1YUSA

Solution structure of apo-s100a13
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S100 calcium binding protein A13
publication title Structural Interplay between Calcium(II) and Copper(II) Binding to S100A13 Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 28
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1yusA00
2MLEC 1LKJA 3D0YB 1JF0A 1KWOC 4OCIA 3PATA 4YGAA 1L7ZA 1KFUL 1F70A 1W7JB 1U5IA 2JQ6A 2L5XB 1LXFC 2LV7A 1JUOA 3DVMA 1SW8A 1XK4A 2M8UA 2L4IA 1CFPA 3OX6A 3BUMB 5IBWA 2SCPA 1FW4A 2QACA 3JTDC 2JNFA 1NX3A 1F71A 1PULA 1NCZA 1EJ3A 1NYAA 1Y1AA 1S36A 1CMFA 2LUCA 1XK4C 2HF5A 2KSPA 2L51A 3IQOA 5G08A 4QJ4B 3JTDB 4OR9B 1X02A 2JU0A 1GGZA 3KEVA 1BLQA 1B9AA 3LK0A 2BCAA 1A75A 4GPLB 3BXKA 2ZNEA 2KFFA 1B1GA 4GBAA 2KFGA 3JVTB 2EGDA 1DVIA 1Y6WA 2MLFC 1XFXO 2LNKA 2CXJA 1JF2A 4ORBB 2JNXA 4YRUA 1MXLC 2GV5A 1DF0B 5AXIA 1YUTA 4PHNA 3SG5A 4NQGA 3CLNA 3H4SE 1CNPA 1OSAA 3TUYC 1B8CA 4PALA 2L98A 2JT0A 1OQPA 3CGAA 4OVNF 3WXAA 1K2HA 1NCXA 1BJFA 3TS5C 1TNQA 4PHKA 2LLTA 2I94A 4GNKB 1S6IA 3LK1A 1IG5A 2LUXA 1LA3A 3CR5X 1YR5A 4M2OA 5CSIA 3TS5B 4JWQA 2K61A 3NSOA 4MZKA 2K7OA 2KYCA 2M49B 4YGCB 2I18A 1WDCC 3EKJA 1BMOA 1QJTA 1SL7A 3M0WA 5DKQA 1QV1A 2HPSA 4YI9A 3O2PA 1UHIA 1DJXA 4YGDB 1QX5B 1K8UA 1ALVA 1TCOB 2WCFA 3I5IC 3PN7C 4HREE 1LVCD 1SCVA 2NCPA 4GGFA 1K95A 3SIAA 4DS7A 3BQ3A 2M7LA 3VRNA 3NSLA 1TN4A 2JC2A 1N65A 3I5IB 2KI6D 1NUBA 1J7PA 2FCEA 2ZRSA 5JJGA 1AJ4A 1BU3A 1ZMZA 2LLSA 2BE6A 3AKBA 4GGFC 1H8BA 2LP2A 2GGMA 3BUXB 4E68A 1AJ5A 4CLNA 4OKHA 1PSRA 3DF0A 3IQQA 3EVUA 2F2PA 2H2KA 4YGBB 3VRQA 2KQYA 4XJKA 3GOFA 4CFRA 1QVIY 2ZFDA 1FI5A 1YURA 2KI4C 1TNXA 1JBAA 2ZN8A 1XFYO 5TNCA 2P6BB 2WCBA 1UHJA 1BG1A 4U8DA 4PHJA 1QVIZ 2K2FA 1S26D 1RECA 1WLMA 2Q91A 2KI4B 1PVBA 4FTGA 1E8AA 2KAXA 1JSAA 1EG4A 1S6CA 2Y5IA 3QRXA 5KU1A 1B7TZ 1S5GZ 3BYAA 1S3PA 3AKAA 4ZCVA 3O4YA 5ER5A 3D0YA 3SG7A 4TNCA 2JT8A 1PALA 2A4JA 1BODA 2MA2A 3RM1A 2M0RA 3BUOB 1RJVA 3AAJA 1KK7Y 2L4HA 2MJWB 1TCFA 3SG4A 3VGOA 1QX7A 1KFXS 1SK6D 2BKIB 1CTRA 2F2OA 1C7VA 1LA0A 2LMVA 1TIZA 1FPWA 4F0ZB 1YUSA 1SMGA 4A4BA 4M2QA 1BR1B 2ZRTA 1RROA 1NIWA 3OX5A 4NDBA 3C1VA 2LE9B 1OZSA 1CMGA 2NCOA 1EXRA 2SASA 2WOSA 1B8RA 1DJIA 2E6WA 2JWWA 2R2IA 1G4YR 4MN0A 1Y1XA 2KQ6A 4BY4A 1F55A 2PVBA 2BBNA 1BF5A 2QPTA 4AOMA 1F4OA 2MRDA 1GJYA 4PE4A 1EG3A 4AQIA 1KCYA 1XA5A 3OB2B 2M29A 1QXPA 5I8NA 4P5OE 4UPGA 1DF0A 3ICBA 2BL0C 3IF7A 1UURA 1NX2A 1OMRA 3FWBA 1XFVO 2BCBA 2WC8A 1FI6A 2KGBC 3JVTC 3TDUA 2ZNDA 2BE4A 2M7NA 1IQ5A 4WQ3A 1QLSA 2BL0B 3BUNB 1SKTA 4YGEB 1XVJA 2M97A 1DJHA 3EK8A 3DVKA 1M45A 1SR6B 5HKZA 1MWNA 4ORAB 1IWQA 1CDMA 5HLVA 1A29A 1IJ6A 1QX2A 4XYNA 1DJZA 2KHNA 1NCYA 2AAOA 4CIDA 4FQOA 3E3RA 2KGRA 3ZWHA 1YRTB 1QTXA 1KFUS 5JOLA 2AUCA 5HYDA 3I5GC 2K8MB 1K9UA 1EL4A 1ZFSA 1N2DA 2KYFA 4I5LB 1RTP1 1GQMA 1IH0A 1ALWA 1SRAA 1PK0D 3LLEA 3OB1B 1WY9A 2M9GA 3DVJA 3K21A 2JRFA 4MZLA 3WNXB 4CPVA 2VRGA 1IQ3A 2Y1MA 1BOCA 3I5GB 1SY9A 2LMTA 4WRIA 3I5HB 4PE1A 1C07A 3VRRA 2JPTA 1KQVA 5D7FA 3RLZA 5HKWA 2PASA 1JFKA 3WHUB 1YX8A 1D1OA 1RFJA 4MRXA 2KAVA 1K93D 2JXCA 1B4CA 1MHOA 2EHBA 5CSJA 1K9KA 1WRZA 4GGNA 1ZUZA 3PFVA 4R1EA 2KDHA 2CT9A 4OV2A 2ZKMX 1A2XA 1PRWA 3MSEB 4IL1A 2LCPA 2F3YA 1A03A 3KHEA 1K90D 2EC6B 4P2YB 1F8HA 1OE9B 1LINA 4D1EA 2CCMA 2JOJA 4CFQA 1MQ1A 4HSZA 1IJ5A 1SCMB 1DJGA 1NX0A 2K7BA 3BUWB 3LL8B 4PHMA 5J3XA 3HX4A 1M39A 2HETA 1UHKA 5PALA 1KFXL 1TNPA 1YUUA 3VRPA 2LC5A 1J1EA 2O5GA 3KF9A 1AP4A 2G9BA 4MZJA 2LHLA 1L2OB 3FS7A 3SG6A 2LANA 1IKUA 5ER4X 4MBEA 2AMIA 1SL9A 2KAYA 1ZACA 3LCPC 1SYMA 4I5NB 4A4CA 1YRUB 1QV0A 1V1FA 4QJ5B 4YBHB 4AQJA 2FCDA 1NP8A 3GK1A 1NSHA 4C0LA 1B8LA 1OZOA 1RWYA 2BECA 2COLB 1DJWA 3SG2A 1DJYA 3FIAA 1KK7Z 3KPXA 5CPVA 2OTGC 1WRLA 1CKKA 2KOTA 2WCEA 5AERA 3EVRA 2NZ0A 1CLLA 3EVVA 1PVAA 1J1DA 1RK9A 2OS8B 2HQWA 1S6JA 3NXAA 5KSZA 2OTGB 4MEWA 3A4UB 1WLZA 4ZCUA 2H61C 3FWCA 1R6PA 3NSKA 4I5KA 4GAOA 2LVIA 5CSFA 5AFPA 5AEQA 2OPOA 1MR8A 2JTTA 2F33A 1BR4B 5D69A 2NXQA 1WRKA 4WQ2A 1SBJA 2I7AA 2L2EA 2K7DA 1QASA 2DOQA 3EKHA 3VROA 2F3ZA 3KO0A 1Q80A 1UWOA 2KBMA 3BOWB 1CFCA 4JQ0D 3CR2A 4MVFA 1SNLA 2K0JA 4PE7A 2LVVA 5GQQC 4DCKA 4QJ3B 1CDPA 1YX7A 3OHMB 1UHNA 5FYXA 5I2LA 3SG3A 4BY5A 3CWGA 1SR6C 1M63B 1DGUA 1SPYA 4GUKA 3TZ1A 1XFWO 1CB1A 4MSPA 1KWOB 1CLBA 4MLWA 1K96A 5B8IB 1QLKA 1DTLA 3OP0A 2LVJA 1MXEA 2GGZA 2LP3A 1K94A 1MUXA 1UHHA 1TTXA 5F6TA 1NWDA 1Y0VH 3TDZA 2JULA 1CDLA 2JT3A 4GFTA 3I5FC 1JFJA 1AVSA 1U5IB 2MAZA 1TNWA 2BCXA 3I5HC 3PALA 2M1KB 2LM5A 2WORA 1NPQA 3I5FB 5KTYA 3PLFB 2KBIA 4HRGA 1CM1A 1QIVA 2PALA 4MRYA 1JC2A 3CR4X 3O78A 3PM8A 2KNEA 3AAKA 4N5XA 2L0PA 1KSOA 2PSRA 1S1EA 2F8PA 2KI6C 1HT9A 2LVKA 2EC6C 3A8RA 1OOJA 2LHIA 3NSIA 3O6BA 2JTZA 5AANA 1J7OA 1A75B 5I2QA 3CS1A 1K9PA 3TUYB 1F54A 2LLUA 4ORCB 1FBVA 1VRKA 1IGVA 3CZTX 1GGWA 1AHRA 1KK8C 2CNPA 2TN4A 1SCMC 1J7QA 3HCMA 2Q4UA 1V1GA 2RGIA 1DT7B 1J55A 2M3WA 2V53A 1A4PA 3WHTB 1XFZO 3SIBA 1UUSA 5CSNA 1PSBA 1HQVA 1KK8B 3EK4A 1J7RA 1KSMA 2JZIA 1SL8A 2JXLA 3PSRA 4DRWA 4JPZB 1AUIB 1DGVA 1C7WA 1L2OC 1WDCB 2D8NA 2FJUB 2IS9A 4I5JA 4ETOA 1XFUO 2B1UA 1IRJA 3D10A 3PN7B 1CLMA 2NLNA 4N1GA 1G8IA 2E30A 4PCWA 4PDZA 1KQMC 1QS7A 2CBLA 1M46A 1YVLA 4N1FA 5HKYA 1NX1A 1CFDA 4L9MA 2MHHA 4DUQA 3ZNIA 2FOTA 2Y4QA 4M2PA 2Y1NA 2ISDA 1KQMB 3GK4X 3DD4A 2I2RE 2BBMA 3DVEA 3GK2A 4NDCA 1JWDA 1ODBA 1B47A 1XYDA 2PRUA 4PE0A 4C0JA 2M1UA 4NDDA 1B7TY 1S5GY 2H61A 2OS8C 5HLOA 5BPJA 1QATA 1H4BA 2O60A 1TRFA 1W7IB 1OMVA 2LAPA 1N0YA 2CTNA 3CTNA 3SJSA 4C0KA 1R2UA 2K2AA 2LMUA 2HQ8A 3BOWA 2PMYA 3DF0B 3EK7A 1AK8A 1CDNA 2BKHB 1EH2A 1M31A 1YVHA 4XJKB 1QIWA 1CM4A 4ICBA 1XO5A 1CFFA 1G33A 1TOPA 1F4QA 2KFHA 5DKNA 4Q04A 2ZN9A 3TDIA 1YTZC 4DIRA 5I2OA 1ZOTB 1FF1A 2L50A 4USLA 4YI8A 1BT6A 5K89A 1DMOA 5DKRA 2MBXA 1OMDA 1UP5A 1Y1UA 4HRHA 3F45A 1MF8B 2WNDA 2G2BA 2K7CA
chains in the Genus database with same CATH superfamily
2MLEC 1LKJA 1Z2CB 3D0YB 1JF0A 1KWOC 4OCIA 2KPHA 3PATA 4YGAA 1L7ZA 1KFUL 2YGUA 1F70A 1W7JB 1DQEA 1U5IA 2JQ6A 2L5XB 1LXFC 2LV7A 1JUOA 2QDIA 3DVMA 1SW8A 3OBVA 3R72A 1XK4A 2M8UA 2L4IA 1CFPA 3OX6A 3BUMB 5IBWA 2SCPA 3BJHA 1FW4A 2QACA 3JTDC 2JNFA 1NX3A 1F71A 1PULA 1NCZA 1EJ3A 1NYAA 1Y1AA 1S36A 2BNXA 1CMFA 2LUCA 1XK4C 2HF5A 2KSPA 2L51A 3IQOA 5G08A 4QJ4B 3JTDB 4OR9B 1X02A 2JU0A 1GGZA 1OOHA 2L2CA 3KEVA 1BLQA 1B9AA 3LK0A 2BCAA 1A75A 4GPLB 3BXKA 2ZNEA 2KFFA 1B1GA 4GBAA 2KFGA 3JVTB 3B86A 2EGDA 3UO9A 1DVIA 1Y6WA 2MLFC 1XFXO 2LNKA 2CXJA 1JF2A 4ORBB 3IVTA 2JNXA 4YRUA 1MXLC 2GV5A 1DF0B 5AXIA 1YUTA 4INWA 4PHNA 3SG5A 4NQGA 3CLNA 3H4SE 1CNPA 1OSAA 3TUYC 1B8CA 4FQTA 2L98A 2JT0A 1OQPA 3CGAA 4OVNF 4PALA 3SS5A 3WXAA 1NCXA 1K2HA 1DC1A 1BJFA 3TS5C 1TNQA 4PHKA 2LLTA 2I94A 4GNKB 1S6IA 3LK1A 1IG5A 2LUXA 1LA3A 3CR5X 1YR5A 4M2OA 3DXLA 5CSIA 3TS5B 4JWQA 2K61A 3NSOA 1TWOA 4MZKA 2K7OA 2KYCA 2M49B 4YGCB 2I18A 1WDCC 3EKJA 1BMOA 1QJTA 1SL7A 3M0WA 5DKQA 1QV1A 2HPSA 3R1PA 3O2PA 4YI9A 1UHIA 1DJXA 4YGDB 1QX5B 1K8UA 1ALVA 1TCOB 2WCFA 3I5IC 3PN7C 4HREE 4IJ7A 1LVCD 1SCVA 2NCPA 4GGFA 1K95A 5FI2A 2PQLA 3SIAA 4DS7A 3BQ3A 4F7FA 2M7LA 3VRNA 3NSLA 1TN4A 3VB1A 2JC2A 1N65A 3I5IB 2KI6D 1NUBA 1J7PA 2FCEA 2ZRSA 5JJGA 1AJ4A 1BU3A 1ZMZA 2LLSA 2BE6A 2FJYA 2WC6A 1SSEB 3AKBA 3PM2A 4GGFC 3BFHA 2LP2A 1H8BA 2GGMA 3BUXB 4E68A 1AJ5A 4CLNA 4OKHA 1PSRA 3DF0A 3IQQA 3EVUA 2F2PA 2H2KA 4YGBB 3VRQA 2KQYA 4XJKA 3GOFA 4CFRA 1QVIY 2ZFDA 1FI5A 1YURA 2KI4C 1TNXA 1QWVA 1JBAA 2ZN8A 1XFYO 5TNCA 2P6BB 2WCBA 1UHJA 1BG1A 4U8DA 4PHJA 3CYZA 1QVIZ 2K2FA 1S26D 1RECA 2QEHA 1WLMA 2K60A 2Q91A 2KI4B 1PVBA 4FTGA 1E8AA 2KAXA 1T14A 3S0DA 1EG4A 1S6CA 2Y5IA 3QRXA 5KU1A 1B7TZ 1S5GZ 3BYAA 1S3PA 3AKAA 4ZCVA 3O4YA 5ER5A 3D0YA 3SG7A 4TNCA 2JT8A 1PALA 2A4JA 1Z4HA 1BODA 2MA2A 3RM1A 2M0RA 3BUOB 1RJVA 3AAJA 1KK7Y 2L4HA 2MJWB 3PJIA 1TCFA 3SG4A 3VGOA 1QX7A 1KFXS 1SK6D 2BKIB 1CTRA 2F2OA 1C7VA 1LA0A 2LMVA 1TIZA 2WC5A 1FPWA 4F0ZB 1YUSA 1SMGA 4A4BA 4M2QA 3B87A 1BR1B 2ZRTA 1RROA 1NIWA 3OX5A 4NDBA 3C1VA 2LE9B 1OZSA 1CMGA 1C3ZA 1EXRA 2NCOA 2SASA 2WOSA 1B8RA 1DJIA 2E6WA 2JWWA 5FI6A 2R2IA 1G4YR 4MN0A 1Y1XA 2KQ6A 4BY4A 1F55A 2PVBA 2BBNA 1BF5A 2QPTA 4AOMA 3DZTA 1F4OA 2MRDA 1GJYA 4PE4A 1EG3A 4AQIA 1OW4A 1KCYA 1XA5A 3OB2B 2M29A 1QXPA 5I8NA 4P5OE 4UPGA 3OGNA 1DF0A 3ICBA 2BL0C 3IF7A 1UURA 1NX2A 1OMRA 3FWBA 1XFVO 2BCBA 2WC8A 1FI6A 2KGBC 3JVTC 3TDUA 2ZNDA 2BE4A 2M7NA 1IQ5A 3Q8IA 4WQ3A 1QLSA 2BL0B 3BUNB 1SKTA 4YGEB 1XVJA 2M97A 1DJHA 3EK8A 3CZ1A 3DVKA 1LS8A 1M45A 1SR6B 5HKZA 1MWNA 4ORAB 1IWQA 2PYQA 3D75A 1CDMA 5HLVA 1A29A 1IJ6A 1QX2A 4JKTA 4XYNA 1DJZA 2KHNA 1NCYA 2JPOA 3S0BA 2AAOA 4CIDA 4PT1A 2WCKA 3S0FA 4FQOA 3E3RA 2KGRA 3K1EA 1YRTB 1QTXA 1KFUS 5JOLA 3ZWHA 2AUCA 5HYDA 3I5GC 2K8MB 1K9UA 1EL4A 1ZFSA 1N2DA 2KYFA 3DY9A 1RTP1 1GQMA 1ORGA 1IH0A 1ALWA 1SRAA 1PK0D 3LLEA 3OB1B 1WY9A 2M9GA 3DVJA 3K21A 2JRFA 4MZLA 3WNXB 4CPVA 2VRGA 1IQ3A 2Y1MA 1BOCA 3I5GB 1SY9A 2LMTA 3BFAA 4WRIA 3I5HB 4PE1A 1C07A 3VRRA 2JPTA 1KQVA 5D7FA 5DICA 5HKWA 3RLZA 2PASA 3B6XA 1JFKA 3WHUB 1YX8A 1D1OA 1RFJA 4MRXA 2KAVA 1K93D 2JXCA 1B4CA 1MHOA 2EHBA 5CSJA 1K9KA 1WRZA 4GGNA 1ZUZA 3QMEA 3PFVA 3D73A 4R1EA 2KDHA 1TUJA 2CT9A 4OV2A 2ZKMX 1A2XA 1PRWA 3MSEB 4IL1A 2LCPA 2F3YA 1A03A 3KHEA 1K90D 2EC6B 4P2YB 1F8HA 1OE9B 1LINA 1OOGA 4D1EA 2CCMA 2JOJA 3L47A 4CFQA 1MQ1A 3B7AA 4HSZA 1IJ5A 1SCMB 1DJGA 1NX0A 3CZ0A 2K7BA 3BUWB 3LL8B 4PHMA 5J3XA 3HX4A 1M39A 2HETA 1UHKA 5PALA 1KFXL 1TNPA 1YUUA 3FE6A 3VRPA 2LC5A 1J1EA 3CDNA 5FI7A 2O5GA 3SS3A 3KF9A 1AP4A 2G9BA 4MZJA 2LHLA 1L2OB 3FS7A 3SG6A 2LANA 1IKUA 5ER4X 4MBEA 3DYEA 2AMIA 1DELA 1SL9A 2KAYA 1ZACA 3LCPC 1SYMA 4I5NB 1P28A 4A4CA 1YRUB 1QV0A 1V1FA 4QJ5B 4YBHB 1XFRA 3BFBA 3S0EA 4INXA 4AQJA 2FCDA 1NP8A 3GK1A 1NSHA 4C0LA 1B8LA 1OZOA 1RWYA 1OOFA 2BECA 2COLB 1DJWA 3SG2A 1DJYA 3FIAA 1KK7Z 3KPXA 5CPVA 2OTGC 1WRLA 1CKKA 2KOTA 3D74A 2WCEA 2P71A 5AERA 3EVRA 2NZ0A 1CLLA 3EVVA 1PVAA 1J1DA 1RK9A 2OS8B 2HQWA 1S6JA 3NXAA 4JD9A 3SS4A 2OTGB 4MEWA 5KSZA 3A4UB 1WLZA 4ZCUA 2H61C 3FWCA 1R6PA 3NSKA 4I5KA 4GAOA 2LVIA 5CSFA 5AFPA 5AEQA 2OPOA 1MR8A 2JTTA 2F33A 1BR4B 5D69A 2NXQA 1WRKA 5HL1A 4WQ2A 3RZSA 1SBJA 2I7AA 2L2EA 2K7DA 1QASA 2DOQA 3EKHA 3VROA 2F3ZA 3KO0A 1Q80A 1UWOA 2KBMA 3BOWB 1CFCA 4JQ0D 3CR2A 4MVFA 1SNLA 2K0JA 4PE7A 2LVVA 5GQQC 4DCKA 4QJ3B 1CDPA 1YX7A 3OHMB 1UHNA 5FYXA 5I2LA 3SG3A 3L4LA 4BY5A 3CWGA 2KLDA 1SR6C 1M63B 1DGUA 1SPYA 4GUKA 4OZDA 3TZ1A 1XFWO 1CB1A 4MSPA 1KWOB 1CLBA 4MLWA 1K96A 5B8IB 1QLKA 1DTLA 3OP0A 3O4XA 2LVJA 1MXEA 2GGZA 2LP3A 1K94A 1MUXA 1UHHA 1W9ZA 1TTXA 5F6TA 1JSAA 1NWDA 1Y0VH 3TDZA 2JULA 1CDLA 2JT3A 4GFTA 3I5FC 1JFJA 1AVSA 1U5IB 2MAZA 3S0AA 1TNWA 2BCXA 3I5HC 3PALA 2M1KB 2LM5A 2WORA 1NPQA 3I5FB 5KTYA 3PLFB 5EL2A 2KBIA 4HRGA 1CM1A 1QIVA 2PALA 4MRYA 3B88A 1JC2A 3CR4X 3O78A 3PM8A 2KNEA 3AAKA 4N5XA 2L0PA 1KSOA 2PSRA 1S1EA 2F8PA 2KI6C 1HT9A 2LVKA 2EC6C 3A8RA 3NHTA 3V2LA 1OOJA 2LHIA 3NSIA 3O6BA 2JTZA 5AANA 1J7OA 1A75B 5I2QA 3CS1A 1K9PA 3TUYB 1F54A 3FE8A 2LLUA 4ORCB 1FBVA 1VRKA 1IGVA 3CZTX 1GGWA 3D77A 1AHRA 1KK8C 2CNPA 2TN4A 3FE9A 1SCMC 5D3OA 1DEKA 1J7QA 3HCMA 2Q4UA 1V1GA 2RGIA 3CZ2A 5I94A 1DT7B 2GTEA 1J55A 2M3WA 2V53A 1A4PA 3WHTB 2L5YA 1XFZO 3SIBA 1UUSA 5CSNA 1PSBA 1HQVA 1KK8B 3EK4A 3NGVA 1IIOA 1J7RA 1KSMA 2JZIA 1SL8A 2JXLA 3EG5B 3PSRA 3NHIA 4DRWA 4JPZB 1TUZA 1AUIB 3D78A 1DGVA 2ERBA 1C7WA 1L2OC 1WDCB 2D8NA 2FJUB 2IS9A 4I5JA 4ETOA 2BAPA 1XFUO 2B1UA 2H8VA 1IRJA 3D10A 2KLEA 3PN7B 1CLMA 2NLNA 4N1GA 1G8IA 2E30A 4PCWA 4PDZA 1KQMC 4KYNA 1QS7A 1M46A 1YVLA 2CBLA 3R1OA 4N1FA 2P70A 5HKYA 1NX1A 1CFDA 4L9MA 2QEBA 2MHHA 2WCLA 4I5LB 4DUQA 3ZNIA 2FOTA 3N7HA 3S0GA 2Y4QA 4M2PA 2Y1NA 2ISDA 2WCJA 1KQMB 2QEVA 3GK4X 3DD4A 3UNWA 2I2RE 2BBMA 3DVEA 3GK2A 4NDCA 1JWDA 1ODBA 1B47A 1XYDA 2PRUA 2QEOA 4PE0A 4C0JA 2M1UA 4NDDA 1B7TY 1S5GY 2H61A 2OS8C 5HLOA 5BPJA 1QATA 1C3YA 1H4BA 2O60A 1TRFA 1W7IB 1OMVA 2LAPA 1N0YA 2CTNA 2WCMA 3CTNA 3SJSA 4C0KA 1R2UA 2K2AA 2LMUA 3CABA 1GM0A 2HQ8A 3BOWA 2PMYA 3DF0B 1OOIX 3EK7A 1AK8A 3D76A 1CDNA 2BKHB 1EH2A 1M31A 1YVHA 4XJKB 1QIWA 1CM4A 4ICBA 1XO5A 1CFFA 1G33A 1TOPA 1F4QA 2KFHA 5DKNA 4Q04A 2ZN9A 3R1VA 3TDIA 1YTZC 4DIRA 5I2OA 1ZOTB 1FF1A 2L50A 3L4AA 4USLA 2WCHA 1BT6A 4YI8A 5K89A 1DMOA 5DKRA 2MBXA 1OMDA 1UP5A 1Y1UA 4HRHA 3F45A 1MF8B 2WNDA 2G2BA 2K7CA
chains in the Genus database with same CATH topology
2MLEC 1LKJA 3D0YB 1JF0A 1KWOC 4OCIA 3PATA 4YGAA 1L7ZA 1KFUL 1F70A 1W7JB 1U5IA 2JQ6A 2L5XB 1LXFC 2LV7A 1JUOA 3DVMA 1SW8A 1XK4A 2M8UA 2L4IA 1CFPA 3OX6A 3BUMB 5IBWA 2SCPA 1FW4A 2QACA 3JTDC 2JNFA 1NX3A 1F71A 1PULA 1NCZA 1EJ3A 1NYAA 1Y1AA 1S36A 1CMFA 2LUCA 1XK4C 2HF5A 2KSPA 2L51A 3IQOA 5G08A 4QJ4B 3JTDB 4OR9B 1X02A 2JU0A 1GGZA 3KEVA 1BLQA 1B9AA 3LK0A 2BCAA 1A75A 4GPLB 3BXKA 2ZNEA 2KFFA 1B1GA 4GBAA 2KFGA 3JVTB 2EGDA 1DVIA 1Y6WA 2MLFC 1XFXO 2LNKA 2CXJA 1JF2A 4ORBB 2JNXA 4YRUA 1MXLC 2GV5A 1DF0B 5AXIA 1YUTA 4PHNA 3SG5A 4NQGA 3CLNA 3H4SE 1CNPA 1OSAA 3TUYC 1B8CA 4PALA 2L98A 2JT0A 1OQPA 3CGAA 4OVNF 3WXAA 1K2HA 1NCXA 1BJFA 3TS5C 1TNQA 4PHKA 2LLTA 2I94A 4GNKB 1S6IA 3LK1A 1IG5A 2LUXA 1LA3A 3CR5X 1YR5A 4M2OA 5CSIA 3TS5B 4JWQA 2K61A 3NSOA 4MZKA 2K7OA 2KYCA 2M49B 4YGCB 2I18A 1WDCC 3EKJA 1BMOA 1QJTA 1SL7A 3M0WA 5DKQA 1QV1A 2HPSA 4YI9A 3O2PA 1UHIA 1DJXA 4YGDB 1QX5B 1K8UA 1ALVA 1TCOB 2WCFA 3I5IC 3PN7C 4HREE 1LVCD 1SCVA 2NCPA 4GGFA 1K95A 3SIAA 4DS7A 3BQ3A 2M7LA 3VRNA 3NSLA 1TN4A 2JC2A 1N65A 3I5IB 2KI6D 1NUBA 1J7PA 2FCEA 2ZRSA 5JJGA 1AJ4A 1BU3A 1ZMZA 2LLSA 2BE6A 3AKBA 4GGFC 1H8BA 2LP2A 2GGMA 3BUXB 4E68A 1AJ5A 4CLNA 4OKHA 1PSRA 3DF0A 3IQQA 3EVUA 2F2PA 2H2KA 4YGBB 3VRQA 2KQYA 4XJKA 3GOFA 4CFRA 1QVIY 2ZFDA 1FI5A 1YURA 2KI4C 1TNXA 1JBAA 2ZN8A 1XFYO 5TNCA 2P6BB 2WCBA 1UHJA 1BG1A 4U8DA 4PHJA 1QVIZ 2K2FA 1S26D 1RECA 1WLMA 2Q91A 2KI4B 1PVBA 4FTGA 1E8AA 2KAXA 1JSAA 1EG4A 1S6CA 2Y5IA 3QRXA 5KU1A 1B7TZ 1S5GZ 3BYAA 1S3PA 3AKAA 4ZCVA 3O4YA 5ER5A 3D0YA 3SG7A 4TNCA 2JT8A 1PALA 2A4JA 1BODA 2MA2A 3RM1A 2M0RA 3BUOB 1RJVA 3AAJA 1KK7Y 2L4HA 2MJWB 1TCFA 3SG4A 3VGOA 1QX7A 1KFXS 1SK6D 2BKIB 1CTRA 2F2OA 1C7VA 1LA0A 2LMVA 1TIZA 1FPWA 4F0ZB 1YUSA 1SMGA 4A4BA 4M2QA 1BR1B 2ZRTA 1RROA 1NIWA 3OX5A 4NDBA 3C1VA 2LE9B 1OZSA 1CMGA 2NCOA 1EXRA 2SASA 2WOSA 1B8RA 1DJIA 2E6WA 2JWWA 2R2IA 1G4YR 4MN0A 1Y1XA 2KQ6A 4BY4A 1F55A 2PVBA 2BBNA 1BF5A 2QPTA 4AOMA 1F4OA 2MRDA 1GJYA 4PE4A 1EG3A 4AQIA 1KCYA 1XA5A 3OB2B 2M29A 1QXPA 5I8NA 4P5OE 4UPGA 1DF0A 3ICBA 2BL0C 3IF7A 1UURA 1NX2A 1OMRA 3FWBA 1XFVO 2BCBA 2WC8A 1FI6A 2KGBC 3JVTC 3TDUA 2ZNDA 2BE4A 2M7NA 1IQ5A 4WQ3A 1QLSA 2BL0B 3BUNB 1SKTA 4YGEB 1XVJA 2M97A 1DJHA 3EK8A 3DVKA 1M45A 1SR6B 5HKZA 1MWNA 4ORAB 1IWQA 1CDMA 5HLVA 1A29A 1IJ6A 1QX2A 4XYNA 1DJZA 2KHNA 1NCYA 2AAOA 4CIDA 4FQOA 3E3RA 2KGRA 3ZWHA 1YRTB 1QTXA 1KFUS 5JOLA 2AUCA 5HYDA 3I5GC 2K8MB 1K9UA 1EL4A 1ZFSA 1N2DA 2KYFA 4I5LB 1RTP1 1GQMA 1IH0A 1ALWA 1SRAA 1PK0D 3LLEA 3OB1B 1WY9A 2M9GA 3DVJA 3K21A 2JRFA 4MZLA 3WNXB 4CPVA 2VRGA 1IQ3A 2Y1MA 1BOCA 3I5GB 1SY9A 2LMTA 4WRIA 3I5HB 4PE1A 1C07A 3VRRA 2JPTA 1KQVA 5D7FA 3RLZA 5HKWA 2PASA 1JFKA 3WHUB 1YX8A 1D1OA 1RFJA 4MRXA 2KAVA 1K93D 2JXCA 1B4CA 1MHOA 2EHBA 5CSJA 1K9KA 1WRZA 4GGNA 1ZUZA 3PFVA 4R1EA 2KDHA 2CT9A 4OV2A 2ZKMX 1A2XA 1PRWA 3MSEB 4IL1A 2LCPA 2F3YA 1A03A 3KHEA 1K90D 2EC6B 4P2YB 1F8HA 1OE9B 1LINA 4D1EA 2CCMA 2JOJA 4CFQA 1MQ1A 4HSZA 1IJ5A 1SCMB 1DJGA 1NX0A 2K7BA 3BUWB 3LL8B 4PHMA 5J3XA 3HX4A 1M39A 2HETA 1UHKA 5PALA 1KFXL 1TNPA 1YUUA 3VRPA 2LC5A 1J1EA 2O5GA 3KF9A 1AP4A 2G9BA 4MZJA 2LHLA 1L2OB 3FS7A 3SG6A 2LANA 1IKUA 5ER4X 4MBEA 2AMIA 1SL9A 2KAYA 1ZACA 3LCPC 1SYMA 4I5NB 4A4CA 1YRUB 1QV0A 1V1FA 4QJ5B 4YBHB 4AQJA 2FCDA 1NP8A 3GK1A 1NSHA 4C0LA 1B8LA 1OZOA 1RWYA 2BECA 2COLB 1DJWA 3SG2A 1DJYA 3FIAA 1KK7Z 3KPXA 5CPVA 2OTGC 1WRLA 1CKKA 2KOTA 2WCEA 5AERA 3EVRA 2NZ0A 1CLLA 3EVVA 1PVAA 1J1DA 1RK9A 2OS8B 2HQWA 1S6JA 3NXAA 5KSZA 2OTGB 4MEWA 3A4UB 1WLZA 4ZCUA 2H61C 3FWCA 1R6PA 3NSKA 4I5KA 4GAOA 2LVIA 5CSFA 5AFPA 5AEQA 2OPOA 1MR8A 2JTTA 2F33A 1BR4B 5D69A 2NXQA 1WRKA 4WQ2A 1SBJA 2I7AA 2L2EA 2K7DA 1QASA 2DOQA 3EKHA 3VROA 2F3ZA 3KO0A 1Q80A 1UWOA 2KBMA 3BOWB 1CFCA 4JQ0D 3CR2A 4MVFA 1SNLA 2K0JA 4PE7A 2LVVA 5GQQC 4DCKA 4QJ3B 1CDPA 1YX7A 3OHMB 1UHNA 5FYXA 5I2LA 3SG3A 4BY5A 3CWGA 1SR6C 1M63B 1DGUA 1SPYA 4GUKA 3TZ1A 1XFWO 1CB1A 4MSPA 1KWOB 1CLBA 4MLWA 1K96A 5B8IB 1QLKA 1DTLA 3OP0A 2LVJA 1MXEA 2GGZA 2LP3A 1K94A 1MUXA 1UHHA 1TTXA 5F6TA 1NWDA 1Y0VH 3TDZA 2JULA 1CDLA 2JT3A 4GFTA 3I5FC 1JFJA 1AVSA 1U5IB 2MAZA 1TNWA 2BCXA 3I5HC 3PALA 2M1KB 2LM5A 2WORA 1NPQA 3I5FB 5KTYA 3PLFB 2KBIA 4HRGA 1CM1A 1QIVA 2PALA 4MRYA 1JC2A 3CR4X 3O78A 3PM8A 2KNEA 3AAKA 4N5XA 2L0PA 1KSOA 2PSRA 1S1EA 2F8PA 2KI6C 1HT9A 2LVKA 2EC6C 3A8RA 1OOJA 2LHIA 3NSIA 3O6BA 2JTZA 5AANA 1J7OA 1A75B 5I2QA 3CS1A 1K9PA 3TUYB 1F54A 2LLUA 4ORCB 1FBVA 1VRKA 1IGVA 3CZTX 1GGWA 1AHRA 1KK8C 2CNPA 2TN4A 1SCMC 1J7QA 3HCMA 2Q4UA 1V1GA 2RGIA 1DT7B 1J55A 2M3WA 2V53A 1A4PA 3WHTB 1XFZO 3SIBA 1UUSA 5CSNA 1PSBA 1HQVA 1KK8B 3EK4A 1J7RA 1KSMA 2JZIA 1SL8A 2JXLA 3PSRA 4DRWA 4JPZB 1AUIB 1DGVA 1C7WA 1L2OC 1WDCB 2D8NA 2FJUB 2IS9A 4I5JA 4ETOA 1XFUO 2B1UA 1IRJA 3D10A 3PN7B 1CLMA 2NLNA 4N1GA 1G8IA 2E30A 4PCWA 4PDZA 1KQMC 1QS7A 2CBLA 1M46A 1YVLA 4N1FA 5HKYA 1NX1A 1CFDA 4L9MA 2MHHA 4DUQA 3ZNIA 2FOTA 2Y4QA 4M2PA 2Y1NA 2ISDA 1KQMB 3GK4X 3DD4A 2I2RE 2BBMA 3DVEA 3GK2A 4NDCA 1JWDA 1ODBA 1B47A 1XYDA 2PRUA 4PE0A 4C0JA 2M1UA 4NDDA 1B7TY 1S5GY 2H61A 2OS8C 5HLOA 5BPJA 1QATA 1H4BA 2O60A 1TRFA 1W7IB 1OMVA 2LAPA 1N0YA 2CTNA 3CTNA 3SJSA 4C0KA 1R2UA 2K2AA 2LMUA 2HQ8A 3BOWA 2PMYA 3DF0B 3EK7A 1AK8A 1CDNA 2BKHB 1EH2A 1M31A 1YVHA 4XJKB 1QIWA 1CM4A 4ICBA 1XO5A 1CFFA 1G33A 1TOPA 1F4QA 2KFHA 5DKNA 4Q04A 2ZN9A 3TDIA 1YTZC 4DIRA 5I2OA 1ZOTB 1FF1A 2L50A 4USLA 4YI8A 1BT6A 5K89A 1DMOA 5DKRA 2MBXA 1OMDA 1UP5A 1Y1UA 4HRHA 3F45A 1MF8B 2WNDA 2G2BA 2K7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLE C;  1LKJ A;  3D0Y B;  1JF0 A;  1KWO C;  4OCI A;  3PAT A;  4YGA A;  1L7Z A;  1KFU L;  1F70 A;  1W7J B;  1U5I A;  2JQ6 A;  2L5X B;  1LXF C;  2LV7 A;  1JUO A;  3DVM A;  1SW8 A;  1XK4 A;  2M8U A;  2L4I A;  1CFP A;  3OX6 A;  3BUM B;  5IBW A;  2SCP A;  1FW4 A;  2QAC A;  3JTD C;  2JNF A;  1NX3 A;  1F71 A;  1PUL A;  1NCZ A;  1EJ3 A;  1NYA A;  1Y1A A;  1S36 A;  1CMF A;  2LUC A;  1XK4 C;  2HF5 A;  2KSP A;  2L51 A;  3IQO A;  5G08 A;  4QJ4 B;  3JTD B;  4OR9 B;  1X02 A;  2JU0 A;  1GGZ A;  3KEV A;  1BLQ A;  1B9A A;  3LK0 A;  2BCA A;  1A75 A;  4GPL B;  3BXK A;  2ZNE A;  2KFF A;  1B1G A;  4GBA A;  2KFG A;  3JVT B;  2EGD A;  1DVI A;  1Y6W A;  2MLF C;  1XFX O;  2LNK A;  2CXJ A;  1JF2 A;  4ORB B;  2JNX A;  4YRU A;  1MXL C;  2GV5 A;  1DF0 B;  5AXI A;  1YUT A;  4PHN A;  3SG5 A;  4NQG A;  3CLN A;  3H4S E;  1CNP A;  1OSA A;  3TUY C;  1B8C A;  4PAL A;  2L98 A;  2JT0 A;  1OQP A;  3CGA A;  4OVN F;  3WXA A;  1K2H A;  1NCX A;  1BJF A;  3TS5 C;  1TNQ A;  4PHK A;  2LLT A;  2I94 A;  4GNK B;  1S6I A;  3LK1 A;  1IG5 A;  2LUX A;  1LA3 A;  3CR5 X;  1YR5 A;  4M2O A;  5CSI A;  3TS5 B;  4JWQ A;  2K61 A;  3NSO A;  4MZK A;  2K7O A;  2KYC A;  2M49 B;  4YGC B;  2I18 A;  1WDC C;  3EKJ A;  1BMO A;  1QJT A;  1SL7 A;  3M0W A;  5DKQ A;  1QV1 A;  2HPS A;  4YI9 A;  3O2P A;  1UHI A;  1DJX A;  4YGD B;  1QX5 B;  1K8U A;  1ALV A;  1TCO B;  2WCF A;  3I5I C;  3PN7 C;  4HRE E;  1LVC D;  1SCV A;  2NCP A;  4GGF A;  1K95 A;  3SIA A;  4DS7 A;  3BQ3 A;  2M7L A;  3VRN A;  3NSL A;  1TN4 A;  2JC2 A;  1N65 A;  3I5I B;  2KI6 D;  1NUB A;  1J7P A;  2FCE A;  2ZRS A;  5JJG A;  1AJ4 A;  1BU3 A;  1ZMZ A;  2LLS A;  2BE6 A;  3AKB A;  4GGF C;  1H8B A;  2LP2 A;  2GGM A;  3BUX B;  4E68 A;  1AJ5 A;  4CLN A;  4OKH A;  1PSR A;  3DF0 A;  3IQQ A;  3EVU A;  2F2P A;  2H2K A;  4YGB B;  3VRQ A;  2KQY A;  4XJK A;  3GOF A;  4CFR A;  1QVI Y;  2ZFD A;  1FI5 A;  1YUR A;  2KI4 C;  1TNX A;  1JBA A;  2ZN8 A;  1XFY O;  5TNC A;  2P6B B;  2WCB A;  1UHJ A;  1BG1 A;  4U8D A;  4PHJ A;  1QVI Z;  2K2F A;  1S26 D;  1REC A;  1WLM A;  2Q91 A;  2KI4 B;  1PVB A;  4FTG A;  1E8A A;  2KAX A;  1JSA A;  1EG4 A;  1S6C A;  2Y5I A;  3QRX A;  5KU1 A;  1B7T Z;  1S5G Z;  3BYA A;  1S3P A;  3AKA A;  4ZCV A;  3O4Y A;  5ER5 A;  3D0Y A;  3SG7 A;  4TNC A;  2JT8 A;  1PAL A;  2A4J A;  1BOD A;  2MA2 A;  3RM1 A;  2M0R A;  3BUO B;  1RJV A;  3AAJ A;  1KK7 Y;  2L4H A;  2MJW B;  1TCF A;  3SG4 A;  3VGO A;  1QX7 A;  1KFX S;  1SK6 D;  2BKI B;  1CTR A;  2F2O A;  1C7V A;  1LA0 A;  2LMV A;  1TIZ A;  1FPW A;  4F0Z B;  1YUS A;  1SMG A;  4A4B A;  4M2Q A;  1BR1 B;  2ZRT A;  1RRO A;  1NIW A;  3OX5 A;  4NDB A;  3C1V A;  2LE9 B;  1OZS A;  1CMG A;  2NCO A;  1EXR A;  2SAS A;  2WOS A;  1B8R A;  1DJI A;  2E6W A;  2JWW A;  2R2I A;  1G4Y R;  4MN0 A;  1Y1X A;  2KQ6 A;  4BY4 A;  1F55 A;  2PVB A;  2BBN A;  1BF5 A;  2QPT A;  4AOM A;  1F4O A;  2MRD A;  1GJY A;  4PE4 A;  1EG3 A;  4AQI A;  1KCY A;  1XA5 A;  3OB2 B;  2M29 A;  1QXP A;  5I8N A;  4P5O E;  4UPG A;  1DF0 A;  3ICB A;  2BL0 C;  3IF7 A;  1UUR A;  1NX2 A;  1OMR A;  3FWB A;  1XFV O;  2BCB A;  2WC8 A;  1FI6 A;  2KGB C;  3JVT C;  3TDU A;  2ZND A;  2BE4 A;  2M7N A;  1IQ5 A;  4WQ3 A;  1QLS A;  2BL0 B;  3BUN B;  1SKT A;  4YGE B;  1XVJ A;  2M97 A;  1DJH A;  3EK8 A;  3DVK A;  1M45 A;  1SR6 B;  5HKZ A;  1MWN A;  4ORA B;  1IWQ A;  1CDM A;  5HLV A;  1A29 A;  1IJ6 A;  1QX2 A;  4XYN A;  1DJZ A;  2KHN A;  1NCY A;  2AAO A;  4CID A;  4FQO A;  3E3R A;  2KGR A;  3ZWH A;  1YRT B;  1QTX A;  1KFU S;  5JOL A;  2AUC A;  5HYD A;  3I5G C;  2K8M B;  1K9U A;  1EL4 A;  1ZFS A;  1N2D A;  2KYF A;  4I5L B;  1RTP 1;  1GQM A;  1IH0 A;  1ALW A;  1SRA A;  1PK0 D;  3LLE A;  3OB1 B;  1WY9 A;  2M9G A;  3DVJ A;  3K21 A;  2JRF A;  4MZL A;  3WNX B;  4CPV A;  2VRG A;  1IQ3 A;  2Y1M A;  1BOC A;  3I5G B;  1SY9 A;  2LMT A;  4WRI A;  3I5H B;  4PE1 A;  1C07 A;  3VRR A;  2JPT A;  1KQV A;  5D7F A;  3RLZ A;  5HKW A;  2PAS A;  1JFK A;  3WHU B;  1YX8 A;  1D1O A;  1RFJ A;  4MRX A;  2KAV A;  1K93 D;  2JXC A;  1B4C A;  1MHO A;  2EHB A;  5CSJ A;  1K9K A;  1WRZ A;  4GGN A;  1ZUZ A;  3PFV A;  4R1E A;  2KDH A;  2CT9 A;  4OV2 A;  2ZKM X;  1A2X A;  1PRW A;  3MSE B;  4IL1 A;  2LCP A;  2F3Y A;  1A03 A;  3KHE A;  1K90 D;  2EC6 B;  4P2Y B;  1F8H A;  1OE9 B;  1LIN A;  4D1E A;  2CCM A;  2JOJ A;  4CFQ A;  1MQ1 A;  4HSZ A;  1IJ5 A;  1SCM B;  1DJG A;  1NX0 A;  2K7B A;  3BUW B;  3LL8 B;  4PHM A;  5J3X A;  3HX4 A;  1M39 A;  2HET A;  1UHK A;  5PAL A;  1KFX L;  1TNP A;  1YUU A;  3VRP A;  2LC5 A;  1J1E A;  2O5G A;  3KF9 A;  1AP4 A;  2G9B A;  4MZJ A;  2LHL A;  1L2O B;  3FS7 A;  3SG6 A;  2LAN A;  1IKU A;  5ER4 X;  4MBE A;  2AMI A;  1SL9 A;  2KAY A;  1ZAC A;  3LCP C;  1SYM A;  4I5N B;  4A4C A;  1YRU B;  1QV0 A;  1V1F A;  4QJ5 B;  4YBH B;  4AQJ A;  2FCD A;  1NP8 A;  3GK1 A;  1NSH A;  4C0L A;  1B8L A;  1OZO A;  1RWY A;  2BEC A;  2COL B;  1DJW A;  3SG2 A;  1DJY A;  3FIA A;  1KK7 Z;  3KPX A;  5CPV A;  2OTG C;  1WRL A;  1CKK A;  2KOT A;  2WCE A;  5AER A;  3EVR A;  2NZ0 A;  1CLL A;  3EVV A;  1PVA A;  1J1D A;  1RK9 A;  2OS8 B;  2HQW A;  1S6J A;  3NXA A;  5KSZ A;  2OTG B;  4MEW A;  3A4U B;  1WLZ A;  4ZCU A;  2H61 C;  3FWC A;  1R6P A;  3NSK A;  4I5K A;  4GAO A;  2LVI A;  5CSF A;  5AFP A;  5AEQ A;  2OPO A;  1MR8 A;  2JTT A;  2F33 A;  1BR4 B;  5D69 A;  2NXQ A;  1WRK A;  4WQ2 A;  1SBJ A;  2I7A A;  2L2E A;  2K7D A;  1QAS A;  2DOQ A;  3EKH A;  3VRO A;  2F3Z A;  3KO0 A;  1Q80 A;  1UWO A;  2KBM A;  3BOW B;  1CFC A;  4JQ0 D;  3CR2 A;  4MVF A;  1SNL A;  2K0J A;  4PE7 A;  2LVV A;  5GQQ C;  4DCK A;  4QJ3 B;  1CDP A;  1YX7 A;  3OHM B;  1UHN A;  5FYX A;  5I2L A;  3SG3 A;  4BY5 A;  3CWG A;  1SR6 C;  1M63 B;  1DGU A;  1SPY A;  4GUK A;  3TZ1 A;  1XFW O;  1CB1 A;  4MSP A;  1KWO B;  1CLB A;  4MLW A;  1K96 A;  5B8I B;  1QLK A;  1DTL A;  3OP0 A;  2LVJ A;  1MXE A;  2GGZ A;  2LP3 A;  1K94 A;  1MUX A;  1UHH A;  1TTX A;  5F6T A;  1NWD A;  1Y0V H;  3TDZ A;  2JUL A;  1CDL A;  2JT3 A;  4GFT A;  3I5F C;  1JFJ A;  1AVS A;  1U5I B;  2MAZ A;  1TNW A;  2BCX A;  3I5H C;  3PAL A;  2M1K B;  2LM5 A;  2WOR A;  1NPQ A;  3I5F B;  5KTY A;  3PLF B;  2KBI A;  4HRG A;  1CM1 A;  1QIV A;  2PAL A;  4MRY A;  1JC2 A;  3CR4 X;  3O78 A;  3PM8 A;  2KNE A;  3AAK A;  4N5X A;  2L0P A;  1KSO A;  2PSR A;  1S1E A;  2F8P A;  2KI6 C;  1HT9 A;  2LVK A;  2EC6 C;  3A8R A;  1OOJ A;  2LHI A;  3NSI A;  3O6B A;  2JTZ A;  5AAN A;  1J7O A;  1A75 B;  5I2Q A;  3CS1 A;  1K9P A;  3TUY B;  1F54 A;  2LLU A;  4ORC B;  1FBV A;  1VRK A;  1IGV A;  3CZT X;  1GGW A;  1AHR A;  1KK8 C;  2CNP A;  2TN4 A;  1SCM C;  1J7Q A;  3HCM A;  2Q4U A;  1V1G A;  2RGI A;  1DT7 B;  1J55 A;  2M3W A;  2V53 A;  1A4P A;  3WHT B;  1XFZ O;  3SIB A;  1UUS A;  5CSN A;  1PSB A;  1HQV A;  1KK8 B;  3EK4 A;  1J7R A;  1KSM A;  2JZI A;  1SL8 A;  2JXL A;  3PSR A;  4DRW A;  4JPZ B;  1AUI B;  1DGV A;  1C7W A;  1L2O C;  1WDC B;  2D8N A;  2FJU B;  2IS9 A;  4I5J A;  4ETO A;  1XFU O;  2B1U A;  1IRJ A;  3D10 A;  3PN7 B;  1CLM A;  2NLN A;  4N1G A;  1G8I A;  2E30 A;  4PCW A;  4PDZ A;  1KQM C;  1QS7 A;  2CBL A;  1M46 A;  1YVL A;  4N1F A;  5HKY A;  1NX1 A;  1CFD A;  4L9M A;  2MHH A;  4DUQ A;  3ZNI A;  2FOT A;  2Y4Q A;  4M2P A;  2Y1N A;  2ISD A;  1KQM B;  3GK4 X;  3DD4 A;  2I2R E;  2BBM A;  3DVE A;  3GK2 A;  4NDC A;  1JWD A;  1ODB A;  1B47 A;  1XYD A;  2PRU A;  4PE0 A;  4C0J A;  2M1U A;  4NDD A;  1B7T Y;  1S5G Y;  2H61 A;  2OS8 C;  5HLO A;  5BPJ A;  1QAT A;  1H4B A;  2O60 A;  1TRF A;  1W7I B;  1OMV A;  2LAP A;  1N0Y A;  2CTN A;  3CTN A;  3SJS A;  4C0K A;  1R2U A;  2K2A A;  2LMU A;  2HQ8 A;  3BOW A;  2PMY A;  3DF0 B;  3EK7 A;  1AK8 A;  1CDN A;  2BKH B;  1EH2 A;  1M31 A;  1YVH A;  4XJK B;  1QIW A;  1CM4 A;  4ICB A;  1XO5 A;  1CFF A;  1G33 A;  1TOP A;  1F4Q A;  2KFH A;  5DKN A;  4Q04 A;  2ZN9 A;  3TDI A;  1YTZ C;  4DIR A;  5I2O A;  1ZOT B;  1FF1 A;  2L50 A;  4USL A;  4YI8 A;  1BT6 A;  5K89 A;  1DMO A;  5DKR A;  2MBX A;  1OMD A;  1UP5 A;  1Y1U A;  4HRH A;  3F45 A;  1MF8 B;  2WND A;  2G2B A;  2K7C A; 
#chains in the Genus database with same CATH topology
 2MLE C;  1LKJ A;  1Z2C B;  3D0Y B;  1JF0 A;  1KWO C;  4OCI A;  2KPH A;  3PAT A;  4YGA A;  1L7Z A;  1KFU L;  2YGU A;  1F70 A;  1W7J B;  1DQE A;  1U5I A;  2JQ6 A;  2L5X B;  1LXF C;  2LV7 A;  1JUO A;  2QDI A;  3DVM A;  1SW8 A;  3OBV A;  3R72 A;  1XK4 A;  2M8U A;  2L4I A;  1CFP A;  3OX6 A;  3BUM B;  5IBW A;  2SCP A;  3BJH A;  1FW4 A;  2QAC A;  3JTD C;  2JNF A;  1NX3 A;  1F71 A;  1PUL A;  1NCZ A;  1EJ3 A;  1NYA A;  1Y1A A;  1S36 A;  2BNX A;  1CMF A;  2LUC A;  1XK4 C;  2HF5 A;  2KSP A;  2L51 A;  3IQO A;  5G08 A;  4QJ4 B;  3JTD B;  4OR9 B;  1X02 A;  2JU0 A;  1GGZ A;  1OOH A;  2L2C A;  3KEV A;  1BLQ A;  1B9A A;  3LK0 A;  2BCA A;  1A75 A;  4GPL B;  3BXK A;  2ZNE A;  2KFF A;  1B1G A;  4GBA A;  2KFG A;  3JVT B;  3B86 A;  2EGD A;  3UO9 A;  1DVI A;  1Y6W A;  2MLF C;  1XFX O;  2LNK A;  2CXJ A;  1JF2 A;  4ORB B;  3IVT A;  2JNX A;  4YRU A;  1MXL C;  2GV5 A;  1DF0 B;  5AXI A;  1YUT A;  4INW A;  4PHN A;  3SG5 A;  4NQG A;  3CLN A;  3H4S E;  1CNP A;  1OSA A;  3TUY C;  1B8C A;  4FQT A;  2L98 A;  2JT0 A;  1OQP A;  3CGA A;  4OVN F;  4PAL A;  3SS5 A;  3WXA A;  1NCX A;  1K2H A;  1DC1 A;  1BJF A;  3TS5 C;  1TNQ A;  4PHK A;  2LLT A;  2I94 A;  4GNK B;  1S6I A;  3LK1 A;  1IG5 A;  2LUX A;  1LA3 A;  3CR5 X;  1YR5 A;  4M2O A;  3DXL A;  5CSI A;  3TS5 B;  4JWQ A;  2K61 A;  3NSO A;  1TWO A;  4MZK A;  2K7O A;  2KYC A;  2M49 B;  4YGC B;  2I18 A;  1WDC C;  3EKJ A;  1BMO A;  1QJT A;  1SL7 A;  3M0W A;  5DKQ A;  1QV1 A;  2HPS A;  3R1P A;  3O2P A;  4YI9 A;  1UHI A;  1DJX A;  4YGD B;  1QX5 B;  1K8U A;  1ALV A;  1TCO B;  2WCF A;  3I5I C;  3PN7 C;  4HRE E;  4IJ7 A;  1LVC D;  1SCV A;  2NCP A;  4GGF A;  1K95 A;  5FI2 A;  2PQL A;  3SIA A;  4DS7 A;  3BQ3 A;  4F7F A;  2M7L A;  3VRN A;  3NSL A;  1TN4 A;  3VB1 A;  2JC2 A;  1N65 A;  3I5I B;  2KI6 D;  1NUB A;  1J7P A;  2FCE A;  2ZRS A;  5JJG A;  1AJ4 A;  1BU3 A;  1ZMZ A;  2LLS A;  2BE6 A;  2FJY A;  2WC6 A;  1SSE B;  3AKB A;  3PM2 A;  4GGF C;  3BFH A;  2LP2 A;  1H8B A;  2GGM A;  3BUX B;  4E68 A;  1AJ5 A;  4CLN A;  4OKH A;  1PSR A;  3DF0 A;  3IQQ A;  3EVU A;  2F2P A;  2H2K A;  4YGB B;  3VRQ A;  2KQY A;  4XJK A;  3GOF A;  4CFR A;  1QVI Y;  2ZFD A;  1FI5 A;  1YUR A;  2KI4 C;  1TNX A;  1QWV A;  1JBA A;  2ZN8 A;  1XFY O;  5TNC A;  2P6B B;  2WCB A;  1UHJ A;  1BG1 A;  4U8D A;  4PHJ A;  3CYZ A;  1QVI Z;  2K2F A;  1S26 D;  1REC A;  2QEH A;  1WLM A;  2K60 A;  2Q91 A;  2KI4 B;  1PVB A;  4FTG A;  1E8A A;  2KAX A;  1T14 A;  3S0D A;  1EG4 A;  1S6C A;  2Y5I A;  3QRX A;  5KU1 A;  1B7T Z;  1S5G Z;  3BYA A;  1S3P A;  3AKA A;  4ZCV A;  3O4Y A;  5ER5 A;  3D0Y A;  3SG7 A;  4TNC A;  2JT8 A;  1PAL A;  2A4J A;  1Z4H A;  1BOD A;  2MA2 A;  3RM1 A;  2M0R A;  3BUO B;  1RJV A;  3AAJ A;  1KK7 Y;  2L4H A;  2MJW B;  3PJI A;  1TCF A;  3SG4 A;  3VGO A;  1QX7 A;  1KFX S;  1SK6 D;  2BKI B;  1CTR A;  2F2O A;  1C7V A;  1LA0 A;  2LMV A;  1TIZ A;  2WC5 A;  1FPW A;  4F0Z B;  1YUS A;  1SMG A;  4A4B A;  4M2Q A;  3B87 A;  1BR1 B;  2ZRT A;  1RRO A;  1NIW A;  3OX5 A;  4NDB A;  3C1V A;  2LE9 B;  1OZS A;  1CMG A;  1C3Z A;  1EXR A;  2NCO A;  2SAS A;  2WOS A;  1B8R A;  1DJI A;  2E6W A;  2JWW A;  5FI6 A;  2R2I A;  1G4Y R;  4MN0 A;  1Y1X A;  2KQ6 A;  4BY4 A;  1F55 A;  2PVB A;  2BBN A;  1BF5 A;  2QPT A;  4AOM A;  3DZT A;  1F4O A;  2MRD A;  1GJY A;  4PE4 A;  1EG3 A;  4AQI A;  1OW4 A;  1KCY A;  1XA5 A;  3OB2 B;  2M29 A;  1QXP A;  5I8N A;  4P5O E;  4UPG A;  3OGN A;  1DF0 A;  3ICB A;  2BL0 C;  3IF7 A;  1UUR A;  1NX2 A;  1OMR A;  3FWB A;  1XFV O;  2BCB A;  2WC8 A;  1FI6 A;  2KGB C;  3JVT C;  3TDU A;  2ZND A;  2BE4 A;  2M7N A;  1IQ5 A;  3Q8I A;  4WQ3 A;  1QLS A;  2BL0 B;  3BUN B;  1SKT A;  4YGE B;  1XVJ A;  2M97 A;  1DJH A;  3EK8 A;  3CZ1 A;  3DVK A;  1LS8 A;  1M45 A;  1SR6 B;  5HKZ A;  1MWN A;  4ORA B;  1IWQ A;  2PYQ A;  3D75 A;  1CDM A;  5HLV A;  1A29 A;  1IJ6 A;  1QX2 A;  4JKT A;  4XYN A;  1DJZ A;  2KHN A;  1NCY A;  2JPO A;  3S0B A;  2AAO A;  4CID A;  4PT1 A;  2WCK A;  3S0F A;  4FQO A;  3E3R A;  2KGR A;  3K1E A;  1YRT B;  1QTX A;  1KFU S;  5JOL A;  3ZWH A;  2AUC A;  5HYD A;  3I5G C;  2K8M B;  1K9U A;  1EL4 A;  1ZFS A;  1N2D A;  2KYF A;  3DY9 A;  1RTP 1;  1GQM A;  1ORG A;  1IH0 A;  1ALW A;  1SRA A;  1PK0 D;  3LLE A;  3OB1 B;  1WY9 A;  2M9G A;  3DVJ A;  3K21 A;  2JRF A;  4MZL A;  3WNX B;  4CPV A;  2VRG A;  1IQ3 A;  2Y1M A;  1BOC A;  3I5G B;  1SY9 A;  2LMT A;  3BFA A;  4WRI A;  3I5H B;  4PE1 A;  1C07 A;  3VRR A;  2JPT A;  1KQV A;  5D7F A;  5DIC A;  5HKW A;  3RLZ A;  2PAS A;  3B6X A;  1JFK A;  3WHU B;  1YX8 A;  1D1O A;  1RFJ A;  4MRX A;  2KAV A;  1K93 D;  2JXC A;  1B4C A;  1MHO A;  2EHB A;  5CSJ A;  1K9K A;  1WRZ A;  4GGN A;  1ZUZ A;  3QME A;  3PFV A;  3D73 A;  4R1E A;  2KDH A;  1TUJ A;  2CT9 A;  4OV2 A;  2ZKM X;  1A2X A;  1PRW A;  3MSE B;  4IL1 A;  2LCP A;  2F3Y A;  1A03 A;  3KHE A;  1K90 D;  2EC6 B;  4P2Y B;  1F8H A;  1OE9 B;  1LIN A;  1OOG A;  4D1E A;  2CCM A;  2JOJ A;  3L47 A;  4CFQ A;  1MQ1 A;  3B7A A;  4HSZ A;  1IJ5 A;  1SCM B;  1DJG A;  1NX0 A;  3CZ0 A;  2K7B A;  3BUW B;  3LL8 B;  4PHM A;  5J3X A;  3HX4 A;  1M39 A;  2HET A;  1UHK A;  5PAL A;  1KFX L;  1TNP A;  1YUU A;  3FE6 A;  3VRP A;  2LC5 A;  1J1E A;  3CDN A;  5FI7 A;  2O5G A;  3SS3 A;  3KF9 A;  1AP4 A;  2G9B A;  4MZJ A;  2LHL A;  1L2O B;  3FS7 A;  3SG6 A;  2LAN A;  1IKU A;  5ER4 X;  4MBE A;  3DYE A;  2AMI A;  1DEL A;  1SL9 A;  2KAY A;  1ZAC A;  3LCP C;  1SYM A;  4I5N B;  1P28 A;  4A4C A;  1YRU B;  1QV0 A;  1V1F A;  4QJ5 B;  4YBH B;  1XFR A;  3BFB A;  3S0E A;  4INX A;  4AQJ A;  2FCD A;  1NP8 A;  3GK1 A;  1NSH A;  4C0L A;  1B8L A;  1OZO A;  1RWY A;  1OOF A;  2BEC A;  2COL B;  1DJW A;  3SG2 A;  1DJY A;  3FIA A;  1KK7 Z;  3KPX A;  5CPV A;  2OTG C;  1WRL A;  1CKK A;  2KOT A;  3D74 A;  2WCE A;  2P71 A;  5AER A;  3EVR A;  2NZ0 A;  1CLL A;  3EVV A;  1PVA A;  1J1D A;  1RK9 A;  2OS8 B;  2HQW A;  1S6J A;  3NXA A;  4JD9 A;  3SS4 A;  2OTG B;  4MEW A;  5KSZ A;  3A4U B;  1WLZ A;  4ZCU A;  2H61 C;  3FWC A;  1R6P A;  3NSK A;  4I5K A;  4GAO A;  2LVI A;  5CSF A;  5AFP A;  5AEQ A;  2OPO A;  1MR8 A;  2JTT A;  2F33 A;  1BR4 B;  5D69 A;  2NXQ A;  1WRK A;  5HL1 A;  4WQ2 A;  3RZS A;  1SBJ A;  2I7A A;  2L2E A;  2K7D A;  1QAS A;  2DOQ A;  3EKH A;  3VRO A;  2F3Z A;  3KO0 A;  1Q80 A;  1UWO A;  2KBM A;  3BOW B;  1CFC A;  4JQ0 D;  3CR2 A;  4MVF A;  1SNL A;  2K0J A;  4PE7 A;  2LVV A;  5GQQ C;  4DCK A;  4QJ3 B;  1CDP A;  1YX7 A;  3OHM B;  1UHN A;  5FYX A;  5I2L A;  3SG3 A;  3L4L A;  4BY5 A;  3CWG A;  2KLD A;  1SR6 C;  1M63 B;  1DGU A;  1SPY A;  4GUK A;  4OZD A;  3TZ1 A;  1XFW O;  1CB1 A;  4MSP A;  1KWO B;  1CLB A;  4MLW A;  1K96 A;  5B8I B;  1QLK A;  1DTL A;  3OP0 A;  3O4X A;  2LVJ A;  1MXE A;  2GGZ A;  2LP3 A;  1K94 A;  1MUX A;  1UHH A;  1W9Z A;  1TTX A;  5F6T A;  1JSA A;  1NWD A;  1Y0V H;  3TDZ A;  2JUL A;  1CDL A;  2JT3 A;  4GFT A;  3I5F C;  1JFJ A;  1AVS A;  1U5I B;  2MAZ A;  3S0A A;  1TNW A;  2BCX A;  3I5H C;  3PAL A;  2M1K B;  2LM5 A;  2WOR A;  1NPQ A;  3I5F B;  5KTY A;  3PLF B;  5EL2 A;  2KBI A;  4HRG A;  1CM1 A;  1QIV A;  2PAL A;  4MRY A;  3B88 A;  1JC2 A;  3CR4 X;  3O78 A;  3PM8 A;  2KNE A;  3AAK A;  4N5X A;  2L0P A;  1KSO A;  2PSR A;  1S1E A;  2F8P A;  2KI6 C;  1HT9 A;  2LVK A;  2EC6 C;  3A8R A;  3NHT A;  3V2L A;  1OOJ A;  2LHI A;  3NSI A;  3O6B A;  2JTZ A;  5AAN A;  1J7O A;  1A75 B;  5I2Q A;  3CS1 A;  1K9P A;  3TUY B;  1F54 A;  3FE8 A;  2LLU A;  4ORC B;  1FBV A;  1VRK A;  1IGV A;  3CZT X;  1GGW A;  3D77 A;  1AHR A;  1KK8 C;  2CNP A;  2TN4 A;  3FE9 A;  1SCM C;  5D3O A;  1DEK A;  1J7Q A;  3HCM A;  2Q4U A;  1V1G A;  2RGI A;  3CZ2 A;  5I94 A;  1DT7 B;  2GTE A;  1J55 A;  2M3W A;  2V53 A;  1A4P A;  3WHT B;  2L5Y A;  1XFZ O;  3SIB A;  1UUS A;  5CSN A;  1PSB A;  1HQV A;  1KK8 B;  3EK4 A;  3NGV A;  1IIO A;  1J7R A;  1KSM A;  2JZI A;  1SL8 A;  2JXL A;  3EG5 B;  3PSR A;  3NHI A;  4DRW A;  4JPZ B;  1TUZ A;  1AUI B;  3D78 A;  1DGV A;  2ERB A;  1C7W A;  1L2O C;  1WDC B;  2D8N A;  2FJU B;  2IS9 A;  4I5J A;  4ETO A;  2BAP A;  1XFU O;  2B1U A;  2H8V A;  1IRJ A;  3D10 A;  2KLE A;  3PN7 B;  1CLM A;  2NLN A;  4N1G A;  1G8I A;  2E30 A;  4PCW A;  4PDZ A;  1KQM C;  4KYN A;  1QS7 A;  1M46 A;  1YVL A;  2CBL A;  3R1O A;  4N1F A;  2P70 A;  5HKY A;  1NX1 A;  1CFD A;  4L9M A;  2QEB A;  2MHH A;  2WCL A;  4I5L B;  4DUQ A;  3ZNI A;  2FOT A;  3N7H A;  3S0G A;  2Y4Q A;  4M2P A;  2Y1N A;  2ISD A;  2WCJ A;  1KQM B;  2QEV A;  3GK4 X;  3DD4 A;  3UNW A;  2I2R E;  2BBM A;  3DVE A;  3GK2 A;  4NDC A;  1JWD A;  1ODB A;  1B47 A;  1XYD A;  2PRU A;  2QEO A;  4PE0 A;  4C0J A;  2M1U A;  4NDD A;  1B7T Y;  1S5G Y;  2H61 A;  2OS8 C;  5HLO A;  5BPJ A;  1QAT A;  1C3Y A;  1H4B A;  2O60 A;  1TRF A;  1W7I B;  1OMV A;  2LAP A;  1N0Y A;  2CTN A;  2WCM A;  3CTN A;  3SJS A;  4C0K A;  1R2U A;  2K2A A;  2LMU A;  3CAB A;  1GM0 A;  2HQ8 A;  3BOW A;  2PMY A;  3DF0 B;  1OOI X;  3EK7 A;  1AK8 A;  3D76 A;  1CDN A;  2BKH B;  1EH2 A;  1M31 A;  1YVH A;  4XJK B;  1QIW A;  1CM4 A;  4ICB A;  1XO5 A;  1CFF A;  1G33 A;  1TOP A;  1F4Q A;  2KFH A;  5DKN A;  4Q04 A;  2ZN9 A;  3R1V A;  3TDI A;  1YTZ C;  4DIR A;  5I2O A;  1ZOT B;  1FF1 A;  2L50 A;  3L4A A;  4USL A;  2WCH A;  1BT6 A;  4YI8 A;  5K89 A;  1DMO A;  5DKR A;  2MBX A;  1OMD A;  1UP5 A;  1Y1U A;  4HRH A;  3F45 A;  1MF8 B;  2WND A;  2G2B A;  2K7C A; 
#chains in the Genus database with same CATH homology
 2MLE C;  1LKJ A;  3D0Y B;  1JF0 A;  1KWO C;  4OCI A;  3PAT A;  4YGA A;  1L7Z A;  1KFU L;  1F70 A;  1W7J B;  1U5I A;  2JQ6 A;  2L5X B;  1LXF C;  2LV7 A;  1JUO A;  3DVM A;  1SW8 A;  1XK4 A;  2M8U A;  2L4I A;  1CFP A;  3OX6 A;  3BUM B;  5IBW A;  2SCP A;  1FW4 A;  2QAC A;  3JTD C;  2JNF A;  1NX3 A;  1F71 A;  1PUL A;  1NCZ A;  1EJ3 A;  1NYA A;  1Y1A A;  1S36 A;  1CMF A;  2LUC A;  1XK4 C;  2HF5 A;  2KSP A;  2L51 A;  3IQO A;  5G08 A;  4QJ4 B;  3JTD B;  4OR9 B;  1X02 A;  2JU0 A;  1GGZ A;  3KEV A;  1BLQ A;  1B9A A;  3LK0 A;  2BCA A;  1A75 A;  4GPL B;  3BXK A;  2ZNE A;  2KFF A;  1B1G A;  4GBA A;  2KFG A;  3JVT B;  2EGD A;  1DVI A;  1Y6W A;  2MLF C;  1XFX O;  2LNK A;  2CXJ A;  1JF2 A;  4ORB B;  2JNX A;  4YRU A;  1MXL C;  2GV5 A;  1DF0 B;  5AXI A;  1YUT A;  4PHN A;  3SG5 A;  4NQG A;  3CLN A;  3H4S E;  1CNP A;  1OSA A;  3TUY C;  1B8C A;  4PAL A;  2L98 A;  2JT0 A;  1OQP A;  3CGA A;  4OVN F;  3WXA A;  1K2H A;  1NCX A;  1BJF A;  3TS5 C;  1TNQ A;  4PHK A;  2LLT A;  2I94 A;  4GNK B;  1S6I A;  3LK1 A;  1IG5 A;  2LUX A;  1LA3 A;  3CR5 X;  1YR5 A;  4M2O A;  5CSI A;  3TS5 B;  4JWQ A;  2K61 A;  3NSO A;  4MZK A;  2K7O A;  2KYC A;  2M49 B;  4YGC B;  2I18 A;  1WDC C;  3EKJ A;  1BMO A;  1QJT A;  1SL7 A;  3M0W A;  5DKQ A;  1QV1 A;  2HPS A;  4YI9 A;  3O2P A;  1UHI A;  1DJX A;  4YGD B;  1QX5 B;  1K8U A;  1ALV A;  1TCO B;  2WCF A;  3I5I C;  3PN7 C;  4HRE E;  1LVC D;  1SCV A;  2NCP A;  4GGF A;  1K95 A;  3SIA A;  4DS7 A;  3BQ3 A;  2M7L A;  3VRN A;  3NSL A;  1TN4 A;  2JC2 A;  1N65 A;  3I5I B;  2KI6 D;  1NUB A;  1J7P A;  2FCE A;  2ZRS A;  5JJG A;  1AJ4 A;  1BU3 A;  1ZMZ A;  2LLS A;  2BE6 A;  3AKB A;  4GGF C;  1H8B A;  2LP2 A;  2GGM A;  3BUX B;  4E68 A;  1AJ5 A;  4CLN A;  4OKH A;  1PSR A;  3DF0 A;  3IQQ A;  3EVU A;  2F2P A;  2H2K A;  4YGB B;  3VRQ A;  2KQY A;  4XJK A;  3GOF A;  4CFR A;  1QVI Y;  2ZFD A;  1FI5 A;  1YUR A;  2KI4 C;  1TNX A;  1JBA A;  2ZN8 A;  1XFY O;  5TNC A;  2P6B B;  2WCB A;  1UHJ A;  1BG1 A;  4U8D A;  4PHJ A;  1QVI Z;  2K2F A;  1S26 D;  1REC A;  1WLM A;  2Q91 A;  2KI4 B;  1PVB A;  4FTG A;  1E8A A;  2KAX A;  1JSA A;  1EG4 A;  1S6C A;  2Y5I A;  3QRX A;  5KU1 A;  1B7T Z;  1S5G Z;  3BYA A;  1S3P A;  3AKA A;  4ZCV A;  3O4Y A;  5ER5 A;  3D0Y A;  3SG7 A;  4TNC A;  2JT8 A;  1PAL A;  2A4J A;  1BOD A;  2MA2 A;  3RM1 A;  2M0R A;  3BUO B;  1RJV A;  3AAJ A;  1KK7 Y;  2L4H A;  2MJW B;  1TCF A;  3SG4 A;  3VGO A;  1QX7 A;  1KFX S;  1SK6 D;  2BKI B;  1CTR A;  2F2O A;  1C7V A;  1LA0 A;  2LMV A;  1TIZ A;  1FPW A;  4F0Z B;  1YUS A;  1SMG A;  4A4B A;  4M2Q A;  1BR1 B;  2ZRT A;  1RRO A;  1NIW A;  3OX5 A;  4NDB A;  3C1V A;  2LE9 B;  1OZS A;  1CMG A;  2NCO A;  1EXR A;  2SAS A;  2WOS A;  1B8R A;  1DJI A;  2E6W A;  2JWW A;  2R2I A;  1G4Y R;  4MN0 A;  1Y1X A;  2KQ6 A;  4BY4 A;  1F55 A;  2PVB A;  2BBN A;  1BF5 A;  2QPT A;  4AOM A;  1F4O A;  2MRD A;  1GJY A;  4PE4 A;  1EG3 A;  4AQI A;  1KCY A;  1XA5 A;  3OB2 B;  2M29 A;  1QXP A;  5I8N A;  4P5O E;  4UPG A;  1DF0 A;  3ICB A;  2BL0 C;  3IF7 A;  1UUR A;  1NX2 A;  1OMR A;  3FWB A;  1XFV O;  2BCB A;  2WC8 A;  1FI6 A;  2KGB C;  3JVT C;  3TDU A;  2ZND A;  2BE4 A;  2M7N A;  1IQ5 A;  4WQ3 A;  1QLS A;  2BL0 B;  3BUN B;  1SKT A;  4YGE B;  1XVJ A;  2M97 A;  1DJH A;  3EK8 A;  3DVK A;  1M45 A;  1SR6 B;  5HKZ A;  1MWN A;  4ORA B;  1IWQ A;  1CDM A;  5HLV A;  1A29 A;  1IJ6 A;  1QX2 A;  4XYN A;  1DJZ A;  2KHN A;  1NCY A;  2AAO A;  4CID A;  4FQO A;  3E3R A;  2KGR A;  3ZWH A;  1YRT B;  1QTX A;  1KFU S;  5JOL A;  2AUC A;  5HYD A;  3I5G C;  2K8M B;  1K9U A;  1EL4 A;  1ZFS A;  1N2D A;  2KYF A;  4I5L B;  1RTP 1;  1GQM A;  1IH0 A;  1ALW A;  1SRA A;  1PK0 D;  3LLE A;  3OB1 B;  1WY9 A;  2M9G A;  3DVJ A;  3K21 A;  2JRF A;  4MZL A;  3WNX B;  4CPV A;  2VRG A;  1IQ3 A;  2Y1M A;  1BOC A;  3I5G B;  1SY9 A;  2LMT A;  4WRI A;  3I5H B;  4PE1 A;  1C07 A;  3VRR A;  2JPT A;  1KQV A;  5D7F A;  3RLZ A;  5HKW A;  2PAS A;  1JFK A;  3WHU B;  1YX8 A;  1D1O A;  1RFJ A;  4MRX A;  2KAV A;  1K93 D;  2JXC A;  1B4C A;  1MHO A;  2EHB A;  5CSJ A;  1K9K A;  1WRZ A;  4GGN A;  1ZUZ A;  3PFV A;  4R1E A;  2KDH A;  2CT9 A;  4OV2 A;  2ZKM X;  1A2X A;  1PRW A;  3MSE B;  4IL1 A;  2LCP A;  2F3Y A;  1A03 A;  3KHE A;  1K90 D;  2EC6 B;  4P2Y B;  1F8H A;  1OE9 B;  1LIN A;  4D1E A;  2CCM A;  2JOJ A;  4CFQ A;  1MQ1 A;  4HSZ A;  1IJ5 A;  1SCM B;  1DJG A;  1NX0 A;  2K7B A;  3BUW B;  3LL8 B;  4PHM A;  5J3X A;  3HX4 A;  1M39 A;  2HET A;  1UHK A;  5PAL A;  1KFX L;  1TNP A;  1YUU A;  3VRP A;  2LC5 A;  1J1E A;  2O5G A;  3KF9 A;  1AP4 A;  2G9B A;  4MZJ A;  2LHL A;  1L2O B;  3FS7 A;  3SG6 A;  2LAN A;  1IKU A;  5ER4 X;  4MBE A;  2AMI A;  1SL9 A;  2KAY A;  1ZAC A;  3LCP C;  1SYM A;  4I5N B;  4A4C A;  1YRU B;  1QV0 A;  1V1F A;  4QJ5 B;  4YBH B;  4AQJ A;  2FCD A;  1NP8 A;  3GK1 A;  1NSH A;  4C0L A;  1B8L A;  1OZO A;  1RWY A;  2BEC A;  2COL B;  1DJW A;  3SG2 A;  1DJY A;  3FIA A;  1KK7 Z;  3KPX A;  5CPV A;  2OTG C;  1WRL A;  1CKK A;  2KOT A;  2WCE A;  5AER A;  3EVR A;  2NZ0 A;  1CLL A;  3EVV A;  1PVA A;  1J1D A;  1RK9 A;  2OS8 B;  2HQW A;  1S6J A;  3NXA A;  5KSZ A;  2OTG B;  4MEW A;  3A4U B;  1WLZ A;  4ZCU A;  2H61 C;  3FWC A;  1R6P A;  3NSK A;  4I5K A;  4GAO A;  2LVI A;  5CSF A;  5AFP A;  5AEQ A;  2OPO A;  1MR8 A;  2JTT A;  2F33 A;  1BR4 B;  5D69 A;  2NXQ A;  1WRK A;  4WQ2 A;  1SBJ A;  2I7A A;  2L2E A;  2K7D A;  1QAS A;  2DOQ A;  3EKH A;  3VRO A;  2F3Z A;  3KO0 A;  1Q80 A;  1UWO A;  2KBM A;  3BOW B;  1CFC A;  4JQ0 D;  3CR2 A;  4MVF A;  1SNL A;  2K0J A;  4PE7 A;  2LVV A;  5GQQ C;  4DCK A;  4QJ3 B;  1CDP A;  1YX7 A;  3OHM B;  1UHN A;  5FYX A;  5I2L A;  3SG3 A;  4BY5 A;  3CWG A;  1SR6 C;  1M63 B;  1DGU A;  1SPY A;  4GUK A;  3TZ1 A;  1XFW O;  1CB1 A;  4MSP A;  1KWO B;  1CLB A;  4MLW A;  1K96 A;  5B8I B;  1QLK A;  1DTL A;  3OP0 A;  2LVJ A;  1MXE A;  2GGZ A;  2LP3 A;  1K94 A;  1MUX A;  1UHH A;  1TTX A;  5F6T A;  1NWD A;  1Y0V H;  3TDZ A;  2JUL A;  1CDL A;  2JT3 A;  4GFT A;  3I5F C;  1JFJ A;  1AVS A;  1U5I B;  2MAZ A;  1TNW A;  2BCX A;  3I5H C;  3PAL A;  2M1K B;  2LM5 A;  2WOR A;  1NPQ A;  3I5F B;  5KTY A;  3PLF B;  2KBI A;  4HRG A;  1CM1 A;  1QIV A;  2PAL A;  4MRY A;  1JC2 A;  3CR4 X;  3O78 A;  3PM8 A;  2KNE A;  3AAK A;  4N5X A;  2L0P A;  1KSO A;  2PSR A;  1S1E A;  2F8P A;  2KI6 C;  1HT9 A;  2LVK A;  2EC6 C;  3A8R A;  1OOJ A;  2LHI A;  3NSI A;  3O6B A;  2JTZ A;  5AAN A;  1J7O A;  1A75 B;  5I2Q A;  3CS1 A;  1K9P A;  3TUY B;  1F54 A;  2LLU A;  4ORC B;  1FBV A;  1VRK A;  1IGV A;  3CZT X;  1GGW A;  1AHR A;  1KK8 C;  2CNP A;  2TN4 A;  1SCM C;  1J7Q A;  3HCM A;  2Q4U A;  1V1G A;  2RGI A;  1DT7 B;  1J55 A;  2M3W A;  2V53 A;  1A4P A;  3WHT B;  1XFZ O;  3SIB A;  1UUS A;  5CSN A;  1PSB A;  1HQV A;  1KK8 B;  3EK4 A;  1J7R A;  1KSM A;  2JZI A;  1SL8 A;  2JXL A;  3PSR A;  4DRW A;  4JPZ B;  1AUI B;  1DGV A;  1C7W A;  1L2O C;  1WDC B;  2D8N A;  2FJU B;  2IS9 A;  4I5J A;  4ETO A;  1XFU O;  2B1U A;  1IRJ A;  3D10 A;  3PN7 B;  1CLM A;  2NLN A;  4N1G A;  1G8I A;  2E30 A;  4PCW A;  4PDZ A;  1KQM C;  1QS7 A;  2CBL A;  1M46 A;  1YVL A;  4N1F A;  5HKY A;  1NX1 A;  1CFD A;  4L9M A;  2MHH A;  4DUQ A;  3ZNI A;  2FOT A;  2Y4Q A;  4M2P A;  2Y1N A;  2ISD A;  1KQM B;  3GK4 X;  3DD4 A;  2I2R E;  2BBM A;  3DVE A;  3GK2 A;  4NDC A;  1JWD A;  1ODB A;  1B47 A;  1XYD A;  2PRU A;  4PE0 A;  4C0J A;  2M1U A;  4NDD A;  1B7T Y;  1S5G Y;  2H61 A;  2OS8 C;  5HLO A;  5BPJ A;  1QAT A;  1H4B A;  2O60 A;  1TRF A;  1W7I B;  1OMV A;  2LAP A;  1N0Y A;  2CTN A;  3CTN A;  3SJS A;  4C0K A;  1R2U A;  2K2A A;  2LMU A;  2HQ8 A;  3BOW A;  2PMY A;  3DF0 B;  3EK7 A;  1AK8 A;  1CDN A;  2BKH B;  1EH2 A;  1M31 A;  1YVH A;  4XJK B;  1QIW A;  1CM4 A;  4ICB A;  1XO5 A;  1CFF A;  1G33 A;  1TOP A;  1F4Q A;  2KFH A;  5DKN A;  4Q04 A;  2ZN9 A;  3TDI A;  1YTZ C;  4DIR A;  5I2O A;  1ZOT B;  1FF1 A;  2L50 A;  4USL A;  4YI8 A;  1BT6 A;  5K89 A;  1DMO A;  5DKR A;  2MBX A;  1OMD A;  1UP5 A;  1Y1U A;  4HRH A;  3F45 A;  1MF8 B;  2WND A;  2G2B A;  2K7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...