1YUSA

Solution structure of apo-s100a13
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S100 calcium binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yusA00
4JWQA 2BL0B 1QIWA 4MZLA 2JT3A 1WDCB 2F33A 2MHHA 2NZ0A 2WOSA 3VRPA 4BY4A 4MLWA 2NCOA 3BXKA 4PE1A 2WCEA 1IWQA 1KWOC 1YURA 2Q91A 2PVBA 1SRAA 3DF0A 3IQQA 3NSIA 5JJGA 3LLEA 2K7CA 1A2XA 2L2EA 3BOWB 1N65A 2NCPA 4ZCUA 1F54A 3H4SE 1EG4A 1S5GY 2M8UA 4WQ2A 1IJ6A 1F4OA 1J55A 2GGMA 3TDZA 1FBVA 1SR6B 3DVKA 3M0WA 1KFXS 1K90D 1JF0A 4U8DA 5AFPA 1JFKA 2K61A 2JC2A 2KGBC 1NX1A 5PALA 2AMIA 2KI4B 2KNEA 1QIVA 4Q04A 4TNCA 2DOQA 1F71A 2HF5A 3SIAA 5GQQC 2K8MB 4QJ4B 2LP2A 1PK0D 1BU3A 1SL9A 1BR1B 2HQ8A 5AANA 2LVIA 2I7AA 1ZOTB 2Q4UA 4N1GA 3I5IC 1DGVA 3E3RA 1UUSA 1AUIB 3NSOA 2SASA 2ZRTA 3PALA 1IQ3A 1N0YA 3K21A 4PE0A 3O4YA 4N5XA 2L0PA 1RK9A 3DVJA 2PSRA 4MVFA 2JNXA 1FI6A 1PVAA 3JVTC 1SYMA 2LE9B 3WHUB 1QLSA 4WRIA 4QJ3B 1LA0A 4E68A 2KQ6A 3GOFA 1DVIA 2R2IA 2L4HA 1NUBA 1OSAA 4XJKB 4WQ3A 1M46A 3CS1A 2LLUA 3RLZA 1C7VA 1XO5A 1A75A 1TCFA 3PLFB 4I5KA 1YUUA 4I5LB 3D0YB 2M49B 1S36A 2KYFA 5JOLA 3OP0A 4MEWA 4GAOA 2BCAA 1QVIZ 1BODA 1BMOA 1MR8A 2JXCA 3CLNA 1J7PA 2LMTA 1B7TZ 3IF7A 1KQMC 4IL1A 3I5FB 1S6CA 1U5IA 1K9KA 3VROA 3I5HC 3VRRA 1WRKA 2FJUB 3EK4A 2BE6A 1SCMB 2ZRSA 3OX6A 1YRTB 2JRFA 4P2YB 1MXEA 1BT6A 3VRQA 1F4QA 4I5NB 3DVMA 2BL0C 3BUNB 2H2KA 5CSNA 2K2AA 1YRUB 2I94A 1Y6WA 2WC8A 3EVVA 1SBJA 1YTZC 1X02A 5D69A 3GK1A 3NXAA 5KU1A 3FWBA 1AK8A 1R6PA 1QTXA 1FW4A 2I2RE 2L4IA 5AERA 1HQVA 1AJ5A 1B47A 1NSHA 4P5OE 1H4BA 1SPYA 1BJFA 2CT9A 2LVJA 3EVRA 1QV1A 2AUCA 4GGFC 1CDNA 2JTTA 1B8LA 3SG3A 1RFJA 4MBEA 2BKHB 2GGZA 2JTZA 2B1UA 3JTDC 1J7RA 4MSPA 3SG4A 2M29A 5HLOA 2K7DA 5I2QA 1LA3A 1B9AA 2V53A 5HKWA 1IJ5A 2RGIA 4CFQA 1JFJA 3DVEA 4C0JA 5HYDA 5AXIA 2F3ZA 3CR2A 2M3WA 2ZNDA 2BCBA 2LHIA 4YGDB 4DS7A 5I2OA 1KQVA 1AHRA 1NX2A 2KFGA 2KI4C 4NDCA 3RM1A 1K93D 4C0KA 3ZWHA 2K7BA 1WY9A 2FOTA 1NYAA 4ORAB 4R1EA 3KO0A 2D8NA 2JT8A 3CWGA 3EK8A 1AJ4A 1M63B 1MHOA 3A4UB 1CDLA 5CPVA 1G33A 1OMVA 4XYNA 4I5JA 1XFYO 3MSEB 1LINA 1NPQA 2CXJA 3KPXA 4AQIA 3SG7A 3NSLA 3OX5A 4YBHB 1DF0A 1SNLA 1GJYA 2OTGC 4MZKA 4PHJA 4GUKA 1TNQA 4OR9B 2CTNA 4JPZB 2HQWA 3TUYC 4CIDA 4DCKA 3HCMA 1KK8C 3OHMB 4GGFA 1CMGA 2LV7A 1PALA 4PDZA 1NCZA 5CSFA 1QJTA 2BKIB 2M7NA 3TDIA 4YGBB 1FPWA 1DJGA 1J7OA 3DD4A 2EHBA 1K94A 1SKTA 4GGNA 1TOPA 3CGAA 5G08A 3FIAA 1JF2A 3I5FC 3VGOA 1UHIA 1N2DA 3PFVA 2KSPA 2BECA 1SCMC 1OOJA 1AP4A 4A4CA 3FS7A 3WXAA 1SL7A 1BOCA 4ORCB 1C7WA 2G2BA 1S5GZ 1UHNA 2JZIA 2KI6C 2O5GA 4GFTA 1DJZA 2OS8C 1TCOB 1MUXA 1RWYA 1B1GA 4ORBB 2M7LA 1PSRA 1TNXA 1EG3A 2JQ6A 1CFCA 1NCYA 1JUOA 2KBIA 1ALVA 4CLNA 2MJWB 1DT7B 4FTGA 1XFWO 1G8IA 1SMGA 2K2FA 1CB1A 1XFUO 1BF5A 1ZFSA 2Y5IA 2HETA 2ZNEA 1K9UA 4MZJA 2KFFA 1M39A 1SCVA 2QACA 4NDDA 2L5XB 1B8CA 2Y4QA 5FYXA 1CKKA 5K89A 2F2OA 4PHKA 1LXFC 2LC5A 2MAZA 5KSZA 4F0ZB 2VRGA 3BUXB 3CR4X 1L2OB 1IQ5A 2LAPA 3ICBA 1YUTA 1HT9A 3O2PA 4GBAA 4YGCB 1G4YR 4FQOA 1QXPA 3A8RA 1ZUZA 1UP5A 1S26D 1J1DA 4YGEB 4YI8A 3ZNIA 5KTYA 1DMOA 1YX7A 1ZMZA 2NXQA 1PSBA 1PULA 1FI5A 1KWOB 2F2PA 2Y1NA 1D1OA 1S6JA 4GNKB 1S3PA 2M1UA 1CFDA 1KFXL 2KAXA 5I8NA 3CZTX 1DJYA 4HRGA 4L9MA 2CNPA 2ZFDA 1B8RA 2MLFC 2O60A 3QRXA 1DTLA 1NX3A 1H8BA 1KFUS 1WDCC 2OPOA 1XVJA 2K0JA 4A4BA 2CBLA 3WNXB 2LUXA 1JSAA 1U5IB 2COLB 2FCDA 1KSMA 1A29A 1QATA 1V1FA 3SG6A 2K7OA 1TN4A 3BUWB 3I5GB 1QX7A 1S6IA 1Y1AA 1SW8A 2G9BA 2BBNA 5ER4X 4PE7A 4ETOA 3PATA 2QPTA 1JWDA 1RJVA 1J1EA 1DJWA 2KI6D 2F3YA 2LHLA 3HX4A 2KAVA 2LM5A 1XFXO 2KGRA 1TNWA 1SR6C 2P6BB 1KK7Y 1YR5A 3TZ1A 3I5IB 1BG1A 2WNDA 1SK6D 1AVSA 5B8IB 1Y1XA 2Y1MA 4DUQA 4OCIA 4NDBA 2BBMA 4JQ0D 1XA5A 3KF9A 5IBWA 3WHTB 3GK2A 3JVTB 1MQ1A 1UURA 4AQJA 1VRKA 4ZCVA 1JC2A 1YX8A 1UHJA 2LUCA 4OKHA 1W7IB 5CSJA 3BYAA 1OZOA 5F6TA 5DKRA 1CM4A 1ZACA 3PN7B 2CCMA 2WCFA 2SCPA 2BCXA 2JWWA 2KOTA 3C1VA 5TNCA 3TS5B 3NSKA 4PALA 3KEVA 1B4CA 1DJIA 1QLKA 1Y1UA 1L7ZA 1V1GA 1KQMB 3LCPC 1XK4C 1MF8B 1CNPA 2H61C 4HRHA 1CLBA 3AAKA 3I5HB 5HLVA 4AOMA 1YVHA 1DGUA 1PVBA 1YUSA 2PMYA 1NCXA 1R2UA 1UHKA 1LVCD 2JU0A 1M31A 4YRUA 1E8AA 3BOWA 4N1FA 1L2OC 3EVUA 4HREE 3AKAA 1NIWA 1F8HA 4MRXA 1IRJA 1RECA 1RTP1 1DF0B 2KQYA 3AAJA 1W7JB 3DF0B 1C07A 2M97A 1RROA 4D1EA 1OMRA 4UPGA 1F70A 1EJ3A 1CM1A 4M2QA 1CFPA 1S1EA 1ODBA 1QX2A 2KFHA 1ALWA 4USLA 4NQGA 1GGZA 1BLQA 1CFFA 2KAYA 3AKBA 3JTDB 5ER5A 2KDHA 2MA2A 4C0LA 3LL8B 4M2PA 2MRDA 2IS9A 2KHNA 3KHEA 1CLLA 1NWDA 4CPVA 2EC6B 2GV5A 2L98A 1UHHA 4PHMA 2L51A 4YGAA 1MXLC 1SY9A 1WLZA 2LVVA 3I5GC 2LANA 4M2OA 4HSZA 1GGWA 4QJ5B 3EKJA 5HKYA 3VRNA 1Q80A 2LMVA 1IGVA 1XK4A 4BY5A 2H61A 5J3XA 2JULA 4PHNA 2TN4A 2HPSA 3TDUA 4MRYA 1SL8A 1Y0VH 1NX0A 2ZKMX 4XJKA 3F45A 3BUMB 4DRWA 2NLNA 3SJSA 4MN0A 1QVIY 1EXRA 3SG5A 2LLSA 1B7TY 3D0YA 1LKJA 2LP3A 1TNPA 2M9GA 3SG2A 3CR5X 3PSRA 2ZN9A 3OB1B 2OTGB 2PALA 1A4PA 3CTNA 1IG5A 4PE4A 1K2HA 1FF1A 2LCPA 1CMFA 3TUYB 2MBXA 1IH0A 1A75B 2WCBA 2ISDA 2M0RA 4PCWA 3GK4X 2LVKA 1KK8B 1OE9B 3OB2B 2WORA 1QV0A 3PN7C 2E30A 1K96A 3O6BA 2JT0A 1IKUA 1QX5B 3TS5C 2L50A 1PRWA 3BQ3A 3LK1A 1OMDA 3LK0A 2KYCA 1YVLA 1TTXA 1MWNA 1KSOA 2FCEA 4YI9A 3FWCA 1J7QA 4CFRA 2JOJA 1CDMA 2KBMA 1CLMA 1EH2A 2OS8B 1XYDA 1QASA 1CTRA 2AAOA 2LLTA 2MLEC 1TRFA 2JXLA 4OV2A 5DKNA 3EKHA 1WRLA 1OZSA 2ZN8A 1NP8A 5D7FA 1K95A 5I2LA 1QS7A 1UWOA 2BE4A 2F8PA 1BR4B 2I18A 4ICBA 1F55A 3IQOA 1WRZA 3PM8A 1K9PA 1WLMA 2E6WA 3EK7A 2A4JA 1CDPA 5CSIA 1OQPA 5BPJA 2LNKA 1DJXA 1KK7Z 3BUOB 5HKZA 1JBAA 2JPTA 3SIBA 1KCYA 2EC6C 1XFVO 1KFUL 1XFZO 2JNFA 3O78A 1A03A 2M1KB 1EL4A 1K8UA 5AEQA 2PRUA 2PASA 4OVNF 1DJHA 3D10A 1TIZA 4DIRA 1GQMA 2LMUA 5DKQA 2EGDA 1M45A 4GPLB
chains in the Genus database with same CATH superfamily
4JWQA 2BL0B 1QIWA 3BJHA 3FE6A 2JT3A 1WDCB 4MZLA 2F33A 2MHHA 2NZ0A 2WOSA 3B87A 3VRPA 4MLWA 2NCOA 3BXKA 3OGNA 4PE1A 4BY4A 3NHTA 2WCEA 1IWQA 1KWOC 1YURA 3CDNA 2Q91A 2PVBA 1SRAA 3DF0A 3IQQA 3NSIA 3S0DA 5JJGA 3LLEA 2K7CA 1A2XA 2L2EA 3BOWB 1N65A 2NCPA 1DEKA 4ZCUA 1F54A 1IIOA 3H4SE 3D74A 1EG4A 1S5GY 2M8UA 4WQ2A 1IJ6A 1F4OA 1J55A 2GGMA 3TDZA 3B7AA 1FBVA 1T14A 1SR6B 3DVKA 3M0WA 1TUJA 1KFXS 1K90D 1JF0A 1DQEA 4U8DA 5AFPA 3K1EA 1JFKA 2K61A 2JC2A 1Z2CB 2KGBC 1NX1A 2WCJA 5PALA 2AMIA 2KI4B 2KNEA 1QIVA 4Q04A 4TNCA 2DOQA 1F71A 2HF5A 3SIAA 3SS3A 4PT1A 5GQQC 3OBVA 2K8MB 4QJ4B 2LP2A 1PK0D 1BU3A 1SL9A 1BR1B 2HQ8A 5AANA 1TUZA 2LVIA 2I7AA 1ZOTB 2Q4UA 4N1GA 3I5IC 1DGVA 3E3RA 1UUSA 1AUIB 3NSOA 2SASA 2L5YA 2K60A 2ZRTA 2P71A 1N0YA 3K21A 3PALA 3O4YA 4N5XA 2L0PA 4PE0A 1RK9A 3DVJA 2PSRA 4MVFA 2JNXA 1FI6A 1PVAA 2KLDA 3JVTC 1SYMA 2LE9B 3WHUB 1QLSA 4WRIA 4QJ3B 1LA0A 4E68A 2KQ6A 3GOFA 1DVIA 2R2IA 2L4HA 1NUBA 1OSAA 3DXLA 4WQ3A 4XJKB 1M46A 3CS1A 2LLUA 3RLZA 1C7VA 1XO5A 3Q8IA 3S0GA 1OOHA 1A75A 1TCFA 3PLFB 4I5KA 1YUUA 4I5LB 1ORGA 2M49B 1S36A 2KYFA 3D0YB 5JOLA 3OP0A 4MEWA 4GAOA 2BCAA 1QVIZ 1BODA 1BMOA 1MR8A 2JXCA 3CLNA 3SS5A 1J7PA 2LMTA 1B7TZ 3IF7A 1KQMC 4IL1A 5I94A 3I5FB 1S6CA 1U5IA 1K9KA 3VROA 3I5HC 3VRRA 1WRKA 2FJUB 3EK4A 4OZDA 2BE6A 1SCMB 2ZRSA 3D78A 1YRTB 2JRFA 3OX6A 4P2YB 1C3YA 1MXEA 1BT6A 3D73A 3VRQA 1F4QA 3B86A 4I5NB 3DVMA 2BL0C 2WCMA 2H2KA 3BUNB 5CSNA 5EL2A 2K2AA 1YRUB 2I94A 3CYZA 1IQ3A 1Y6WA 2WC8A 3EVVA 1SBJA 1Z4HA 1YTZC 1X02A 5D69A 3GK1A 1OOIX 3NXAA 5KU1A 3FWBA 1AK8A 1R6PA 1QTXA 1FW4A 2I2RE 2L4IA 5AERA 1AJ5A 1B47A 1HQVA 1NSHA 4P5OE 1H4BA 1SPYA 1BJFA 2CT9A 2LVJA 3EVRA 1QV1A 4JKTA 2AUCA 4GGFC 3RZSA 2JTTA 1OW4A 1B8LA 3SG3A 1CDNA 1RFJA 4MBEA 2BKHB 2GGZA 1SSEB 2KLEA 2YGUA 2JTZA 2B1UA 3JTDC 1J7RA 4MSPA 3SG4A 2M29A 5HLOA 2K7DA 5I2QA 1LA3A 1B9AA 2V53A 5HKWA 1IJ5A 2RGIA 4CFQA 1JFJA 3DVEA 4C0JA 5HYDA 5AXIA 2F3ZA 3CR2A 2M3WA 2ZNDA 2BCBA 2LHIA 4YGDB 4DS7A 5I2OA 1KQVA 1AHRA 1NX2A 2KFGA 2KI4C 4NDCA 5HL1A 3RM1A 1K93D 4C0KA 3ZWHA 2K7BA 1WY9A 2FOTA 1NYAA 4ORAB 4R1EA 3KO0A 3O4XA 2D8NA 2JT8A 3CWGA 3B88A 3EK8A 1AJ4A 1M63B 1MHOA 3A4UB 1CDLA 5CPVA 1G33A 1OMVA 2WCHA 4XYNA 4I5JA 1XFYO 3MSEB 1LINA 1NPQA 2CXJA 3KPXA 4AQIA 3SG7A 3NSLA 3OX5A 4YBHB 1DF0A 1SNLA 1GJYA 2OTGC 2WCLA 4MZKA 4PHJA 4GUKA 3BFAA 1TNQA 4OR9B 2CTNA 4JPZB 2HQWA 3CZ0A 4CIDA 3TUYC 3NGVA 4DCKA 3HCMA 1KK8C 3OHMB 4GGFA 1CMGA 2WCKA 2LV7A 1PALA 4PDZA 3D75A 1NCZA 5CSFA 1QJTA 2BKIB 2M7NA 3TDIA 4YGBB 1FPWA 1DJGA 1J7OA 3DD4A 2EHBA 1K94A 1SKTA 4GGNA 1TOPA 3CGAA 5G08A 3FIAA 1JF2A 3I5FC 3VGOA 1UHIA 1N2DA 3PFVA 2KSPA 2BECA 1SCMC 1W9ZA 1OOJA 1AP4A 4A4CA 3FS7A 3WXAA 1SL7A 1BOCA 1TWOA 4ORCB 1C7WA 2G2BA 1S5GZ 1UHNA 2JZIA 2KI6C 2O5GA 4GFTA 1DJZA 2L2CA 1TCOB 1MUXA 2OS8C 1RWYA 3DY9A 1B1GA 4ORBB 2M7LA 1PSRA 1TNXA 1EG3A 2JQ6A 1CFCA 1NCYA 1JUOA 2KBIA 1ALVA 4CLNA 2MJWB 2QEOA 4FTGA 1DT7B 1XFWO 5FI2A 1G8IA 1SMGA 2K2FA 3L4AA 1CB1A 1XFUO 1BF5A 1ZFSA 2Y5IA 2HETA 2ZNEA 1K9UA 4MZJA 2KFFA 3D77A 1M39A 1SCVA 2QACA 4NDDA 2L5XB 1B8CA 2Y4QA 5FYXA 1CKKA 5K89A 2F2OA 4PHKA 1LXFC 2LC5A 2MAZA 2QDIA 5KSZA 4F0ZB 2VRGA 3BUXB 3CR4X 1L2OB 1IQ5A 2LAPA 3ICBA 1YUTA 1HT9A 3O2PA 4GBAA 4YGCB 1G4YR 4FQOA 1QXPA 3A8RA 1ZUZA 1UP5A 1S26D 1J1DA 4YGEB 4YI8A 3ZNIA 5KTYA 1DMOA 1YX7A 1ZMZA 2NXQA 1PSBA 1PULA 1FI5A 1KWOB 2F2PA 2Y1NA 1D1OA 1S6JA 4GNKB 1S3PA 2M1UA 1CFDA 1KFXL 3S0FA 2KAXA 1C3ZA 5I8NA 3BFBA 1DJYA 3CZTX 4HRGA 4INXA 4L9MA 3L4LA 2CNPA 2ZFDA 1B8RA 2MLFC 2O60A 3QRXA 1DTLA 1NX3A 1H8BA 3L47A 1KFUS 1WDCC 3QMEA 3R1PA 2OPOA 1XVJA 2K0JA 4A4BA 2CBLA 3WNXB 2LUXA 1JSAA 1U5IB 2COLB 2FCDA 1KSMA 1A29A 1QATA 1V1FA 3SG6A 2K7OA 1TN4A 3BUWB 3I5GB 1QX7A 1S6IA 1Y1AA 1SW8A 2G9BA 2BBNA 2KPHA 3DZTA 5ER4X 4PE7A 4ETOA 3PATA 2QPTA 3S0BA 1JWDA 1RJVA 1J1EA 1DJWA 2KI6D 2F3YA 2LHLA 3HX4A 2KAVA 2LM5A 1LS8A 1XFXO 2KGRA 1OOFA 1TNWA 3UO9A 1SR6C 2P6BB 1KK7Y 1YR5A 3TZ1A 3I5IB 1BG1A 3EG5B 2WNDA 3IVTA 1SK6D 1AVSA 3N7HA 5B8IB 1Y1XA 2Y1MA 3CZ2A 4DUQA 4OCIA 4NDBA 2BBMA 4JQ0D 1XA5A 3KF9A 5IBWA 3WHTB 3PM2A 3GK2A 3JVTB 1MQ1A 1UURA 4AQJA 1VRKA 4ZCVA 1JC2A 1YX8A 1UHJA 2LUCA 4OKHA 1W7IB 5CSJA 3BYAA 1OZOA 5F6TA 3VB1A 5DKRA 1CM4A 1ZACA 3PN7B 2CCMA 2WCFA 2SCPA 2BCXA 2JWWA 2KOTA 3C1VA 5TNCA 3TS5B 3NSKA 4PALA 3KEVA 1B4CA 1DJIA 1QLKA 1Y1UA 1L7ZA 1XFRA 1V1GA 1KQMB 3LCPC 1XK4C 1MF8B 1CNPA 2H61C 4HRHA 5FI6A 1CLBA 3AAKA 3I5HB 5HLVA 4AOMA 3CZ1A 1YVHA 1DGUA 1PVBA 1YUSA 2PMYA 1NCXA 1R2UA 1UHKA 3S0AA 1LVCD 2JU0A 1M31A 4YRUA 1E8AA 3BOWA 4N1FA 1L2OC 3EVUA 4HREE 3UNWA 1DELA 3AKAA 1NIWA 1F8HA 4MRXA 1IRJA 1RECA 1RTP1 4JD9A 2WC5A 1DF0B 2KQYA 2FJYA 3AAJA 1W7JB 3DF0B 2BNXA 1C07A 2WC6A 2M97A 1RROA 4D1EA 1OMRA 4IJ7A 4UPGA 1F70A 1EJ3A 1CM1A 4M2QA 1CFPA 1S1EA 1ODBA 1QX2A 2KFHA 1ALWA 4USLA 4NQGA 1GGZA 1BLQA 1CFFA 2ERBA 2KAYA 3AKBA 3JTDB 5ER5A 2KDHA 3SS4A 3R72A 3R1VA 2MA2A 4C0LA 3LL8B 4M2PA 2MRDA 4FQTA 2IS9A 2KHNA 3KHEA 1CLLA 1NWDA 4CPVA 2EC6B 2GV5A 5FI7A 2L98A 1UHHA 4PHMA 2L51A 4YGAA 3S0EA 1MXLC 1SY9A 1WLZA 2LVVA 3I5GC 2LANA 4M2OA 4HSZA 4KYNA 1GGWA 4INWA 4QJ5B 3EKJA 3R1OA 5HKYA 3VRNA 1Q80A 2LMVA 1IGVA 1XK4A 4BY5A 2H61A 5J3XA 2JULA 4PHNA 2TN4A 2HPSA 3TDUA 4MRYA 1SL8A 2BAPA 1Y0VH 1DC1A 1NX0A 2ZKMX 4XJKA 3F45A 3BUMB 4DRWA 2NLNA 3SJSA 4MN0A 1QVIY 2PYQA 1EXRA 3FE8A 3SG5A 2LLSA 1B7TY 3D0YA 1LKJA 2LP3A 1TNPA 2M9GA 3SG2A 3CR5X 3PSRA 2ZN9A 3OB1B 2OTGB 2PALA 1A4PA 3CTNA 1IG5A 4PE4A 1K2HA 2GTEA 3V2LA 1FF1A 2LCPA 1CMFA 3TUYB 2MBXA 1IH0A 1A75B 2WCBA 2ISDA 2M0RA 4PCWA 3GK4X 2LVKA 1KK8B 3FE9A 1OE9B 3OB2B 2WORA 1QV0A 3PN7C 2E30A 3PJIA 1K96A 3O6BA 2JT0A 1IKUA 1QX5B 4F7FA 3TS5C 2QEBA 2L50A 1PRWA 3BQ3A 2JPOA 3LK1A 1OMDA 3LK0A 2KYCA 1YVLA 1TTXA 3DYEA 3B6XA 1MWNA 2P70A 1KSOA 2FCEA 4YI9A 3FWCA 1J7QA 4CFRA 2JOJA 1CDMA 2KBMA 1CLMA 1EH2A 2OS8B 1P28A 1XYDA 1QASA 1CTRA 2AAOA 3NHIA 2LLTA 2MLEC 1TRFA 2JXLA 4OV2A 5DKNA 3EKHA 2QEHA 5D3OA 1WRLA 1OZSA 2ZN8A 1NP8A 5D7FA 1K95A 5I2LA 1QS7A 1UWOA 2BE4A 2QEVA 5DICA 3CABA 2F8PA 1QWVA 1BR4B 2I18A 4ICBA 1F55A 3IQOA 1WRZA 3PM8A 1K9PA 1WLMA 2E6WA 2PQLA 3EK7A 2A4JA 1CDPA 5CSIA 1OQPA 5BPJA 2LNKA 1DJXA 1KK7Z 3BUOB 3D76A 5HKZA 1JBAA 2JPTA 3SIBA 1KCYA 2EC6C 1XFVO 2H8VA 1KFUL 1XFZO 2JNFA 3O78A 1A03A 2M1KB 1EL4A 1K8UA 5AEQA 2PRUA 1OOGA 2PASA 1DJHA 4OVNF 3D10A 1TIZA 4DIRA 1GQMA 2LMUA 5DKQA 2EGDA 1M45A 1GM0A 3BFHA 4GPLB
chains in the Genus database with same CATH topology
4JWQA 2BL0B 1QIWA 4MZLA 2JT3A 1WDCB 2F33A 2MHHA 2NZ0A 2WOSA 3VRPA 4BY4A 4MLWA 2NCOA 3BXKA 4PE1A 2WCEA 1IWQA 1KWOC 1YURA 2Q91A 2PVBA 1SRAA 3DF0A 3IQQA 3NSIA 5JJGA 3LLEA 2K7CA 1A2XA 2L2EA 3BOWB 1N65A 2NCPA 4ZCUA 1F54A 3H4SE 1EG4A 1S5GY 2M8UA 4WQ2A 1IJ6A 1F4OA 1J55A 2GGMA 3TDZA 1FBVA 1SR6B 3DVKA 3M0WA 1KFXS 1K90D 1JF0A 4U8DA 5AFPA 1JFKA 2K61A 2JC2A 2KGBC 1NX1A 5PALA 2AMIA 2KI4B 2KNEA 1QIVA 4Q04A 4TNCA 2DOQA 1F71A 2HF5A 3SIAA 5GQQC 2K8MB 4QJ4B 2LP2A 1PK0D 1BU3A 1SL9A 1BR1B 2HQ8A 5AANA 2LVIA 2I7AA 1ZOTB 2Q4UA 4N1GA 3I5IC 1DGVA 3E3RA 1UUSA 1AUIB 3NSOA 2SASA 2ZRTA 3PALA 1IQ3A 1N0YA 3K21A 4PE0A 3O4YA 4N5XA 2L0PA 1RK9A 3DVJA 2PSRA 4MVFA 2JNXA 1FI6A 1PVAA 3JVTC 1SYMA 2LE9B 3WHUB 1QLSA 4WRIA 4QJ3B 1LA0A 4E68A 2KQ6A 3GOFA 1DVIA 2R2IA 2L4HA 1NUBA 1OSAA 4XJKB 4WQ3A 1M46A 3CS1A 2LLUA 3RLZA 1C7VA 1XO5A 1A75A 1TCFA 3PLFB 4I5KA 1YUUA 4I5LB 3D0YB 2M49B 1S36A 2KYFA 5JOLA 3OP0A 4MEWA 4GAOA 2BCAA 1QVIZ 1BODA 1BMOA 1MR8A 2JXCA 3CLNA 1J7PA 2LMTA 1B7TZ 3IF7A 1KQMC 4IL1A 3I5FB 1S6CA 1U5IA 1K9KA 3VROA 3I5HC 3VRRA 1WRKA 2FJUB 3EK4A 2BE6A 1SCMB 2ZRSA 3OX6A 1YRTB 2JRFA 4P2YB 1MXEA 1BT6A 3VRQA 1F4QA 4I5NB 3DVMA 2BL0C 3BUNB 2H2KA 5CSNA 2K2AA 1YRUB 2I94A 1Y6WA 2WC8A 3EVVA 1SBJA 1YTZC 1X02A 5D69A 3GK1A 3NXAA 5KU1A 3FWBA 1AK8A 1R6PA 1QTXA 1FW4A 2I2RE 2L4IA 5AERA 1HQVA 1AJ5A 1B47A 1NSHA 4P5OE 1H4BA 1SPYA 1BJFA 2CT9A 2LVJA 3EVRA 1QV1A 2AUCA 4GGFC 1CDNA 2JTTA 1B8LA 3SG3A 1RFJA 4MBEA 2BKHB 2GGZA 2JTZA 2B1UA 3JTDC 1J7RA 4MSPA 3SG4A 2M29A 5HLOA 2K7DA 5I2QA 1LA3A 1B9AA 2V53A 5HKWA 1IJ5A 2RGIA 4CFQA 1JFJA 3DVEA 4C0JA 5HYDA 5AXIA 2F3ZA 3CR2A 2M3WA 2ZNDA 2BCBA 2LHIA 4YGDB 4DS7A 5I2OA 1KQVA 1AHRA 1NX2A 2KFGA 2KI4C 4NDCA 3RM1A 1K93D 4C0KA 3ZWHA 2K7BA 1WY9A 2FOTA 1NYAA 4ORAB 4R1EA 3KO0A 2D8NA 2JT8A 3CWGA 3EK8A 1AJ4A 1M63B 1MHOA 3A4UB 1CDLA 5CPVA 1G33A 1OMVA 4XYNA 4I5JA 1XFYO 3MSEB 1LINA 1NPQA 2CXJA 3KPXA 4AQIA 3SG7A 3NSLA 3OX5A 4YBHB 1DF0A 1SNLA 1GJYA 2OTGC 4MZKA 4PHJA 4GUKA 1TNQA 4OR9B 2CTNA 4JPZB 2HQWA 3TUYC 4CIDA 4DCKA 3HCMA 1KK8C 3OHMB 4GGFA 1CMGA 2LV7A 1PALA 4PDZA 1NCZA 5CSFA 1QJTA 2BKIB 2M7NA 3TDIA 4YGBB 1FPWA 1DJGA 1J7OA 3DD4A 2EHBA 1K94A 1SKTA 4GGNA 1TOPA 3CGAA 5G08A 3FIAA 1JF2A 3I5FC 3VGOA 1UHIA 1N2DA 3PFVA 2KSPA 2BECA 1SCMC 1OOJA 1AP4A 4A4CA 3FS7A 3WXAA 1SL7A 1BOCA 4ORCB 1C7WA 2G2BA 1S5GZ 1UHNA 2JZIA 2KI6C 2O5GA 4GFTA 1DJZA 2OS8C 1TCOB 1MUXA 1RWYA 1B1GA 4ORBB 2M7LA 1PSRA 1TNXA 1EG3A 2JQ6A 1CFCA 1NCYA 1JUOA 2KBIA 1ALVA 4CLNA 2MJWB 1DT7B 4FTGA 1XFWO 1G8IA 1SMGA 2K2FA 1CB1A 1XFUO 1BF5A 1ZFSA 2Y5IA 2HETA 2ZNEA 1K9UA 4MZJA 2KFFA 1M39A 1SCVA 2QACA 4NDDA 2L5XB 1B8CA 2Y4QA 5FYXA 1CKKA 5K89A 2F2OA 4PHKA 1LXFC 2LC5A 2MAZA 5KSZA 4F0ZB 2VRGA 3BUXB 3CR4X 1L2OB 1IQ5A 2LAPA 3ICBA 1YUTA 1HT9A 3O2PA 4GBAA 4YGCB 1G4YR 4FQOA 1QXPA 3A8RA 1ZUZA 1UP5A 1S26D 1J1DA 4YGEB 4YI8A 3ZNIA 5KTYA 1DMOA 1YX7A 1ZMZA 2NXQA 1PSBA 1PULA 1FI5A 1KWOB 2F2PA 2Y1NA 1D1OA 1S6JA 4GNKB 1S3PA 2M1UA 1CFDA 1KFXL 2KAXA 5I8NA 3CZTX 1DJYA 4HRGA 4L9MA 2CNPA 2ZFDA 1B8RA 2MLFC 2O60A 3QRXA 1DTLA 1NX3A 1H8BA 1KFUS 1WDCC 2OPOA 1XVJA 2K0JA 4A4BA 2CBLA 3WNXB 2LUXA 1JSAA 1U5IB 2COLB 2FCDA 1KSMA 1A29A 1QATA 1V1FA 3SG6A 2K7OA 1TN4A 3BUWB 3I5GB 1QX7A 1S6IA 1Y1AA 1SW8A 2G9BA 2BBNA 5ER4X 4PE7A 4ETOA 3PATA 2QPTA 1JWDA 1RJVA 1J1EA 1DJWA 2KI6D 2F3YA 2LHLA 3HX4A 2KAVA 2LM5A 1XFXO 2KGRA 1TNWA 1SR6C 2P6BB 1KK7Y 1YR5A 3TZ1A 3I5IB 1BG1A 2WNDA 1SK6D 1AVSA 5B8IB 1Y1XA 2Y1MA 4DUQA 4OCIA 4NDBA 2BBMA 4JQ0D 1XA5A 3KF9A 5IBWA 3WHTB 3GK2A 3JVTB 1MQ1A 1UURA 4AQJA 1VRKA 4ZCVA 1JC2A 1YX8A 1UHJA 2LUCA 4OKHA 1W7IB 5CSJA 3BYAA 1OZOA 5F6TA 5DKRA 1CM4A 1ZACA 3PN7B 2CCMA 2WCFA 2SCPA 2BCXA 2JWWA 2KOTA 3C1VA 5TNCA 3TS5B 3NSKA 4PALA 3KEVA 1B4CA 1DJIA 1QLKA 1Y1UA 1L7ZA 1V1GA 1KQMB 3LCPC 1XK4C 1MF8B 1CNPA 2H61C 4HRHA 1CLBA 3AAKA 3I5HB 5HLVA 4AOMA 1YVHA 1DGUA 1PVBA 1YUSA 2PMYA 1NCXA 1R2UA 1UHKA 1LVCD 2JU0A 1M31A 4YRUA 1E8AA 3BOWA 4N1FA 1L2OC 3EVUA 4HREE 3AKAA 1NIWA 1F8HA 4MRXA 1IRJA 1RECA 1RTP1 1DF0B 2KQYA 3AAJA 1W7JB 3DF0B 1C07A 2M97A 1RROA 4D1EA 1OMRA 4UPGA 1F70A 1EJ3A 1CM1A 4M2QA 1CFPA 1S1EA 1ODBA 1QX2A 2KFHA 1ALWA 4USLA 4NQGA 1GGZA 1BLQA 1CFFA 2KAYA 3AKBA 3JTDB 5ER5A 2KDHA 2MA2A 4C0LA 3LL8B 4M2PA 2MRDA 2IS9A 2KHNA 3KHEA 1CLLA 1NWDA 4CPVA 2EC6B 2GV5A 2L98A 1UHHA 4PHMA 2L51A 4YGAA 1MXLC 1SY9A 1WLZA 2LVVA 3I5GC 2LANA 4M2OA 4HSZA 1GGWA 4QJ5B 3EKJA 5HKYA 3VRNA 1Q80A 2LMVA 1IGVA 1XK4A 4BY5A 2H61A 5J3XA 2JULA 4PHNA 2TN4A 2HPSA 3TDUA 4MRYA 1SL8A 1Y0VH 1NX0A 2ZKMX 4XJKA 3F45A 3BUMB 4DRWA 2NLNA 3SJSA 4MN0A 1QVIY 1EXRA 3SG5A 2LLSA 1B7TY 3D0YA 1LKJA 2LP3A 1TNPA 2M9GA 3SG2A 3CR5X 3PSRA 2ZN9A 3OB1B 2OTGB 2PALA 1A4PA 3CTNA 1IG5A 4PE4A 1K2HA 1FF1A 2LCPA 1CMFA 3TUYB 2MBXA 1IH0A 1A75B 2WCBA 2ISDA 2M0RA 4PCWA 3GK4X 2LVKA 1KK8B 1OE9B 3OB2B 2WORA 1QV0A 3PN7C 2E30A 1K96A 3O6BA 2JT0A 1IKUA 1QX5B 3TS5C 2L50A 1PRWA 3BQ3A 3LK1A 1OMDA 3LK0A 2KYCA 1YVLA 1TTXA 1MWNA 1KSOA 2FCEA 4YI9A 3FWCA 1J7QA 4CFRA 2JOJA 1CDMA 2KBMA 1CLMA 1EH2A 2OS8B 1XYDA 1QASA 1CTRA 2AAOA 2LLTA 2MLEC 1TRFA 2JXLA 4OV2A 5DKNA 3EKHA 1WRLA 1OZSA 2ZN8A 1NP8A 5D7FA 1K95A 5I2LA 1QS7A 1UWOA 2BE4A 2F8PA 1BR4B 2I18A 4ICBA 1F55A 3IQOA 1WRZA 3PM8A 1K9PA 1WLMA 2E6WA 3EK7A 2A4JA 1CDPA 5CSIA 1OQPA 5BPJA 2LNKA 1DJXA 1KK7Z 3BUOB 5HKZA 1JBAA 2JPTA 3SIBA 1KCYA 2EC6C 1XFVO 1KFUL 1XFZO 2JNFA 3O78A 1A03A 2M1KB 1EL4A 1K8UA 5AEQA 2PRUA 2PASA 4OVNF 1DJHA 3D10A 1TIZA 4DIRA 1GQMA 2LMUA 5DKQA 2EGDA 1M45A 4GPLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWQ A;  2BL0 B;  1QIW A;  4MZL A;  2JT3 A;  1WDC B;  2F33 A;  2MHH A;  2NZ0 A;  2WOS A;  3VRP A;  4BY4 A;  4MLW A;  2NCO A;  3BXK A;  4PE1 A;  2WCE A;  1IWQ A;  1KWO C;  1YUR A;  2Q91 A;  2PVB A;  1SRA A;  3DF0 A;  3IQQ A;  3NSI A;  5JJG A;  3LLE A;  2K7C A;  1A2X A;  2L2E A;  3BOW B;  1N65 A;  2NCP A;  4ZCU A;  1F54 A;  3H4S E;  1EG4 A;  1S5G Y;  2M8U A;  4WQ2 A;  1IJ6 A;  1F4O A;  1J55 A;  2GGM A;  3TDZ A;  1FBV A;  1SR6 B;  3DVK A;  3M0W A;  1KFX S;  1K90 D;  1JF0 A;  4U8D A;  5AFP A;  1JFK A;  2K61 A;  2JC2 A;  2KGB C;  1NX1 A;  5PAL A;  2AMI A;  2KI4 B;  2KNE A;  1QIV A;  4Q04 A;  4TNC A;  2DOQ A;  1F71 A;  2HF5 A;  3SIA A;  5GQQ C;  2K8M B;  4QJ4 B;  2LP2 A;  1PK0 D;  1BU3 A;  1SL9 A;  1BR1 B;  2HQ8 A;  5AAN A;  2LVI A;  2I7A A;  1ZOT B;  2Q4U A;  4N1G A;  3I5I C;  1DGV A;  3E3R A;  1UUS A;  1AUI B;  3NSO A;  2SAS A;  2ZRT A;  3PAL A;  1IQ3 A;  1N0Y A;  3K21 A;  4PE0 A;  3O4Y A;  4N5X A;  2L0P A;  1RK9 A;  3DVJ A;  2PSR A;  4MVF A;  2JNX A;  1FI6 A;  1PVA A;  3JVT C;  1SYM A;  2LE9 B;  3WHU B;  1QLS A;  4WRI A;  4QJ3 B;  1LA0 A;  4E68 A;  2KQ6 A;  3GOF A;  1DVI A;  2R2I A;  2L4H A;  1NUB A;  1OSA A;  4XJK B;  4WQ3 A;  1M46 A;  3CS1 A;  2LLU A;  3RLZ A;  1C7V A;  1XO5 A;  1A75 A;  1TCF A;  3PLF B;  4I5K A;  1YUU A;  4I5L B;  3D0Y B;  2M49 B;  1S36 A;  2KYF A;  5JOL A;  3OP0 A;  4MEW A;  4GAO A;  2BCA A;  1QVI Z;  1BOD A;  1BMO A;  1MR8 A;  2JXC A;  3CLN A;  1J7P A;  2LMT A;  1B7T Z;  3IF7 A;  1KQM C;  4IL1 A;  3I5F B;  1S6C A;  1U5I A;  1K9K A;  3VRO A;  3I5H C;  3VRR A;  1WRK A;  2FJU B;  3EK4 A;  2BE6 A;  1SCM B;  2ZRS A;  3OX6 A;  1YRT B;  2JRF A;  4P2Y B;  1MXE A;  1BT6 A;  3VRQ A;  1F4Q A;  4I5N B;  3DVM A;  2BL0 C;  3BUN B;  2H2K A;  5CSN A;  2K2A A;  1YRU B;  2I94 A;  1Y6W A;  2WC8 A;  3EVV A;  1SBJ A;  1YTZ C;  1X02 A;  5D69 A;  3GK1 A;  3NXA A;  5KU1 A;  3FWB A;  1AK8 A;  1R6P A;  1QTX A;  1FW4 A;  2I2R E;  2L4I A;  5AER A;  1HQV A;  1AJ5 A;  1B47 A;  1NSH A;  4P5O E;  1H4B A;  1SPY A;  1BJF A;  2CT9 A;  2LVJ A;  3EVR A;  1QV1 A;  2AUC A;  4GGF C;  1CDN A;  2JTT A;  1B8L A;  3SG3 A;  1RFJ A;  4MBE A;  2BKH B;  2GGZ A;  2JTZ A;  2B1U A;  3JTD C;  1J7R A;  4MSP A;  3SG4 A;  2M29 A;  5HLO A;  2K7D A;  5I2Q A;  1LA3 A;  1B9A A;  2V53 A;  5HKW A;  1IJ5 A;  2RGI A;  4CFQ A;  1JFJ A;  3DVE A;  4C0J A;  5HYD A;  5AXI A;  2F3Z A;  3CR2 A;  2M3W A;  2ZND A;  2BCB A;  2LHI A;  4YGD B;  4DS7 A;  5I2O A;  1KQV A;  1AHR A;  1NX2 A;  2KFG A;  2KI4 C;  4NDC A;  3RM1 A;  1K93 D;  4C0K A;  3ZWH A;  2K7B A;  1WY9 A;  2FOT A;  1NYA A;  4ORA B;  4R1E A;  3KO0 A;  2D8N A;  2JT8 A;  3CWG A;  3EK8 A;  1AJ4 A;  1M63 B;  1MHO A;  3A4U B;  1CDL A;  5CPV A;  1G33 A;  1OMV A;  4XYN A;  4I5J A;  1XFY O;  3MSE B;  1LIN A;  1NPQ A;  2CXJ A;  3KPX A;  4AQI A;  3SG7 A;  3NSL A;  3OX5 A;  4YBH B;  1DF0 A;  1SNL A;  1GJY A;  2OTG C;  4MZK A;  4PHJ A;  4GUK A;  1TNQ A;  4OR9 B;  2CTN A;  4JPZ B;  2HQW A;  3TUY C;  4CID A;  4DCK A;  3HCM A;  1KK8 C;  3OHM B;  4GGF A;  1CMG A;  2LV7 A;  1PAL A;  4PDZ A;  1NCZ A;  5CSF A;  1QJT A;  2BKI B;  2M7N A;  3TDI A;  4YGB B;  1FPW A;  1DJG A;  1J7O A;  3DD4 A;  2EHB A;  1K94 A;  1SKT A;  4GGN A;  1TOP A;  3CGA A;  5G08 A;  3FIA A;  1JF2 A;  3I5F C;  3VGO A;  1UHI A;  1N2D A;  3PFV A;  2KSP A;  2BEC A;  1SCM C;  1OOJ A;  1AP4 A;  4A4C A;  3FS7 A;  3WXA A;  1SL7 A;  1BOC A;  4ORC B;  1C7W A;  2G2B A;  1S5G Z;  1UHN A;  2JZI A;  2KI6 C;  2O5G A;  4GFT A;  1DJZ A;  2OS8 C;  1TCO B;  1MUX A;  1RWY A;  1B1G A;  4ORB B;  2M7L A;  1PSR A;  1TNX A;  1EG3 A;  2JQ6 A;  1CFC A;  1NCY A;  1JUO A;  2KBI A;  1ALV A;  4CLN A;  2MJW B;  1DT7 B;  4FTG A;  1XFW O;  1G8I A;  1SMG A;  2K2F A;  1CB1 A;  1XFU O;  1BF5 A;  1ZFS A;  2Y5I A;  2HET A;  2ZNE A;  1K9U A;  4MZJ A;  2KFF A;  1M39 A;  1SCV A;  2QAC A;  4NDD A;  2L5X B;  1B8C A;  2Y4Q A;  5FYX A;  1CKK A;  5K89 A;  2F2O A;  4PHK A;  1LXF C;  2LC5 A;  2MAZ A;  5KSZ A;  4F0Z B;  2VRG A;  3BUX B;  3CR4 X;  1L2O B;  1IQ5 A;  2LAP A;  3ICB A;  1YUT A;  1HT9 A;  3O2P A;  4GBA A;  4YGC B;  1G4Y R;  4FQO A;  1QXP A;  3A8R A;  1ZUZ A;  1UP5 A;  1S26 D;  1J1D A;  4YGE B;  4YI8 A;  3ZNI A;  5KTY A;  1DMO A;  1YX7 A;  1ZMZ A;  2NXQ A;  1PSB A;  1PUL A;  1FI5 A;  1KWO B;  2F2P A;  2Y1N A;  1D1O A;  1S6J A;  4GNK B;  1S3P A;  2M1U A;  1CFD A;  1KFX L;  2KAX A;  5I8N A;  3CZT X;  1DJY A;  4HRG A;  4L9M A;  2CNP A;  2ZFD A;  1B8R A;  2MLF C;  2O60 A;  3QRX A;  1DTL A;  1NX3 A;  1H8B A;  1KFU S;  1WDC C;  2OPO A;  1XVJ A;  2K0J A;  4A4B A;  2CBL A;  3WNX B;  2LUX A;  1JSA A;  1U5I B;  2COL B;  2FCD A;  1KSM A;  1A29 A;  1QAT A;  1V1F A;  3SG6 A;  2K7O A;  1TN4 A;  3BUW B;  3I5G B;  1QX7 A;  1S6I A;  1Y1A A;  1SW8 A;  2G9B A;  2BBN A;  5ER4 X;  4PE7 A;  4ETO A;  3PAT A;  2QPT A;  1JWD A;  1RJV A;  1J1E A;  1DJW A;  2KI6 D;  2F3Y A;  2LHL A;  3HX4 A;  2KAV A;  2LM5 A;  1XFX O;  2KGR A;  1TNW A;  1SR6 C;  2P6B B;  1KK7 Y;  1YR5 A;  3TZ1 A;  3I5I B;  1BG1 A;  2WND A;  1SK6 D;  1AVS A;  5B8I B;  1Y1X A;  2Y1M A;  4DUQ A;  4OCI A;  4NDB A;  2BBM A;  4JQ0 D;  1XA5 A;  3KF9 A;  5IBW A;  3WHT B;  3GK2 A;  3JVT B;  1MQ1 A;  1UUR A;  4AQJ A;  1VRK A;  4ZCV A;  1JC2 A;  1YX8 A;  1UHJ A;  2LUC A;  4OKH A;  1W7I B;  5CSJ A;  3BYA A;  1OZO A;  5F6T A;  5DKR A;  1CM4 A;  1ZAC A;  3PN7 B;  2CCM A;  2WCF A;  2SCP A;  2BCX A;  2JWW A;  2KOT A;  3C1V A;  5TNC A;  3TS5 B;  3NSK A;  4PAL A;  3KEV A;  1B4C A;  1DJI A;  1QLK A;  1Y1U A;  1L7Z A;  1V1G A;  1KQM B;  3LCP C;  1XK4 C;  1MF8 B;  1CNP A;  2H61 C;  4HRH A;  1CLB A;  3AAK A;  3I5H B;  5HLV A;  4AOM A;  1YVH A;  1DGU A;  1PVB A;  1YUS A;  2PMY A;  1NCX A;  1R2U A;  1UHK A;  1LVC D;  2JU0 A;  1M31 A;  4YRU A;  1E8A A;  3BOW A;  4N1F A;  1L2O C;  3EVU A;  4HRE E;  3AKA A;  1NIW A;  1F8H A;  4MRX A;  1IRJ A;  1REC A;  1RTP 1;  1DF0 B;  2KQY A;  3AAJ A;  1W7J B;  3DF0 B;  1C07 A;  2M97 A;  1RRO A;  4D1E A;  1OMR A;  4UPG A;  1F70 A;  1EJ3 A;  1CM1 A;  4M2Q A;  1CFP A;  1S1E A;  1ODB A;  1QX2 A;  2KFH A;  1ALW A;  4USL A;  4NQG A;  1GGZ A;  1BLQ A;  1CFF A;  2KAY A;  3AKB A;  3JTD B;  5ER5 A;  2KDH A;  2MA2 A;  4C0L A;  3LL8 B;  4M2P A;  2MRD A;  2IS9 A;  2KHN A;  3KHE A;  1CLL A;  1NWD A;  4CPV A;  2EC6 B;  2GV5 A;  2L98 A;  1UHH A;  4PHM A;  2L51 A;  4YGA A;  1MXL C;  1SY9 A;  1WLZ A;  2LVV A;  3I5G C;  2LAN A;  4M2O A;  4HSZ A;  1GGW A;  4QJ5 B;  3EKJ A;  5HKY A;  3VRN A;  1Q80 A;  2LMV A;  1IGV A;  1XK4 A;  4BY5 A;  2H61 A;  5J3X A;  2JUL A;  4PHN A;  2TN4 A;  2HPS A;  3TDU A;  4MRY A;  1SL8 A;  1Y0V H;  1NX0 A;  2ZKM X;  4XJK A;  3F45 A;  3BUM B;  4DRW A;  2NLN A;  3SJS A;  4MN0 A;  1QVI Y;  1EXR A;  3SG5 A;  2LLS A;  1B7T Y;  3D0Y A;  1LKJ A;  2LP3 A;  1TNP A;  2M9G A;  3SG2 A;  3CR5 X;  3PSR A;  2ZN9 A;  3OB1 B;  2OTG B;  2PAL A;  1A4P A;  3CTN A;  1IG5 A;  4PE4 A;  1K2H A;  1FF1 A;  2LCP A;  1CMF A;  3TUY B;  2MBX A;  1IH0 A;  1A75 B;  2WCB A;  2ISD A;  2M0R A;  4PCW A;  3GK4 X;  2LVK A;  1KK8 B;  1OE9 B;  3OB2 B;  2WOR A;  1QV0 A;  3PN7 C;  2E30 A;  1K96 A;  3O6B A;  2JT0 A;  1IKU A;  1QX5 B;  3TS5 C;  2L50 A;  1PRW A;  3BQ3 A;  3LK1 A;  1OMD A;  3LK0 A;  2KYC A;  1YVL A;  1TTX A;  1MWN A;  1KSO A;  2FCE A;  4YI9 A;  3FWC A;  1J7Q A;  4CFR A;  2JOJ A;  1CDM A;  2KBM A;  1CLM A;  1EH2 A;  2OS8 B;  1XYD A;  1QAS A;  1CTR A;  2AAO A;  2LLT A;  2MLE C;  1TRF A;  2JXL A;  4OV2 A;  5DKN A;  3EKH A;  1WRL A;  1OZS A;  2ZN8 A;  1NP8 A;  5D7F A;  1K95 A;  5I2L A;  1QS7 A;  1UWO A;  2BE4 A;  2F8P A;  1BR4 B;  2I18 A;  4ICB A;  1F55 A;  3IQO A;  1WRZ A;  3PM8 A;  1K9P A;  1WLM A;  2E6W A;  3EK7 A;  2A4J A;  1CDP A;  5CSI A;  1OQP A;  5BPJ A;  2LNK A;  1DJX A;  1KK7 Z;  3BUO B;  5HKZ A;  1JBA A;  2JPT A;  3SIB A;  1KCY A;  2EC6 C;  1XFV O;  1KFU L;  1XFZ O;  2JNF A;  3O78 A;  1A03 A;  2M1K B;  1EL4 A;  1K8U A;  5AEQ A;  2PRU A;  2PAS A;  4OVN F;  1DJH A;  3D10 A;  1TIZ A;  4DIR A;  1GQM A;  2LMU A;  5DKQ A;  2EGD A;  1M45 A;  4GPL B; 
#chains in the Genus database with same CATH topology
 4JWQ A;  2BL0 B;  1QIW A;  3BJH A;  3FE6 A;  2JT3 A;  1WDC B;  4MZL A;  2F33 A;  2MHH A;  2NZ0 A;  2WOS A;  3B87 A;  3VRP A;  4MLW A;  2NCO A;  3BXK A;  3OGN A;  4PE1 A;  4BY4 A;  3NHT A;  2WCE A;  1IWQ A;  1KWO C;  1YUR A;  3CDN A;  2Q91 A;  2PVB A;  1SRA A;  3DF0 A;  3IQQ A;  3NSI A;  3S0D A;  5JJG A;  3LLE A;  2K7C A;  1A2X A;  2L2E A;  3BOW B;  1N65 A;  2NCP A;  1DEK A;  4ZCU A;  1F54 A;  1IIO A;  3H4S E;  3D74 A;  1EG4 A;  1S5G Y;  2M8U A;  4WQ2 A;  1IJ6 A;  1F4O A;  1J55 A;  2GGM A;  3TDZ A;  3B7A A;  1FBV A;  1T14 A;  1SR6 B;  3DVK A;  3M0W A;  1TUJ A;  1KFX S;  1K90 D;  1JF0 A;  1DQE A;  4U8D A;  5AFP A;  3K1E A;  1JFK A;  2K61 A;  2JC2 A;  1Z2C B;  2KGB C;  1NX1 A;  2WCJ A;  5PAL A;  2AMI A;  2KI4 B;  2KNE A;  1QIV A;  4Q04 A;  4TNC A;  2DOQ A;  1F71 A;  2HF5 A;  3SIA A;  3SS3 A;  4PT1 A;  5GQQ C;  3OBV A;  2K8M B;  4QJ4 B;  2LP2 A;  1PK0 D;  1BU3 A;  1SL9 A;  1BR1 B;  2HQ8 A;  5AAN A;  1TUZ A;  2LVI A;  2I7A A;  1ZOT B;  2Q4U A;  4N1G A;  3I5I C;  1DGV A;  3E3R A;  1UUS A;  1AUI B;  3NSO A;  2SAS A;  2L5Y A;  2K60 A;  2ZRT A;  2P71 A;  1N0Y A;  3K21 A;  3PAL A;  3O4Y A;  4N5X A;  2L0P A;  4PE0 A;  1RK9 A;  3DVJ A;  2PSR A;  4MVF A;  2JNX A;  1FI6 A;  1PVA A;  2KLD A;  3JVT C;  1SYM A;  2LE9 B;  3WHU B;  1QLS A;  4WRI A;  4QJ3 B;  1LA0 A;  4E68 A;  2KQ6 A;  3GOF A;  1DVI A;  2R2I A;  2L4H A;  1NUB A;  1OSA A;  3DXL A;  4WQ3 A;  4XJK B;  1M46 A;  3CS1 A;  2LLU A;  3RLZ A;  1C7V A;  1XO5 A;  3Q8I A;  3S0G A;  1OOH A;  1A75 A;  1TCF A;  3PLF B;  4I5K A;  1YUU A;  4I5L B;  1ORG A;  2M49 B;  1S36 A;  2KYF A;  3D0Y B;  5JOL A;  3OP0 A;  4MEW A;  4GAO A;  2BCA A;  1QVI Z;  1BOD A;  1BMO A;  1MR8 A;  2JXC A;  3CLN A;  3SS5 A;  1J7P A;  2LMT A;  1B7T Z;  3IF7 A;  1KQM C;  4IL1 A;  5I94 A;  3I5F B;  1S6C A;  1U5I A;  1K9K A;  3VRO A;  3I5H C;  3VRR A;  1WRK A;  2FJU B;  3EK4 A;  4OZD A;  2BE6 A;  1SCM B;  2ZRS A;  3D78 A;  1YRT B;  2JRF A;  3OX6 A;  4P2Y B;  1C3Y A;  1MXE A;  1BT6 A;  3D73 A;  3VRQ A;  1F4Q A;  3B86 A;  4I5N B;  3DVM A;  2BL0 C;  2WCM A;  2H2K A;  3BUN B;  5CSN A;  5EL2 A;  2K2A A;  1YRU B;  2I94 A;  3CYZ A;  1IQ3 A;  1Y6W A;  2WC8 A;  3EVV A;  1SBJ A;  1Z4H A;  1YTZ C;  1X02 A;  5D69 A;  3GK1 A;  1OOI X;  3NXA A;  5KU1 A;  3FWB A;  1AK8 A;  1R6P A;  1QTX A;  1FW4 A;  2I2R E;  2L4I A;  5AER A;  1AJ5 A;  1B47 A;  1HQV A;  1NSH A;  4P5O E;  1H4B A;  1SPY A;  1BJF A;  2CT9 A;  2LVJ A;  3EVR A;  1QV1 A;  4JKT A;  2AUC A;  4GGF C;  3RZS A;  2JTT A;  1OW4 A;  1B8L A;  3SG3 A;  1CDN A;  1RFJ A;  4MBE A;  2BKH B;  2GGZ A;  1SSE B;  2KLE A;  2YGU A;  2JTZ A;  2B1U A;  3JTD C;  1J7R A;  4MSP A;  3SG4 A;  2M29 A;  5HLO A;  2K7D A;  5I2Q A;  1LA3 A;  1B9A A;  2V53 A;  5HKW A;  1IJ5 A;  2RGI A;  4CFQ A;  1JFJ A;  3DVE A;  4C0J A;  5HYD A;  5AXI A;  2F3Z A;  3CR2 A;  2M3W A;  2ZND A;  2BCB A;  2LHI A;  4YGD B;  4DS7 A;  5I2O A;  1KQV A;  1AHR A;  1NX2 A;  2KFG A;  2KI4 C;  4NDC A;  5HL1 A;  3RM1 A;  1K93 D;  4C0K A;  3ZWH A;  2K7B A;  1WY9 A;  2FOT A;  1NYA A;  4ORA B;  4R1E A;  3KO0 A;  3O4X A;  2D8N A;  2JT8 A;  3CWG A;  3B88 A;  3EK8 A;  1AJ4 A;  1M63 B;  1MHO A;  3A4U B;  1CDL A;  5CPV A;  1G33 A;  1OMV A;  2WCH A;  4XYN A;  4I5J A;  1XFY O;  3MSE B;  1LIN A;  1NPQ A;  2CXJ A;  3KPX A;  4AQI A;  3SG7 A;  3NSL A;  3OX5 A;  4YBH B;  1DF0 A;  1SNL A;  1GJY A;  2OTG C;  2WCL A;  4MZK A;  4PHJ A;  4GUK A;  3BFA A;  1TNQ A;  4OR9 B;  2CTN A;  4JPZ B;  2HQW A;  3CZ0 A;  4CID A;  3TUY C;  3NGV A;  4DCK A;  3HCM A;  1KK8 C;  3OHM B;  4GGF A;  1CMG A;  2WCK A;  2LV7 A;  1PAL A;  4PDZ A;  3D75 A;  1NCZ A;  5CSF A;  1QJT A;  2BKI B;  2M7N A;  3TDI A;  4YGB B;  1FPW A;  1DJG A;  1J7O A;  3DD4 A;  2EHB A;  1K94 A;  1SKT A;  4GGN A;  1TOP A;  3CGA A;  5G08 A;  3FIA A;  1JF2 A;  3I5F C;  3VGO A;  1UHI A;  1N2D A;  3PFV A;  2KSP A;  2BEC A;  1SCM C;  1W9Z A;  1OOJ A;  1AP4 A;  4A4C A;  3FS7 A;  3WXA A;  1SL7 A;  1BOC A;  1TWO A;  4ORC B;  1C7W A;  2G2B A;  1S5G Z;  1UHN A;  2JZI A;  2KI6 C;  2O5G A;  4GFT A;  1DJZ A;  2L2C A;  1TCO B;  1MUX A;  2OS8 C;  1RWY A;  3DY9 A;  1B1G A;  4ORB B;  2M7L A;  1PSR A;  1TNX A;  1EG3 A;  2JQ6 A;  1CFC A;  1NCY A;  1JUO A;  2KBI A;  1ALV A;  4CLN A;  2MJW B;  2QEO A;  4FTG A;  1DT7 B;  1XFW O;  5FI2 A;  1G8I A;  1SMG A;  2K2F A;  3L4A A;  1CB1 A;  1XFU O;  1BF5 A;  1ZFS A;  2Y5I A;  2HET A;  2ZNE A;  1K9U A;  4MZJ A;  2KFF A;  3D77 A;  1M39 A;  1SCV A;  2QAC A;  4NDD A;  2L5X B;  1B8C A;  2Y4Q A;  5FYX A;  1CKK A;  5K89 A;  2F2O A;  4PHK A;  1LXF C;  2LC5 A;  2MAZ A;  2QDI A;  5KSZ A;  4F0Z B;  2VRG A;  3BUX B;  3CR4 X;  1L2O B;  1IQ5 A;  2LAP A;  3ICB A;  1YUT A;  1HT9 A;  3O2P A;  4GBA A;  4YGC B;  1G4Y R;  4FQO A;  1QXP A;  3A8R A;  1ZUZ A;  1UP5 A;  1S26 D;  1J1D A;  4YGE B;  4YI8 A;  3ZNI A;  5KTY A;  1DMO A;  1YX7 A;  1ZMZ A;  2NXQ A;  1PSB A;  1PUL A;  1FI5 A;  1KWO B;  2F2P A;  2Y1N A;  1D1O A;  1S6J A;  4GNK B;  1S3P A;  2M1U A;  1CFD A;  1KFX L;  3S0F A;  2KAX A;  1C3Z A;  5I8N A;  3BFB A;  1DJY A;  3CZT X;  4HRG A;  4INX A;  4L9M A;  3L4L A;  2CNP A;  2ZFD A;  1B8R A;  2MLF C;  2O60 A;  3QRX A;  1DTL A;  1NX3 A;  1H8B A;  3L47 A;  1KFU S;  1WDC C;  3QME A;  3R1P A;  2OPO A;  1XVJ A;  2K0J A;  4A4B A;  2CBL A;  3WNX B;  2LUX A;  1JSA A;  1U5I B;  2COL B;  2FCD A;  1KSM A;  1A29 A;  1QAT A;  1V1F A;  3SG6 A;  2K7O A;  1TN4 A;  3BUW B;  3I5G B;  1QX7 A;  1S6I A;  1Y1A A;  1SW8 A;  2G9B A;  2BBN A;  2KPH A;  3DZT A;  5ER4 X;  4PE7 A;  4ETO A;  3PAT A;  2QPT A;  3S0B A;  1JWD A;  1RJV A;  1J1E A;  1DJW A;  2KI6 D;  2F3Y A;  2LHL A;  3HX4 A;  2KAV A;  2LM5 A;  1LS8 A;  1XFX O;  2KGR A;  1OOF A;  1TNW A;  3UO9 A;  1SR6 C;  2P6B B;  1KK7 Y;  1YR5 A;  3TZ1 A;  3I5I B;  1BG1 A;  3EG5 B;  2WND A;  3IVT A;  1SK6 D;  1AVS A;  3N7H A;  5B8I B;  1Y1X A;  2Y1M A;  3CZ2 A;  4DUQ A;  4OCI A;  4NDB A;  2BBM A;  4JQ0 D;  1XA5 A;  3KF9 A;  5IBW A;  3WHT B;  3PM2 A;  3GK2 A;  3JVT B;  1MQ1 A;  1UUR A;  4AQJ A;  1VRK A;  4ZCV A;  1JC2 A;  1YX8 A;  1UHJ A;  2LUC A;  4OKH A;  1W7I B;  5CSJ A;  3BYA A;  1OZO A;  5F6T A;  3VB1 A;  5DKR A;  1CM4 A;  1ZAC A;  3PN7 B;  2CCM A;  2WCF A;  2SCP A;  2BCX A;  2JWW A;  2KOT A;  3C1V A;  5TNC A;  3TS5 B;  3NSK A;  4PAL A;  3KEV A;  1B4C A;  1DJI A;  1QLK A;  1Y1U A;  1L7Z A;  1XFR A;  1V1G A;  1KQM B;  3LCP C;  1XK4 C;  1MF8 B;  1CNP A;  2H61 C;  4HRH A;  5FI6 A;  1CLB A;  3AAK A;  3I5H B;  5HLV A;  4AOM A;  3CZ1 A;  1YVH A;  1DGU A;  1PVB A;  1YUS A;  2PMY A;  1NCX A;  1R2U A;  1UHK A;  3S0A A;  1LVC D;  2JU0 A;  1M31 A;  4YRU A;  1E8A A;  3BOW A;  4N1F A;  1L2O C;  3EVU A;  4HRE E;  3UNW A;  1DEL A;  3AKA A;  1NIW A;  1F8H A;  4MRX A;  1IRJ A;  1REC A;  1RTP 1;  4JD9 A;  2WC5 A;  1DF0 B;  2KQY A;  2FJY A;  3AAJ A;  1W7J B;  3DF0 B;  2BNX A;  1C07 A;  2WC6 A;  2M97 A;  1RRO A;  4D1E A;  1OMR A;  4IJ7 A;  4UPG A;  1F70 A;  1EJ3 A;  1CM1 A;  4M2Q A;  1CFP A;  1S1E A;  1ODB A;  1QX2 A;  2KFH A;  1ALW A;  4USL A;  4NQG A;  1GGZ A;  1BLQ A;  1CFF A;  2ERB A;  2KAY A;  3AKB A;  3JTD B;  5ER5 A;  2KDH A;  3SS4 A;  3R72 A;  3R1V A;  2MA2 A;  4C0L A;  3LL8 B;  4M2P A;  2MRD A;  4FQT A;  2IS9 A;  2KHN A;  3KHE A;  1CLL A;  1NWD A;  4CPV A;  2EC6 B;  2GV5 A;  5FI7 A;  2L98 A;  1UHH A;  4PHM A;  2L51 A;  4YGA A;  3S0E A;  1MXL C;  1SY9 A;  1WLZ A;  2LVV A;  3I5G C;  2LAN A;  4M2O A;  4HSZ A;  4KYN A;  1GGW A;  4INW A;  4QJ5 B;  3EKJ A;  3R1O A;  5HKY A;  3VRN A;  1Q80 A;  2LMV A;  1IGV A;  1XK4 A;  4BY5 A;  2H61 A;  5J3X A;  2JUL A;  4PHN A;  2TN4 A;  2HPS A;  3TDU A;  4MRY A;  1SL8 A;  2BAP A;  1Y0V H;  1DC1 A;  1NX0 A;  2ZKM X;  4XJK A;  3F45 A;  3BUM B;  4DRW A;  2NLN A;  3SJS A;  4MN0 A;  1QVI Y;  2PYQ A;  1EXR A;  3FE8 A;  3SG5 A;  2LLS A;  1B7T Y;  3D0Y A;  1LKJ A;  2LP3 A;  1TNP A;  2M9G A;  3SG2 A;  3CR5 X;  3PSR A;  2ZN9 A;  3OB1 B;  2OTG B;  2PAL A;  1A4P A;  3CTN A;  1IG5 A;  4PE4 A;  1K2H A;  2GTE A;  3V2L A;  1FF1 A;  2LCP A;  1CMF A;  3TUY B;  2MBX A;  1IH0 A;  1A75 B;  2WCB A;  2ISD A;  2M0R A;  4PCW A;  3GK4 X;  2LVK A;  1KK8 B;  3FE9 A;  1OE9 B;  3OB2 B;  2WOR A;  1QV0 A;  3PN7 C;  2E30 A;  3PJI A;  1K96 A;  3O6B A;  2JT0 A;  1IKU A;  1QX5 B;  4F7F A;  3TS5 C;  2QEB A;  2L50 A;  1PRW A;  3BQ3 A;  2JPO A;  3LK1 A;  1OMD A;  3LK0 A;  2KYC A;  1YVL A;  1TTX A;  3DYE A;  3B6X A;  1MWN A;  2P70 A;  1KSO A;  2FCE A;  4YI9 A;  3FWC A;  1J7Q A;  4CFR A;  2JOJ A;  1CDM A;  2KBM A;  1CLM A;  1EH2 A;  2OS8 B;  1P28 A;  1XYD A;  1QAS A;  1CTR A;  2AAO A;  3NHI A;  2LLT A;  2MLE C;  1TRF A;  2JXL A;  4OV2 A;  5DKN A;  3EKH A;  2QEH A;  5D3O A;  1WRL A;  1OZS A;  2ZN8 A;  1NP8 A;  5D7F A;  1K95 A;  5I2L A;  1QS7 A;  1UWO A;  2BE4 A;  2QEV A;  5DIC A;  3CAB A;  2F8P A;  1QWV A;  1BR4 B;  2I18 A;  4ICB A;  1F55 A;  3IQO A;  1WRZ A;  3PM8 A;  1K9P A;  1WLM A;  2E6W A;  2PQL A;  3EK7 A;  2A4J A;  1CDP A;  5CSI A;  1OQP A;  5BPJ A;  2LNK A;  1DJX A;  1KK7 Z;  3BUO B;  3D76 A;  5HKZ A;  1JBA A;  2JPT A;  3SIB A;  1KCY A;  2EC6 C;  1XFV O;  2H8V A;  1KFU L;  1XFZ O;  2JNF A;  3O78 A;  1A03 A;  2M1K B;  1EL4 A;  1K8U A;  5AEQ A;  2PRU A;  1OOG A;  2PAS A;  1DJH A;  4OVN F;  3D10 A;  1TIZ A;  4DIR A;  1GQM A;  2LMU A;  5DKQ A;  2EGD A;  1M45 A;  1GM0 A;  3BFH A;  4GPL B; 
#chains in the Genus database with same CATH homology
 4JWQ A;  2BL0 B;  1QIW A;  4MZL A;  2JT3 A;  1WDC B;  2F33 A;  2MHH A;  2NZ0 A;  2WOS A;  3VRP A;  4BY4 A;  4MLW A;  2NCO A;  3BXK A;  4PE1 A;  2WCE A;  1IWQ A;  1KWO C;  1YUR A;  2Q91 A;  2PVB A;  1SRA A;  3DF0 A;  3IQQ A;  3NSI A;  5JJG A;  3LLE A;  2K7C A;  1A2X A;  2L2E A;  3BOW B;  1N65 A;  2NCP A;  4ZCU A;  1F54 A;  3H4S E;  1EG4 A;  1S5G Y;  2M8U A;  4WQ2 A;  1IJ6 A;  1F4O A;  1J55 A;  2GGM A;  3TDZ A;  1FBV A;  1SR6 B;  3DVK A;  3M0W A;  1KFX S;  1K90 D;  1JF0 A;  4U8D A;  5AFP A;  1JFK A;  2K61 A;  2JC2 A;  2KGB C;  1NX1 A;  5PAL A;  2AMI A;  2KI4 B;  2KNE A;  1QIV A;  4Q04 A;  4TNC A;  2DOQ A;  1F71 A;  2HF5 A;  3SIA A;  5GQQ C;  2K8M B;  4QJ4 B;  2LP2 A;  1PK0 D;  1BU3 A;  1SL9 A;  1BR1 B;  2HQ8 A;  5AAN A;  2LVI A;  2I7A A;  1ZOT B;  2Q4U A;  4N1G A;  3I5I C;  1DGV A;  3E3R A;  1UUS A;  1AUI B;  3NSO A;  2SAS A;  2ZRT A;  3PAL A;  1IQ3 A;  1N0Y A;  3K21 A;  4PE0 A;  3O4Y A;  4N5X A;  2L0P A;  1RK9 A;  3DVJ A;  2PSR A;  4MVF A;  2JNX A;  1FI6 A;  1PVA A;  3JVT C;  1SYM A;  2LE9 B;  3WHU B;  1QLS A;  4WRI A;  4QJ3 B;  1LA0 A;  4E68 A;  2KQ6 A;  3GOF A;  1DVI A;  2R2I A;  2L4H A;  1NUB A;  1OSA A;  4XJK B;  4WQ3 A;  1M46 A;  3CS1 A;  2LLU A;  3RLZ A;  1C7V A;  1XO5 A;  1A75 A;  1TCF A;  3PLF B;  4I5K A;  1YUU A;  4I5L B;  3D0Y B;  2M49 B;  1S36 A;  2KYF A;  5JOL A;  3OP0 A;  4MEW A;  4GAO A;  2BCA A;  1QVI Z;  1BOD A;  1BMO A;  1MR8 A;  2JXC A;  3CLN A;  1J7P A;  2LMT A;  1B7T Z;  3IF7 A;  1KQM C;  4IL1 A;  3I5F B;  1S6C A;  1U5I A;  1K9K A;  3VRO A;  3I5H C;  3VRR A;  1WRK A;  2FJU B;  3EK4 A;  2BE6 A;  1SCM B;  2ZRS A;  3OX6 A;  1YRT B;  2JRF A;  4P2Y B;  1MXE A;  1BT6 A;  3VRQ A;  1F4Q A;  4I5N B;  3DVM A;  2BL0 C;  3BUN B;  2H2K A;  5CSN A;  2K2A A;  1YRU B;  2I94 A;  1Y6W A;  2WC8 A;  3EVV A;  1SBJ A;  1YTZ C;  1X02 A;  5D69 A;  3GK1 A;  3NXA A;  5KU1 A;  3FWB A;  1AK8 A;  1R6P A;  1QTX A;  1FW4 A;  2I2R E;  2L4I A;  5AER A;  1HQV A;  1AJ5 A;  1B47 A;  1NSH A;  4P5O E;  1H4B A;  1SPY A;  1BJF A;  2CT9 A;  2LVJ A;  3EVR A;  1QV1 A;  2AUC A;  4GGF C;  1CDN A;  2JTT A;  1B8L A;  3SG3 A;  1RFJ A;  4MBE A;  2BKH B;  2GGZ A;  2JTZ A;  2B1U A;  3JTD C;  1J7R A;  4MSP A;  3SG4 A;  2M29 A;  5HLO A;  2K7D A;  5I2Q A;  1LA3 A;  1B9A A;  2V53 A;  5HKW A;  1IJ5 A;  2RGI A;  4CFQ A;  1JFJ A;  3DVE A;  4C0J A;  5HYD A;  5AXI A;  2F3Z A;  3CR2 A;  2M3W A;  2ZND A;  2BCB A;  2LHI A;  4YGD B;  4DS7 A;  5I2O A;  1KQV A;  1AHR A;  1NX2 A;  2KFG A;  2KI4 C;  4NDC A;  3RM1 A;  1K93 D;  4C0K A;  3ZWH A;  2K7B A;  1WY9 A;  2FOT A;  1NYA A;  4ORA B;  4R1E A;  3KO0 A;  2D8N A;  2JT8 A;  3CWG A;  3EK8 A;  1AJ4 A;  1M63 B;  1MHO A;  3A4U B;  1CDL A;  5CPV A;  1G33 A;  1OMV A;  4XYN A;  4I5J A;  1XFY O;  3MSE B;  1LIN A;  1NPQ A;  2CXJ A;  3KPX A;  4AQI A;  3SG7 A;  3NSL A;  3OX5 A;  4YBH B;  1DF0 A;  1SNL A;  1GJY A;  2OTG C;  4MZK A;  4PHJ A;  4GUK A;  1TNQ A;  4OR9 B;  2CTN A;  4JPZ B;  2HQW A;  3TUY C;  4CID A;  4DCK A;  3HCM A;  1KK8 C;  3OHM B;  4GGF A;  1CMG A;  2LV7 A;  1PAL A;  4PDZ A;  1NCZ A;  5CSF A;  1QJT A;  2BKI B;  2M7N A;  3TDI A;  4YGB B;  1FPW A;  1DJG A;  1J7O A;  3DD4 A;  2EHB A;  1K94 A;  1SKT A;  4GGN A;  1TOP A;  3CGA A;  5G08 A;  3FIA A;  1JF2 A;  3I5F C;  3VGO A;  1UHI A;  1N2D A;  3PFV A;  2KSP A;  2BEC A;  1SCM C;  1OOJ A;  1AP4 A;  4A4C A;  3FS7 A;  3WXA A;  1SL7 A;  1BOC A;  4ORC B;  1C7W A;  2G2B A;  1S5G Z;  1UHN A;  2JZI A;  2KI6 C;  2O5G A;  4GFT A;  1DJZ A;  2OS8 C;  1TCO B;  1MUX A;  1RWY A;  1B1G A;  4ORB B;  2M7L A;  1PSR A;  1TNX A;  1EG3 A;  2JQ6 A;  1CFC A;  1NCY A;  1JUO A;  2KBI A;  1ALV A;  4CLN A;  2MJW B;  1DT7 B;  4FTG A;  1XFW O;  1G8I A;  1SMG A;  2K2F A;  1CB1 A;  1XFU O;  1BF5 A;  1ZFS A;  2Y5I A;  2HET A;  2ZNE A;  1K9U A;  4MZJ A;  2KFF A;  1M39 A;  1SCV A;  2QAC A;  4NDD A;  2L5X B;  1B8C A;  2Y4Q A;  5FYX A;  1CKK A;  5K89 A;  2F2O A;  4PHK A;  1LXF C;  2LC5 A;  2MAZ A;  5KSZ A;  4F0Z B;  2VRG A;  3BUX B;  3CR4 X;  1L2O B;  1IQ5 A;  2LAP A;  3ICB A;  1YUT A;  1HT9 A;  3O2P A;  4GBA A;  4YGC B;  1G4Y R;  4FQO A;  1QXP A;  3A8R A;  1ZUZ A;  1UP5 A;  1S26 D;  1J1D A;  4YGE B;  4YI8 A;  3ZNI A;  5KTY A;  1DMO A;  1YX7 A;  1ZMZ A;  2NXQ A;  1PSB A;  1PUL A;  1FI5 A;  1KWO B;  2F2P A;  2Y1N A;  1D1O A;  1S6J A;  4GNK B;  1S3P A;  2M1U A;  1CFD A;  1KFX L;  2KAX A;  5I8N A;  3CZT X;  1DJY A;  4HRG A;  4L9M A;  2CNP A;  2ZFD A;  1B8R A;  2MLF C;  2O60 A;  3QRX A;  1DTL A;  1NX3 A;  1H8B A;  1KFU S;  1WDC C;  2OPO A;  1XVJ A;  2K0J A;  4A4B A;  2CBL A;  3WNX B;  2LUX A;  1JSA A;  1U5I B;  2COL B;  2FCD A;  1KSM A;  1A29 A;  1QAT A;  1V1F A;  3SG6 A;  2K7O A;  1TN4 A;  3BUW B;  3I5G B;  1QX7 A;  1S6I A;  1Y1A A;  1SW8 A;  2G9B A;  2BBN A;  5ER4 X;  4PE7 A;  4ETO A;  3PAT A;  2QPT A;  1JWD A;  1RJV A;  1J1E A;  1DJW A;  2KI6 D;  2F3Y A;  2LHL A;  3HX4 A;  2KAV A;  2LM5 A;  1XFX O;  2KGR A;  1TNW A;  1SR6 C;  2P6B B;  1KK7 Y;  1YR5 A;  3TZ1 A;  3I5I B;  1BG1 A;  2WND A;  1SK6 D;  1AVS A;  5B8I B;  1Y1X A;  2Y1M A;  4DUQ A;  4OCI A;  4NDB A;  2BBM A;  4JQ0 D;  1XA5 A;  3KF9 A;  5IBW A;  3WHT B;  3GK2 A;  3JVT B;  1MQ1 A;  1UUR A;  4AQJ A;  1VRK A;  4ZCV A;  1JC2 A;  1YX8 A;  1UHJ A;  2LUC A;  4OKH A;  1W7I B;  5CSJ A;  3BYA A;  1OZO A;  5F6T A;  5DKR A;  1CM4 A;  1ZAC A;  3PN7 B;  2CCM A;  2WCF A;  2SCP A;  2BCX A;  2JWW A;  2KOT A;  3C1V A;  5TNC A;  3TS5 B;  3NSK A;  4PAL A;  3KEV A;  1B4C A;  1DJI A;  1QLK A;  1Y1U A;  1L7Z A;  1V1G A;  1KQM B;  3LCP C;  1XK4 C;  1MF8 B;  1CNP A;  2H61 C;  4HRH A;  1CLB A;  3AAK A;  3I5H B;  5HLV A;  4AOM A;  1YVH A;  1DGU A;  1PVB A;  1YUS A;  2PMY A;  1NCX A;  1R2U A;  1UHK A;  1LVC D;  2JU0 A;  1M31 A;  4YRU A;  1E8A A;  3BOW A;  4N1F A;  1L2O C;  3EVU A;  4HRE E;  3AKA A;  1NIW A;  1F8H A;  4MRX A;  1IRJ A;  1REC A;  1RTP 1;  1DF0 B;  2KQY A;  3AAJ A;  1W7J B;  3DF0 B;  1C07 A;  2M97 A;  1RRO A;  4D1E A;  1OMR A;  4UPG A;  1F70 A;  1EJ3 A;  1CM1 A;  4M2Q A;  1CFP A;  1S1E A;  1ODB A;  1QX2 A;  2KFH A;  1ALW A;  4USL A;  4NQG A;  1GGZ A;  1BLQ A;  1CFF A;  2KAY A;  3AKB A;  3JTD B;  5ER5 A;  2KDH A;  2MA2 A;  4C0L A;  3LL8 B;  4M2P A;  2MRD A;  2IS9 A;  2KHN A;  3KHE A;  1CLL A;  1NWD A;  4CPV A;  2EC6 B;  2GV5 A;  2L98 A;  1UHH A;  4PHM A;  2L51 A;  4YGA A;  1MXL C;  1SY9 A;  1WLZ A;  2LVV A;  3I5G C;  2LAN A;  4M2O A;  4HSZ A;  1GGW A;  4QJ5 B;  3EKJ A;  5HKY A;  3VRN A;  1Q80 A;  2LMV A;  1IGV A;  1XK4 A;  4BY5 A;  2H61 A;  5J3X A;  2JUL A;  4PHN A;  2TN4 A;  2HPS A;  3TDU A;  4MRY A;  1SL8 A;  1Y0V H;  1NX0 A;  2ZKM X;  4XJK A;  3F45 A;  3BUM B;  4DRW A;  2NLN A;  3SJS A;  4MN0 A;  1QVI Y;  1EXR A;  3SG5 A;  2LLS A;  1B7T Y;  3D0Y A;  1LKJ A;  2LP3 A;  1TNP A;  2M9G A;  3SG2 A;  3CR5 X;  3PSR A;  2ZN9 A;  3OB1 B;  2OTG B;  2PAL A;  1A4P A;  3CTN A;  1IG5 A;  4PE4 A;  1K2H A;  1FF1 A;  2LCP A;  1CMF A;  3TUY B;  2MBX A;  1IH0 A;  1A75 B;  2WCB A;  2ISD A;  2M0R A;  4PCW A;  3GK4 X;  2LVK A;  1KK8 B;  1OE9 B;  3OB2 B;  2WOR A;  1QV0 A;  3PN7 C;  2E30 A;  1K96 A;  3O6B A;  2JT0 A;  1IKU A;  1QX5 B;  3TS5 C;  2L50 A;  1PRW A;  3BQ3 A;  3LK1 A;  1OMD A;  3LK0 A;  2KYC A;  1YVL A;  1TTX A;  1MWN A;  1KSO A;  2FCE A;  4YI9 A;  3FWC A;  1J7Q A;  4CFR A;  2JOJ A;  1CDM A;  2KBM A;  1CLM A;  1EH2 A;  2OS8 B;  1XYD A;  1QAS A;  1CTR A;  2AAO A;  2LLT A;  2MLE C;  1TRF A;  2JXL A;  4OV2 A;  5DKN A;  3EKH A;  1WRL A;  1OZS A;  2ZN8 A;  1NP8 A;  5D7F A;  1K95 A;  5I2L A;  1QS7 A;  1UWO A;  2BE4 A;  2F8P A;  1BR4 B;  2I18 A;  4ICB A;  1F55 A;  3IQO A;  1WRZ A;  3PM8 A;  1K9P A;  1WLM A;  2E6W A;  3EK7 A;  2A4J A;  1CDP A;  5CSI A;  1OQP A;  5BPJ A;  2LNK A;  1DJX A;  1KK7 Z;  3BUO B;  5HKZ A;  1JBA A;  2JPT A;  3SIB A;  1KCY A;  2EC6 C;  1XFV O;  1KFU L;  1XFZ O;  2JNF A;  3O78 A;  1A03 A;  2M1K B;  1EL4 A;  1K8U A;  5AEQ A;  2PRU A;  2PAS A;  4OVN F;  1DJH A;  3D10 A;  1TIZ A;  4DIR A;  1GQM A;  2LMU A;  5DKQ A;  2EGD A;  1M45 A;  4GPL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...