D1O A;  2MHH A;  1PSB A;  1S6J A;  1JUO A;  1ZMZ A;  2KDH A;  1L2O B;  4JPZ B;  1DJI A;  1IJ5 A;  2BE6 A;  2Y1M A;  2GV5 A;  3GK4 X;  1K95 A;  1N2D A;  2L2E A;  1CLB A;  2EGD A;  3I5G B;  3CZT X;  2MAZ A;  2BE4 A;  2H61 C;  1Q80 A;  1YUR A;  1W7J B;  3JTD C;  1MUX A;  1IG5 A;  1R2U A;  2OTG C;  4ORA B;  3WHT B;  1DJW A;  1GGZ A;  4GPL B;  3VRP A;  5AFP A;  2EHB A;  5AXI A;  1FI5 A;  1AJ5 A;  4GGF C;  1CM4 A;  1S6C A;  4QJ5 B;  2LUX A;  2L4H A;  4NDC A;  1FI6 A;  4CLN A;  2AMI A;  2JT8 A;  4I5N B;  3LL8 B;  1A75 B;  4YGE B;  1BR1 B;  4I5L B;  5D7F A;  1NX0 A;  1A29 A;  1REC A;  3BOW B;  3AAK A;  2HPS A;  3PN7 C;  1DJG A;  2O5G A;  3BUN B;  2WCF A;  1WLM A;  3KPX A;  2AUC A;  4PE1 A;  3EKJ A;  1LVC D;  1WDC C;  1QX5 B;  2BCX A;  1HQV A;  1AP4 A;  1QAT A;  1R6P A;  1K9K A;  1X02 A;  4MEW A;  3EK4 A;  1UWO A;  1JF2 A;  1NX1 A;  1JSA A;  1Y1A A;  2F2P A;  2ZKM X;  5CPV A;  1MXL C;  1U5I B;  2F3Y A;  2LAP A;  1A03 A;  4BY5 A;  1WDC B;  2EC6 B;  5JJG A;  1TNW A;  1UUR A;  2MLE C;  2ZN8 A;  3DD4 A;  2KQ6 A;  1EL4 A;  5B8I B;  3D0Y B;  1FBV A;  3KO0 A;  1B8L A;  2JWW A;  5I2O A;  1XFV O;  1KFU L;  1SK6 D;  1KQV A;  1DF0 A;  1GQM A;  1S5G Y;  2K7D A;  5DKN A;  4CPV A;  1SY9 A;  1ZFS A;  1B7T Z;  2R2I A;  3FWB A;  4PDZ A;  4GBA A;  1SL9 A;  2Y5I A;  4YI9 A;  1F55 A;  1S1E A;  2WOR A;  1NSH A;  1S36 A;  2BBN A;  2MA2 A;  2L0P A;  1Y6W A;  2M97 A;  2M49 B;  5I2L A;  1F70 A;  1YUS A;  4N1G A;  1WRZ A;  3F45 A;  4JWQ A;  4DS7 A;  1J1E A;  1F8H A;  2KBM A;  1CFF A;  5AAN A;  2MRD A;  3OHM B;  1AK8 A;  1M46 A;  2K7C A;  1TNQ A;  1QX2 A;  3I5I C;  1MF8 B;  3FWC A;  2KOT A;  1M45 A;  1MR8 A;  2L98 A;  2L50 A;  3SIB A;  2G9B A;  4AOM A;  2M29 A;  3TZ1 A;  3VRQ A;  2CT9 A;  1A75 A;  1NUB A;  4GUK A;  2FOT A;  3BOW A;  1QS7 A;  2ISD A;  1XO5 A;  1YX7 A;  4R1E A;  5IBW A;  1SW8 A;  1RFJ A;  1J7R A;  1YVL A;  2KFG A;  1KWO C;  3I5I B;  3RM1 A;  1IJ6 A;  2SAS A;  1TNP A;  4GFT A;  2TN4 A;  2F2O A;  1KK7 Y;  3O2P A;  1CFD A;  1DJX A;  1WLZ A;  2ZRS A;  4WQ3 A;  3DVK A;  3KHE A;  3SG2 A;  2F8P A;  2LM5 A;  4GNK B;  1UHH A;  4YGC B;  1G8I A;  2BBM A;  2JUL A;  2LMV A;  1SBJ A;  2LP2 A;  3A4U B;  4OKH A;  2M9G A;  1A4P A;  2LP3 A;  3I5H C;  5ER5 A;  2LAN A;  2LHL A;  5TNC A;  2O60 A;  4DCK A;  2NZ0 A;  3NSL A;  1U5I A;  3BUO B;  1KQM C;  2LVV A;  2PAS A;  2JU0 A;  2JT0 A;  1OSA A;  2KI6 D;  1QAS A;  2WOS A;  4TNC A;  4HRE E;  1Y1X A;  3DF0 B;  1RK9 A;  2KI4 B;  2KAX A;  2DOQ A;  1MWN A;  1IH0 A;  1XK4 A;  1YX8 A;  3I5H B;  2LVJ A;  2PRU A;  1SRA A;  2V53 A;  2HQ8 A;  1AUI B;  3KF9 A;  1V1F A;  2KFH A;  1KK8 C;  1K96 A;  5F6T A;  1KQM B;  1SL7 A;  2L5X B;  2I18 A;  4YI8 A;  3ZWH A;  1ODB A;  1QV1 A;  1LXF C;  2P6B B;  3AAJ A;  2BL0 B;  4MN0 A;  3BUM B;  2JNF A;  1YUU A;  5HKZ A;  4HSZ A;  4PHN A;  4USL A;  1QXP A;  1XFY O;  3JVT C;  3TS5 B;  2SCP A;  1SR6 B;  2AAO A;  4F0Z B;  5KU1 A;  2OPO A;  1BG1 A;  4D1E A;  5HLO A;  2LLS A;  1NX3 A;  1S6I A;  3M0W A;  1CDN A;  1OMV A;  1WRL A;  2JOJ A;  4PE0 A;  1K93 D;  5JOL A;  4ICB A;  1S5G Z;  1F71 A;  3WHU B;  2VRG A;  2LC5 A;  1DJY A;  4IL1 A;  1K9P A;  2JPT A;  3JTD B;  2OTG B;  3VRO A;  1BLQ A;  2KAY A;  2I94 A;  3EK8 A;  1N0Y A;  4ORC B;  1PVA A;  2A4J A;  3TUY C;  1CLL A;  1W7I B;  4Q04 A;  1SL8 A;  4OVN F;  2JTT A;  2GGM A;  1S3P A;  3PSR A;  5AEQ A;  2JXL A;  5ER4 X;  1GJY A;  1PAL A;  3SJS A;  3CLN A;  2Q4U A;  1CDM A;  3PN7 B;  2I2R E;  1CFP A;  2M3W A;  1QJT A;  1JFJ A;  4I5K A;  4C0J A;  1C7V A;  1YRT B;  1BJF A;  2L4I A;  3DF0 A;  1NCX A;  2F33 A;  1J1D A;  3LK0 A;  4CID A;  3PFV A;  2K61 A;  4DIR A;  1Y0V H;  4WRI A;  1SNL A;  4U8D A;  4C0K A;  3OB2 B;  1TOP A;  1SCM C;  1SCV A;  1BOC A;  1G33 A;  3GK1 A;  1UUS A;  1G4Y R;  1KK7 Z;  3BUX B;  3LK1 A;  2M7N A;  3OX5 A;  1OMD A;  4M2Q A;  1K9U A;  4N1F A;  4OCI A;  1DMO A;  2PAL A;  2JTZ A;  1S26 D;  2PMY A;  1F4Q A;  2PVB A;  1QVI Y;  1E8A A;  1SCM B;  1QLK A;  1NP8 A;  3O6B A;  1XFW O;  5D69 A;  2MJW B;  4DUQ A;  2JQ6 A;  2BCB A;  2FJU B;  2ZND A;  1C07 A;  1AHR A;  4WQ2 A;  1IQ5 A;  1OZO A;  4JQ0 D;  2LE9 B;  2JT3 A;  1OE9 B;  2OS8 C;  3BYA A;  2ZFD A;  4ZCV A;  3CR5 X;  4OV2 A;  1JF0 A;  1PVB A;  2H61 A;  3SG5 A;  4I5J A;  2K7O A;  1YR5 A;  4QJ3 B;  1QIV A;  2LHI A;  2KAV A;  4M2P A;  1F54 A;  1YVH A;  1XFU O;  2NLN A;  1ZOT B;  3FS7 A;  4GGF A;  2NCP A;  3ZNI A;  1EJ3 A;  2OS8 B;  1LKJ A;  1UP5 A;  3OP0 A;  5FYX A;  3NSO A;  2Q91 A;  1F4O A;  2ZN9 A;  1ZAC A;  2M1U A;  4QJ4 B;  5AER A;  5GQQ C;  4NDD A;  4PHM A;  2M7L A;  3E3R A;  1B9A A;  2WND A;  4MSP A;  4OR9 B;  2G2B A;  3WNX B;  4P5O E;  1JFK A;  2KFF A;  1J55 A;  1NX2 A;  3EVU A;  1EH2 A;  1KWO B;  2WCE A;  4FQO A;  1K2H A;  2KQY A;  3VRN A;  3VGO A;  5K89 A;  3PLF B;  2M0R A;  1DJZ A;  3EVV A;  1IKU A;  3CR2 A;  3IQO A;  1JC2 A;  4BY4 A;  1B47 A;  2CTN A;  5DKQ A;  3D0Y A;  1TIZ A;  4HRG A;  4A4C A;  2K7B A;  1DGV A;  3AKA A;  1M63 B;  1WRK A;  1QIW A;  1QTX A;  1B7T Y;  2IS9 A;  1DTL A;  3EVR A;  1LIN A;  3H4S E;  4AQJ A;  2CXJ A;  2L51 A;  1KSO A;  4N5X A;  3VRR A;  1JWD A;  1CNP A;  1NWD A;  2KGR A;  2D8N A;  1XYD A;  1FF1 A;  1IGV A;  2CCM A;  4MZK A;  3NXA A;  2LLU A;  1BT6 A;  4PAL A;  3RLZ A;  3QRX A;  5KSZ A;  1QLS A;  2KHN A;  1OOJ A;  1YUT A;  1L2O C;  3CWG A;  4NQG A;  1KK8 B;  2BEC A;  1CB1 A;  1TNX A;  2I7A A;  4MZJ A;  1RRO A;  1QX7 A;  1EXR A;  3I5G C;  5PAL A;  4GGN A;  2MBX A;  1XFX O;  1H4B A;  3BQ3 A;  1MXE A;  1NCZ A;  1DF0 B;  2NCO A;  1CM1 A;  1CDP A;  2M1K B;  4M2O A;  1K8U A;  2COL B;  3PAT A;  1HT9 A;  5KTY A;  1M39 A;  1AJ4 A;  3BUW B;  3JVT B;  2HQW A;  1VRK A;  3SG6 A; 
#chains in the Genus database with same CATH topology
 3IF7 A;  1KFX L;  2CBL A;  2PYQ A;  2LV7 A;  5HKY A;  1IIO A;  1DJH A;  3C1V A;  1CMF A;  5I8N A;  3SG2 A;  3D73 A;  4A4B A;  1SSE B;  5HKW A;  4AQI A;  3SG7 A;  4YRU A;  2FCE A;  1PSR A;  4FTG A;  1QVI Z;  2RGI A;  5CSN A;  2H2K A;  1LA0 A;  1PUL A;  3S0B A;  1YRU B;  2QEH A;  4YGD B;  1RWY A;  3MSE B;  5DKR A;  4CFQ A;  3PM2 A;  4ORB B;  4XYN A;  5G08 A;  1KSM A;  3D75 A;  3CR4 X;  3PAL A;  5FI7 A;  1W9Z A;  3I5F C;  2KI6 C;  3SIA A;  2E30 A;  3TUY B;  3O4Y A;  1K94 A;  2ZNE A;  1J7P A;  3UO9 A;  1FW4 A;  2Y1N A;  2Y4Q A;  1YTZ C;  2QPT A;  1BF5 A;  3BXK A;  3B6X A;  4YGA A;  1TCO B;  3GK2 A;  1JBA A;  2EC6 C;  1MQ1 A;  2LVK A;  1LA3 A;  1N65 A;  2MLF C;  2KLE A;  5CSF A;  3EK7 A;  1TRF A;  1K90 D;  1RJV A;  1SKT A;  3I5F B;  5CSI A;  1DT7 B;  2K2F A;  5HLV A;  1A2X A;  3S0F A;  1MHO A;  2FCD A;  2BCA A;  1XK4 C;  1EG4 A;  2GGZ A;  2JC2 A;  4L9M A;  4XJK B;  1B1G A;  3HX4 A;  1M31 A;  1NCY A;  1UHN A;  1UHK A;  2NXQ A;  3CAB A;  3OB1 B;  4MLW A;  5J3X A;  4ETO A;  1B8C A;  3O78 A;  2JXC A;  2KGB C;  4E68 A;  1OQP A;  3KEV A;  1TN4 A;  1IWQ A;  2JNX A;  3LLE A;  2WC8 A;  3DVE A;  3SG3 A;  2P70 A;  3L4A A;  4JD9 A;  1LS8 A;  1GGW A;  4MZL A;  3TDI A;  1OW4 A;  3A8R A;  3CZ0 A;  1BMO A;  4KYN A;  1KFX S;  4P2Y B;  1ZUZ A;  4NDB A;  3D10 A;  2K2A A;  1B8R A;  2WCB A;  2LLT A;  4PE4 A;  3CZ2 A;  1L7Z A;  3LCP C;  2KSP A;  3CS1 A;  1IRJ A;  2K8M B;  5HYD A;  1BR4 B;  1OMR A;  1CLM A;  3NSI A;  1XA5 A;  1PRW A;  2LUC A;  3DVM A;  1NYA A;  2F3Z A;  2JRF A;  2PQL A;  2E6W A;  3FIA A;  3OGN A;  4YBH B;  1J7O A;  2KYC A;  4MBE A;  2KYF A;  3D76 A;  1SPY A;  3FE8 A;  5DIC A;  1ALW A;  1AVS A;  1CMG A;  3ICB A;  1BOD A;  1KCY A;  4MRX A;  4GAO A;  3D78 A;  3IQQ A;  4HRH A;  4YGB B;  2LMT A;  4MRY A;  1CFC A;  3R1P A;  3N7H A;  1XVJ A;  1DEK A;  1NPQ A;  5I2Q A;  3SG4 A;  1EG3 A;  3CGA A;  2QAC A;  3SS3 A;  2WCK A;  5I94 A;  1SMG A;  1QV0 A;  3HCM A;  3K21 A;  1CDL A;  2JZI A;  4JKT A;  1CKK A;  1BU3 A;  3DY9 A;  1IQ3 A;  1SYM A;  1J7Q A;  1Y1U A;  2K60 A;  2L5Y A;  2LNK A;  4PHJ A;  3S0D A;  1XFZ O;  3GOF A;  3NGV A;  1DGU A;  1NIW A;  2BKI B;  1UHI A;  2K0J A;  2JPO A;  2PSR A;  3TDZ A;  3DVJ A;  3D74 A;  4F7F A;  5HL1 A;  4UPG A;  4ZCU A;  2CNP A;  1OZS A;  1FPW A;  2LVI A;  3NSK A;  1V1G A;  1P28 A;  2KI4 C;  3B88 A;  2LMU A;  1UHJ A;  2P71 A;  4XJK A;  3AKB A;  4PCW A;  3OX6 A;  3CTN A;  3WXA A;  4PE7 A;  4C0L A;  2ZRT A;  3S0A A;  3EKH A;  1KFU S;  2WCH A;  2LCP A;  4DRW A;  5BPJ A;  2M8U A;  1TTX A;  2GTE A;  3NHT A;  4MVF A;  1CTR A;  3RZS A;  2BL0 C;  1C7W A;  2KBI A;  1WY9 A;  5CSJ A;  1PK0 D;  1DVI A;  4PHK A;  2B1U A;  1RTP 1;  1TCF A;  2KNE A;  2HF5 A;  3TDU A;  1H8B A;  3PM8 A;  2YGU A;  1ALV A;  3BFB A;  3NHI A;  2BKH B;  2WC6 A;  4INX A;  2HET A;  3TS5 C;  1SR6 C;  1B4C A;  1D1O A;  2MHH A;  1PSB A;  1S6J A;  1JUO A;  1ZMZ A;  3IVT A;  2KDH A;  1L2O B;  4JPZ B;  1DJI A;  1IJ5 A;  2BE6 A;  2Y1M A;  2GV5 A;  3GK4 X;  1K95 A;  1N2D A;  2L2E A;  3CZ1 A;  1CLB A;  2EGD A;  3I5G B;  1OOI X;  2KPH A;  3CZT X;  2MAZ A;  2BE4 A;  2H61 C;  1Q80 A;  4FQT A;  1YUR A;  2QDI A;  1W7J B;  1Z4H A;  1MUX A;  1IG5 A;  1R2U A;  2OTG C;  2WCJ A;  3JTD C;  4ORA B;  1DJW A;  3WHT B;  1GGZ A;  4GPL B;  3VRP A;  5AFP A;  2EHB A;  5AXI A;  1FI5 A;  1AJ5 A;  4GGF C;  1CM4 A;  1S6C A;  4QJ5 B;  4OZD A;  2LUX A;  2L4H A;  4NDC A;  1FI6 A;  4CLN A;  2AMI A;  2WCL A;  2JT8 A;  4I5N B;  3LL8 B;  1A75 B;  4YGE B;  1BR1 B;  4I5L B;  5D7F A;  1NX0 A;  1A29 A;  1REC A;  3BOW B;  3AAK A;  2HPS A;  3PN7 C;  1DJG A;  2O5G A;  3BUN B;  2WCF A;  1WLM A;  3KPX A;  2AUC A;  4PE1 A;  3EKJ A;  1LVC D;  1WDC C;  1T14 A;  1QX5 B;  2BCX A;  2H8V A;  1HQV A;  1AP4 A;  1QAT A;  1R6P A;  2QEB A;  1K9K A;  1X02 A;  4MEW A;  3EK4 A;  1UWO A;  1JF2 A;  1OOF A;  1NX1 A;  3UNW A;  1JSA A;  1GM0 A;  1Y1A A;  2F2P A;  2ZKM X;  5CPV A;  1MXL C;  1U5I B;  2F3Y A;  2LAP A;  1A03 A;  4BY5 A;  1WDC B;  2EC6 B;  1OOG A;  5JJG A;  1TNW A;  1UUR A;  2MLE C;  2ZN8 A;  3DD4 A;  2KQ6 A;  1EL4 A;  5B8I B;  3D0Y B;  1FBV A;  3KO0 A;  1B8L A;  2JWW A;  5I2O A;  1XFV O;  1KFU L;  1SK6 D;  3R72 A;  1KQV A;  1DF0 A;  1GQM A;  1S5G Y;  2K7D A;  5DKN A;  5FI2 A;  4CPV A;  1SY9 A;  1ZFS A;  1B7T Z;  2R2I A;  3FWB A;  4PDZ A;  4GBA A;  1SL9 A;  2Y5I A;  4YI9 A;  1F55 A;  1C3Y A;  1S1E A;  2WOR A;  1NSH A;  2ERB A;  1S36 A;  3O4X A;  3DYE A;  2BBN A;  3V2L A;  2MA2 A;  2L0P A;  1Y6W A;  2M97 A;  2M49 B;  5I2L A;  1F70 A;  1YUS A;  4N1G A;  1WRZ A;  3F45 A;  4JWQ A;  4DS7 A;  1J1E A;  1F8H A;  2KBM A;  1CFF A;  5AAN A;  2MRD A;  3OHM B;  1AK8 A;  3OBV A;  1M46 A;  2K7C A;  1TNQ A;  1QX2 A;  3I5I C;  1MF8 B;  3FWC A;  2KOT A;  1M45 A;  1MR8 A;  2L98 A;  2L50 A;  3SIB A;  2G9B A;  4AOM A;  2M29 A;  3VB1 A;  3TZ1 A;  3VRQ A;  2CT9 A;  1A75 A;  1NUB A;  4GUK A;  2FOT A;  3O2P A;  3BOW A;  1QS7 A;  3B7A A;  2ISD A;  1XO5 A;  1YX7 A;  4R1E A;  5IBW A;  1SW8 A;  1RFJ A;  1J7R A;  1YVL A;  2KFG A;  1KWO C;  3I5I B;  3RM1 A;  1IJ6 A;  2SAS A;  1TNP A;  4GFT A;  1TUJ A;  2F2O A;  1KK7 Y;  2TN4 A;  1CFD A;  1DJX A;  1OOH A;  1WLZ A;  2ZRS A;  3DVK A;  3KHE A;  4WQ3 A;  2F8P A;  2LM5 A;  4GNK B;  1UHH A;  4YGC B;  1G8I A;  2BBM A;  2QEV A;  2JUL A;  2LMV A;  1SBJ A;  2LP2 A;  3A4U B;  4OKH A;  2M9G A;  1A4P A;  2LP3 A;  3I5H C;  5ER5 A;  2FJY A;  2LAN A;  2LHL A;  5TNC A;  2O60 A;  4DCK A;  2NZ0 A;  3NSL A;  1U5I A;  1Z2C B;  3QME A;  5FI6 A;  3BJH A;  3BUO B;  1KQM C;  2LVV A;  2PAS A;  2JU0 A;  3D77 A;  2JT0 A;  1OSA A;  2KI6 D;  1QAS A;  2WOS A;  4TNC A;  4HRE E;  1Y1X A;  3DF0 B;  1RK9 A;  2KI4 B;  2KAX A;  2DOQ A;  1MWN A;  3SS4 A;  1IH0 A;  1XK4 A;  1YX8 A;  4PT1 A;  3I5H B;  2LVJ A;  2PRU A;  1SRA A;  3S0G A;  2V53 A;  2HQ8 A;  3SS5 A;  1AUI B;  3KF9 A;  1V1F A;  3K1E A;  2KFH A;  1KK8 C;  1K96 A;  5F6T A;  1KQM B;  1SL7 A;  2L5X B;  1C3Z A;  2I18 A;  1XFR A;  3R1O A;  4YI8 A;  3ZWH A;  1ODB A;  1QV1 A;  1LXF C;  2P6B B;  3AAJ A;  2BL0 B;  4MN0 A;  3BUM B;  2JNF A;  1YUU A;  5HKZ A;  3PJI A;  4HSZ A;  4PHN A;  4USL A;  1QXP A;  1XFY O;  3JVT C;  3TS5 B;  2SCP A;  1SR6 B;  2AAO A;  3BFH A;  4F0Z B;  5KU1 A;  5EL2 A;  2OPO A;  3S0E A;  1BG1 A;  4D1E A;  5HLO A;  2LLS A;  1NX3 A;  1S6I A;  3M0W A;  1CDN A;  1OMV A;  1WRL A;  2JOJ A;  3CDN A;  4PE0 A;  1K93 D;  5JOL A;  4ICB A;  1S5G Z;  1F71 A;  3WHU B;  2VRG A;  2LC5 A;  1DJY A;  4IL1 A;  1K9P A;  2JPT A;  3JTD B;  2OTG B;  3VRO A;  1BLQ A;  2KAY A;  2I94 A;  3EG5 B;  3EK8 A;  1N0Y A;  4ORC B;  2BNX A;  1PVA A;  2A4J A;  3TUY C;  3FE6 A;  1CLL A;  1W7I B;  4Q04 A;  1SL8 A;  4OVN F;  2JTT A;  2GGM A;  1S3P A;  2WC5 A;  3PSR A;  5AEQ A;  2JXL A;  5ER4 X;  1GJY A;  1PAL A;  3SJS A;  3CLN A;  2Q4U A;  1CDM A;  3PN7 B;  2I2R E;  1CFP A;  2M3W A;  1QJT A;  3R1V A;  1JFJ A;  4I5K A;  4C0J A;  1C7V A;  1YRT B;  1BJF A;  2L4I A;  3L4L A;  3DF0 A;  1NCX A;  2F33 A;  1J1D A;  3LK0 A;  4CID A;  2L2C A;  3PFV A;  2K61 A;  2WCM A;  4DIR A;  1Y0V H;  4WRI A;  1SNL A;  4U8D A;  4C0K A;  3OB2 B;  4IJ7 A;  1TOP A;  1SCM C;  1SCV A;  1BOC A;  1G33 A;  3GK1 A;  1UUS A;  1G4Y R;  1KK7 Z;  3BUX B;  3LK1 A;  2M7N A;  3OX5 A;  1OMD A;  4M2Q A;  1K9U A;  4N1F A;  4OCI A;  1DMO A;  2PAL A;  2JTZ A;  5D3O A;  1S26 D;  2PMY A;  1F4Q A;  1TUZ A;  1QVI Y;  1E8A A;  1SCM B;  2KLD A;  2PVB A;  1QLK A;  1NP8 A;  3O6B A;  1XFW O;  5D69 A;  1ORG A;  2MJW B;  4CFR A;  4DUQ A;  2JQ6 A;  2BCB A;  3FE9 A;  2FJU B;  2ZND A;  1C07 A;  1AHR A;  4WQ2 A;  1IQ5 A;  1OZO A;  4JQ0 D;  2LE9 B;  2JT3 A;  1OE9 B;  2OS8 C;  3BYA A;  2ZFD A;  4ZCV A;  3CR5 X;  4OV2 A;  3DZT A;  1JF0 A;  1PVB A;  2H61 A;  3SG5 A;  4I5J A;  2K7O A;  1YR5 A;  4QJ3 B;  1DEL A;  1QIV A;  2KAV A;  2LHI A;  4M2P A;  1F54 A;  1YVH A;  1XFU O;  2NLN A;  1ZOT B;  3FS7 A;  4GGF A;  2NCP A;  3ZNI A;  1DQE A;  1EJ3 A;  2OS8 B;  1LKJ A;  1UP5 A;  1TWO A;  3OP0 A;  5FYX A;  3NSO A;  2Q91 A;  1F4O A;  2ZN9 A;  1ZAC A;  2M1U A;  4QJ4 B;  5AER A;  5GQQ C;  4NDD A;  4PHM A;  2M7L A;  3E3R A;  1B9A A;  2WND A;  4MSP A;  4OR9 B;  2G2B A;  3WNX B;  3B86 A;  4P5O E;  1JFK A;  2KFF A;  1J55 A;  1NX2 A;  3EVU A;  1EH2 A;  1KWO B;  2WCE A;  4FQO A;  1K2H A;  1QWV A;  2KQY A;  3VRN A;  3VGO A;  5K89 A;  3PLF B;  2M0R A;  1DJZ A;  3EVV A;  2BAP A;  1IKU A;  3CR2 A;  3IQO A;  1JC2 A;  4BY4 A;  3DXL A;  1B47 A;  2CTN A;  5DKQ A;  3D0Y A;  1TIZ A;  3CYZ A;  4HRG A;  4A4C A;  2K7B A;  1DGV A;  3AKA A;  3BFA A;  1M63 B;  1WRK A;  1QIW A;  1QTX A;  1B7T Y;  2IS9 A;  1DTL A;  3EVR A;  1LIN A;  3H4S E;  4AQJ A;  2CXJ A;  2L51 A;  1KSO A;  3Q8I A;  4N5X A;  3VRR A;  1JWD A;  1CNP A;  1NWD A;  2KGR A;  2D8N A;  1XYD A;  1FF1 A;  1IGV A;  2CCM A;  4MZK A;  3NXA A;  4INW A;  2LLU A;  1BT6 A;  4PAL A;  3RLZ A;  3QRX A;  5KSZ A;  1QLS A;  2KHN A;  1OOJ A;  1YUT A;  1L2O C;  3L47 A;  3CWG A;  4NQG A;  1KK8 B;  2BEC A;  1CB1 A;  1TNX A;  2I7A A;  4MZJ A;  1RRO A;  1QX7 A;  1EXR A;  3I5G C;  5PAL A;  4GGN A;  2MBX A;  1XFX O;  1H4B A;  3BQ3 A;  1MXE A;  1NCZ A;  1DF0 B;  2NCO A;  1DC1 A;  1CM1 A;  1CDP A;  2M1K B;  4M2O A;  1K8U A;  2COL B;  3PAT A;  1HT9 A;  5KTY A;  1M39 A;  2QEO A;  1AJ4 A;  3B87 A;  3BUW B;  3JVT B;  2HQW A;  1VRK A;  3SG6 A; 
#chains in the Genus database with same CATH homology
 3IF7 A;  1KFX L;  2CBL A;  2LV7 A;  5HKY A;  1DJH A;  3C1V A;  1CMF A;  5I8N A;  4A4B A;  4AQI A;  5HKW A;  3SG7 A;  4YRU A;  2FCE A;  1PSR A;  4FTG A;  1QVI Z;  2RGI A;  5CSN A;  2H2K A;  1LA0 A;  1PUL A;  1YRU B;  4YGD B;  4CFQ A;  1RWY A;  3MSE B;  5DKR A;  4ORB B;  4XYN A;  5G08 A;  1KSM A;  3CR4 X;  3PAL A;  3I5F C;  2KI6 C;  3SIA A;  2E30 A;  3TUY B;  3O4Y A;  1K94 A;  2ZNE A;  1J7P A;  1FW4 A;  2Y1N A;  2Y4Q A;  1YTZ C;  2QPT A;  1BF5 A;  3BXK A;  4YGA A;  1TCO B;  3GK2 A;  1JBA A;  2EC6 C;  1MQ1 A;  2LVK A;  1LA3 A;  1N65 A;  2MLF C;  5CSF A;  3EK7 A;  1TRF A;  1K90 D;  1RJV A;  1SKT A;  3I5F B;  5CSI A;  1DT7 B;  2K2F A;  5HLV A;  1A2X A;  1MHO A;  2FCD A;  2BCA A;  1XK4 C;  1EG4 A;  2GGZ A;  2JC2 A;  4L9M A;  4XJK B;  1B1G A;  3HX4 A;  1M31 A;  1NCY A;  1UHN A;  1UHK A;  2NXQ A;  3OB1 B;  4MLW A;  5J3X A;  4ETO A;  1B8C A;  3O78 A;  2JXC A;  2KGB C;  4E68 A;  1OQP A;  3KEV A;  1TN4 A;  1IWQ A;  2JNX A;  3LLE A;  2WC8 A;  3DVE A;  3SG3 A;  1GGW A;  4MZL A;  3TDI A;  3A8R A;  1BMO A;  1KFX S;  4P2Y B;  1ZUZ A;  4NDB A;  3D10 A;  2K2A A;  1B8R A;  2WCB A;  2LLT A;  4PE4 A;  1L7Z A;  3LCP C;  2KSP A;  3CS1 A;  1IRJ A;  2K8M B;  5HYD A;  1BR4 B;  1OMR A;  1CLM A;  3NSI A;  1XA5 A;  1PRW A;  2LUC A;  3DVM A;  1NYA A;  2F3Z A;  2JRF A;  3FIA A;  2E6W A;  4YBH B;  1J7O A;  2KYC A;  4MBE A;  2KYF A;  1SPY A;  1ALW A;  1AVS A;  1CMG A;  3ICB A;  1BOD A;  1KCY A;  4MRX A;  4GAO A;  3IQQ A;  4HRH A;  4YGB B;  2LMT A;  4MRY A;  1CFC A;  1XVJ A;  1NPQ A;  5I2Q A;  3SG4 A;  1EG3 A;  3CGA A;  2QAC A;  1SMG A;  1QV0 A;  3HCM A;  3K21 A;  1CDL A;  2JZI A;  1CKK A;  1J7Q A;  1BU3 A;  1IQ3 A;  1SYM A;  1Y1U A;  2LNK A;  4PHJ A;  4CFR A;  1XFZ O;  3GOF A;  1DGU A;  1NIW A;  2BKI B;  1UHI A;  2K0J A;  3TDZ A;  2PSR A;  3DVJ A;  4UPG A;  4ZCU A;  2CNP A;  1OZS A;  1FPW A;  2LVI A;  3NSK A;  1V1G A;  2KI4 C;  2LMU A;  1UHJ A;  4XJK A;  3AKB A;  4PCW A;  3OX6 A;  3CTN A;  3WXA A;  4PE7 A;  4C0L A;  2ZRT A;  3EKH A;  1KFU S;  2LCP A;  4DRW A;  5BPJ A;  2M8U A;  1TTX A;  4MVF A;  1CTR A;  2BL0 C;  1C7W A;  2KBI A;  1WY9 A;  5CSJ A;  1PK0 D;  1DVI A;  4PHK A;  2B1U A;  1RTP 1;  1TCF A;  2KNE A;  2HF5 A;  3TDU A;  1H8B A;  3PM8 A;  1ALV A;  2BKH B;  3TS5 C;  2HET A;  1SR6 C;  1B4C A;  1D1O A;  2MHH A;  1PSB A;  1S6J A;  1JUO A;  1ZMZ A;  2KDH A;  1L2O B;  4JPZ B;  1DJI A;  1IJ5 A;  2BE6 A;  2Y1M A;  2GV5 A;  3GK4 X;  1K95 A;  1N2D A;  2L2E A;  1CLB A;  2EGD A;  3I5G B;  3CZT X;  2MAZ A;  2BE4 A;  2H61 C;  1Q80 A;  1YUR A;  1W7J B;  3JTD C;  1MUX A;  1IG5 A;  1R2U A;  2OTG C;  4ORA B;  3WHT B;  1DJW A;  1GGZ A;  4GPL B;  3VRP A;  5AFP A;  2EHB A;  5AXI A;  1FI5 A;  1AJ5 A;  4GGF C;  1CM4 A;  1S6C A;  4QJ5 B;  2LUX A;  2L4H A;  4NDC A;  1FI6 A;  4CLN A;  2AMI A;  2JT8 A;  4I5N B;  3LL8 B;  1A75 B;  4YGE B;  1BR1 B;  4I5L B;  5D7F A;  1NX0 A;  1A29 A;  1REC A;  3BOW B;  3AAK A;  2HPS A;  3PN7 C;  1DJG A;  2O5G A;  3BUN B;  2WCF A;  1WLM A;  3KPX A;  2AUC A;  4PE1 A;  3EKJ A;  1LVC D;  1WDC C;  1QX5 B;  2BCX A;  1HQV A;  1AP4 A;  1QAT A;  1R6P A;  1K9K A;  1X02 A;  4MEW A;  3EK4 A;  1UWO A;  1JF2 A;  1NX1 A;  1JSA A;  1Y1A A;  2F2P A;  2ZKM X;  5CPV A;  1MXL C;  1U5I B;  2F3Y A;  2LAP A;  1A03 A;  4BY5 A;  1WDC B;  2EC6 B;  5JJG A;  1TNW A;  1UUR A;  2MLE C;  2ZN8 A;  3DD4 A;  2KQ6 A;  1EL4 A;  5B8I B;  3D0Y B;  1FBV A;  3KO0 A;  1B8L A;  2JWW A;  5I2O A;  1XFV O;  1KFU L;  1SK6 D;  1KQV A;  1DF0 A;  1GQM A;  1S5G Y;  2K7D A;  5DKN A;  4CPV A;  1SY9 A;  1ZFS A;  1B7T Z;  2R2I A;  3FWB A;  4PDZ A;  4GBA A;  1SL9 A;  2Y5I A;  4YI9 A;  1F55 A;  1S1E A;  2WOR A;  1NSH A;  1S36 A;  2BBN A;  2MA2 A;  2L0P A;  1Y6W A;  2M97 A;  2M49 B;  5I2L A;  1F70 A;  1YUS A;  4N1G A;  1WRZ A;  3F45 A;  4JWQ A;  4DS7 A;  1J1E A;  1F8H A;  2KBM A;  1CFF A;  5AAN A;  2MRD A;  3OHM B;  1AK8 A;  1M46 A;  2K7C A;  1TNQ A;  1QX2 A;  3I5I C;  1MF8 B;  3FWC A;  2KOT A;  1M45 A;  1MR8 A;  2L98 A;  2L50 A;  3SIB A;  2G9B A;  4AOM A;  2M29 A;  3TZ1 A;  3VRQ A;  2CT9 A;  1A75 A;  1NUB A;  4GUK A;  2FOT A;  3BOW A;  1QS7 A;  2ISD A;  1XO5 A;  1YX7 A;  4R1E A;  5IBW A;  1SW8 A;  1RFJ A;  1J7R A;  1YVL A;  2KFG A;  1KWO C;  3I5I B;  3RM1 A;  1IJ6 A;  2SAS A;  1TNP A;  4GFT A;  2TN4 A;  2F2O A;  1KK7 Y;  3O2P A;  1CFD A;  1DJX A;  1WLZ A;  2ZRS A;  4WQ3 A;  3DVK A;  3KHE A;  3SG2 A;  2F8P A;  2LM5 A;  4GNK B;  1UHH A;  4YGC B;  1G8I A;  2BBM A;  2JUL A;  2LMV A;  1SBJ A;  2LP2 A;  3A4U B;  4OKH A;  2M9G A;  1A4P A;  2LP3 A;  3I5H C;  5ER5 A;  2LAN A;  2LHL A;  5TNC A;  2O60 A;  4DCK A;  2NZ0 A;  3NSL A;  1U5I A;  3BUO B;  1KQM C;  2LVV A;  2PAS A;  2JU0 A;  2JT0 A;  1OSA A;  2KI6 D;  1QAS A;  2WOS A;  4TNC A;  4HRE E;  1Y1X A;  3DF0 B;  1RK9 A;  2KI4 B;  2KAX A;  2DOQ A;  1MWN A;  1IH0 A;  1XK4 A;  1YX8 A;  3I5H B;  2LVJ A;  2PRU A;  1SRA A;  2V53 A;  2HQ8 A;  1AUI B;  3KF9 A;  1V1F A;  2KFH A;  1KK8 C;  1K96 A;  5F6T A;  1KQM B;  1SL7 A;  2L5X B;  2I18 A;  4YI8 A;  3ZWH A;  1ODB A;  1QV1 A;  1LXF C;  2P6B B;  3AAJ A;  2BL0 B;  4MN0 A;  3BUM B;  2JNF A;  1YUU A;  5HKZ A;  4HSZ A;  4PHN A;  4USL A;  1QXP A;  1XFY O;  3JVT C;  3TS5 B;  2SCP A;  1SR6 B;  2AAO A;  4F0Z B;  5KU1 A;  2OPO A;  1BG1 A;  4D1E A;  5HLO A;  2LLS A;  1NX3 A;  1S6I A;  3M0W A;  1CDN A;  1OMV A;  1WRL A;  2JOJ A;  4PE0 A;  1K93 D;  5JOL A;  4ICB A;  1S5G Z;  1F71 A;  3WHU B;  2VRG A;  2LC5 A;  1DJY A;  4IL1 A;  1K9P A;  2JPT A;  3JTD B;  2OTG B;  3VRO A;  1BLQ A;  2KAY A;  2I94 A;  3EK8 A;  1N0Y A;  4ORC B;  1PVA A;  2A4J A;  3TUY C;  1CLL A;  1W7I B;  4Q04 A;  1SL8 A;  4OVN F;  2JTT A;  2GGM A;  1S3P A;  3PSR A;  5AEQ A;  2JXL A;  5ER4 X;  1GJY A;  1PAL A;  3SJS A;  3CLN A;  2Q4U A;  1CDM A;  3PN7 B;  2I2R E;  1CFP A;  2M3W A;  1QJT A;  1JFJ A;  4I5K A;  4C0J A;  1C7V A;  1YRT B;  1BJF A;  2L4I A;  3DF0 A;  1NCX A;  2F33 A;  1J1D A;  3LK0 A;  4CID A;  3PFV A;  2K61 A;  4DIR A;  1Y0V H;  4WRI A;  1SNL A;  4U8D A;  4C0K A;  3OB2 B;  1TOP A;  1SCM C;  1SCV A;  1BOC A;  1G33 A;  3GK1 A;  1UUS A;  1G4Y R;  1KK7 Z;  3BUX B;  3LK1 A;  2M7N A;  3OX5 A;  1OMD A;  4M2Q A;  1K9U A;  4N1F A;  4OCI A;  1DMO A;  2PAL A;  2JTZ A;  1S26 D;  2PMY A;  1F4Q A;  2PVB A;  1QVI Y;  1E8A A;  1SCM B;  1QLK A;  1NP8 A;  3O6B A;  1XFW O;  5D69 A;  2MJW B;  4DUQ A;  2JQ6 A;  2BCB A;  2FJU B;  2ZND A;  1C07 A;  1AHR A;  4WQ2 A;  1IQ5 A;  1OZO A;  4JQ0 D;  2LE9 B;  2JT3 A;  1OE9 B;  2OS8 C;  3BYA A;  2ZFD A;  4ZCV A;  3CR5 X;  4OV2 A;  1JF0 A;  1PVB A;  2H61 A;  3SG5 A;  4I5J A;  2K7O A;  1YR5 A;  4QJ3 B;  1QIV A;  2LHI A;  2KAV A;  4M2P A;  1F54 A;  1YVH A;  1XFU O;  2NLN A;  1ZOT B;  3FS7 A;  4GGF A;  2NCP A;  3ZNI A;  1EJ3 A;  2OS8 B;  1LKJ A;  1UP5 A;  3OP0 A;  5FYX A;  3NSO A;  2Q91 A;  1F4O A;  2ZN9 A;  1ZAC A;  2M1U A;  4QJ4 B;  5AER A;  5GQQ C;  4NDD A;  4PHM A;  2M7L A;  3E3R A;  1B9A A;  2WND A;  4MSP A;  4OR9 B;  2G2B A;  3WNX B;  4P5O E;  1JFK A;  2KFF A;  1J55 A;  1NX2 A;  3EVU A;  1EH2 A;  1KWO B;  2WCE A;  4FQO A;  1K2H A;  2KQY A;  3VRN A;  3VGO A;  5K89 A;  3PLF B;  2M0R A;  1DJZ A;  3EVV A;  1IKU A;  3CR2 A;  3IQO A;  1JC2 A;  4BY4 A;  1B47 A;  2CTN A;  5DKQ A;  3D0Y A;  1TIZ A;  4HRG A;  4A4C A;  2K7B A;  1DGV A;  3AKA A;  1M63 B;  1WRK A;  1QIW A;  1QTX A;  1B7T Y;  2IS9 A;  1DTL A;  3EVR A;  1LIN A;  3H4S E;  4AQJ A;  2CXJ A;  2L51 A;  1KSO A;  4N5X A;  3VRR A;  1JWD A;  1CNP A;  1NWD A;  2KGR A;  2D8N A;  1XYD A;  1FF1 A;  1IGV A;  2CCM A;  4MZK A;  3NXA A;  2LLU A;  1BT6 A;  4PAL A;  3RLZ A;  3QRX A;  5KSZ A;  1QLS A;  2KHN A;  1OOJ A;  1YUT A;  1L2O C;  3CWG A;  4NQG A;  1KK8 B;  2BEC A;  1CB1 A;  1TNX A;  2I7A A;  4MZJ A;  1RRO A;  1QX7 A;  1EXR A;  3I5G C;  5PAL A;  4GGN A;  2MBX A;  1XFX O;  1H4B A;  3BQ3 A;  1MXE A;  1NCZ A;  1DF0 B;  2NCO A;  1CM1 A;  1CDP A;  2M1K B;  4M2O A;  1K8U A;  2COL B;  3PAT A;  1HT9 A;  5KTY A;  1M39 A;  1AJ4 A;  3BUW B;  3JVT B;  2HQW A;  1VRK A;  3SG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...