1YUSA

Solution structure of apo-s100a13
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
b'MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yusA00
1OMRA 1YVHA 1MXEA 3LK1A 1WLMA 2KI4C 3VRQA 3PSRA 1SKTA 5JOLA 3WNXB 5HKWA 1B4CA 2M7NA 1XK4C 3E3RA 2Y4QA 1PVAA 2LE9B 4M2PA 2CXJA 2KFHA 1J7QA 1M31A 2M7LA 4MN0A 1QX5B 1GGWA 1S6CA 1TOPA 5K89A 1UHHA 4MLWA 1NP8A 4U8DA 1K9PA 5D69A 2Y5IA 1SBJA 1HQVA 1JWDA 1YRUB 4PE4A 1KQVA 1AJ5A 1ALWA 3OB2B 1Y0VH 1CFCA 4PHJA 3NSIA 5HYDA 3EVUA 3C1VA 2M97A 1A75A 3ZNIA 1J1DA 3VRPA 3CGAA 2SASA 4AQIA 2FCDA 1SL7A 1NX0A 2EC6B 3OP0A 4YRUA 2KFFA 2MHHA 5CSFA 1DF0A 1KK8B 1H4BA 2L98A 2BCBA 2KOTA 1QX2A 1AP4A 1U5IB 2KHNA 4CFRA 1OMVA 1OZSA 1KK7Z 2TN4A 4ORCB 2JU0A 3CR4X 2ISDA 3EKHA 5ER5A 2KSPA 1DT7B 1S1EA 2EC6C 4D1EA 1UHJA 4DRWA 1B47A 2KQYA 2LAPA 2KQ6A 2PASA 4Q04A 1CMGA 4PE0A 1SR6C 1OQPA 3LK0A 1CFFA 1IJ6A 2KFGA 4I5JA 1TNQA 2KDHA 4OCIA 2JQ6A 1RFJA 2JXCA 1SRAA 2LVJA 2PRUA 1A4PA 1CDLA 2JRFA 1OSAA 1TCOB 2GGZA 2BCXA 1F54A 1NPQA 2ZN8A 3EVRA 1K9UA 4AQJA 3PN7B 4PE1A 1AK8A 1MR8A 1IH0A 3BUNB 2LP2A 3BUXB 1YVLA 2DOQA 3O6BA 1DJWA 2K61A 2MRDA 2BE6A 4PHNA 2LVKA 4GGFC 4GUKA 2LP3A 1TIZA 4M2OA 3I5GB 1RTP1 4MEWA 4GAOA 1YTZC 1Y1XA 1CDNA 2JT8A 5DKRA 2QACA 4N5XA 1LKJA 3BUWB 2M0RA 5GQQC 2KBMA 1PALA 2FJUB 5B8IB 2JZIA 1LVCD 3M0WA 4NDCA 1UWOA 2CNPA 2HETA 1YX8A 3I5GC 4YGAA 2I2RE 1Y1UA 1U5IA 2L5XB 1UUSA 5D7FA 2PSRA 4CLNA 1JF0A 4GGNA 1CFPA 2OS8B 4JPZB 2H61A 2OTGB 1X02A 1XFXO 1F55A 5KTYA 3IQQA 2QPTA 5IBWA 1MQ1A 3AKBA 3O2PA 4PE7A 4ICBA 3DVMA 4MZKA 1M63B 2ZN9A 4C0JA 1JUOA 2JULA 1BOCA 1AHRA 4I5LB 2I94A 1DGVA 2CT9A 2D8NA 2AMIA 2LCPA 3DVKA 1NIWA 2OTGC 1QXPA 4ZCUA 1BMOA 1B7TZ 2M49B 3SIAA 4YGEB 5BPJA 1B9AA 1KFXL 4NDDA 1ODBA 1CB1A 2K8MB 3QRXA 1KWOB 1GJYA 4BY5A 2PVBA 1RROA 3IF7A 4JQ0D 2JOJA 1OMDA 3CS1A 1CLBA 2L4IA 2BE4A 2JNXA 1BJFA 4HREE 4MVFA 2O5GA 3LCPC 2E30A 1SNLA 1WDCB 1CLMA 1EG4A 2JPTA 1C7VA 1WY9A 4I5NB 1L2OB 2LM5A 3JVTB 1LXFC 4GFTA 3FIAA 3KPXA 4YGCB 2HQ8A 1S26D 1XVJA 1WRLA 1SL8A 1YR5A 1HT9A 1CFDA 2M1UA 1IQ3A 1JC2A 2G2BA 1NX1A 5HLOA 3I5IB 4R1EA 1C7WA 2BKHB 4XJKB 3KO0A 4DUQA 2NZ0A 1FI5A 5I2OA 1GGZA 2KBIA 1QLKA 1FBVA 1J7OA 2KYCA 2P6BB 1AVSA 4CFQA 1CTRA 1BG1A 4ORBB 1FPWA 5AFPA 2FCEA 4OVNF 1CM1A 1CDMA 4MZLA 4PCWA 2L2EA 1NX3A 1LA0A 1B8LA 1PSRA 1YUTA 1OE9B 1ZFSA 3A4UB 3TS5B 2KAXA 1L7ZA 3DVEA 1IQ5A 3PLFB 1YURA 1XFYO 1BLQA 3TDUA 4YGDB 1AUIB 5KSZA 1DMOA 3LLEA 1SMGA 2PALA 4MZJA 5CSJA 2LVVA 2LLUA 3I5HB 5F6TA 5TNCA 1NCZA 3CR5X 4MRYA 1F4OA 1CKKA 2COLB 2MAZA 1N2DA 2BBNA 2KI6D 4HRHA 3ZWHA 1QIWA 1KSMA 1SYMA 1S3PA 4ETOA 1J7RA 1M46A 1R2UA 2NCPA 2K7DA 4QJ3B 1V1FA 1SCMB 2JNFA 1NSHA 1PULA 2K2AA 1KSOA 1S5GY 2L4HA 1KK8C 1YUUA 2WCEA 1QLSA 1J1EA 1ZOTB 4GBAA 4N1GA 3TDIA 4YGBB 1F70A 3EVVA 3RLZA 2BL0B 1CNPA 4HRGA 1NCXA 1QASA 3DF0B 3TUYB 4L9MA 1OZOA 1JFJA 1MXLC 4M2QA 2H61C 3K21A 2FOTA 3BQ3A 1NYAA 5JJGA 1M45A 2MA2A 3NSLA 1LA3A 1ZMZA 3GK4X 3DD4A 1DJXA 1EH2A 1F4QA 3PATA 4MRXA 3WHTB 4A4BA 2JTTA 3PFVA 2KGBC 1QVIY 2GV5A 4XJKA 1MWNA 5CSIA 1QJTA 1YX7A 3IQOA 1ALVA 1G4YR 3EK4A 4HSZA 1LINA 2NCOA 2M3WA 1EXRA 1IWQA 1QX7A 2F3ZA 2I18A 4YI9A 3GK1A 1S6JA 4P5OE 2LMVA 2WCBA 1K94A 5ER4X 3PN7C 1W7IB 1MUXA 1KFUL 1Y6WA 4WQ2A 1UHIA 1DJYA 1NWDA 4C0LA 3FWCA 2WNDA 3VRRA 4MBEA 2HPSA 1VRKA 2LUCA 2F8PA 1S36A 1PVBA 3PALA 4IL1A 5HKZA 1BR4B 3BUMB 4QJ4B 1G33A 2LC5A 2VRGA 3EKJA 4GPLB 2AUCA 1FW4A 3BUOB 2CTNA 2LMTA 4A4CA 2KGRA 4MSPA 3GOFA 4F0ZB 2KI6C 1C07A 1TNXA 4N1FA 2LANA 3WXAA 2Q91A 3RM1A 1IJ5A 2HF5A 4ZCVA 1BODA 5HKYA 1TRFA 3DF0A 1JBAA 3TZ1A 2OS8C 1QIVA 1N0YA 4QJ5B 2M1KB 2F2OA 1EL4A 5AERA 5DKQA 2BECA 1K93D 3O4YA 1F71A 5I8NA 3D0YB 2JWWA 1R6PA 2ZRTA 4OKHA 1PK0D 4WRIA 1FI6A 2ZFDA 4AOMA 1K96A 4CIDA 1A03A 1E8AA 1YRTB 2E6WA 1RWYA 2EHBA 1XFWO 1K9KA 1CDPA 1KFXS 1ZUZA 5PALA 2A4JA 1DJZA 1NX2A 2JT3A 4PHMA 1DTLA 4TNCA 1CM4A 2JT0A 2RGIA 2ZNDA 4PDZA 1K95A 3VROA 1KWOC 2M29A 1UP5A 4JWQA 1YUSA 2Q4UA 4DIRA 1UHKA 4OV2A 3SG6A 2KI4B 1PSBA 1WDCC 2WC8A 2H2KA 3GK2A 3DVJA 1L2OC 3JVTC 5CSNA 1MHOA 2WCFA 3CZTX 3SIBA 3NXAA 3OHMB 1PRWA 1QS7A 1UHNA 1SPYA 2KYFA 4FTGA 1DGUA 2BBMA 1MF8B 1N65A 1SW8A 3I5IC 5DKNA 1TNPA 3SG3A 2KAVA 2MBXA 1SY9A 3HX4A 1B8RA 2F2PA 3AAKA 3O78A 1TNWA 4USLA 2JC2A 2LMUA 2PMYA 3AKAA 3VGOA 4PALA 1TTXA 2LHLA 2L51A 1QV0A 1JFKA 4E68A 4NDBA 2K7CA 3TS5C 3TDZA 2WORA 1WRKA 5HLVA 1OOJA 1DVIA 2LNKA 1EG3A 4DS7A 3OB1B 3D0YA 1XFZO 2LLSA 1CLLA 1KK7Y 4P2YB 1JSAA 3I5HC 1KCYA 1GQMA 1RK9A 1XO5A 2SCPA 3BOWB 4WQ3A 2CCMA 2R2IA 2HQWA 2LVIA 1EJ3A 1RJVA 3PM8A 2ZKMX 1JF2A 3NSOA 1IG5A 2NLNA 2ZNEA 1SCMC 4XYNA 5I2LA 5FYXA 1Q80A 5AANA 1SR6B 2B1UA 3SG4A 1S5GZ 1NUBA 3SJSA 1M39A 1XFVO 1BR1B 3KHEA 2BL0C 3LL8B 1TCFA 3TUYC 1XK4A 1WLZA 2JXLA 1SK6D 1IRJA 2Y1NA 1RECA 1B8CA 2JTZA 3WHUB 2LLTA 5I2QA 2Y1MA 1F8HA 3FWBA 1D1OA 1FF1A 1DJGA 4UPGA 1QV1A 3H4SE 2OPOA 2K7OA 1Y1AA 2EGDA 2K0JA 2BKIB 2M8UA 2K7BA 2LHIA 1QVIZ 3F45A 2BCAA 1K90D 4GNKB 1IGVA 1BU3A 5CPVA 2L0PA 3VRNA 3NSKA 2WOSA 3MSEB 1KFUS 1G8IA 3ICBA 2F33A 3SG2A 3CLNA 2AAOA 2MLEC 1QATA 3CR2A 4BY4A 2ZRSA 2LUXA 3EK7A 1CMFA 2M9GA 2MJWB 2L50A 1DJHA 1V1GA 1W7JB 3BOWA 1XFUO 2MLFC 1K8UA 3CWGA 1ZACA 2O60A 4I5KA 4DCKA 1WRZA 4OR9B 4PHKA 2KAYA 1B1GA 1AJ4A 4NQGA 3A8RA 4YI8A 1IKUA 2IS9A 3I5FB 1SCVA 1NCYA 1S6IA 4YBHB 1A29A 3OX6A 2NXQA 1B7TY 3EK8A 1A75B 1KQMB 1K2HA 2GGMA 3JTDB 2KNEA 3I5FC 3SG7A 5KU1A 2I7AA 3D10A 2F3YA 3CTNA 3KEVA 1DF0B 5J3XA 2CBLA 4ORAB 3OX5A 1H8BA 1KQMC 5G08A 2K2FA 5AXIA 1J55A 3JTDC 4FQOA 4GGFA 2LV7A 3HCMA 2V53A 1QTXA 1XA5A 4C0KA 1UURA 3AAJA 3SG5A 1DJIA 1SL9A 1BF5A 3KF9A 3BXKA 1J7PA 5AEQA 1BT6A 1TN4A 3FS7A 3BYAA 1XYDA 2G9BA 4CPVA 1A2XA
chains in the Genus database with same CATH superfamily
1OMRA 3IVTA 1YVHA 1MXEA 3LK1A 3D78A 1WLMA 2KI4C 3VRQA 3PSRA 1SKTA 5JOLA 3WNXB 5HKWA 1B4CA 2M7NA 1XK4C 3E3RA 2Y4QA 1PVAA 2LE9B 4M2PA 2CXJA 3N7HA 2KFHA 1J7QA 1M31A 2M7LA 4MN0A 1QX5B 1GGWA 4JD9A 1S6CA 1TOPA 1ORGA 5K89A 1UHHA 4MLWA 1NP8A 4U8DA 3SS3A 1K9PA 5D69A 2Y5IA 1SBJA 3BFBA 1HQVA 2FJYA 1JWDA 1YRUB 2KLDA 4PE4A 1KQVA 1AJ5A 1ALWA 3L4AA 3OB2B 1Y0VH 1CFCA 4PHJA 1OOHA 3NSIA 5HYDA 3EVUA 3C1VA 2M97A 1A75A 3ZNIA 3UO9A 1J1DA 3VRPA 3CGAA 2SASA 4AQIA 2FCDA 1SL7A 1NX0A 2EC6B 3OP0A 4YRUA 2KFFA 2MHHA 5CSFA 1DF0A 1KK8B 3V2LA 1H4BA 2L98A 2BCBA 2KOTA 1QX2A 1AP4A 1U5IB 2KHNA 4CFRA 1OMVA 1OZSA 1KK7Z 2TN4A 1DC1A 4ORCB 2JU0A 3CR4X 2ISDA 3EKHA 5ER5A 2KSPA 1DT7B 1S1EA 2EC6C 4D1EA 1UHJA 4DRWA 1B47A 2KQYA 2LAPA 3NHIA 2KQ6A 2PASA 4Q04A 1CMGA 3UNWA 4PE0A 1SR6C 1OQPA 3LK0A 1CFFA 1Z4HA 1IJ6A 2KFGA 4I5JA 1OOIX 1TNQA 2KDHA 3S0GA 3CDNA 4OCIA 2JQ6A 1RFJA 2JXCA 1SRAA 2LVJA 2PRUA 1A4PA 1CDLA 2JRFA 1OSAA 1TCOB 2GGZA 2BCXA 1F54A 1NPQA 2ZN8A 3EVRA 1K9UA 4AQJA 2WCMA 2PQLA 3PN7B 4PE1A 1AK8A 1MR8A 1IH0A 3BUNB 3L4LA 2LP2A 3BUXB 1YVLA 2DOQA 3O6BA 1DJWA 2K61A 2MRDA 2BE6A 3FE6A 4PHNA 2LVKA 2P71A 4GGFC 3R72A 4GUKA 2LP3A 1TIZA 4M2OA 3I5GB 2WCLA 3RZSA 1RTP1 4MEWA 4GAOA 1YTZC 1Y1XA 1CDNA 2JT8A 5DKRA 3FE8A 2QACA 4N5XA 1LKJA 3BUWB 4FQTA 2M0RA 5GQQC 2KBMA 1PALA 2FJUB 5B8IB 2JZIA 1LVCD 3CZ0A 3EG5B 3M0WA 4NDCA 1UWOA 2CNPA 2HETA 1YX8A 3I5GC 4YGAA 2I2RE 1Y1UA 1U5IA 2L5XB 1UUSA 5D7FA 4IJ7A 2PSRA 4CLNA 1JF0A 4GGNA 4INWA 1CFPA 2OS8B 1W9ZA 4JPZB 2H61A 2OTGB 1X02A 1XFXO 1F55A 5KTYA 1Z2CB 2QPTA 3IQQA 5IBWA 1MQ1A 3AKBA 3O2PA 4PE7A 4ICBA 3DVMA 4MZKA 1M63B 2ZN9A 4C0JA 1JUOA 2JULA 1BOCA 1AHRA 4I5LB 2I94A 1DGVA 2CT9A 2D8NA 2AMIA 2LCPA 3DVKA 1NIWA 2OTGC 1QXPA 4ZCUA 2K60A 1BMOA 1B7TZ 2M49B 3SIAA 4YGEB 5BPJA 1B9AA 1KFXL 4NDDA 3D77A 1ODBA 1CB1A 2K8MB 3QRXA 2WCHA 1KWOB 1GJYA 1TWOA 4BY5A 5D3OA 2PVBA 1OW4A 1RROA 3IF7A 4JQ0D 2JOJA 1OMDA 3CS1A 2WCKA 4JKTA 1CLBA 2L4IA 2BE4A 2JNXA 1BJFA 4HREE 3B6XA 4MVFA 2O5GA 3LCPC 2E30A 1SNLA 1WDCB 1CLMA 1EG4A 2JPTA 1C7VA 1WY9A 4I5NB 1L2OB 2LM5A 3JVTB 1LXFC 4GFTA 3FIAA 3KPXA 4YGCB 2HQ8A 1S26D 1XVJA 1WRLA 3B87A 1SL8A 1YR5A 1HT9A 1CFDA 2M1UA 1IQ3A 1JC2A 2G2BA 1NX1A 5HLOA 3I5IB 4R1EA 1C7WA 2BKHB 4XJKB 3KO0A 5HL1A 1C3ZA 4DUQA 2NZ0A 1FI5A 5I2OA 1GGZA 2KBIA 1QLKA 1FBVA 1J7OA 1TUJA 4INXA 2KYCA 1P28A 2P6BB 1AVSA 4CFQA 1CTRA 1BG1A 4ORBB 1FPWA 5AFPA 2FCEA 4OVNF 1CM1A 1CDMA 4MZLA 4PCWA 2L2EA 1NX3A 1LA0A 1B8LA 1PSRA 1YUTA 1OE9B 1ZFSA 2P70A 3A4UB 3TS5B 2KAXA 1L7ZA 3DVEA 1IQ5A 3PLFB 1YURA 1XFYO 1BLQA 3TDUA 4YGDB 1AUIB 5KSZA 4F7FA 3BFHA 2GTEA 3LLEA 1DMOA 1SMGA 2PALA 4MZJA 3OBVA 2KLEA 2LVVA 5CSJA 2LLUA 3I5HB 5F6TA 5TNCA 1NCZA 3CR5X 4MRYA 1F4OA 1CKKA 2COLB 2WC5A 2MAZA 1N2DA 2BBNA 2KI6D 3NHTA 4HRHA 3ZWHA 1QIWA 3L47A 1KSMA 1DEKA 1SYMA 1S3PA 4ETOA 1J7RA 1M46A 1R2UA 2NCPA 2K7DA 4QJ3B 1V1FA 1SCMB 2JNFA 1NSHA 1PULA 2K2AA 1KSOA 1S5GY 2L4HA 1KK8C 1YUUA 2WCEA 1QLSA 1J1EA 1ZOTB 4GBAA 4N1GA 3TDIA 3CZ2A 4YGBB 1F70A 3EVVA 3RLZA 2BL0B 3D75A 1CNPA 4HRGA 1NCXA 1QASA 3DF0B 3OGNA 4L9MA 3TUYB 1OZOA 1JFJA 1MXLC 4M2QA 2H61C 3K21A 2FOTA 3BQ3A 1NYAA 5JJGA 1M45A 3R1PA 2MA2A 3NSLA 1LA3A 1ZMZA 3GK4X 3DD4A 1DJXA 1EH2A 1F4QA 3PATA 4MRXA 3WHTB 4A4BA 2JTTA 1DELA 3PFVA 2KGBC 1QVIY 2GV5A 4XJKA 1MWNA 5CSIA 1QJTA 1YX7A 3IQOA 3S0DA 1ALVA 1G4YR 3EK4A 4HSZA 1LINA 2NCOA 2M3WA 1EXRA 1IWQA 1QX7A 2F3ZA 2I18A 4YI9A 3GK1A 1S6JA 4P5OE 2LMVA 3DZTA 4PT1A 2WCBA 1K94A 5ER4X 3PN7C 1W7IB 1MUXA 2QEVA 1KFUL 1Y6WA 4WQ2A 1UHIA 1DJYA 1NWDA 3NGVA 4C0LA 3FWCA 2WNDA 5FI7A 3VRRA 4MBEA 3B86A 3SS4A 2HPSA 1VRKA 2LUCA 2F8PA 1S36A 1PVBA 3PALA 3DY9A 4IL1A 5HKZA 1BR4B 5EL2A 3BUMB 4QJ4B 1G33A 2LC5A 2VRGA 3EKJA 4GPLB 2AUCA 4KYNA 1FW4A 3BFAA 3BUOB 2CTNA 2LMTA 4A4CA 2KGRA 2L2CA 4MSPA 3GOFA 4F0ZB 2KI6C 2QDIA 1C07A 1TNXA 4N1FA 2LANA 3WXAA 2Q91A 2QEOA 3RM1A 1IJ5A 5FI2A 2HF5A 3S0AA 4ZCVA 1BODA 1T14A 5HKYA 1TRFA 3DF0A 1JBAA 3TZ1A 2OS8C 1QIVA 1N0YA 3PJIA 4QJ5B 2WCJA 2M1KB 2F2OA 1EL4A 5AERA 5DKQA 2BECA 1K93D 3O4YA 1F71A 5I8NA 3D0YB 2JWWA 1R6PA 2ZRTA 4OKHA 1PK0D 4WRIA 1FI6A 2ZFDA 4AOMA 1K96A 4CIDA 5DICA 1E8AA 1A03A 1YRTB 2E6WA 1RWYA 2EHBA 1XFWO 1K9KA 1CDPA 1KFXS 1ZUZA 5PALA 2A4JA 1DJZA 1NX2A 2JT3A 4PHMA 1DTLA 4TNCA 1CM4A 2JT0A 2RGIA 2ZNDA 4PDZA 1K95A 3VROA 1KWOC 2M29A 1UP5A 4JWQA 1YUSA 2Q4UA 4DIRA 1UHKA 4OV2A 3SG6A 1IIOA 3S0BA 2KI4B 1GM0A 2BNXA 1PSBA 1WDCC 2WC8A 2H2KA 3GK2A 3DVJA 3K1EA 1L2OC 3JVTC 5CSNA 1MHOA 2WCFA 3CZTX 3SIBA 2YGUA 3NXAA 3OHMB 1PRWA 1UHNA 1QS7A 1SPYA 2KYFA 4FTGA 2BAPA 1DGUA 2BBMA 1MF8B 1N65A 1SW8A 3I5IC 5DKNA 1TNPA 3SG3A 2KAVA 2MBXA 1SY9A 3HX4A 1B8RA 2F2PA 3AAKA 3O78A 1TNWA 3Q8IA 4USLA 5I94A 2JC2A 2LMUA 2PMYA 3AKAA 3VGOA 4PALA 3S0EA 1TTXA 2LHLA 2L51A 1QV0A 3BJHA 1JFKA 4E68A 4NDBA 2K7CA 3TS5C 3TDZA 2WORA 1WRKA 5HLVA 1OOJA 1DVIA 2LNKA 1EG3A 3O4XA 4DS7A 3OB1B 3D0YA 3D76A 1XFZO 2LLSA 1CLLA 1KK7Y 4P2YB 5FI6A 1JSAA 3I5HC 1KCYA 1GQMA 1RK9A 1XO5A 2SCPA 3BOWB 4WQ3A 2CCMA 2R2IA 2QEHA 2HQWA 2LVIA 1EJ3A 1RJVA 3DXLA 3PM8A 2ZKMX 3R1OA 1JF2A 3NSOA 1IG5A 2NLNA 2ZNEA 1SCMC 4XYNA 5I2LA 5FYXA 1Q80A 5AANA 1SR6B 2B1UA 3SG4A 1S5GZ 1NUBA 3SJSA 1M39A 1XFVO 1BR1B 3KHEA 2BL0C 3CABA 3LL8B 1TCFA 3TUYC 1XK4A 1WLZA 2JXLA 1SK6D 1IRJA 2Y1NA 1RECA 1B8CA 2JTZA 3WHUB 2LLTA 5I2QA 2Y1MA 1F8HA 3FWBA 1D1OA 1FF1A 1DJGA 4UPGA 1OOGA 1QV1A 3H4SE 2OPOA 2K7OA 1Y1AA 2EGDA 2K0JA 2BKIB 2M8UA 2K7BA 2LHIA 1QVIZ 2QEBA 3F45A 2BCAA 1K90D 4GNKB 1IGVA 1BU3A 5CPVA 2KPHA 2L0PA 3VRNA 3NSKA 2WOSA 2H8VA 3MSEB 1KFUS 1G8IA 3ICBA 2PYQA 2F33A 3SG2A 3CLNA 2WC6A 2AAOA 2MLEC 2L5YA 3SS5A 1QATA 3CR2A 4BY4A 2ZRSA 2LUXA 3EK7A 2JPOA 2M9GA 1CMFA 2MJWB 2L50A 1C3YA 1DJHA 1V1GA 1W7JB 3BOWA 1XFUO 2MLFC 1K8UA 3CWGA 1ZACA 2O60A 4I5KA 4DCKA 1WRZA 3QMEA 4OR9B 4PHKA 2KAYA 1B1GA 1AJ4A 4NQGA 3A8RA 3B88A 4YI8A 3CYZA 3VB1A 1IKUA 1TUZA 2IS9A 3I5FB 1SCVA 1NCYA 1S6IA 4YBHB 1A29A 3DYEA 3OX6A 2NXQA 3PM2A 1B7TY 3EK8A 1SSEB 3D74A 1A75B 1KQMB 1XFRA 1K2HA 2GGMA 3JTDB 2KNEA 3R1VA 3CZ1A 3I5FC 3SG7A 5KU1A 2I7AA 3D10A 2F3YA 3CTNA 3KEVA 1DF0B 5J3XA 1OOFA 2CBLA 3FE9A 3OX5A 4ORAB 1H8BA 1KQMC 2ERBA 5G08A 2K2FA 5AXIA 1DQEA 1LS8A 1J55A 3JTDC 3S0FA 4FQOA 4GGFA 4OZDA 2LV7A 3HCMA 2V53A 1QTXA 1XA5A 4C0KA 1UURA 3AAJA 3SG5A 1DJIA 1SL9A 1BF5A 1QWVA 3D73A 3BXKA 3KF9A 1J7PA 5AEQA 1BT6A 1TN4A 3FS7A 3B7AA 3BYAA 1XYDA 2G9BA 4CPVA 1A2XA
chains in the Genus database with same CATH topology
1OMRA 1YVHA 1MXEA 3LK1A 1WLMA 2KI4C 3VRQA 3PSRA 1SKTA 5JOLA 3WNXB 5HKWA 1B4CA 2M7NA 1XK4C 3E3RA 2Y4QA 1PVAA 2LE9B 4M2PA 2CXJA 2KFHA 1J7QA 1M31A 2M7LA 4MN0A 1QX5B 1GGWA 1S6CA 1TOPA 5K89A 1UHHA 4MLWA 1NP8A 4U8DA 1K9PA 5D69A 2Y5IA 1SBJA 1HQVA 1JWDA 1YRUB 4PE4A 1KQVA 1AJ5A 1ALWA 3OB2B 1Y0VH 1CFCA 4PHJA 3NSIA 5HYDA 3EVUA 3C1VA 2M97A 1A75A 3ZNIA 1J1DA 3VRPA 3CGAA 2SASA 4AQIA 2FCDA 1SL7A 1NX0A 2EC6B 3OP0A 4YRUA 2KFFA 2MHHA 5CSFA 1DF0A 1KK8B 1H4BA 2L98A 2BCBA 2KOTA 1QX2A 1AP4A 1U5IB 2KHNA 4CFRA 1OMVA 1OZSA 1KK7Z 2TN4A 4ORCB 2JU0A 3CR4X 2ISDA 3EKHA 5ER5A 2KSPA 1DT7B 1S1EA 2EC6C 4D1EA 1UHJA 4DRWA 1B47A 2KQYA 2LAPA 2KQ6A 2PASA 4Q04A 1CMGA 4PE0A 1SR6C 1OQPA 3LK0A 1CFFA 1IJ6A 2KFGA 4I5JA 1TNQA 2KDHA 4OCIA 2JQ6A 1RFJA 2JXCA 1SRAA 2LVJA 2PRUA 1A4PA 1CDLA 2JRFA 1OSAA 1TCOB 2GGZA 2BCXA 1F54A 1NPQA 2ZN8A 3EVRA 1K9UA 4AQJA 3PN7B 4PE1A 1AK8A 1MR8A 1IH0A 3BUNB 2LP2A 3BUXB 1YVLA 2DOQA 3O6BA 1DJWA 2K61A 2MRDA 2BE6A 4PHNA 2LVKA 4GGFC 4GUKA 2LP3A 1TIZA 4M2OA 3I5GB 1RTP1 4MEWA 4GAOA 1YTZC 1Y1XA 1CDNA 2JT8A 5DKRA 2QACA 4N5XA 1LKJA 3BUWB 2M0RA 5GQQC 2KBMA 1PALA 2FJUB 5B8IB 2JZIA 1LVCD 3M0WA 4NDCA 1UWOA 2CNPA 2HETA 1YX8A 3I5GC 4YGAA 2I2RE 1Y1UA 1U5IA 2L5XB 1UUSA 5D7FA 2PSRA 4CLNA 1JF0A 4GGNA 1CFPA 2OS8B 4JPZB 2H61A 2OTGB 1X02A 1XFXO 1F55A 5KTYA 3IQQA 2QPTA 5IBWA 1MQ1A 3AKBA 3O2PA 4PE7A 4ICBA 3DVMA 4MZKA 1M63B 2ZN9A 4C0JA 1JUOA 2JULA 1BOCA 1AHRA 4I5LB 2I94A 1DGVA 2CT9A 2D8NA 2AMIA 2LCPA 3DVKA 1NIWA 2OTGC 1QXPA 4ZCUA 1BMOA 1B7TZ 2M49B 3SIAA 4YGEB 5BPJA 1B9AA 1KFXL 4NDDA 1ODBA 1CB1A 2K8MB 3QRXA 1KWOB 1GJYA 4BY5A 2PVBA 1RROA 3IF7A 4JQ0D 2JOJA 1OMDA 3CS1A 1CLBA 2L4IA 2BE4A 2JNXA 1BJFA 4HREE 4MVFA 2O5GA 3LCPC 2E30A 1SNLA 1WDCB 1CLMA 1EG4A 2JPTA 1C7VA 1WY9A 4I5NB 1L2OB 2LM5A 3JVTB 1LXFC 4GFTA 3FIAA 3KPXA 4YGCB 2HQ8A 1S26D 1XVJA 1WRLA 1SL8A 1YR5A 1HT9A 1CFDA 2M1UA 1IQ3A 1JC2A 2G2BA 1NX1A 5HLOA 3I5IB 4R1EA 1C7WA 2BKHB 4XJKB 3KO0A 4DUQA 2NZ0A 1FI5A 5I2OA 1GGZA 2KBIA 1QLKA 1FBVA 1J7OA 2KYCA 2P6BB 1AVSA 4CFQA 1CTRA 1BG1A 4ORBB 1FPWA 5AFPA 2FCEA 4OVNF 1CM1A 1CDMA 4MZLA 4PCWA 2L2EA 1NX3A 1LA0A 1B8LA 1PSRA 1YUTA 1OE9B 1ZFSA 3A4UB 3TS5B 2KAXA 1L7ZA 3DVEA 1IQ5A 3PLFB 1YURA 1XFYO 1BLQA 3TDUA 4YGDB 1AUIB 5KSZA 1DMOA 3LLEA 1SMGA 2PALA 4MZJA 5CSJA 2LVVA 2LLUA 3I5HB 5F6TA 5TNCA 1NCZA 3CR5X 4MRYA 1F4OA 1CKKA 2COLB 2MAZA 1N2DA 2BBNA 2KI6D 4HRHA 3ZWHA 1QIWA 1KSMA 1SYMA 1S3PA 4ETOA 1J7RA 1M46A 1R2UA 2NCPA 2K7DA 4QJ3B 1V1FA 1SCMB 2JNFA 1NSHA 1PULA 2K2AA 1KSOA 1S5GY 2L4HA 1KK8C 1YUUA 2WCEA 1QLSA 1J1EA 1ZOTB 4GBAA 4N1GA 3TDIA 4YGBB 1F70A 3EVVA 3RLZA 2BL0B 1CNPA 4HRGA 1NCXA 1QASA 3DF0B 3TUYB 4L9MA 1OZOA 1JFJA 1MXLC 4M2QA 2H61C 3K21A 2FOTA 3BQ3A 1NYAA 5JJGA 1M45A 2MA2A 3NSLA 1LA3A 1ZMZA 3GK4X 3DD4A 1DJXA 1EH2A 1F4QA 3PATA 4MRXA 3WHTB 4A4BA 2JTTA 3PFVA 2KGBC 1QVIY 2GV5A 4XJKA 1MWNA 5CSIA 1QJTA 1YX7A 3IQOA 1ALVA 1G4YR 3EK4A 4HSZA 1LINA 2NCOA 2M3WA 1EXRA 1IWQA 1QX7A 2F3ZA 2I18A 4YI9A 3GK1A 1S6JA 4P5OE 2LMVA 2WCBA 1K94A 5ER4X 3PN7C 1W7IB 1MUXA 1KFUL 1Y6WA 4WQ2A 1UHIA 1DJYA 1NWDA 4C0LA 3FWCA 2WNDA 3VRRA 4MBEA 2HPSA 1VRKA 2LUCA 2F8PA 1S36A 1PVBA 3PALA 4IL1A 5HKZA 1BR4B 3BUMB 4QJ4B 1G33A 2LC5A 2VRGA 3EKJA 4GPLB 2AUCA 1FW4A 3BUOB 2CTNA 2LMTA 4A4CA 2KGRA 4MSPA 3GOFA 4F0ZB 2KI6C 1C07A 1TNXA 4N1FA 2LANA 3WXAA 2Q91A 3RM1A 1IJ5A 2HF5A 4ZCVA 1BODA 5HKYA 1TRFA 3DF0A 1JBAA 3TZ1A 2OS8C 1QIVA 1N0YA 4QJ5B 2M1KB 2F2OA 1EL4A 5AERA 5DKQA 2BECA 1K93D 3O4YA 1F71A 5I8NA 3D0YB 2JWWA 1R6PA 2ZRTA 4OKHA 1PK0D 4WRIA 1FI6A 2ZFDA 4AOMA 1K96A 4CIDA 1A03A 1E8AA 1YRTB 2E6WA 1RWYA 2EHBA 1XFWO 1K9KA 1CDPA 1KFXS 1ZUZA 5PALA 2A4JA 1DJZA 1NX2A 2JT3A 4PHMA 1DTLA 4TNCA 1CM4A 2JT0A 2RGIA 2ZNDA 4PDZA 1K95A 3VROA 1KWOC 2M29A 1UP5A 4JWQA 1YUSA 2Q4UA 4DIRA 1UHKA 4OV2A 3SG6A 2KI4B 1PSBA 1WDCC 2WC8A 2H2KA 3GK2A 3DVJA 1L2OC 3JVTC 5CSNA 1MHOA 2WCFA 3CZTX 3SIBA 3NXAA 3OHMB 1PRWA 1QS7A 1UHNA 1SPYA 2KYFA 4FTGA 1DGUA 2BBMA 1MF8B 1N65A 1SW8A 3I5IC 5DKNA 1TNPA 3SG3A 2KAVA 2MBXA 1SY9A 3HX4A 1B8RA 2F2PA 3AAKA 3O78A 1TNWA 4USLA 2JC2A 2LMUA 2PMYA 3AKAA 3VGOA 4PALA 1TTXA 2LHLA 2L51A 1QV0A 1JFKA 4E68A 4NDBA 2K7CA 3TS5C 3TDZA 2WORA 1WRKA 5HLVA 1OOJA 1DVIA 2LNKA 1EG3A 4DS7A 3OB1B 3D0YA 1XFZO 2LLSA 1CLLA 1KK7Y 4P2YB 1JSAA 3I5HC 1KCYA 1GQMA 1RK9A 1XO5A 2SCPA 3BOWB 4WQ3A 2CCMA 2R2IA 2HQWA 2LVIA 1EJ3A 1RJVA 3PM8A 2ZKMX 1JF2A 3NSOA 1IG5A 2NLNA 2ZNEA 1SCMC 4XYNA 5I2LA 5FYXA 1Q80A 5AANA 1SR6B 2B1UA 3SG4A 1S5GZ 1NUBA 3SJSA 1M39A 1XFVO 1BR1B 3KHEA 2BL0C 3LL8B 1TCFA 3TUYC 1XK4A 1WLZA 2JXLA 1SK6D 1IRJA 2Y1NA 1RECA 1B8CA 2JTZA 3WHUB 2LLTA 5I2QA 2Y1MA 1F8HA 3FWBA 1D1OA 1FF1A 1DJGA 4UPGA 1QV1A 3H4SE 2OPOA 2K7OA 1Y1AA 2EGDA 2K0JA 2BKIB 2M8UA 2K7BA 2LHIA 1QVIZ 3F45A 2BCAA 1K90D 4GNKB 1IGVA 1BU3A 5CPVA 2L0PA 3VRNA 3NSKA 2WOSA 3MSEB 1KFUS 1G8IA 3ICBA 2F33A 3SG2A 3CLNA 2AAOA 2MLEC 1QATA 3CR2A 4BY4A 2ZRSA 2LUXA 3EK7A 1CMFA 2M9GA 2MJWB 2L50A 1DJHA 1V1GA 1W7JB 3BOWA 1XFUO 2MLFC 1K8UA 3CWGA 1ZACA 2O60A 4I5KA 4DCKA 1WRZA 4OR9B 4PHKA 2KAYA 1B1GA 1AJ4A 4NQGA 3A8RA 4YI8A 1IKUA 2IS9A 3I5FB 1SCVA 1NCYA 1S6IA 4YBHB 1A29A 3OX6A 2NXQA 1B7TY 3EK8A 1A75B 1KQMB 1K2HA 2GGMA 3JTDB 2KNEA 3I5FC 3SG7A 5KU1A 2I7AA 3D10A 2F3YA 3CTNA 3KEVA 1DF0B 5J3XA 2CBLA 4ORAB 3OX5A 1H8BA 1KQMC 5G08A 2K2FA 5AXIA 1J55A 3JTDC 4FQOA 4GGFA 2LV7A 3HCMA 2V53A 1QTXA 1XA5A 4C0KA 1UURA 3AAJA 3SG5A 1DJIA 1SL9A 1BF5A 3KF9A 3BXKA 1J7PA 5AEQA 1BT6A 1TN4A 3FS7A 3BYAA 1XYDA 2G9BA 4CPVA 1A2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OMR A;  1YVH A;  1MXE A;  3LK1 A;  1WLM A;  2KI4 C;  3VRQ A;  3PSR A;  1SKT A;  5JOL A;  3WNX B;  5HKW A;  1B4C A;  2M7N A;  1XK4 C;  3E3R A;  2Y4Q A;  1PVA A;  2LE9 B;  4M2P A;  2CXJ A;  2KFH A;  1J7Q A;  1M31 A;  2M7L A;  4MN0 A;  1QX5 B;  1GGW A;  1S6C A;  1TOP A;  5K89 A;  1UHH A;  4MLW A;  1NP8 A;  4U8D A;  1K9P A;  5D69 A;  2Y5I A;  1SBJ A;  1HQV A;  1JWD A;  1YRU B;  4PE4 A;  1KQV A;  1AJ5 A;  1ALW A;  3OB2 B;  1Y0V H;  1CFC A;  4PHJ A;  3NSI A;  5HYD A;  3EVU A;  3C1V A;  2M97 A;  1A75 A;  3ZNI A;  1J1D A;  3VRP A;  3CGA A;  2SAS A;  4AQI A;  2FCD A;  1SL7 A;  1NX0 A;  2EC6 B;  3OP0 A;  4YRU A;  2KFF A;  2MHH A;  5CSF A;  1DF0 A;  1KK8 B;  1H4B A;  2L98 A;  2BCB A;  2KOT A;  1QX2 A;  1AP4 A;  1U5I B;  2KHN A;  4CFR A;  1OMV A;  1OZS A;  1KK7 Z;  2TN4 A;  4ORC B;  2JU0 A;  3CR4 X;  2ISD A;  3EKH A;  5ER5 A;  2KSP A;  1DT7 B;  1S1E A;  2EC6 C;  4D1E A;  1UHJ A;  4DRW A;  1B47 A;  2KQY A;  2LAP A;  2KQ6 A;  2PAS A;  4Q04 A;  1CMG A;  4PE0 A;  1SR6 C;  1OQP A;  3LK0 A;  1CFF A;  1IJ6 A;  2KFG A;  4I5J A;  1TNQ A;  2KDH A;  4OCI A;  2JQ6 A;  1RFJ A;  2JXC A;  1SRA A;  2LVJ A;  2PRU A;  1A4P A;  1CDL A;  2JRF A;  1OSA A;  1TCO B;  2GGZ A;  2BCX A;  1F54 A;  1NPQ A;  2ZN8 A;  3EVR A;  1K9U A;  4AQJ A;  3PN7 B;  4PE1 A;  1AK8 A;  1MR8 A;  1IH0 A;  3BUN B;  2LP2 A;  3BUX B;  1YVL A;  2DOQ A;  3O6B A;  1DJW A;  2K61 A;  2MRD A;  2BE6 A;  4PHN A;  2LVK A;  4GGF C;  4GUK A;  2LP3 A;  1TIZ A;  4M2O A;  3I5G B;  1RTP 1;  4MEW A;  4GAO A;  1YTZ C;  1Y1X A;  1CDN A;  2JT8 A;  5DKR A;  2QAC A;  4N5X A;  1LKJ A;  3BUW B;  2M0R A;  5GQQ C;  2KBM A;  1PAL A;  2FJU B;  5B8I B;  2JZI A;  1LVC D;  3M0W A;  4NDC A;  1UWO A;  2CNP A;  2HET A;  1YX8 A;  3I5G C;  4YGA A;  2I2R E;  1Y1U A;  1U5I A;  2L5X B;  1UUS A;  5D7F A;  2PSR A;  4CLN A;  1JF0 A;  4GGN A;  1CFP A;  2OS8 B;  4JPZ B;  2H61 A;  2OTG B;  1X02 A;  1XFX O;  1F55 A;  5KTY A;  3IQQ A;  2QPT A;  5IBW A;  1MQ1 A;  3AKB A;  3O2P A;  4PE7 A;  4ICB A;  3DVM A;  4MZK A;  1M63 B;  2ZN9 A;  4C0J A;  1JUO A;  2JUL A;  1BOC A;  1AHR A;  4I5L B;  2I94 A;  1DGV A;  2CT9 A;  2D8N A;  2AMI A;  2LCP A;  3DVK A;  1NIW A;  2OTG C;  1QXP A;  4ZCU A;  1BMO A;  1B7T Z;  2M49 B;  3SIA A;  4YGE B;  5BPJ A;  1B9A A;  1KFX L;  4NDD A;  1ODB A;  1CB1 A;  2K8M B;  3QRX A;  1KWO B;  1GJY A;  4BY5 A;  2PVB A;  1RRO A;  3IF7 A;  4JQ0 D;  2JOJ A;  1OMD A;  3CS1 A;  1CLB A;  2L4I A;  2BE4 A;  2JNX A;  1BJF A;  4HRE E;  4MVF A;  2O5G A;  3LCP C;  2E30 A;  1SNL A;  1WDC B;  1CLM A;  1EG4 A;  2JPT A;  1C7V A;  1WY9 A;  4I5N B;  1L2O B;  2LM5 A;  3JVT B;  1LXF C;  4GFT A;  3FIA A;  3KPX A;  4YGC B;  2HQ8 A;  1S26 D;  1XVJ A;  1WRL A;  1SL8 A;  1YR5 A;  1HT9 A;  1CFD A;  2M1U A;  1IQ3 A;  1JC2 A;  2G2B A;  1NX1 A;  5HLO A;  3I5I B;  4R1E A;  1C7W A;  2BKH B;  4XJK B;  3KO0 A;  4DUQ A;  2NZ0 A;  1FI5 A;  5I2O A;  1GGZ A;  2KBI A;  1QLK A;  1FBV A;  1J7O A;  2KYC A;  2P6B B;  1AVS A;  4CFQ A;  1CTR A;  1BG1 A;  4ORB B;  1FPW A;  5AFP A;  2FCE A;  4OVN F;  1CM1 A;  1CDM A;  4MZL A;  4PCW A;  2L2E A;  1NX3 A;  1LA0 A;  1B8L A;  1PSR A;  1YUT A;  1OE9 B;  1ZFS A;  3A4U B;  3TS5 B;  2KAX A;  1L7Z A;  3DVE A;  1IQ5 A;  3PLF B;  1YUR A;  1XFY O;  1BLQ A;  3TDU A;  4YGD B;  1AUI B;  5KSZ A;  1DMO A;  3LLE A;  1SMG A;  2PAL A;  4MZJ A;  5CSJ A;  2LVV A;  2LLU A;  3I5H B;  5F6T A;  5TNC A;  1NCZ A;  3CR5 X;  4MRY A;  1F4O A;  1CKK A;  2COL B;  2MAZ A;  1N2D A;  2BBN A;  2KI6 D;  4HRH A;  3ZWH A;  1QIW A;  1KSM A;  1SYM A;  1S3P A;  4ETO A;  1J7R A;  1M46 A;  1R2U A;  2NCP A;  2K7D A;  4QJ3 B;  1V1F A;  1SCM B;  2JNF A;  1NSH A;  1PUL A;  2K2A A;  1KSO A;  1S5G Y;  2L4H A;  1KK8 C;  1YUU A;  2WCE A;  1QLS A;  1J1E A;  1ZOT B;  4GBA A;  4N1G A;  3TDI A;  4YGB B;  1F70 A;  3EVV A;  3RLZ A;  2BL0 B;  1CNP A;  4HRG A;  1NCX A;  1QAS A;  3DF0 B;  3TUY B;  4L9M A;  1OZO A;  1JFJ A;  1MXL C;  4M2Q A;  2H61 C;  3K21 A;  2FOT A;  3BQ3 A;  1NYA A;  5JJG A;  1M45 A;  2MA2 A;  3NSL A;  1LA3 A;  1ZMZ A;  3GK4 X;  3DD4 A;  1DJX A;  1EH2 A;  1F4Q A;  3PAT A;  4MRX A;  3WHT B;  4A4B A;  2JTT A;  3PFV A;  2KGB C;  1QVI Y;  2GV5 A;  4XJK A;  1MWN A;  5CSI A;  1QJT A;  1YX7 A;  3IQO A;  1ALV A;  1G4Y R;  3EK4 A;  4HSZ A;  1LIN A;  2NCO A;  2M3W A;  1EXR A;  1IWQ A;  1QX7 A;  2F3Z A;  2I18 A;  4YI9 A;  3GK1 A;  1S6J A;  4P5O E;  2LMV A;  2WCB A;  1K94 A;  5ER4 X;  3PN7 C;  1W7I B;  1MUX A;  1KFU L;  1Y6W A;  4WQ2 A;  1UHI A;  1DJY A;  1NWD A;  4C0L A;  3FWC A;  2WND A;  3VRR A;  4MBE A;  2HPS A;  1VRK A;  2LUC A;  2F8P A;  1S36 A;  1PVB A;  3PAL A;  4IL1 A;  5HKZ A;  1BR4 B;  3BUM B;  4QJ4 B;  1G33 A;  2LC5 A;  2VRG A;  3EKJ A;  4GPL B;  2AUC A;  1FW4 A;  3BUO B;  2CTN A;  2LMT A;  4A4C A;  2KGR A;  4MSP A;  3GOF A;  4F0Z B;  2KI6 C;  1C07 A;  1TNX A;  4N1F A;  2LAN A;  3WXA A;  2Q91 A;  3RM1 A;  1IJ5 A;  2HF5 A;  4ZCV A;  1BOD A;  5HKY A;  1TRF A;  3DF0 A;  1JBA A;  3TZ1 A;  2OS8 C;  1QIV A;  1N0Y A;  4QJ5 B;  2M1K B;  2F2O A;  1EL4 A;  5AER A;  5DKQ A;  2BEC A;  1K93 D;  3O4Y A;  1F71 A;  5I8N A;  3D0Y B;  2JWW A;  1R6P A;  2ZRT A;  4OKH A;  1PK0 D;  4WRI A;  1FI6 A;  2ZFD A;  4AOM A;  1K96 A;  4CID A;  1A03 A;  1E8A A;  1YRT B;  2E6W A;  1RWY A;  2EHB A;  1XFW O;  1K9K A;  1CDP A;  1KFX S;  1ZUZ A;  5PAL A;  2A4J A;  1DJZ A;  1NX2 A;  2JT3 A;  4PHM A;  1DTL A;  4TNC A;  1CM4 A;  2JT0 A;  2RGI A;  2ZND A;  4PDZ A;  1K95 A;  3VRO A;  1KWO C;  2M29 A;  1UP5 A;  4JWQ A;  1YUS A;  2Q4U A;  4DIR A;  1UHK A;  4OV2 A;  3SG6 A;  2KI4 B;  1PSB A;  1WDC C;  2WC8 A;  2H2K A;  3GK2 A;  3DVJ A;  1L2O C;  3JVT C;  5CSN A;  1MHO A;  2WCF A;  3CZT X;  3SIB A;  3NXA A;  3OHM B;  1PRW A;  1QS7 A;  1UHN A;  1SPY A;  2KYF A;  4FTG A;  1DGU A;  2BBM A;  1MF8 B;  1N65 A;  1SW8 A;  3I5I C;  5DKN A;  1TNP A;  3SG3 A;  2KAV A;  2MBX A;  1SY9 A;  3HX4 A;  1B8R A;  2F2P A;  3AAK A;  3O78 A;  1TNW A;  4USL A;  2JC2 A;  2LMU A;  2PMY A;  3AKA A;  3VGO A;  4PAL A;  1TTX A;  2LHL A;  2L51 A;  1QV0 A;  1JFK A;  4E68 A;  4NDB A;  2K7C A;  3TS5 C;  3TDZ A;  2WOR A;  1WRK A;  5HLV A;  1OOJ A;  1DVI A;  2LNK A;  1EG3 A;  4DS7 A;  3OB1 B;  3D0Y A;  1XFZ O;  2LLS A;  1CLL A;  1KK7 Y;  4P2Y B;  1JSA A;  3I5H C;  1KCY A;  1GQM A;  1RK9 A;  1XO5 A;  2SCP A;  3BOW B;  4WQ3 A;  2CCM A;  2R2I A;  2HQW A;  2LVI A;  1EJ3 A;  1RJV A;  3PM8 A;  2ZKM X;  1JF2 A;  3NSO A;  1IG5 A;  2NLN A;  2ZNE A;  1SCM C;  4XYN A;  5I2L A;  5FYX A;  1Q80 A;  5AAN A;  1SR6 B;  2B1U A;  3SG4 A;  1S5G Z;  1NUB A;  3SJS A;  1M39 A;  1XFV O;  1BR1 B;  3KHE A;  2BL0 C;  3LL8 B;  1TCF A;  3TUY C;  1XK4 A;  1WLZ A;  2JXL A;  1SK6 D;  1IRJ A;  2Y1N A;  1REC A;  1B8C A;  2JTZ A;  3WHU B;  2LLT A;  5I2Q A;  2Y1M A;  1F8H A;  3FWB A;  1D1O A;  1FF1 A;  1DJG A;  4UPG A;  1QV1 A;  3H4S E;  2OPO A;  2K7O A;  1Y1A A;  2EGD A;  2K0J A;  2BKI B;  2M8U A;  2K7B A;  2LHI A;  1QVI Z;  3F45 A;  2BCA A;  1K90 D;  4GNK B;  1IGV A;  1BU3 A;  5CPV A;  2L0P A;  3VRN A;  3NSK A;  2WOS A;  3MSE B;  1KFU S;  1G8I A;  3ICB A;  2F33 A;  3SG2 A;  3CLN A;  2AAO A;  2MLE C;  1QAT A;  3CR2 A;  4BY4 A;  2ZRS A;  2LUX A;  3EK7 A;  1CMF A;  2M9G A;  2MJW B;  2L50 A;  1DJH A;  1V1G A;  1W7J B;  3BOW A;  1XFU O;  2MLF C;  1K8U A;  3CWG A;  1ZAC A;  2O60 A;  4I5K A;  4DCK A;  1WRZ A;  4OR9 B;  4PHK A;  2KAY A;  1B1G A;  1AJ4 A;  4NQG A;  3A8R A;  4YI8 A;  1IKU A;  2IS9 A;  3I5F B;  1SCV A;  1NCY A;  1S6I A;  4YBH B;  1A29 A;  3OX6 A;  2NXQ A;  1B7T Y;  3EK8 A;  1A75 B;  1KQM B;  1K2H A;  2GGM A;  3JTD B;  2KNE A;  3I5F C;  3SG7 A;  5KU1 A;  2I7A A;  3D10 A;  2F3Y A;  3CTN A;  3KEV A;  1DF0 B;  5J3X A;  2CBL A;  4ORA B;  3OX5 A;  1H8B A;  1KQM C;  5G08 A;  2K2F A;  5AXI A;  1J55 A;  3JTD C;  4FQO A;  4GGF A;  2LV7 A;  3HCM A;  2V53 A;  1QTX A;  1XA5 A;  4C0K A;  1UUR A;  3AAJ A;  3SG5 A;  1DJI A;  1SL9 A;  1BF5 A;  3KF9 A;  3BXK A;  1J7P A;  5AEQ A;  1BT6 A;  1TN4 A;  3FS7 A;  3BYA A;  1XYD A;  2G9B A;  4CPV A;  1A2X A; 
#chains in the Genus database with same CATH topology
 1OMR A;  3IVT A;  1YVH A;  1MXE A;  3LK1 A;  3D78 A;  1WLM A;  2KI4 C;  3VRQ A;  3PSR A;  1SKT A;  5JOL A;  3WNX B;  5HKW A;  1B4C A;  2M7N A;  1XK4 C;  3E3R A;  2Y4Q A;  1PVA A;  2LE9 B;  4M2P A;  2CXJ A;  3N7H A;  2KFH A;  1J7Q A;  1M31 A;  2M7L A;  4MN0 A;  1QX5 B;  1GGW A;  4JD9 A;  1S6C A;  1TOP A;  1ORG A;  5K89 A;  1UHH A;  4MLW A;  1NP8 A;  4U8D A;  3SS3 A;  1K9P A;  5D69 A;  2Y5I A;  1SBJ A;  3BFB A;  1HQV A;  2FJY A;  1JWD A;  1YRU B;  2KLD A;  4PE4 A;  1KQV A;  1AJ5 A;  1ALW A;  3L4A A;  3OB2 B;  1Y0V H;  1CFC A;  4PHJ A;  1OOH A;  3NSI A;  5HYD A;  3EVU A;  3C1V A;  2M97 A;  1A75 A;  3ZNI A;  3UO9 A;  1J1D A;  3VRP A;  3CGA A;  2SAS A;  4AQI A;  2FCD A;  1SL7 A;  1NX0 A;  2EC6 B;  3OP0 A;  4YRU A;  2KFF A;  2MHH A;  5CSF A;  1DF0 A;  1KK8 B;  3V2L A;  1H4B A;  2L98 A;  2BCB A;  2KOT A;  1QX2 A;  1AP4 A;  1U5I B;  2KHN A;  4CFR A;  1OMV A;  1OZS A;  1KK7 Z;  2TN4 A;  1DC1 A;  4ORC B;  2JU0 A;  3CR4 X;  2ISD A;  3EKH A;  5ER5 A;  2KSP A;  1DT7 B;  1S1E A;  2EC6 C;  4D1E A;  1UHJ A;  4DRW A;  1B47 A;  2KQY A;  2LAP A;  3NHI A;  2KQ6 A;  2PAS A;  4Q04 A;  1CMG A;  3UNW A;  4PE0 A;  1SR6 C;  1OQP A;  3LK0 A;  1CFF A;  1Z4H A;  1IJ6 A;  2KFG A;  4I5J A;  1OOI X;  1TNQ A;  2KDH A;  3S0G A;  3CDN A;  4OCI A;  2JQ6 A;  1RFJ A;  2JXC A;  1SRA A;  2LVJ A;  2PRU A;  1A4P A;  1CDL A;  2JRF A;  1OSA A;  1TCO B;  2GGZ A;  2BCX A;  1F54 A;  1NPQ A;  2ZN8 A;  3EVR A;  1K9U A;  4AQJ A;  2WCM A;  2PQL A;  3PN7 B;  4PE1 A;  1AK8 A;  1MR8 A;  1IH0 A;  3BUN B;  3L4L A;  2LP2 A;  3BUX B;  1YVL A;  2DOQ A;  3O6B A;  1DJW A;  2K61 A;  2MRD A;  2BE6 A;  3FE6 A;  4PHN A;  2LVK A;  2P71 A;  4GGF C;  3R72 A;  4GUK A;  2LP3 A;  1TIZ A;  4M2O A;  3I5G B;  2WCL A;  3RZS A;  1RTP 1;  4MEW A;  4GAO A;  1YTZ C;  1Y1X A;  1CDN A;  2JT8 A;  5DKR A;  3FE8 A;  2QAC A;  4N5X A;  1LKJ A;  3BUW B;  4FQT A;  2M0R A;  5GQQ C;  2KBM A;  1PAL A;  2FJU B;  5B8I B;  2JZI A;  1LVC D;  3CZ0 A;  3EG5 B;  3M0W A;  4NDC A;  1UWO A;  2CNP A;  2HET A;  1YX8 A;  3I5G C;  4YGA A;  2I2R E;  1Y1U A;  1U5I A;  2L5X B;  1UUS A;  5D7F A;  4IJ7 A;  2PSR A;  4CLN A;  1JF0 A;  4GGN A;  4INW A;  1CFP A;  2OS8 B;  1W9Z A;  4JPZ B;  2H61 A;  2OTG B;  1X02 A;  1XFX O;  1F55 A;  5KTY A;  1Z2C B;  2QPT A;  3IQQ A;  5IBW A;  1MQ1 A;  3AKB A;  3O2P A;  4PE7 A;  4ICB A;  3DVM A;  4MZK A;  1M63 B;  2ZN9 A;  4C0J A;  1JUO A;  2JUL A;  1BOC A;  1AHR A;  4I5L B;  2I94 A;  1DGV A;  2CT9 A;  2D8N A;  2AMI A;  2LCP A;  3DVK A;  1NIW A;  2OTG C;  1QXP A;  4ZCU A;  2K60 A;  1BMO A;  1B7T Z;  2M49 B;  3SIA A;  4YGE B;  5BPJ A;  1B9A A;  1KFX L;  4NDD A;  3D77 A;  1ODB A;  1CB1 A;  2K8M B;  3QRX A;  2WCH A;  1KWO B;  1GJY A;  1TWO A;  4BY5 A;  5D3O A;  2PVB A;  1OW4 A;  1RRO A;  3IF7 A;  4JQ0 D;  2JOJ A;  1OMD A;  3CS1 A;  2WCK A;  4JKT A;  1CLB A;  2L4I A;  2BE4 A;  2JNX A;  1BJF A;  4HRE E;  3B6X A;  4MVF A;  2O5G A;  3LCP C;  2E30 A;  1SNL A;  1WDC B;  1CLM A;  1EG4 A;  2JPT A;  1C7V A;  1WY9 A;  4I5N B;  1L2O B;  2LM5 A;  3JVT B;  1LXF C;  4GFT A;  3FIA A;  3KPX A;  4YGC B;  2HQ8 A;  1S26 D;  1XVJ A;  1WRL A;  3B87 A;  1SL8 A;  1YR5 A;  1HT9 A;  1CFD A;  2M1U A;  1IQ3 A;  1JC2 A;  2G2B A;  1NX1 A;  5HLO A;  3I5I B;  4R1E A;  1C7W A;  2BKH B;  4XJK B;  3KO0 A;  5HL1 A;  1C3Z A;  4DUQ A;  2NZ0 A;  1FI5 A;  5I2O A;  1GGZ A;  2KBI A;  1QLK A;  1FBV A;  1J7O A;  1TUJ A;  4INX A;  2KYC A;  1P28 A;  2P6B B;  1AVS A;  4CFQ A;  1CTR A;  1BG1 A;  4ORB B;  1FPW A;  5AFP A;  2FCE A;  4OVN F;  1CM1 A;  1CDM A;  4MZL A;  4PCW A;  2L2E A;  1NX3 A;  1LA0 A;  1B8L A;  1PSR A;  1YUT A;  1OE9 B;  1ZFS A;  2P70 A;  3A4U B;  3TS5 B;  2KAX A;  1L7Z A;  3DVE A;  1IQ5 A;  3PLF B;  1YUR A;  1XFY O;  1BLQ A;  3TDU A;  4YGD B;  1AUI B;  5KSZ A;  4F7F A;  3BFH A;  2GTE A;  3LLE A;  1DMO A;  1SMG A;  2PAL A;  4MZJ A;  3OBV A;  2KLE A;  2LVV A;  5CSJ A;  2LLU A;  3I5H B;  5F6T A;  5TNC A;  1NCZ A;  3CR5 X;  4MRY A;  1F4O A;  1CKK A;  2COL B;  2WC5 A;  2MAZ A;  1N2D A;  2BBN A;  2KI6 D;  3NHT A;  4HRH A;  3ZWH A;  1QIW A;  3L47 A;  1KSM A;  1DEK A;  1SYM A;  1S3P A;  4ETO A;  1J7R A;  1M46 A;  1R2U A;  2NCP A;  2K7D A;  4QJ3 B;  1V1F A;  1SCM B;  2JNF A;  1NSH A;  1PUL A;  2K2A A;  1KSO A;  1S5G Y;  2L4H A;  1KK8 C;  1YUU A;  2WCE A;  1QLS A;  1J1E A;  1ZOT B;  4GBA A;  4N1G A;  3TDI A;  3CZ2 A;  4YGB B;  1F70 A;  3EVV A;  3RLZ A;  2BL0 B;  3D75 A;  1CNP A;  4HRG A;  1NCX A;  1QAS A;  3DF0 B;  3OGN A;  4L9M A;  3TUY B;  1OZO A;  1JFJ A;  1MXL C;  4M2Q A;  2H61 C;  3K21 A;  2FOT A;  3BQ3 A;  1NYA A;  5JJG A;  1M45 A;  3R1P A;  2MA2 A;  3NSL A;  1LA3 A;  1ZMZ A;  3GK4 X;  3DD4 A;  1DJX A;  1EH2 A;  1F4Q A;  3PAT A;  4MRX A;  3WHT B;  4A4B A;  2JTT A;  1DEL A;  3PFV A;  2KGB C;  1QVI Y;  2GV5 A;  4XJK A;  1MWN A;  5CSI A;  1QJT A;  1YX7 A;  3IQO A;  3S0D A;  1ALV A;  1G4Y R;  3EK4 A;  4HSZ A;  1LIN A;  2NCO A;  2M3W A;  1EXR A;  1IWQ A;  1QX7 A;  2F3Z A;  2I18 A;  4YI9 A;  3GK1 A;  1S6J A;  4P5O E;  2LMV A;  3DZT A;  4PT1 A;  2WCB A;  1K94 A;  5ER4 X;  3PN7 C;  1W7I B;  1MUX A;  2QEV A;  1KFU L;  1Y6W A;  4WQ2 A;  1UHI A;  1DJY A;  1NWD A;  3NGV A;  4C0L A;  3FWC A;  2WND A;  5FI7 A;  3VRR A;  4MBE A;  3B86 A;  3SS4 A;  2HPS A;  1VRK A;  2LUC A;  2F8P A;  1S36 A;  1PVB A;  3PAL A;  3DY9 A;  4IL1 A;  5HKZ A;  1BR4 B;  5EL2 A;  3BUM B;  4QJ4 B;  1G33 A;  2LC5 A;  2VRG A;  3EKJ A;  4GPL B;  2AUC A;  4KYN A;  1FW4 A;  3BFA A;  3BUO B;  2CTN A;  2LMT A;  4A4C A;  2KGR A;  2L2C A;  4MSP A;  3GOF A;  4F0Z B;  2KI6 C;  2QDI A;  1C07 A;  1TNX A;  4N1F A;  2LAN A;  3WXA A;  2Q91 A;  2QEO A;  3RM1 A;  1IJ5 A;  5FI2 A;  2HF5 A;  3S0A A;  4ZCV A;  1BOD A;  1T14 A;  5HKY A;  1TRF A;  3DF0 A;  1JBA A;  3TZ1 A;  2OS8 C;  1QIV A;  1N0Y A;  3PJI A;  4QJ5 B;  2WCJ A;  2M1K B;  2F2O A;  1EL4 A;  5AER A;  5DKQ A;  2BEC A;  1K93 D;  3O4Y A;  1F71 A;  5I8N A;  3D0Y B;  2JWW A;  1R6P A;  2ZRT A;  4OKH A;  1PK0 D;  4WRI A;  1FI6 A;  2ZFD A;  4AOM A;  1K96 A;  4CID A;  5DIC A;  1E8A A;  1A03 A;  1YRT B;  2E6W A;  1RWY A;  2EHB A;  1XFW O;  1K9K A;  1CDP A;  1KFX S;  1ZUZ A;  5PAL A;  2A4J A;  1DJZ A;  1NX2 A;  2JT3 A;  4PHM A;  1DTL A;  4TNC A;  1CM4 A;  2JT0 A;  2RGI A;  2ZND A;  4PDZ A;  1K95 A;  3VRO A;  1KWO C;  2M29 A;  1UP5 A;  4JWQ A;  1YUS A;  2Q4U A;  4DIR A;  1UHK A;  4OV2 A;  3SG6 A;  1IIO A;  3S0B A;  2KI4 B;  1GM0 A;  2BNX A;  1PSB A;  1WDC C;  2WC8 A;  2H2K A;  3GK2 A;  3DVJ A;  3K1E A;  1L2O C;  3JVT C;  5CSN A;  1MHO A;  2WCF A;  3CZT X;  3SIB A;  2YGU A;  3NXA A;  3OHM B;  1PRW A;  1UHN A;  1QS7 A;  1SPY A;  2KYF A;  4FTG A;  2BAP A;  1DGU A;  2BBM A;  1MF8 B;  1N65 A;  1SW8 A;  3I5I C;  5DKN A;  1TNP A;  3SG3 A;  2KAV A;  2MBX A;  1SY9 A;  3HX4 A;  1B8R A;  2F2P A;  3AAK A;  3O78 A;  1TNW A;  3Q8I A;  4USL A;  5I94 A;  2JC2 A;  2LMU A;  2PMY A;  3AKA A;  3VGO A;  4PAL A;  3S0E A;  1TTX A;  2LHL A;  2L51 A;  1QV0 A;  3BJH A;  1JFK A;  4E68 A;  4NDB A;  2K7C A;  3TS5 C;  3TDZ A;  2WOR A;  1WRK A;  5HLV A;  1OOJ A;  1DVI A;  2LNK A;  1EG3 A;  3O4X A;  4DS7 A;  3OB1 B;  3D0Y A;  3D76 A;  1XFZ O;  2LLS A;  1CLL A;  1KK7 Y;  4P2Y B;  5FI6 A;  1JSA A;  3I5H C;  1KCY A;  1GQM A;  1RK9 A;  1XO5 A;  2SCP A;  3BOW B;  4WQ3 A;  2CCM A;  2R2I A;  2QEH A;  2HQW A;  2LVI A;  1EJ3 A;  1RJV A;  3DXL A;  3PM8 A;  2ZKM X;  3R1O A;  1JF2 A;  3NSO A;  1IG5 A;  2NLN A;  2ZNE A;  1SCM C;  4XYN A;  5I2L A;  5FYX A;  1Q80 A;  5AAN A;  1SR6 B;  2B1U A;  3SG4 A;  1S5G Z;  1NUB A;  3SJS A;  1M39 A;  1XFV O;  1BR1 B;  3KHE A;  2BL0 C;  3CAB A;  3LL8 B;  1TCF A;  3TUY C;  1XK4 A;  1WLZ A;  2JXL A;  1SK6 D;  1IRJ A;  2Y1N A;  1REC A;  1B8C A;  2JTZ A;  3WHU B;  2LLT A;  5I2Q A;  2Y1M A;  1F8H A;  3FWB A;  1D1O A;  1FF1 A;  1DJG A;  4UPG A;  1OOG A;  1QV1 A;  3H4S E;  2OPO A;  2K7O A;  1Y1A A;  2EGD A;  2K0J A;  2BKI B;  2M8U A;  2K7B A;  2LHI A;  1QVI Z;  2QEB A;  3F45 A;  2BCA A;  1K90 D;  4GNK B;  1IGV A;  1BU3 A;  5CPV A;  2KPH A;  2L0P A;  3VRN A;  3NSK A;  2WOS A;  2H8V A;  3MSE B;  1KFU S;  1G8I A;  3ICB A;  2PYQ A;  2F33 A;  3SG2 A;  3CLN A;  2WC6 A;  2AAO A;  2MLE C;  2L5Y A;  3SS5 A;  1QAT A;  3CR2 A;  4BY4 A;  2ZRS A;  2LUX A;  3EK7 A;  2JPO A;  2M9G A;  1CMF A;  2MJW B;  2L50 A;  1C3Y A;  1DJH A;  1V1G A;  1W7J B;  3BOW A;  1XFU O;  2MLF C;  1K8U A;  3CWG A;  1ZAC A;  2O60 A;  4I5K A;  4DCK A;  1WRZ A;  3QME A;  4OR9 B;  4PHK A;  2KAY A;  1B1G A;  1AJ4 A;  4NQG A;  3A8R A;  3B88 A;  4YI8 A;  3CYZ A;  3VB1 A;  1IKU A;  1TUZ A;  2IS9 A;  3I5F B;  1SCV A;  1NCY A;  1S6I A;  4YBH B;  1A29 A;  3DYE A;  3OX6 A;  2NXQ A;  3PM2 A;  1B7T Y;  3EK8 A;  1SSE B;  3D74 A;  1A75 B;  1KQM B;  1XFR A;  1K2H A;  2GGM A;  3JTD B;  2KNE A;  3R1V A;  3CZ1 A;  3I5F C;  3SG7 A;  5KU1 A;  2I7A A;  3D10 A;  2F3Y A;  3CTN A;  3KEV A;  1DF0 B;  5J3X A;  1OOF A;  2CBL A;  3FE9 A;  3OX5 A;  4ORA B;  1H8B A;  1KQM C;  2ERB A;  5G08 A;  2K2F A;  5AXI A;  1DQE A;  1LS8 A;  1J55 A;  3JTD C;  3S0F A;  4FQO A;  4GGF A;  4OZD A;  2LV7 A;  3HCM A;  2V53 A;  1QTX A;  1XA5 A;  4C0K A;  1UUR A;  3AAJ A;  3SG5 A;  1DJI A;  1SL9 A;  1BF5 A;  1QWV A;  3D73 A;  3BXK A;  3KF9 A;  1J7P A;  5AEQ A;  1BT6 A;  1TN4 A;  3FS7 A;  3B7A A;  3BYA A;  1XYD A;  2G9B A;  4CPV A;  1A2X A; 
#chains in the Genus database with same CATH homology
 1OMR A;  1YVH A;  1MXE A;  3LK1 A;  1WLM A;  2KI4 C;  3VRQ A;  3PSR A;  1SKT A;  5JOL A;  3WNX B;  5HKW A;  1B4C A;  2M7N A;  1XK4 C;  3E3R A;  2Y4Q A;  1PVA A;  2LE9 B;  4M2P A;  2CXJ A;  2KFH A;  1J7Q A;  1M31 A;  2M7L A;  4MN0 A;  1QX5 B;  1GGW A;  1S6C A;  1TOP A;  5K89 A;  1UHH A;  4MLW A;  1NP8 A;  4U8D A;  1K9P A;  5D69 A;  2Y5I A;  1SBJ A;  1HQV A;  1JWD A;  1YRU B;  4PE4 A;  1KQV A;  1AJ5 A;  1ALW A;  3OB2 B;  1Y0V H;  1CFC A;  4PHJ A;  3NSI A;  5HYD A;  3EVU A;  3C1V A;  2M97 A;  1A75 A;  3ZNI A;  1J1D A;  3VRP A;  3CGA A;  2SAS A;  4AQI A;  2FCD A;  1SL7 A;  1NX0 A;  2EC6 B;  3OP0 A;  4YRU A;  2KFF A;  2MHH A;  5CSF A;  1DF0 A;  1KK8 B;  1H4B A;  2L98 A;  2BCB A;  2KOT A;  1QX2 A;  1AP4 A;  1U5I B;  2KHN A;  4CFR A;  1OMV A;  1OZS A;  1KK7 Z;  2TN4 A;  4ORC B;  2JU0 A;  3CR4 X;  2ISD A;  3EKH A;  5ER5 A;  2KSP A;  1DT7 B;  1S1E A;  2EC6 C;  4D1E A;  1UHJ A;  4DRW A;  1B47 A;  2KQY A;  2LAP A;  2KQ6 A;  2PAS A;  4Q04 A;  1CMG A;  4PE0 A;  1SR6 C;  1OQP A;  3LK0 A;  1CFF A;  1IJ6 A;  2KFG A;  4I5J A;  1TNQ A;  2KDH A;  4OCI A;  2JQ6 A;  1RFJ A;  2JXC A;  1SRA A;  2LVJ A;  2PRU A;  1A4P A;  1CDL A;  2JRF A;  1OSA A;  1TCO B;  2GGZ A;  2BCX A;  1F54 A;  1NPQ A;  2ZN8 A;  3EVR A;  1K9U A;  4AQJ A;  3PN7 B;  4PE1 A;  1AK8 A;  1MR8 A;  1IH0 A;  3BUN B;  2LP2 A;  3BUX B;  1YVL A;  2DOQ A;  3O6B A;  1DJW A;  2K61 A;  2MRD A;  2BE6 A;  4PHN A;  2LVK A;  4GGF C;  4GUK A;  2LP3 A;  1TIZ A;  4M2O A;  3I5G B;  1RTP 1;  4MEW A;  4GAO A;  1YTZ C;  1Y1X A;  1CDN A;  2JT8 A;  5DKR A;  2QAC A;  4N5X A;  1LKJ A;  3BUW B;  2M0R A;  5GQQ C;  2KBM A;  1PAL A;  2FJU B;  5B8I B;  2JZI A;  1LVC D;  3M0W A;  4NDC A;  1UWO A;  2CNP A;  2HET A;  1YX8 A;  3I5G C;  4YGA A;  2I2R E;  1Y1U A;  1U5I A;  2L5X B;  1UUS A;  5D7F A;  2PSR A;  4CLN A;  1JF0 A;  4GGN A;  1CFP A;  2OS8 B;  4JPZ B;  2H61 A;  2OTG B;  1X02 A;  1XFX O;  1F55 A;  5KTY A;  3IQQ A;  2QPT A;  5IBW A;  1MQ1 A;  3AKB A;  3O2P A;  4PE7 A;  4ICB A;  3DVM A;  4MZK A;  1M63 B;  2ZN9 A;  4C0J A;  1JUO A;  2JUL A;  1BOC A;  1AHR A;  4I5L B;  2I94 A;  1DGV A;  2CT9 A;  2D8N A;  2AMI A;  2LCP A;  3DVK A;  1NIW A;  2OTG C;  1QXP A;  4ZCU A;  1BMO A;  1B7T Z;  2M49 B;  3SIA A;  4YGE B;  5BPJ A;  1B9A A;  1KFX L;  4NDD A;  1ODB A;  1CB1 A;  2K8M B;  3QRX A;  1KWO B;  1GJY A;  4BY5 A;  2PVB A;  1RRO A;  3IF7 A;  4JQ0 D;  2JOJ A;  1OMD A;  3CS1 A;  1CLB A;  2L4I A;  2BE4 A;  2JNX A;  1BJF A;  4HRE E;  4MVF A;  2O5G A;  3LCP C;  2E30 A;  1SNL A;  1WDC B;  1CLM A;  1EG4 A;  2JPT A;  1C7V A;  1WY9 A;  4I5N B;  1L2O B;  2LM5 A;  3JVT B;  1LXF C;  4GFT A;  3FIA A;  3KPX A;  4YGC B;  2HQ8 A;  1S26 D;  1XVJ A;  1WRL A;  1SL8 A;  1YR5 A;  1HT9 A;  1CFD A;  2M1U A;  1IQ3 A;  1JC2 A;  2G2B A;  1NX1 A;  5HLO A;  3I5I B;  4R1E A;  1C7W A;  2BKH B;  4XJK B;  3KO0 A;  4DUQ A;  2NZ0 A;  1FI5 A;  5I2O A;  1GGZ A;  2KBI A;  1QLK A;  1FBV A;  1J7O A;  2KYC A;  2P6B B;  1AVS A;  4CFQ A;  1CTR A;  1BG1 A;  4ORB B;  1FPW A;  5AFP A;  2FCE A;  4OVN F;  1CM1 A;  1CDM A;  4MZL A;  4PCW A;  2L2E A;  1NX3 A;  1LA0 A;  1B8L A;  1PSR A;  1YUT A;  1OE9 B;  1ZFS A;  3A4U B;  3TS5 B;  2KAX A;  1L7Z A;  3DVE A;  1IQ5 A;  3PLF B;  1YUR A;  1XFY O;  1BLQ A;  3TDU A;  4YGD B;  1AUI B;  5KSZ A;  1DMO A;  3LLE A;  1SMG A;  2PAL A;  4MZJ A;  5CSJ A;  2LVV A;  2LLU A;  3I5H B;  5F6T A;  5TNC A;  1NCZ A;  3CR5 X;  4MRY A;  1F4O A;  1CKK A;  2COL B;  2MAZ A;  1N2D A;  2BBN A;  2KI6 D;  4HRH A;  3ZWH A;  1QIW A;  1KSM A;  1SYM A;  1S3P A;  4ETO A;  1J7R A;  1M46 A;  1R2U A;  2NCP A;  2K7D A;  4QJ3 B;  1V1F A;  1SCM B;  2JNF A;  1NSH A;  1PUL A;  2K2A A;  1KSO A;  1S5G Y;  2L4H A;  1KK8 C;  1YUU A;  2WCE A;  1QLS A;  1J1E A;  1ZOT B;  4GBA A;  4N1G A;  3TDI A;  4YGB B;  1F70 A;  3EVV A;  3RLZ A;  2BL0 B;  1CNP A;  4HRG A;  1NCX A;  1QAS A;  3DF0 B;  3TUY B;  4L9M A;  1OZO A;  1JFJ A;  1MXL C;  4M2Q A;  2H61 C;  3K21 A;  2FOT A;  3BQ3 A;  1NYA A;  5JJG A;  1M45 A;  2MA2 A;  3NSL A;  1LA3 A;  1ZMZ A;  3GK4 X;  3DD4 A;  1DJX A;  1EH2 A;  1F4Q A;  3PAT A;  4MRX A;  3WHT B;  4A4B A;  2JTT A;  3PFV A;  2KGB C;  1QVI Y;  2GV5 A;  4XJK A;  1MWN A;  5CSI A;  1QJT A;  1YX7 A;  3IQO A;  1ALV A;  1G4Y R;  3EK4 A;  4HSZ A;  1LIN A;  2NCO A;  2M3W A;  1EXR A;  1IWQ A;  1QX7 A;  2F3Z A;  2I18 A;  4YI9 A;  3GK1 A;  1S6J A;  4P5O E;  2LMV A;  2WCB A;  1K94 A;  5ER4 X;  3PN7 C;  1W7I B;  1MUX A;  1KFU L;  1Y6W A;  4WQ2 A;  1UHI A;  1DJY A;  1NWD A;  4C0L A;  3FWC A;  2WND A;  3VRR A;  4MBE A;  2HPS A;  1VRK A;  2LUC A;  2F8P A;  1S36 A;  1PVB A;  3PAL A;  4IL1 A;  5HKZ A;  1BR4 B;  3BUM B;  4QJ4 B;  1G33 A;  2LC5 A;  2VRG A;  3EKJ A;  4GPL B;  2AUC A;  1FW4 A;  3BUO B;  2CTN A;  2LMT A;  4A4C A;  2KGR A;  4MSP A;  3GOF A;  4F0Z B;  2KI6 C;  1C07 A;  1TNX A;  4N1F A;  2LAN A;  3WXA A;  2Q91 A;  3RM1 A;  1IJ5 A;  2HF5 A;  4ZCV A;  1BOD A;  5HKY A;  1TRF A;  3DF0 A;  1JBA A;  3TZ1 A;  2OS8 C;  1QIV A;  1N0Y A;  4QJ5 B;  2M1K B;  2F2O A;  1EL4 A;  5AER A;  5DKQ A;  2BEC A;  1K93 D;  3O4Y A;  1F71 A;  5I8N A;  3D0Y B;  2JWW A;  1R6P A;  2ZRT A;  4OKH A;  1PK0 D;  4WRI A;  1FI6 A;  2ZFD A;  4AOM A;  1K96 A;  4CID A;  1A03 A;  1E8A A;  1YRT B;  2E6W A;  1RWY A;  2EHB A;  1XFW O;  1K9K A;  1CDP A;  1KFX S;  1ZUZ A;  5PAL A;  2A4J A;  1DJZ A;  1NX2 A;  2JT3 A;  4PHM A;  1DTL A;  4TNC A;  1CM4 A;  2JT0 A;  2RGI A;  2ZND A;  4PDZ A;  1K95 A;  3VRO A;  1KWO C;  2M29 A;  1UP5 A;  4JWQ A;  1YUS A;  2Q4U A;  4DIR A;  1UHK A;  4OV2 A;  3SG6 A;  2KI4 B;  1PSB A;  1WDC C;  2WC8 A;  2H2K A;  3GK2 A;  3DVJ A;  1L2O C;  3JVT C;  5CSN A;  1MHO A;  2WCF A;  3CZT X;  3SIB A;  3NXA A;  3OHM B;  1PRW A;  1QS7 A;  1UHN A;  1SPY A;  2KYF A;  4FTG A;  1DGU A;  2BBM A;  1MF8 B;  1N65 A;  1SW8 A;  3I5I C;  5DKN A;  1TNP A;  3SG3 A;  2KAV A;  2MBX A;  1SY9 A;  3HX4 A;  1B8R A;  2F2P A;  3AAK A;  3O78 A;  1TNW A;  4USL A;  2JC2 A;  2LMU A;  2PMY A;  3AKA A;  3VGO A;  4PAL A;  1TTX A;  2LHL A;  2L51 A;  1QV0 A;  1JFK A;  4E68 A;  4NDB A;  2K7C A;  3TS5 C;  3TDZ A;  2WOR A;  1WRK A;  5HLV A;  1OOJ A;  1DVI A;  2LNK A;  1EG3 A;  4DS7 A;  3OB1 B;  3D0Y A;  1XFZ O;  2LLS A;  1CLL A;  1KK7 Y;  4P2Y B;  1JSA A;  3I5H C;  1KCY A;  1GQM A;  1RK9 A;  1XO5 A;  2SCP A;  3BOW B;  4WQ3 A;  2CCM A;  2R2I A;  2HQW A;  2LVI A;  1EJ3 A;  1RJV A;  3PM8 A;  2ZKM X;  1JF2 A;  3NSO A;  1IG5 A;  2NLN A;  2ZNE A;  1SCM C;  4XYN A;  5I2L A;  5FYX A;  1Q80 A;  5AAN A;  1SR6 B;  2B1U A;  3SG4 A;  1S5G Z;  1NUB A;  3SJS A;  1M39 A;  1XFV O;  1BR1 B;  3KHE A;  2BL0 C;  3LL8 B;  1TCF A;  3TUY C;  1XK4 A;  1WLZ A;  2JXL A;  1SK6 D;  1IRJ A;  2Y1N A;  1REC A;  1B8C A;  2JTZ A;  3WHU B;  2LLT A;  5I2Q A;  2Y1M A;  1F8H A;  3FWB A;  1D1O A;  1FF1 A;  1DJG A;  4UPG A;  1QV1 A;  3H4S E;  2OPO A;  2K7O A;  1Y1A A;  2EGD A;  2K0J A;  2BKI B;  2M8U A;  2K7B A;  2LHI A;  1QVI Z;  3F45 A;  2BCA A;  1K90 D;  4GNK B;  1IGV A;  1BU3 A;  5CPV A;  2L0P A;  3VRN A;  3NSK A;  2WOS A;  3MSE B;  1KFU S;  1G8I A;  3ICB A;  2F33 A;  3SG2 A;  3CLN A;  2AAO A;  2MLE C;  1QAT A;  3CR2 A;  4BY4 A;  2ZRS A;  2LUX A;  3EK7 A;  1CMF A;  2M9G A;  2MJW B;  2L50 A;  1DJH A;  1V1G A;  1W7J B;  3BOW A;  1XFU O;  2MLF C;  1K8U A;  3CWG A;  1ZAC A;  2O60 A;  4I5K A;  4DCK A;  1WRZ A;  4OR9 B;  4PHK A;  2KAY A;  1B1G A;  1AJ4 A;  4NQG A;  3A8R A;  4YI8 A;  1IKU A;  2IS9 A;  3I5F B;  1SCV A;  1NCY A;  1S6I A;  4YBH B;  1A29 A;  3OX6 A;  2NXQ A;  1B7T Y;  3EK8 A;  1A75 B;  1KQM B;  1K2H A;  2GGM A;  3JTD B;  2KNE A;  3I5F C;  3SG7 A;  5KU1 A;  2I7A A;  3D10 A;  2F3Y A;  3CTN A;  3KEV A;  1DF0 B;  5J3X A;  2CBL A;  4ORA B;  3OX5 A;  1H8B A;  1KQM C;  5G08 A;  2K2F A;  5AXI A;  1J55 A;  3JTD C;  4FQO A;  4GGF A;  2LV7 A;  3HCM A;  2V53 A;  1QTX A;  1XA5 A;  4C0K A;  1UUR A;  3AAJ A;  3SG5 A;  1DJI A;  1SL9 A;  1BF5 A;  3KF9 A;  3BXK A;  1J7P A;  5AEQ A;  1BT6 A;  1TN4 A;  3FS7 A;  3BYA A;  1XYD A;  2G9B A;  4CPV A;  1A2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...