4PHNA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phnA00
1QV1A 1JC2A 2ZRSA 1JF2A 1YRTB 4I5NB 1RJVA 1AJ5A 4QJ4B 2JT3A 1M46A 2BCAA 1Y1UA 1FI6A 4GGFC 4PALA 2COLB 1R2UA 1S36A 4ORBB 2LMVA 3O4YA 2K7DA 2O60A 2KSPA 5HKZA 1KSMA 4N1GA 1TCFA 4M2OA 1PSRA 3WHUB 1XFYO 3BOWA 2KGRA 4C0JA 5AFPA 1DT7B 1OMVA 3EVRA 3FIAA 4JWQA 2WCEA 2H61C 4GPLB 1KSOA 1CDMA 1WY9A 3CZTX 1GGZA 2CBLA 1MUXA 2KYFA 1NCYA 2G2BA 2M1KB 1UHJA 3PLFB 4MEWA 4MN0A 2MAZA 3H4SE 4ZCVA 5TNCA 1ALWA 2HQWA 4DS7A 1H4BA 1S1EA 2TN4A 1UWOA 1KQVA 3PATA 2JT8A 1ZFSA 2MHHA 3CLNA 3KF9A 2FOTA 1OMRA 4WRIA 5CSFA 2L51A 2O5GA 1K2HA 4MZKA 4GNKB 3M0WA 1F8HA 3JVTB 1W7IB 4ZCUA 5HKWA 1K95A 2LCPA 4YGAA 2PSRA 1QJTA 2M1UA 4OKHA 1FPWA 4MBEA 1MHOA 4P5OE 1CTRA 3C1VA 1YRUB 2H61A 1G33A 3IQQA 2LLTA 3NSLA 1QIVA 5CPVA 3VRNA 2JULA 5KSZA 2EC6C 4FTGA 1YTZC 2ZRTA 1BF5A 1A4PA 1GQMA 3NSKA 3KPXA 3D0YA 1SRAA 1WRKA 3K21A 2HPSA 4MLWA 2GGZA 1F4QA 1RTP1 2M29A 3TZ1A 4AQIA 3O2PA 1WRLA 1CDLA 2L50A 3FWBA 4HREE 4QJ5B 2E6WA 2LLSA 2SASA 1PALA 3F45A 1E8AA 2OS8C 3LK1A 3PALA 4JPZB 5CSJA 2WORA 5DKRA 2K7CA 5KTYA 2NCPA 1DMOA 1XYDA 1KFUL 3VRRA 1XFVO 1QX2A 1OOJA 1F70A 2JTTA 2DOQA 1RWYA 1DGUA 3CWGA 3I5HC 4PHMA 4AOMA 5CSNA 1CNPA 2LVVA 1CLMA 3I5FB 4HSZA 3NSOA 1AUIB 3O78A 1B47A 2F3YA 2PMYA 3TDIA 4C0KA 1H8BA 1LA3A 1PSBA 3KHEA 4E68A 3BUXB 1YX8A 1K9KA 3BUMB 2JU0A 1U5IA 4PCWA 4PHNA 1J55A 2I18A 2M9GA 1B4CA 1F54A 1QLSA 1A29A 1IQ5A 1CMGA 4AQJA 1JSAA 2L5XB 1CMFA 1F55A 5HYDA 1C7VA 1FBVA 4YBHB 1F71A 1ALVA 2M49B 2M97A 1DJWA 2CTNA 1TIZA 3FS7A 4OCIA 3I5GB 5K89A 1S3PA 1FF1A 1SCVA 1AVSA 2EHBA 4PE0A 1YUUA 1D1OA 1A75A 1KFXS 2MA2A 4Q04A 2L98A 1S6IA 2QPTA 5IBWA 5HLVA 1V1GA 3VROA 2CCMA 1ZOTB 4F0ZB 1DJZA 3CS1A 2Q91A 1SL8A 4R1EA 1SBJA 5F6TA 3LL8B 2F2PA 1FW4A 3PSRA 1OSAA 1OQPA 4XJKB 3EK4A 2LLUA 2KI4C 5JOLA 3TDZA 1YVHA 1WDCB 3PN7B 2LC5A 4WQ3A 5G08A 2KBIA 2HETA 1DJIA 1CM1A 1QLKA 1RFJA 3TS5B 1NYAA 3EKHA 4CFQA 5CSIA 1N65A 3BUOB 1NSHA 1EG4A 1Y0VH 4A4BA 1JWDA 1DGVA 4ICBA 1IJ6A 1NUBA 3I5IC 2H2KA 2F8PA 4PHJA 1NCXA 1S6CA 1TRFA 5HKYA 1EL4A 2K7BA 1SW8A 2BL0B 1B8RA 1DTLA 4N1FA 3DVJA 5AERA 4HRHA 1L2OC 1KK8C 2LP3A 4WQ2A 3E3RA 4BY4A 5BPJA 2KAXA 4OR9B 5FYXA 1B7TZ 2HF5A 2D8NA 3HCMA 3IF7A 1WRZA 1B8CA 1PULA 1Y1XA 3CGAA 4YGBB 2LM5A 1JFJA 1K8UA 1Q80A 2ISDA 1NPQA 4MZJA 3ZNIA 1SCMC 3BUNB 1CDPA 1N0YA 1TTXA 3DF0B 4TNCA 1KWOC 3PM8A 2K0JA 1OZSA 2KQ6A 5I2OA 2KBMA 3VRQA 4CFRA 1SL9A 2K2AA 3NSIA 1KK7Z 1CLBA 4YRUA 4D1EA 4GFTA 4MSPA 2NCOA 1BOCA 3JTDC 1J7RA 1NWDA 4L9MA 3OHMB 2BBMA 2L4HA 1BU3A 2B1UA 1QS7A 2WOSA 3EKJA 1DVIA 1QATA 2BE4A 1JF0A 1NIWA 4PE4A 1NX1A 1ZACA 2OTGC 1GGWA 1XFUO 1WLMA 5I2QA 2FCEA 1DF0B 2NXQA 1BT6A 2K8MB 1C7WA 1NX3A 2WC8A 1CFPA 3WHTB 1QIWA 1QXPA 3TDUA 3KEVA 2MRDA 4ORCB 1VRKA 1KQMB 2LANA 2ZKMX 1AHRA 2KGBC 4HRGA 1HT9A 1XK4A 2F33A 3BXKA 2JPTA 1DJHA 2G9BA 2QACA 2JT0A 1IGVA 1TNQA 2CXJA 1UHKA 3TUYC 2KQYA 2M8UA 1U5IB 3NXAA 1J7QA 2KAVA 2JTZA 3BUWB 2M3WA 1UP5A 4YI8A 2ZFDA 3GK4X 4YGDB 1S6JA 2JOJA 2KDHA 1TNPA 2OS8B 5DKQA 2JNFA 2CNPA 1K96A 2K2FA 1C07A 3GOFA 2LE9B 1V1FA 1PRWA 2L0PA 1AK8A 2Y1NA 2KAYA 1YVLA 2NZ0A 3I5HB 2Q4UA 3DVEA 5D7FA 4NDBA 2NLNA 5AEQA 1SY9A 3AKAA 3FWCA 3BQ3A 2K61A 1M63B 1A75B 1OZOA 1DJXA 4A4CA 1LINA 2CT9A 2BECA 4XYNA 1QX5B 2Y5IA 2Y1MA 4ORAB 1R6PA 2BCBA 2MJWB 1RECA 2RGIA 4CIDA 2Y4QA 1J7PA 4CLNA 1SR6C 5HLOA 3MSEB 1MWNA 5B8IB 1L7ZA 2WCBA 2ZNEA 2OPOA 3CR4X 2AAOA 1TCOB 4I5JA 5PALA 1M39A 3CR2A 1IG5A 1X02A 4QJ3B 3O6BA 3QRXA 2FCDA 2LMUA 1EH2A 4GGNA 1MXEA 5I2LA 2I2RE 1WDCC 3DVKA 4CPVA 1TN4A 1PK0D 2KNEA 1B7TY 3RLZA 1G4YR 1OMDA 3BOWB 2PALA 1ODBA 1RK9A 3WXAA 3AAKA 3CR5X 1YX7A 1JUOA 1B1GA 2LVIA 2BCXA 4M2QA 1CLLA 4USLA 1DJYA 1ZMZA 1SPYA 3EVUA 1K9PA 1EXRA 1NX2A 2L2EA 2AUCA 1IQ3A 2LHLA 4MRXA 1KFXL 2KI4B 3OP0A 1XA5A 2JXCA 2MBXA 3PFVA 1UHHA 1M31A 2GV5A 1S5GY 2LVKA 1JFKA 1NP8A 3SG6A 4XJKA 2KHNA 1MR8A 1LVCD 2JRFA 4OVNF 1FI5A 4YGEB 3I5IB 1NX0A 1KK7Y 1LA0A 1MF8B 2VRGA 2ZN9A 1JBAA 2A4JA 2LUXA 2MLFC 1XFWO 1L2OB 1KK8B 1YURA 2ZN8A 3IQOA 4DUQA 1BR1B 2EGDA 2LV7A 3JVTC 1S5GZ 1YUSA 1CFCA 2MLEC 1WLZA 4DRWA 3LLEA 1CFDA 1K9UA 2M7NA 3LK0A 1XK4C 4GUKA 1YUTA 1UHNA 1IWQA 4MVFA 2M0RA 3BYAA 2PASA 1CB1A 4NDDA 5D69A 3D0YB 5JJGA 2LVJA 2BBNA 1A03A 1IRJA 2E30A 4ETOA 1BG1A 3DD4A 1SCMB 4M2PA 1MXLC 2JQ6A 1LKJA 4NDCA 1Y1AA 3CTNA 1KFUS 4GGFA 1CDNA 1KWOB 1Y6WA 1TNXA 1AJ4A 2SCPA 1QX7A 1W7JB 1CKKA 2BKHB 1LXFC 4DIRA 3LCPC 1BR4B 3A8RA 2KOTA 2I7AA 1SNLA 5KU1A 1TOPA 4UPGA 1CFFA 3DF0A 2PRUA 2HQ8A 1TNWA 1XFXO 3JTDB 3VGOA 1B9AA 1KQMC 1J7OA 3SG5A 2F2OA 1BLQA 2JC2A 1UUSA 1IKUA 1K93D 1G8IA 2EC6B 2LMTA 2IS9A 1NCZA 2KI6C 2OTGB 2KFFA 1SKTA 3I5FC 3OX6A 4IL1A 3EVVA 2M7LA 1IJ5A 1SMGA 3DVMA 2LNKA 2BKIB 1S26D 2PVBA 2LHIA 2JZIA 1M45A 4DCKA 1XFZO 1BMOA 3D10A 2KFHA 3RM1A 1A2XA 2GGMA 2LUCA 1XVJA 3VRPA 1BODA 1DF0A 1XO5A 1QVIY 4NQGA 1GJYA 5J3XA 5DKNA 4MZLA 2JWWA 2I94A 1ZUZA 4PHKA 4MRYA 1YR5A 2K7OA 4YI9A 5AXIA 3TUYB 3OX5A 3KO0A 3ZWHA 3SG7A 1KCYA 1SYMA 2P6BB 3A4UB 3EK8A 1B8LA 1HQVA 2JNXA 3SG3A 3OB1B 1MQ1A 1QTXA 2F3ZA 3I5GC 1OE9B 5AANA 5I8NA 4YGCB 2V53A 1QVIZ 2KYCA 3AAJA 3SG2A 1RROA 2R2IA 3OB2B 1EJ3A 1CM4A 2FJUB 3EK7A 1EG3A 1UURA 4PE1A 3SIBA 2LP2A 4P2YB 1PVBA 4GBAA 2JXLA 1AP4A 3HX4A 4C0LA 3SJSA 4I5LB 2WNDA 3AKBA 3WNXB 1QV0A 4N5XA 1N2DA 3SG4A 4I5KA 3GK2A 3PN7C 2KFGA 1SL7A 2AMIA 3ICBA 1K90D 1PVAA 5ER5A 2ZNDA 4BY5A 4OV2A 4FQOA 3TS5C 4JQ0D 1QASA 2WCFA 1J1EA 1SR6B 4PDZA 5GQQC 2L4IA 1BJFA 1SK6D 1UHIA 4PE7A 2LAPA 4U8DA 1IH0A 2BL0C 5ER4X 4GAOA 1F4OA 3GK1A 3SIAA 1DJGA 2BE6A 1K94A 2KI6D 1J1DA
chains in the Genus database with same CATH superfamily
1OOFA 1QV1A 1JC2A 2ZRSA 1JF2A 1YRTB 2L2CA 4I5NB 1RJVA 1AJ5A 4QJ4B 5FI6A 2JT3A 1M46A 2BCAA 1Y1UA 1FI6A 1DQEA 4GGFC 4PALA 2COLB 1R2UA 1S36A 4ORBB 2LMVA 1W9ZA 3O4YA 2K7DA 2O60A 2KSPA 5HKZA 1KSMA 2QEHA 2WC6A 4N1GA 1TCFA 4M2OA 1PSRA 3WHUB 2JPOA 1XFYO 3BOWA 2KGRA 4C0JA 5AFPA 1DT7B 1OMVA 3BFAA 3EVRA 3FIAA 4INXA 4JWQA 2WCEA 2H61C 4GPLB 1KSOA 1CDMA 1WY9A 3CZTX 2WCLA 1GGZA 2CBLA 1MUXA 2KYFA 1NCYA 2G2BA 2M1KB 1UHJA 3PLFB 4MEWA 4MN0A 2MAZA 3H4SE 4ZCVA 5TNCA 2HQWA 4DS7A 1H4BA 1S1EA 2TN4A 1UWOA 1KQVA 3PATA 2JT8A 1ZFSA 2MHHA 3CLNA 3KF9A 2FOTA 1OMRA 4WRIA 5CSFA 2L51A 3D76A 2O5GA 1K2HA 4MZKA 4GNKB 2BAPA 3M0WA 1F8HA 3JVTB 1W7IB 4ZCUA 5HKWA 1K95A 2LCPA 4YGAA 2PSRA 1QJTA 3BJHA 2M1UA 4OKHA 1FPWA 4MBEA 3IVTA 1MHOA 4P5OE 1CTRA 2ERBA 3C1VA 1YRUB 2P71A 2H61A 1G33A 2WCKA 3IQQA 2LLTA 3NSLA 1QIVA 5CPVA 3VRNA 2JULA 5KSZA 2EC6C 1DEKA 4FTGA 1YTZC 2ZRTA 3D73A 1BF5A 1A4PA 1GQMA 3NSKA 3KPXA 3D0YA 2WCJA 1SRAA 1WRKA 3K21A 2HPSA 4MLWA 2GGZA 1F4QA 1RTP1 2M29A 3TZ1A 4AQIA 3O2PA 1WRLA 1CDLA 2L50A 2WCMA 3FWBA 4HREE 4QJ5B 2E6WA 2LLSA 2SASA 1PALA 2BNXA 1E8AA 2OS8C 3F45A 3LK1A 3PALA 4JPZB 2WORA 5CSJA 2K7CA 5DKRA 2NCPA 3B7AA 5KTYA 1DMOA 1XYDA 1KFUL 5HL1A 3VRRA 1XFVO 1QX2A 1OOJA 1F70A 2JTTA 2DOQA 1RWYA 1DGUA 3CWGA 3I5HC 4PHMA 3B6XA 5CSNA 4AOMA 1CNPA 2KLEA 2LVVA 1Z4HA 1CLMA 3I5FB 4HSZA 3NSOA 1AUIB 3O78A 1B47A 2F3YA 2PMYA 3TDIA 3S0BA 3L4AA 4C0KA 1H8BA 1LA3A 1PSBA 3KHEA 4E68A 3BUXB 1YX8A 1K9KA 3BUMB 2JU0A 1U5IA 4PCWA 3PJIA 5D3OA 4PHNA 1J55A 2I18A 2M9GA 1B4CA 1F54A 1QLSA 1A29A 1IQ5A 1CMGA 4AQJA 1JSAA 2L5XB 1CMFA 1F55A 5HYDA 1C7VA 1FBVA 4YBHB 1F71A 1ALVA 2M49B 3FE8A 2M97A 1DJWA 2CTNA 1TIZA 3FS7A 4OCIA 3I5GB 3O4XA 3R1VA 1GM0A 3BFBA 5K89A 1S3PA 1FF1A 1SCVA 1AVSA 2EHBA 4PE0A 1YUUA 1D1OA 1A75A 1KFXS 2MA2A 4Q04A 2L98A 1S6IA 2QPTA 5IBWA 5HLVA 1V1GA 3VROA 2CCMA 1ZOTB 4F0ZB 1DJZA 3CS1A 2Q91A 1SL8A 3D78A 1SBJA 4R1EA 5F6TA 3S0AA 3LL8B 2F2PA 1FW4A 1ORGA 3PSRA 1OSAA 3EG5B 1OQPA 3CABA 4XJKB 3EK4A 5FI2A 2LLUA 2KI4C 5JOLA 3TDZA 1YVHA 1WDCB 3PN7B 2LC5A 4WQ3A 5G08A 2KBIA 2HETA 1DJIA 1CM1A 1QLKA 1RFJA 3TS5B 1NYAA 3EKHA 2WC5A 4CFQA 5CSIA 1N65A 3BUOB 1NSHA 1EG4A 1Y0VH 4A4BA 1JWDA 1DGVA 2P70A 4ICBA 1IJ6A 1NUBA 3I5IC 2H2KA 2F8PA 4PHJA 1NCXA 1S6CA 1TRFA 5HKYA 1EL4A 2K7BA 1SW8A 2BL0B 1B8RA 1DTLA 4N1FA 5EL2A 3DVJA 5AERA 2KPHA 4HRHA 1L2OC 1KK8C 2LP3A 4WQ2A 3E3RA 4BY4A 5BPJA 2KAXA 4OR9B 3CZ2A 5FYXA 1B7TZ 3DXLA 2HF5A 2QEOA 2D8NA 3HCMA 3IF7A 1WRZA 3V2LA 2PYQA 1XFRA 1B8CA 1PULA 3B87A 4IJ7A 1Y1XA 3CGAA 4YGBB 2LM5A 1JFJA 4OZDA 1K8UA 1Q80A 2GTEA 1NPQA 3QMEA 4MZJA 1SCMC 2ISDA 3ZNIA 3S0FA 3BUNB 1CDPA 1N0YA 1TTXA 3DF0B 4TNCA 1KWOC 3PM8A 2K0JA 3CZ0A 1OZSA 2KQ6A 5I2OA 2KBMA 3VRQA 4JD9A 4CFRA 1SL9A 2K2AA 5DICA 3NSIA 1KK7Z 1CLBA 4YRUA 4FQTA 4D1EA 4GFTA 4MSPA 2NCOA 1BOCA 3JTDC 1J7RA 1NWDA 4L9MA 3B86A 3OHMB 2BBMA 2L4HA 1BU3A 2B1UA 1QS7A 2WOSA 3EKJA 1DVIA 1QATA 2BE4A 1JF0A 1NIWA 4PE4A 1NX1A 1ZACA 2OTGC 1GGWA 1XFUO 1WLMA 2FJYA 5I2QA 3NHIA 2FCEA 1DF0B 2NXQA 1BT6A 2K8MB 3K1EA 1C7WA 1NX3A 2WC8A 3NGVA 1CFPA 3WHTB 3S0GA 1QIWA 3BFHA 1QXPA 3TDUA 3KEVA 2MRDA 3FE9A 4ORCB 1VRKA 1KQMB 2LANA 2ZKMX 1AHRA 2KGBC 4HRGA 1HT9A 1XK4A 2F33A 3BXKA 3N7HA 2JPTA 1DJHA 2G9BA 2QACA 2JT0A 1IGVA 1TNQA 2BE6A 2CXJA 3CDNA 3D77A 1UHKA 3TUYC 2KQYA 2M8UA 1U5IB 3NXAA 1J7QA 2KAVA 2JTZA 3BUWB 2M3WA 1UP5A 4YI8A 2ZFDA 3SS4A 3GK4X 4YGDB 1S6JA 2JOJA 2KDHA 1TNPA 2OS8B 5DKQA 2JNFA 2CNPA 1K96A 1TWOA 2K2FA 3GOFA 1C07A 2LE9B 1V1FA 1PRWA 2L0PA 1AK8A 2Y1NA 2KAYA 1OOIX 1YVLA 2NZ0A 3I5HB 2Q4UA 3DVEA 5D7FA 4NDBA 2NLNA 5AEQA 1SY9A 3D75A 3AKAA 3FWCA 1DC1A 3BQ3A 2K61A 1M63B 1A75B 1OZOA 1DJXA 4A4CA 1LINA 2CT9A 1DELA 2BECA 4XYNA 3OBVA 1QX5B 2Y5IA 2Y1MA 4ORAB 1R6PA 2BCBA 2MJWB 1RECA 2RGIA 4CIDA 2Y4QA 3PM2A 1J7PA 4CLNA 1SR6C 5HLOA 3MSEB 1MWNA 5B8IB 1L7ZA 2WCBA 2ZNEA 2OPOA 3CR4X 2AAOA 1TCOB 4I5JA 5PALA 1M39A 3CR2A 1IG5A 3RZSA 1X02A 4QJ3B 3O6BA 3SS5A 3R1PA 3QRXA 2FCDA 2LMUA 1EH2A 1OOHA 1MXEA 4GGNA 3DYEA 5I2LA 3S0EA 2I2RE 1WDCC 3DVKA 4CPVA 1TUZA 1TN4A 1PK0D 2KNEA 1B7TY 3RLZA 1G4YR 1OMDA 3BOWB 2PALA 3L4LA 1ODBA 3B88A 1RK9A 3WXAA 3CYZA 3OGNA 3AAKA 3CR5X 1YX7A 1JUOA 1B1GA 2LVIA 2BCXA 4M2QA 1CLLA 4USLA 1DJYA 1ZMZA 1SPYA 3EVUA 1K9PA 1EXRA 1NX2A 2L2EA 2AUCA 1IQ3A 2YGUA 2LHLA 4MRXA 1KFXL 2KI4B 3OP0A 1XA5A 2JXCA 3UNWA 2MBXA 3PFVA 3VB1A 1UHHA 1M31A 2GV5A 1S5GY 2LVKA 1JFKA 1NP8A 3SG6A 4XJKA 2KHNA 1MR8A 1LVCD 2JRFA 4OVNF 1FI5A 4YGEB 3I5IB 1NX0A 1KK7Y 1LA0A 1MF8B 2VRGA 1Z2CB 2ZN9A 1JBAA 2A4JA 2LUXA 2MLFC 1XFWO 1L2OB 1KK8B 1QWVA 1YURA 2ZN8A 3IQOA 4JKTA 1BR1B 2EGDA 4DUQA 2LV7A 3JVTC 1S5GZ 1YUSA 1CFCA 2MLEC 1WLZA 4DRWA 3LLEA 1CFDA 1K9UA 2M7NA 4F7FA 3LK0A 1XK4C 4GUKA 4INWA 1YUTA 1UHNA 3R72A 1IWQA 4MVFA 2M0RA 2QEVA 3BYAA 2PASA 1CB1A 2K60A 4NDDA 5D69A 3D0YB 5JJGA 2LVJA 2BBNA 1A03A 1IRJA 2E30A 4ETOA 1BG1A 3DD4A 1SCMB 4M2PA 5I94A 1MXLC 2JQ6A 1LKJA 4NDCA 1Y1AA 3CTNA 1KFUS 4GGFA 1CDNA 1KWOB 1Y6WA 1TNXA 1AJ4A 2SCPA 1QX7A 1W7JB 1LS8A 3R1OA 1CKKA 2BKHB 1LXFC 4DIRA 3LCPC 1BR4B 3A8RA 2KOTA 2I7AA 1SNLA 5KU1A 1TOPA 4UPGA 1OW4A 3DF0A 2PRUA 1CFFA 3CZ1A 2HQ8A 1TNWA 1XFXO 3JTDB 3VGOA 1B9AA 1KQMC 1J7OA 3SS3A 3SG5A 1SSEB 2F2OA 1BLQA 2JC2A 1UUSA 3D74A 1IKUA 3UO9A 1K93D 1G8IA 1C3ZA 2EC6B 2IS9A 1NCZA 2LMTA 2KI6C 2OTGB 2KFFA 1SKTA 3I5FC 3OX6A 4IL1A 3EVVA 2M7LA 1IJ5A 1SMGA 3DVMA 2LNKA 2BKIB 1S26D 2PVBA 2LHIA 2JZIA 1M45A 4DCKA 1XFZO 1BMOA 3D10A 2KFHA 3RM1A 1A2XA 2GGMA 2LUCA 1XVJA 3L47A 3VRPA 1BODA 1DF0A 1XO5A 1QVIY 4NQGA 1GJYA 5J3XA 1T14A 5DKNA 3Q8IA 4MZLA 2JWWA 2I94A 1ZUZA 4PHKA 4MRYA 1YR5A 2K7OA 4YI9A 5AXIA 3TUYB 3OX5A 3KO0A 3ZWHA 3SG7A 1KCYA 1SYMA 2P6BB 3A4UB 3EK8A 1B8LA 1HQVA 2JNXA 2KLDA 2QDIA 3OB1B 3SG3A 1IIOA 1MQ1A 1QTXA 2F3ZA 3I5GC 3NHTA 1OE9B 5AANA 5I8NA 4YGCB 2V53A 1QVIZ 2L5YA 2H8VA 2KYCA 3AAJA 3SG2A 2QEBA 1RROA 2R2IA 3OB2B 1EJ3A 1CM4A 2FJUB 3EK7A 1EG3A 1UURA 4PE1A 1C3YA 3SIBA 2PQLA 2LP2A 4P2YB 5FI7A 1PVBA 4GBAA 3FE6A 2JXLA 3DY9A 1AP4A 3HX4A 4C0LA 3SJSA 4I5LB 2WNDA 3AKBA 1OOGA 1QV0A 1TUJA 4N5XA 3DZTA 3WNXB 1N2DA 4PT1A 3SG4A 3S0DA 4I5KA 3GK2A 3PN7C 2KFGA 1SL7A 2AMIA 3ICBA 1K90D 1PVAA 5ER5A 2WCHA 2ZNDA 4BY5A 4OV2A 4FQOA 3TS5C 4JQ0D 1QASA 2WCFA 1J1EA 4KYNA 1SR6B 4PDZA 5GQQC 2L4IA 1BJFA 1P28A 1SK6D 1UHIA 4PE7A 2LAPA 4U8DA 1IH0A 2BL0C 5ER4X 4GAOA 1F4OA 3GK1A 3SIAA 1DJGA 1ALWA 1K94A 2KI6D 1J1DA
chains in the Genus database with same CATH topology
1QV1A 1JC2A 2ZRSA 1JF2A 1YRTB 4I5NB 1RJVA 1AJ5A 4QJ4B 2JT3A 1M46A 2BCAA 1Y1UA 1FI6A 4GGFC 4PALA 2COLB 1R2UA 1S36A 4ORBB 2LMVA 3O4YA 2K7DA 2O60A 2KSPA 5HKZA 1KSMA 4N1GA 1TCFA 4M2OA 1PSRA 3WHUB 1XFYO 3BOWA 2KGRA 4C0JA 5AFPA 1DT7B 1OMVA 3EVRA 3FIAA 4JWQA 2WCEA 2H61C 4GPLB 1KSOA 1CDMA 1WY9A 3CZTX 1GGZA 2CBLA 1MUXA 2KYFA 1NCYA 2G2BA 2M1KB 1UHJA 3PLFB 4MEWA 4MN0A 2MAZA 3H4SE 4ZCVA 5TNCA 1ALWA 2HQWA 4DS7A 1H4BA 1S1EA 2TN4A 1UWOA 1KQVA 3PATA 2JT8A 1ZFSA 2MHHA 3CLNA 3KF9A 2FOTA 1OMRA 4WRIA 5CSFA 2L51A 2O5GA 1K2HA 4MZKA 4GNKB 3M0WA 1F8HA 3JVTB 1W7IB 4ZCUA 5HKWA 1K95A 2LCPA 4YGAA 2PSRA 1QJTA 2M1UA 4OKHA 1FPWA 4MBEA 1MHOA 4P5OE 1CTRA 3C1VA 1YRUB 2H61A 1G33A 3IQQA 2LLTA 3NSLA 1QIVA 5CPVA 3VRNA 2JULA 5KSZA 2EC6C 4FTGA 1YTZC 2ZRTA 1BF5A 1A4PA 1GQMA 3NSKA 3KPXA 3D0YA 1SRAA 1WRKA 3K21A 2HPSA 4MLWA 2GGZA 1F4QA 1RTP1 2M29A 3TZ1A 4AQIA 3O2PA 1WRLA 1CDLA 2L50A 3FWBA 4HREE 4QJ5B 2E6WA 2LLSA 2SASA 1PALA 3F45A 1E8AA 2OS8C 3LK1A 3PALA 4JPZB 5CSJA 2WORA 5DKRA 2K7CA 5KTYA 2NCPA 1DMOA 1XYDA 1KFUL 3VRRA 1XFVO 1QX2A 1OOJA 1F70A 2JTTA 2DOQA 1RWYA 1DGUA 3CWGA 3I5HC 4PHMA 4AOMA 5CSNA 1CNPA 2LVVA 1CLMA 3I5FB 4HSZA 3NSOA 1AUIB 3O78A 1B47A 2F3YA 2PMYA 3TDIA 4C0KA 1H8BA 1LA3A 1PSBA 3KHEA 4E68A 3BUXB 1YX8A 1K9KA 3BUMB 2JU0A 1U5IA 4PCWA 4PHNA 1J55A 2I18A 2M9GA 1B4CA 1F54A 1QLSA 1A29A 1IQ5A 1CMGA 4AQJA 1JSAA 2L5XB 1CMFA 1F55A 5HYDA 1C7VA 1FBVA 4YBHB 1F71A 1ALVA 2M49B 2M97A 1DJWA 2CTNA 1TIZA 3FS7A 4OCIA 3I5GB 5K89A 1S3PA 1FF1A 1SCVA 1AVSA 2EHBA 4PE0A 1YUUA 1D1OA 1A75A 1KFXS 2MA2A 4Q04A 2L98A 1S6IA 2QPTA 5IBWA 5HLVA 1V1GA 3VROA 2CCMA 1ZOTB 4F0ZB 1DJZA 3CS1A 2Q91A 1SL8A 4R1EA 1SBJA 5F6TA 3LL8B 2F2PA 1FW4A 3PSRA 1OSAA 1OQPA 4XJKB 3EK4A 2LLUA 2KI4C 5JOLA 3TDZA 1YVHA 1WDCB 3PN7B 2LC5A 4WQ3A 5G08A 2KBIA 2HETA 1DJIA 1CM1A 1QLKA 1RFJA 3TS5B 1NYAA 3EKHA 4CFQA 5CSIA 1N65A 3BUOB 1NSHA 1EG4A 1Y0VH 4A4BA 1JWDA 1DGVA 4ICBA 1IJ6A 1NUBA 3I5IC 2H2KA 2F8PA 4PHJA 1NCXA 1S6CA 1TRFA 5HKYA 1EL4A 2K7BA 1SW8A 2BL0B 1B8RA 1DTLA 4N1FA 3DVJA 5AERA 4HRHA 1L2OC 1KK8C 2LP3A 4WQ2A 3E3RA 4BY4A 5BPJA 2KAXA 4OR9B 5FYXA 1B7TZ 2HF5A 2D8NA 3HCMA 3IF7A 1WRZA 1B8CA 1PULA 1Y1XA 3CGAA 4YGBB 2LM5A 1JFJA 1K8UA 1Q80A 2ISDA 1NPQA 4MZJA 3ZNIA 1SCMC 3BUNB 1CDPA 1N0YA 1TTXA 3DF0B 4TNCA 1KWOC 3PM8A 2K0JA 1OZSA 2KQ6A 5I2OA 2KBMA 3VRQA 4CFRA 1SL9A 2K2AA 3NSIA 1KK7Z 1CLBA 4YRUA 4D1EA 4GFTA 4MSPA 2NCOA 1BOCA 3JTDC 1J7RA 1NWDA 4L9MA 3OHMB 2BBMA 2L4HA 1BU3A 2B1UA 1QS7A 2WOSA 3EKJA 1DVIA 1QATA 2BE4A 1JF0A 1NIWA 4PE4A 1NX1A 1ZACA 2OTGC 1GGWA 1XFUO 1WLMA 5I2QA 2FCEA 1DF0B 2NXQA 1BT6A 2K8MB 1C7WA 1NX3A 2WC8A 1CFPA 3WHTB 1QIWA 1QXPA 3TDUA 3KEVA 2MRDA 4ORCB 1VRKA 1KQMB 2LANA 2ZKMX 1AHRA 2KGBC 4HRGA 1HT9A 1XK4A 2F33A 3BXKA 2JPTA 1DJHA 2G9BA 2QACA 2JT0A 1IGVA 1TNQA 2CXJA 1UHKA 3TUYC 2KQYA 2M8UA 1U5IB 3NXAA 1J7QA 2KAVA 2JTZA 3BUWB 2M3WA 1UP5A 4YI8A 2ZFDA 3GK4X 4YGDB 1S6JA 2JOJA 2KDHA 1TNPA 2OS8B 5DKQA 2JNFA 2CNPA 1K96A 2K2FA 1C07A 3GOFA 2LE9B 1V1FA 1PRWA 2L0PA 1AK8A 2Y1NA 2KAYA 1YVLA 2NZ0A 3I5HB 2Q4UA 3DVEA 5D7FA 4NDBA 2NLNA 5AEQA 1SY9A 3AKAA 3FWCA 3BQ3A 2K61A 1M63B 1A75B 1OZOA 1DJXA 4A4CA 1LINA 2CT9A 2BECA 4XYNA 1QX5B 2Y5IA 2Y1MA 4ORAB 1R6PA 2BCBA 2MJWB 1RECA 2RGIA 4CIDA 2Y4QA 1J7PA 4CLNA 1SR6C 5HLOA 3MSEB 1MWNA 5B8IB 1L7ZA 2WCBA 2ZNEA 2OPOA 3CR4X 2AAOA 1TCOB 4I5JA 5PALA 1M39A 3CR2A 1IG5A 1X02A 4QJ3B 3O6BA 3QRXA 2FCDA 2LMUA 1EH2A 4GGNA 1MXEA 5I2LA 2I2RE 1WDCC 3DVKA 4CPVA 1TN4A 1PK0D 2KNEA 1B7TY 3RLZA 1G4YR 1OMDA 3BOWB 2PALA 1ODBA 1RK9A 3WXAA 3AAKA 3CR5X 1YX7A 1JUOA 1B1GA 2LVIA 2BCXA 4M2QA 1CLLA 4USLA 1DJYA 1ZMZA 1SPYA 3EVUA 1K9PA 1EXRA 1NX2A 2L2EA 2AUCA 1IQ3A 2LHLA 4MRXA 1KFXL 2KI4B 3OP0A 1XA5A 2JXCA 2MBXA 3PFVA 1UHHA 1M31A 2GV5A 1S5GY 2LVKA 1JFKA 1NP8A 3SG6A 4XJKA 2KHNA 1MR8A 1LVCD 2JRFA 4OVNF 1FI5A 4YGEB 3I5IB 1NX0A 1KK7Y 1LA0A 1MF8B 2VRGA 2ZN9A 1JBAA 2A4JA 2LUXA 2MLFC 1XFWO 1L2OB 1KK8B 1YURA 2ZN8A 3IQOA 4DUQA 1BR1B 2EGDA 2LV7A 3JVTC 1S5GZ 1YUSA 1CFCA 2MLEC 1WLZA 4DRWA 3LLEA 1CFDA 1K9UA 2M7NA 3LK0A 1XK4C 4GUKA 1YUTA 1UHNA 1IWQA 4MVFA 2M0RA 3BYAA 2PASA 1CB1A 4NDDA 5D69A 3D0YB 5JJGA 2LVJA 2BBNA 1A03A 1IRJA 2E30A 4ETOA 1BG1A 3DD4A 1SCMB 4M2PA 1MXLC 2JQ6A 1LKJA 4NDCA 1Y1AA 3CTNA 1KFUS 4GGFA 1CDNA 1KWOB 1Y6WA 1TNXA 1AJ4A 2SCPA 1QX7A 1W7JB 1CKKA 2BKHB 1LXFC 4DIRA 3LCPC 1BR4B 3A8RA 2KOTA 2I7AA 1SNLA 5KU1A 1TOPA 4UPGA 1CFFA 3DF0A 2PRUA 2HQ8A 1TNWA 1XFXO 3JTDB 3VGOA 1B9AA 1KQMC 1J7OA 3SG5A 2F2OA 1BLQA 2JC2A 1UUSA 1IKUA 1K93D 1G8IA 2EC6B 2LMTA 2IS9A 1NCZA 2KI6C 2OTGB 2KFFA 1SKTA 3I5FC 3OX6A 4IL1A 3EVVA 2M7LA 1IJ5A 1SMGA 3DVMA 2LNKA 2BKIB 1S26D 2PVBA 2LHIA 2JZIA 1M45A 4DCKA 1XFZO 1BMOA 3D10A 2KFHA 3RM1A 1A2XA 2GGMA 2LUCA 1XVJA 3VRPA 1BODA 1DF0A 1XO5A 1QVIY 4NQGA 1GJYA 5J3XA 5DKNA 4MZLA 2JWWA 2I94A 1ZUZA 4PHKA 4MRYA 1YR5A 2K7OA 4YI9A 5AXIA 3TUYB 3OX5A 3KO0A 3ZWHA 3SG7A 1KCYA 1SYMA 2P6BB 3A4UB 3EK8A 1B8LA 1HQVA 2JNXA 3SG3A 3OB1B 1MQ1A 1QTXA 2F3ZA 3I5GC 1OE9B 5AANA 5I8NA 4YGCB 2V53A 1QVIZ 2KYCA 3AAJA 3SG2A 1RROA 2R2IA 3OB2B 1EJ3A 1CM4A 2FJUB 3EK7A 1EG3A 1UURA 4PE1A 3SIBA 2LP2A 4P2YB 1PVBA 4GBAA 2JXLA 1AP4A 3HX4A 4C0LA 3SJSA 4I5LB 2WNDA 3AKBA 3WNXB 1QV0A 4N5XA 1N2DA 3SG4A 4I5KA 3GK2A 3PN7C 2KFGA 1SL7A 2AMIA 3ICBA 1K90D 1PVAA 5ER5A 2ZNDA 4BY5A 4OV2A 4FQOA 3TS5C 4JQ0D 1QASA 2WCFA 1J1EA 1SR6B 4PDZA 5GQQC 2L4IA 1BJFA 1SK6D 1UHIA 4PE7A 2LAPA 4U8DA 1IH0A 2BL0C 5ER4X 4GAOA 1F4OA 3GK1A 3SIAA 1DJGA 2BE6A 1K94A 2KI6D 1J1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QV1 A;  1JC2 A;  2ZRS A;  1JF2 A;  1YRT B;  4I5N B;  1RJV A;  1AJ5 A;  4QJ4 B;  2JT3 A;  1M46 A;  2BCA A;  1Y1U A;  1FI6 A;  4GGF C;  4PAL A;  2COL B;  1R2U A;  1S36 A;  4ORB B;  2LMV A;  3O4Y A;  2K7D A;  2O60 A;  2KSP A;  5HKZ A;  1KSM A;  4N1G A;  1TCF A;  4M2O A;  1PSR A;  3WHU B;  1XFY O;  3BOW A;  2KGR A;  4C0J A;  5AFP A;  1DT7 B;  1OMV A;  3EVR A;  3FIA A;  4JWQ A;  2WCE A;  2H61 C;  4GPL B;  1KSO A;  1CDM A;  1WY9 A;  3CZT X;  1GGZ A;  2CBL A;  1MUX A;  2KYF A;  1NCY A;  2G2B A;  2M1K B;  1UHJ A;  3PLF B;  4MEW A;  4MN0 A;  2MAZ A;  3H4S E;  4ZCV A;  5TNC A;  1ALW A;  2HQW A;  4DS7 A;  1H4B A;  1S1E A;  2TN4 A;  1UWO A;  1KQV A;  3PAT A;  2JT8 A;  1ZFS A;  2MHH A;  3CLN A;  3KF9 A;  2FOT A;  1OMR A;  4WRI A;  5CSF A;  2L51 A;  2O5G A;  1K2H A;  4MZK A;  4GNK B;  3M0W A;  1F8H A;  3JVT B;  1W7I B;  4ZCU A;  5HKW A;  1K95 A;  2LCP A;  4YGA A;  2PSR A;  1QJT A;  2M1U A;  4OKH A;  1FPW A;  4MBE A;  1MHO A;  4P5O E;  1CTR A;  3C1V A;  1YRU B;  2H61 A;  1G33 A;  3IQQ A;  2LLT A;  3NSL A;  1QIV A;  5CPV A;  3VRN A;  2JUL A;  5KSZ A;  2EC6 C;  4FTG A;  1YTZ C;  2ZRT A;  1BF5 A;  1A4P A;  1GQM A;  3NSK A;  3KPX A;  3D0Y A;  1SRA A;  1WRK A;  3K21 A;  2HPS A;  4MLW A;  2GGZ A;  1F4Q A;  1RTP 1;  2M29 A;  3TZ1 A;  4AQI A;  3O2P A;  1WRL A;  1CDL A;  2L50 A;  3FWB A;  4HRE E;  4QJ5 B;  2E6W A;  2LLS A;  2SAS A;  1PAL A;  3F45 A;  1E8A A;  2OS8 C;  3LK1 A;  3PAL A;  4JPZ B;  5CSJ A;  2WOR A;  5DKR A;  2K7C A;  5KTY A;  2NCP A;  1DMO A;  1XYD A;  1KFU L;  3VRR A;  1XFV O;  1QX2 A;  1OOJ A;  1F70 A;  2JTT A;  2DOQ A;  1RWY A;  1DGU A;  3CWG A;  3I5H C;  4PHM A;  4AOM A;  5CSN A;  1CNP A;  2LVV A;  1CLM A;  3I5F B;  4HSZ A;  3NSO A;  1AUI B;  3O78 A;  1B47 A;  2F3Y A;  2PMY A;  3TDI A;  4C0K A;  1H8B A;  1LA3 A;  1PSB A;  3KHE A;  4E68 A;  3BUX B;  1YX8 A;  1K9K A;  3BUM B;  2JU0 A;  1U5I A;  4PCW A;  4PHN A;  1J55 A;  2I18 A;  2M9G A;  1B4C A;  1F54 A;  1QLS A;  1A29 A;  1IQ5 A;  1CMG A;  4AQJ A;  1JSA A;  2L5X B;  1CMF A;  1F55 A;  5HYD A;  1C7V A;  1FBV A;  4YBH B;  1F71 A;  1ALV A;  2M49 B;  2M97 A;  1DJW A;  2CTN A;  1TIZ A;  3FS7 A;  4OCI A;  3I5G B;  5K89 A;  1S3P A;  1FF1 A;  1SCV A;  1AVS A;  2EHB A;  4PE0 A;  1YUU A;  1D1O A;  1A75 A;  1KFX S;  2MA2 A;  4Q04 A;  2L98 A;  1S6I A;  2QPT A;  5IBW A;  5HLV A;  1V1G A;  3VRO A;  2CCM A;  1ZOT B;  4F0Z B;  1DJZ A;  3CS1 A;  2Q91 A;  1SL8 A;  4R1E A;  1SBJ A;  5F6T A;  3LL8 B;  2F2P A;  1FW4 A;  3PSR A;  1OSA A;  1OQP A;  4XJK B;  3EK4 A;  2LLU A;  2KI4 C;  5JOL A;  3TDZ A;  1YVH A;  1WDC B;  3PN7 B;  2LC5 A;  4WQ3 A;  5G08 A;  2KBI A;  2HET A;  1DJI A;  1CM1 A;  1QLK A;  1RFJ A;  3TS5 B;  1NYA A;  3EKH A;  4CFQ A;  5CSI A;  1N65 A;  3BUO B;  1NSH A;  1EG4 A;  1Y0V H;  4A4B A;  1JWD A;  1DGV A;  4ICB A;  1IJ6 A;  1NUB A;  3I5I C;  2H2K A;  2F8P A;  4PHJ A;  1NCX A;  1S6C A;  1TRF A;  5HKY A;  1EL4 A;  2K7B A;  1SW8 A;  2BL0 B;  1B8R A;  1DTL A;  4N1F A;  3DVJ A;  5AER A;  4HRH A;  1L2O C;  1KK8 C;  2LP3 A;  4WQ2 A;  3E3R A;  4BY4 A;  5BPJ A;  2KAX A;  4OR9 B;  5FYX A;  1B7T Z;  2HF5 A;  2D8N A;  3HCM A;  3IF7 A;  1WRZ A;  1B8C A;  1PUL A;  1Y1X A;  3CGA A;  4YGB B;  2LM5 A;  1JFJ A;  1K8U A;  1Q80 A;  2ISD A;  1NPQ A;  4MZJ A;  3ZNI A;  1SCM C;  3BUN B;  1CDP A;  1N0Y A;  1TTX A;  3DF0 B;  4TNC A;  1KWO C;  3PM8 A;  2K0J A;  1OZS A;  2KQ6 A;  5I2O A;  2KBM A;  3VRQ A;  4CFR A;  1SL9 A;  2K2A A;  3NSI A;  1KK7 Z;  1CLB A;  4YRU A;  4D1E A;  4GFT A;  4MSP A;  2NCO A;  1BOC A;  3JTD C;  1J7R A;  1NWD A;  4L9M A;  3OHM B;  2BBM A;  2L4H A;  1BU3 A;  2B1U A;  1QS7 A;  2WOS A;  3EKJ A;  1DVI A;  1QAT A;  2BE4 A;  1JF0 A;  1NIW A;  4PE4 A;  1NX1 A;  1ZAC A;  2OTG C;  1GGW A;  1XFU O;  1WLM A;  5I2Q A;  2FCE A;  1DF0 B;  2NXQ A;  1BT6 A;  2K8M B;  1C7W A;  1NX3 A;  2WC8 A;  1CFP A;  3WHT B;  1QIW A;  1QXP A;  3TDU A;  3KEV A;  2MRD A;  4ORC B;  1VRK A;  1KQM B;  2LAN A;  2ZKM X;  1AHR A;  2KGB C;  4HRG A;  1HT9 A;  1XK4 A;  2F33 A;  3BXK A;  2JPT A;  1DJH A;  2G9B A;  2QAC A;  2JT0 A;  1IGV A;  1TNQ A;  2CXJ A;  1UHK A;  3TUY C;  2KQY A;  2M8U A;  1U5I B;  3NXA A;  1J7Q A;  2KAV A;  2JTZ A;  3BUW B;  2M3W A;  1UP5 A;  4YI8 A;  2ZFD A;  3GK4 X;  4YGD B;  1S6J A;  2JOJ A;  2KDH A;  1TNP A;  2OS8 B;  5DKQ A;  2JNF A;  2CNP A;  1K96 A;  2K2F A;  1C07 A;  3GOF A;  2LE9 B;  1V1F A;  1PRW A;  2L0P A;  1AK8 A;  2Y1N A;  2KAY A;  1YVL A;  2NZ0 A;  3I5H B;  2Q4U A;  3DVE A;  5D7F A;  4NDB A;  2NLN A;  5AEQ A;  1SY9 A;  3AKA A;  3FWC A;  3BQ3 A;  2K61 A;  1M63 B;  1A75 B;  1OZO A;  1DJX A;  4A4C A;  1LIN A;  2CT9 A;  2BEC A;  4XYN A;  1QX5 B;  2Y5I A;  2Y1M A;  4ORA B;  1R6P A;  2BCB A;  2MJW B;  1REC A;  2RGI A;  4CID A;  2Y4Q A;  1J7P A;  4CLN A;  1SR6 C;  5HLO A;  3MSE B;  1MWN A;  5B8I B;  1L7Z A;  2WCB A;  2ZNE A;  2OPO A;  3CR4 X;  2AAO A;  1TCO B;  4I5J A;  5PAL A;  1M39 A;  3CR2 A;  1IG5 A;  1X02 A;  4QJ3 B;  3O6B A;  3QRX A;  2FCD A;  2LMU A;  1EH2 A;  4GGN A;  1MXE A;  5I2L A;  2I2R E;  1WDC C;  3DVK A;  4CPV A;  1TN4 A;  1PK0 D;  2KNE A;  1B7T Y;  3RLZ A;  1G4Y R;  1OMD A;  3BOW B;  2PAL A;  1ODB A;  1RK9 A;  3WXA A;  3AAK A;  3CR5 X;  1YX7 A;  1JUO A;  1B1G A;  2LVI A;  2BCX A;  4M2Q A;  1CLL A;  4USL A;  1DJY A;  1ZMZ A;  1SPY A;  3EVU A;  1K9P A;  1EXR A;  1NX2 A;  2L2E A;  2AUC A;  1IQ3 A;  2LHL A;  4MRX A;  1KFX L;  2KI4 B;  3OP0 A;  1XA5 A;  2JXC A;  2MBX A;  3PFV A;  1UHH A;  1M31 A;  2GV5 A;  1S5G Y;  2LVK A;  1JFK A;  1NP8 A;  3SG6 A;  4XJK A;  2KHN A;  1MR8 A;  1LVC D;  2JRF A;  4OVN F;  1FI5 A;  4YGE B;  3I5I B;  1NX0 A;  1KK7 Y;  1LA0 A;  1MF8 B;  2VRG A;  2ZN9 A;  1JBA A;  2A4J A;  2LUX A;  2MLF C;  1XFW O;  1L2O B;  1KK8 B;  1YUR A;  2ZN8 A;  3IQO A;  4DUQ A;  1BR1 B;  2EGD A;  2LV7 A;  3JVT C;  1S5G Z;  1YUS A;  1CFC A;  2MLE C;  1WLZ A;  4DRW A;  3LLE A;  1CFD A;  1K9U A;  2M7N A;  3LK0 A;  1XK4 C;  4GUK A;  1YUT A;  1UHN A;  1IWQ A;  4MVF A;  2M0R A;  3BYA A;  2PAS A;  1CB1 A;  4NDD A;  5D69 A;  3D0Y B;  5JJG A;  2LVJ A;  2BBN A;  1A03 A;  1IRJ A;  2E30 A;  4ETO A;  1BG1 A;  3DD4 A;  1SCM B;  4M2P A;  1MXL C;  2JQ6 A;  1LKJ A;  4NDC A;  1Y1A A;  3CTN A;  1KFU S;  4GGF A;  1CDN A;  1KWO B;  1Y6W A;  1TNX A;  1AJ4 A;  2SCP A;  1QX7 A;  1W7J B;  1CKK A;  2BKH B;  1LXF C;  4DIR A;  3LCP C;  1BR4 B;  3A8R A;  2KOT A;  2I7A A;  1SNL A;  5KU1 A;  1TOP A;  4UPG A;  1CFF A;  3DF0 A;  2PRU A;  2HQ8 A;  1TNW A;  1XFX O;  3JTD B;  3VGO A;  1B9A A;  1KQM C;  1J7O A;  3SG5 A;  2F2O A;  1BLQ A;  2JC2 A;  1UUS A;  1IKU A;  1K93 D;  1G8I A;  2EC6 B;  2LMT A;  2IS9 A;  1NCZ A;  2KI6 C;  2OTG B;  2KFF A;  1SKT A;  3I5F C;  3OX6 A;  4IL1 A;  3EVV A;  2M7L A;  1IJ5 A;  1SMG A;  3DVM A;  2LNK A;  2BKI B;  1S26 D;  2PVB A;  2LHI A;  2JZI A;  1M45 A;  4DCK A;  1XFZ O;  1BMO A;  3D10 A;  2KFH A;  3RM1 A;  1A2X A;  2GGM A;  2LUC A;  1XVJ A;  3VRP A;  1BOD A;  1DF0 A;  1XO5 A;  1QVI Y;  4NQG A;  1GJY A;  5J3X A;  5DKN A;  4MZL A;  2JWW A;  2I94 A;  1ZUZ A;  4PHK A;  4MRY A;  1YR5 A;  2K7O A;  4YI9 A;  5AXI A;  3TUY B;  3OX5 A;  3KO0 A;  3ZWH A;  3SG7 A;  1KCY A;  1SYM A;  2P6B B;  3A4U B;  3EK8 A;  1B8L A;  1HQV A;  2JNX A;  3SG3 A;  3OB1 B;  1MQ1 A;  1QTX A;  2F3Z A;  3I5G C;  1OE9 B;  5AAN A;  5I8N A;  4YGC B;  2V53 A;  1QVI Z;  2KYC A;  3AAJ A;  3SG2 A;  1RRO A;  2R2I A;  3OB2 B;  1EJ3 A;  1CM4 A;  2FJU B;  3EK7 A;  1EG3 A;  1UUR A;  4PE1 A;  3SIB A;  2LP2 A;  4P2Y B;  1PVB A;  4GBA A;  2JXL A;  1AP4 A;  3HX4 A;  4C0L A;  3SJS A;  4I5L B;  2WND A;  3AKB A;  3WNX B;  1QV0 A;  4N5X A;  1N2D A;  3SG4 A;  4I5K A;  3GK2 A;  3PN7 C;  2KFG A;  1SL7 A;  2AMI A;  3ICB A;  1K90 D;  1PVA A;  5ER5 A;  2ZND A;  4BY5 A;  4OV2 A;  4FQO A;  3TS5 C;  4JQ0 D;  1QAS A;  2WCF A;  1J1E A;  1SR6 B;  4PDZ A;  5GQQ C;  2L4I A;  1BJF A;  1SK6 D;  1UHI A;  4PE7 A;  2LAP A;  4U8D A;  1IH0 A;  2BL0 C;  5ER4 X;  4GAO A;  1F4O A;  3GK1 A;  3SIA A;  1DJG A;  2BE6 A;  1K94 A;  2KI6 D;  1J1D A; 
#chains in the Genus database with same CATH topology
 1OOF A;  1QV1 A;  1JC2 A;  2ZRS A;  1JF2 A;  1YRT B;  2L2C A;  4I5N B;  1RJV A;  1AJ5 A;  4QJ4 B;  5FI6 A;  2JT3 A;  1M46 A;  2BCA A;  1Y1U A;  1FI6 A;  1DQE A;  4GGF C;  4PAL A;  2COL B;  1R2U A;  1S36 A;  4ORB B;  2LMV A;  1W9Z A;  3O4Y A;  2K7D A;  2O60 A;  2KSP A;  5HKZ A;  1KSM A;  2QEH A;  2WC6 A;  4N1G A;  1TCF A;  4M2O A;  1PSR A;  3WHU B;  2JPO A;  1XFY O;  3BOW A;  2KGR A;  4C0J A;  5AFP A;  1DT7 B;  1OMV A;  3BFA A;  3EVR A;  3FIA A;  4INX A;  4JWQ A;  2WCE A;  2H61 C;  4GPL B;  1KSO A;  1CDM A;  1WY9 A;  3CZT X;  2WCL A;  1GGZ A;  2CBL A;  1MUX A;  2KYF A;  1NCY A;  2G2B A;  2M1K B;  1UHJ A;  3PLF B;  4MEW A;  4MN0 A;  2MAZ A;  3H4S E;  4ZCV A;  5TNC A;  2HQW A;  4DS7 A;  1H4B A;  1S1E A;  2TN4 A;  1UWO A;  1KQV A;  3PAT A;  2JT8 A;  1ZFS A;  2MHH A;  3CLN A;  3KF9 A;  2FOT A;  1OMR A;  4WRI A;  5CSF A;  2L51 A;  3D76 A;  2O5G A;  1K2H A;  4MZK A;  4GNK B;  2BAP A;  3M0W A;  1F8H A;  3JVT B;  1W7I B;  4ZCU A;  5HKW A;  1K95 A;  2LCP A;  4YGA A;  2PSR A;  1QJT A;  3BJH A;  2M1U A;  4OKH A;  1FPW A;  4MBE A;  3IVT A;  1MHO A;  4P5O E;  1CTR A;  2ERB A;  3C1V A;  1YRU B;  2P71 A;  2H61 A;  1G33 A;  2WCK A;  3IQQ A;  2LLT A;  3NSL A;  1QIV A;  5CPV A;  3VRN A;  2JUL A;  5KSZ A;  2EC6 C;  1DEK A;  4FTG A;  1YTZ C;  2ZRT A;  3D73 A;  1BF5 A;  1A4P A;  1GQM A;  3NSK A;  3KPX A;  3D0Y A;  2WCJ A;  1SRA A;  1WRK A;  3K21 A;  2HPS A;  4MLW A;  2GGZ A;  1F4Q A;  1RTP 1;  2M29 A;  3TZ1 A;  4AQI A;  3O2P A;  1WRL A;  1CDL A;  2L50 A;  2WCM A;  3FWB A;  4HRE E;  4QJ5 B;  2E6W A;  2LLS A;  2SAS A;  1PAL A;  2BNX A;  1E8A A;  2OS8 C;  3F45 A;  3LK1 A;  3PAL A;  4JPZ B;  2WOR A;  5CSJ A;  2K7C A;  5DKR A;  2NCP A;  3B7A A;  5KTY A;  1DMO A;  1XYD A;  1KFU L;  5HL1 A;  3VRR A;  1XFV O;  1QX2 A;  1OOJ A;  1F70 A;  2JTT A;  2DOQ A;  1RWY A;  1DGU A;  3CWG A;  3I5H C;  4PHM A;  3B6X A;  5CSN A;  4AOM A;  1CNP A;  2KLE A;  2LVV A;  1Z4H A;  1CLM A;  3I5F B;  4HSZ A;  3NSO A;  1AUI B;  3O78 A;  1B47 A;  2F3Y A;  2PMY A;  3TDI A;  3S0B A;  3L4A A;  4C0K A;  1H8B A;  1LA3 A;  1PSB A;  3KHE A;  4E68 A;  3BUX B;  1YX8 A;  1K9K A;  3BUM B;  2JU0 A;  1U5I A;  4PCW A;  3PJI A;  5D3O A;  4PHN A;  1J55 A;  2I18 A;  2M9G A;  1B4C A;  1F54 A;  1QLS A;  1A29 A;  1IQ5 A;  1CMG A;  4AQJ A;  1JSA A;  2L5X B;  1CMF A;  1F55 A;  5HYD A;  1C7V A;  1FBV A;  4YBH B;  1F71 A;  1ALV A;  2M49 B;  3FE8 A;  2M97 A;  1DJW A;  2CTN A;  1TIZ A;  3FS7 A;  4OCI A;  3I5G B;  3O4X A;  3R1V A;  1GM0 A;  3BFB A;  5K89 A;  1S3P A;  1FF1 A;  1SCV A;  1AVS A;  2EHB A;  4PE0 A;  1YUU A;  1D1O A;  1A75 A;  1KFX S;  2MA2 A;  4Q04 A;  2L98 A;  1S6I A;  2QPT A;  5IBW A;  5HLV A;  1V1G A;  3VRO A;  2CCM A;  1ZOT B;  4F0Z B;  1DJZ A;  3CS1 A;  2Q91 A;  1SL8 A;  3D78 A;  1SBJ A;  4R1E A;  5F6T A;  3S0A A;  3LL8 B;  2F2P A;  1FW4 A;  1ORG A;  3PSR A;  1OSA A;  3EG5 B;  1OQP A;  3CAB A;  4XJK B;  3EK4 A;  5FI2 A;  2LLU A;  2KI4 C;  5JOL A;  3TDZ A;  1YVH A;  1WDC B;  3PN7 B;  2LC5 A;  4WQ3 A;  5G08 A;  2KBI A;  2HET A;  1DJI A;  1CM1 A;  1QLK A;  1RFJ A;  3TS5 B;  1NYA A;  3EKH A;  2WC5 A;  4CFQ A;  5CSI A;  1N65 A;  3BUO B;  1NSH A;  1EG4 A;  1Y0V H;  4A4B A;  1JWD A;  1DGV A;  2P70 A;  4ICB A;  1IJ6 A;  1NUB A;  3I5I C;  2H2K A;  2F8P A;  4PHJ A;  1NCX A;  1S6C A;  1TRF A;  5HKY A;  1EL4 A;  2K7B A;  1SW8 A;  2BL0 B;  1B8R A;  1DTL A;  4N1F A;  5EL2 A;  3DVJ A;  5AER A;  2KPH A;  4HRH A;  1L2O C;  1KK8 C;  2LP3 A;  4WQ2 A;  3E3R A;  4BY4 A;  5BPJ A;  2KAX A;  4OR9 B;  3CZ2 A;  5FYX A;  1B7T Z;  3DXL A;  2HF5 A;  2QEO A;  2D8N A;  3HCM A;  3IF7 A;  1WRZ A;  3V2L A;  2PYQ A;  1XFR A;  1B8C A;  1PUL A;  3B87 A;  4IJ7 A;  1Y1X A;  3CGA A;  4YGB B;  2LM5 A;  1JFJ A;  4OZD A;  1K8U A;  1Q80 A;  2GTE A;  1NPQ A;  3QME A;  4MZJ A;  1SCM C;  2ISD A;  3ZNI A;  3S0F A;  3BUN B;  1CDP A;  1N0Y A;  1TTX A;  3DF0 B;  4TNC A;  1KWO C;  3PM8 A;  2K0J A;  3CZ0 A;  1OZS A;  2KQ6 A;  5I2O A;  2KBM A;  3VRQ A;  4JD9 A;  4CFR A;  1SL9 A;  2K2A A;  5DIC A;  3NSI A;  1KK7 Z;  1CLB A;  4YRU A;  4FQT A;  4D1E A;  4GFT A;  4MSP A;  2NCO A;  1BOC A;  3JTD C;  1J7R A;  1NWD A;  4L9M A;  3B86 A;  3OHM B;  2BBM A;  2L4H A;  1BU3 A;  2B1U A;  1QS7 A;  2WOS A;  3EKJ A;  1DVI A;  1QAT A;  2BE4 A;  1JF0 A;  1NIW A;  4PE4 A;  1NX1 A;  1ZAC A;  2OTG C;  1GGW A;  1XFU O;  1WLM A;  2FJY A;  5I2Q A;  3NHI A;  2FCE A;  1DF0 B;  2NXQ A;  1BT6 A;  2K8M B;  3K1E A;  1C7W A;  1NX3 A;  2WC8 A;  3NGV A;  1CFP A;  3WHT B;  3S0G A;  1QIW A;  3BFH A;  1QXP A;  3TDU A;  3KEV A;  2MRD A;  3FE9 A;  4ORC B;  1VRK A;  1KQM B;  2LAN A;  2ZKM X;  1AHR A;  2KGB C;  4HRG A;  1HT9 A;  1XK4 A;  2F33 A;  3BXK A;  3N7H A;  2JPT A;  1DJH A;  2G9B A;  2QAC A;  2JT0 A;  1IGV A;  1TNQ A;  2BE6 A;  2CXJ A;  3CDN A;  3D77 A;  1UHK A;  3TUY C;  2KQY A;  2M8U A;  1U5I B;  3NXA A;  1J7Q A;  2KAV A;  2JTZ A;  3BUW B;  2M3W A;  1UP5 A;  4YI8 A;  2ZFD A;  3SS4 A;  3GK4 X;  4YGD B;  1S6J A;  2JOJ A;  2KDH A;  1TNP A;  2OS8 B;  5DKQ A;  2JNF A;  2CNP A;  1K96 A;  1TWO A;  2K2F A;  3GOF A;  1C07 A;  2LE9 B;  1V1F A;  1PRW A;  2L0P A;  1AK8 A;  2Y1N A;  2KAY A;  1OOI X;  1YVL A;  2NZ0 A;  3I5H B;  2Q4U A;  3DVE A;  5D7F A;  4NDB A;  2NLN A;  5AEQ A;  1SY9 A;  3D75 A;  3AKA A;  3FWC A;  1DC1 A;  3BQ3 A;  2K61 A;  1M63 B;  1A75 B;  1OZO A;  1DJX A;  4A4C A;  1LIN A;  2CT9 A;  1DEL A;  2BEC A;  4XYN A;  3OBV A;  1QX5 B;  2Y5I A;  2Y1M A;  4ORA B;  1R6P A;  2BCB A;  2MJW B;  1REC A;  2RGI A;  4CID A;  2Y4Q A;  3PM2 A;  1J7P A;  4CLN A;  1SR6 C;  5HLO A;  3MSE B;  1MWN A;  5B8I B;  1L7Z A;  2WCB A;  2ZNE A;  2OPO A;  3CR4 X;  2AAO A;  1TCO B;  4I5J A;  5PAL A;  1M39 A;  3CR2 A;  1IG5 A;  3RZS A;  1X02 A;  4QJ3 B;  3O6B A;  3SS5 A;  3R1P A;  3QRX A;  2FCD A;  2LMU A;  1EH2 A;  1OOH A;  1MXE A;  4GGN A;  3DYE A;  5I2L A;  3S0E A;  2I2R E;  1WDC C;  3DVK A;  4CPV A;  1TUZ A;  1TN4 A;  1PK0 D;  2KNE A;  1B7T Y;  3RLZ A;  1G4Y R;  1OMD A;  3BOW B;  2PAL A;  3L4L A;  1ODB A;  3B88 A;  1RK9 A;  3WXA A;  3CYZ A;  3OGN A;  3AAK A;  3CR5 X;  1YX7 A;  1JUO A;  1B1G A;  2LVI A;  2BCX A;  4M2Q A;  1CLL A;  4USL A;  1DJY A;  1ZMZ A;  1SPY A;  3EVU A;  1K9P A;  1EXR A;  1NX2 A;  2L2E A;  2AUC A;  1IQ3 A;  2YGU A;  2LHL A;  4MRX A;  1KFX L;  2KI4 B;  3OP0 A;  1XA5 A;  2JXC A;  3UNW A;  2MBX A;  3PFV A;  3VB1 A;  1UHH A;  1M31 A;  2GV5 A;  1S5G Y;  2LVK A;  1JFK A;  1NP8 A;  3SG6 A;  4XJK A;  2KHN A;  1MR8 A;  1LVC D;  2JRF A;  4OVN F;  1FI5 A;  4YGE B;  3I5I B;  1NX0 A;  1KK7 Y;  1LA0 A;  1MF8 B;  2VRG A;  1Z2C B;  2ZN9 A;  1JBA A;  2A4J A;  2LUX A;  2MLF C;  1XFW O;  1L2O B;  1KK8 B;  1QWV A;  1YUR A;  2ZN8 A;  3IQO A;  4JKT A;  1BR1 B;  2EGD A;  4DUQ A;  2LV7 A;  3JVT C;  1S5G Z;  1YUS A;  1CFC A;  2MLE C;  1WLZ A;  4DRW A;  3LLE A;  1CFD A;  1K9U A;  2M7N A;  4F7F A;  3LK0 A;  1XK4 C;  4GUK A;  4INW A;  1YUT A;  1UHN A;  3R72 A;  1IWQ A;  4MVF A;  2M0R A;  2QEV A;  3BYA A;  2PAS A;  1CB1 A;  2K60 A;  4NDD A;  5D69 A;  3D0Y B;  5JJG A;  2LVJ A;  2BBN A;  1A03 A;  1IRJ A;  2E30 A;  4ETO A;  1BG1 A;  3DD4 A;  1SCM B;  4M2P A;  5I94 A;  1MXL C;  2JQ6 A;  1LKJ A;  4NDC A;  1Y1A A;  3CTN A;  1KFU S;  4GGF A;  1CDN A;  1KWO B;  1Y6W A;  1TNX A;  1AJ4 A;  2SCP A;  1QX7 A;  1W7J B;  1LS8 A;  3R1O A;  1CKK A;  2BKH B;  1LXF C;  4DIR A;  3LCP C;  1BR4 B;  3A8R A;  2KOT A;  2I7A A;  1SNL A;  5KU1 A;  1TOP A;  4UPG A;  1OW4 A;  3DF0 A;  2PRU A;  1CFF A;  3CZ1 A;  2HQ8 A;  1TNW A;  1XFX O;  3JTD B;  3VGO A;  1B9A A;  1KQM C;  1J7O A;  3SS3 A;  3SG5 A;  1SSE B;  2F2O A;  1BLQ A;  2JC2 A;  1UUS A;  3D74 A;  1IKU A;  3UO9 A;  1K93 D;  1G8I A;  1C3Z A;  2EC6 B;  2IS9 A;  1NCZ A;  2LMT A;  2KI6 C;  2OTG B;  2KFF A;  1SKT A;  3I5F C;  3OX6 A;  4IL1 A;  3EVV A;  2M7L A;  1IJ5 A;  1SMG A;  3DVM A;  2LNK A;  2BKI B;  1S26 D;  2PVB A;  2LHI A;  2JZI A;  1M45 A;  4DCK A;  1XFZ O;  1BMO A;  3D10 A;  2KFH A;  3RM1 A;  1A2X A;  2GGM A;  2LUC A;  1XVJ A;  3L47 A;  3VRP A;  1BOD A;  1DF0 A;  1XO5 A;  1QVI Y;  4NQG A;  1GJY A;  5J3X A;  1T14 A;  5DKN A;  3Q8I A;  4MZL A;  2JWW A;  2I94 A;  1ZUZ A;  4PHK A;  4MRY A;  1YR5 A;  2K7O A;  4YI9 A;  5AXI A;  3TUY B;  3OX5 A;  3KO0 A;  3ZWH A;  3SG7 A;  1KCY A;  1SYM A;  2P6B B;  3A4U B;  3EK8 A;  1B8L A;  1HQV A;  2JNX A;  2KLD A;  2QDI A;  3OB1 B;  3SG3 A;  1IIO A;  1MQ1 A;  1QTX A;  2F3Z A;  3I5G C;  3NHT A;  1OE9 B;  5AAN A;  5I8N A;  4YGC B;  2V53 A;  1QVI Z;  2L5Y A;  2H8V A;  2KYC A;  3AAJ A;  3SG2 A;  2QEB A;  1RRO A;  2R2I A;  3OB2 B;  1EJ3 A;  1CM4 A;  2FJU B;  3EK7 A;  1EG3 A;  1UUR A;  4PE1 A;  1C3Y A;  3SIB A;  2PQL A;  2LP2 A;  4P2Y B;  5FI7 A;  1PVB A;  4GBA A;  3FE6 A;  2JXL A;  3DY9 A;  1AP4 A;  3HX4 A;  4C0L A;  3SJS A;  4I5L B;  2WND A;  3AKB A;  1OOG A;  1QV0 A;  1TUJ A;  4N5X A;  3DZT A;  3WNX B;  1N2D A;  4PT1 A;  3SG4 A;  3S0D A;  4I5K A;  3GK2 A;  3PN7 C;  2KFG A;  1SL7 A;  2AMI A;  3ICB A;  1K90 D;  1PVA A;  5ER5 A;  2WCH A;  2ZND A;  4BY5 A;  4OV2 A;  4FQO A;  3TS5 C;  4JQ0 D;  1QAS A;  2WCF A;  1J1E A;  4KYN A;  1SR6 B;  4PDZ A;  5GQQ C;  2L4I A;  1BJF A;  1P28 A;  1SK6 D;  1UHI A;  4PE7 A;  2LAP A;  4U8D A;  1IH0 A;  2BL0 C;  5ER4 X;  4GAO A;  1F4O A;  3GK1 A;  3SIA A;  1DJG A;  1ALW A;  1K94 A;  2KI6 D;  1J1D A; 
#chains in the Genus database with same CATH homology
 1QV1 A;  1JC2 A;  2ZRS A;  1JF2 A;  1YRT B;  4I5N B;  1RJV A;  1AJ5 A;  4QJ4 B;  2JT3 A;  1M46 A;  2BCA A;  1Y1U A;  1FI6 A;  4GGF C;  4PAL A;  2COL B;  1R2U A;  1S36 A;  4ORB B;  2LMV A;  3O4Y A;  2K7D A;  2O60 A;  2KSP A;  5HKZ A;  1KSM A;  4N1G A;  1TCF A;  4M2O A;  1PSR A;  3WHU B;  1XFY O;  3BOW A;  2KGR A;  4C0J A;  5AFP A;  1DT7 B;  1OMV A;  3EVR A;  3FIA A;  4JWQ A;  2WCE A;  2H61 C;  4GPL B;  1KSO A;  1CDM A;  1WY9 A;  3CZT X;  1GGZ A;  2CBL A;  1MUX A;  2KYF A;  1NCY A;  2G2B A;  2M1K B;  1UHJ A;  3PLF B;  4MEW A;  4MN0 A;  2MAZ A;  3H4S E;  4ZCV A;  5TNC A;  1ALW A;  2HQW A;  4DS7 A;  1H4B A;  1S1E A;  2TN4 A;  1UWO A;  1KQV A;  3PAT A;  2JT8 A;  1ZFS A;  2MHH A;  3CLN A;  3KF9 A;  2FOT A;  1OMR A;  4WRI A;  5CSF A;  2L51 A;  2O5G A;  1K2H A;  4MZK A;  4GNK B;  3M0W A;  1F8H A;  3JVT B;  1W7I B;  4ZCU A;  5HKW A;  1K95 A;  2LCP A;  4YGA A;  2PSR A;  1QJT A;  2M1U A;  4OKH A;  1FPW A;  4MBE A;  1MHO A;  4P5O E;  1CTR A;  3C1V A;  1YRU B;  2H61 A;  1G33 A;  3IQQ A;  2LLT A;  3NSL A;  1QIV A;  5CPV A;  3VRN A;  2JUL A;  5KSZ A;  2EC6 C;  4FTG A;  1YTZ C;  2ZRT A;  1BF5 A;  1A4P A;  1GQM A;  3NSK A;  3KPX A;  3D0Y A;  1SRA A;  1WRK A;  3K21 A;  2HPS A;  4MLW A;  2GGZ A;  1F4Q A;  1RTP 1;  2M29 A;  3TZ1 A;  4AQI A;  3O2P A;  1WRL A;  1CDL A;  2L50 A;  3FWB A;  4HRE E;  4QJ5 B;  2E6W A;  2LLS A;  2SAS A;  1PAL A;  3F45 A;  1E8A A;  2OS8 C;  3LK1 A;  3PAL A;  4JPZ B;  5CSJ A;  2WOR A;  5DKR A;  2K7C A;  5KTY A;  2NCP A;  1DMO A;  1XYD A;  1KFU L;  3VRR A;  1XFV O;  1QX2 A;  1OOJ A;  1F70 A;  2JTT A;  2DOQ A;  1RWY A;  1DGU A;  3CWG A;  3I5H C;  4PHM A;  4AOM A;  5CSN A;  1CNP A;  2LVV A;  1CLM A;  3I5F B;  4HSZ A;  3NSO A;  1AUI B;  3O78 A;  1B47 A;  2F3Y A;  2PMY A;  3TDI A;  4C0K A;  1H8B A;  1LA3 A;  1PSB A;  3KHE A;  4E68 A;  3BUX B;  1YX8 A;  1K9K A;  3BUM B;  2JU0 A;  1U5I A;  4PCW A;  4PHN A;  1J55 A;  2I18 A;  2M9G A;  1B4C A;  1F54 A;  1QLS A;  1A29 A;  1IQ5 A;  1CMG A;  4AQJ A;  1JSA A;  2L5X B;  1CMF A;  1F55 A;  5HYD A;  1C7V A;  1FBV A;  4YBH B;  1F71 A;  1ALV A;  2M49 B;  2M97 A;  1DJW A;  2CTN A;  1TIZ A;  3FS7 A;  4OCI A;  3I5G B;  5K89 A;  1S3P A;  1FF1 A;  1SCV A;  1AVS A;  2EHB A;  4PE0 A;  1YUU A;  1D1O A;  1A75 A;  1KFX S;  2MA2 A;  4Q04 A;  2L98 A;  1S6I A;  2QPT A;  5IBW A;  5HLV A;  1V1G A;  3VRO A;  2CCM A;  1ZOT B;  4F0Z B;  1DJZ A;  3CS1 A;  2Q91 A;  1SL8 A;  4R1E A;  1SBJ A;  5F6T A;  3LL8 B;  2F2P A;  1FW4 A;  3PSR A;  1OSA A;  1OQP A;  4XJK B;  3EK4 A;  2LLU A;  2KI4 C;  5JOL A;  3TDZ A;  1YVH A;  1WDC B;  3PN7 B;  2LC5 A;  4WQ3 A;  5G08 A;  2KBI A;  2HET A;  1DJI A;  1CM1 A;  1QLK A;  1RFJ A;  3TS5 B;  1NYA A;  3EKH A;  4CFQ A;  5CSI A;  1N65 A;  3BUO B;  1NSH A;  1EG4 A;  1Y0V H;  4A4B A;  1JWD A;  1DGV A;  4ICB A;  1IJ6 A;  1NUB A;  3I5I C;  2H2K A;  2F8P A;  4PHJ A;  1NCX A;  1S6C A;  1TRF A;  5HKY A;  1EL4 A;  2K7B A;  1SW8 A;  2BL0 B;  1B8R A;  1DTL A;  4N1F A;  3DVJ A;  5AER A;  4HRH A;  1L2O C;  1KK8 C;  2LP3 A;  4WQ2 A;  3E3R A;  4BY4 A;  5BPJ A;  2KAX A;  4OR9 B;  5FYX A;  1B7T Z;  2HF5 A;  2D8N A;  3HCM A;  3IF7 A;  1WRZ A;  1B8C A;  1PUL A;  1Y1X A;  3CGA A;  4YGB B;  2LM5 A;  1JFJ A;  1K8U A;  1Q80 A;  2ISD A;  1NPQ A;  4MZJ A;  3ZNI A;  1SCM C;  3BUN B;  1CDP A;  1N0Y A;  1TTX A;  3DF0 B;  4TNC A;  1KWO C;  3PM8 A;  2K0J A;  1OZS A;  2KQ6 A;  5I2O A;  2KBM A;  3VRQ A;  4CFR A;  1SL9 A;  2K2A A;  3NSI A;  1KK7 Z;  1CLB A;  4YRU A;  4D1E A;  4GFT A;  4MSP A;  2NCO A;  1BOC A;  3JTD C;  1J7R A;  1NWD A;  4L9M A;  3OHM B;  2BBM A;  2L4H A;  1BU3 A;  2B1U A;  1QS7 A;  2WOS A;  3EKJ A;  1DVI A;  1QAT A;  2BE4 A;  1JF0 A;  1NIW A;  4PE4 A;  1NX1 A;  1ZAC A;  2OTG C;  1GGW A;  1XFU O;  1WLM A;  5I2Q A;  2FCE A;  1DF0 B;  2NXQ A;  1BT6 A;  2K8M B;  1C7W A;  1NX3 A;  2WC8 A;  1CFP A;  3WHT B;  1QIW A;  1QXP A;  3TDU A;  3KEV A;  2MRD A;  4ORC B;  1VRK A;  1KQM B;  2LAN A;  2ZKM X;  1AHR A;  2KGB C;  4HRG A;  1HT9 A;  1XK4 A;  2F33 A;  3BXK A;  2JPT A;  1DJH A;  2G9B A;  2QAC A;  2JT0 A;  1IGV A;  1TNQ A;  2CXJ A;  1UHK A;  3TUY C;  2KQY A;  2M8U A;  1U5I B;  3NXA A;  1J7Q A;  2KAV A;  2JTZ A;  3BUW B;  2M3W A;  1UP5 A;  4YI8 A;  2ZFD A;  3GK4 X;  4YGD B;  1S6J A;  2JOJ A;  2KDH A;  1TNP A;  2OS8 B;  5DKQ A;  2JNF A;  2CNP A;  1K96 A;  2K2F A;  1C07 A;  3GOF A;  2LE9 B;  1V1F A;  1PRW A;  2L0P A;  1AK8 A;  2Y1N A;  2KAY A;  1YVL A;  2NZ0 A;  3I5H B;  2Q4U A;  3DVE A;  5D7F A;  4NDB A;  2NLN A;  5AEQ A;  1SY9 A;  3AKA A;  3FWC A;  3BQ3 A;  2K61 A;  1M63 B;  1A75 B;  1OZO A;  1DJX A;  4A4C A;  1LIN A;  2CT9 A;  2BEC A;  4XYN A;  1QX5 B;  2Y5I A;  2Y1M A;  4ORA B;  1R6P A;  2BCB A;  2MJW B;  1REC A;  2RGI A;  4CID A;  2Y4Q A;  1J7P A;  4CLN A;  1SR6 C;  5HLO A;  3MSE B;  1MWN A;  5B8I B;  1L7Z A;  2WCB A;  2ZNE A;  2OPO A;  3CR4 X;  2AAO A;  1TCO B;  4I5J A;  5PAL A;  1M39 A;  3CR2 A;  1IG5 A;  1X02 A;  4QJ3 B;  3O6B A;  3QRX A;  2FCD A;  2LMU A;  1EH2 A;  4GGN A;  1MXE A;  5I2L A;  2I2R E;  1WDC C;  3DVK A;  4CPV A;  1TN4 A;  1PK0 D;  2KNE A;  1B7T Y;  3RLZ A;  1G4Y R;  1OMD A;  3BOW B;  2PAL A;  1ODB A;  1RK9 A;  3WXA A;  3AAK A;  3CR5 X;  1YX7 A;  1JUO A;  1B1G A;  2LVI A;  2BCX A;  4M2Q A;  1CLL A;  4USL A;  1DJY A;  1ZMZ A;  1SPY A;  3EVU A;  1K9P A;  1EXR A;  1NX2 A;  2L2E A;  2AUC A;  1IQ3 A;  2LHL A;  4MRX A;  1KFX L;  2KI4 B;  3OP0 A;  1XA5 A;  2JXC A;  2MBX A;  3PFV A;  1UHH A;  1M31 A;  2GV5 A;  1S5G Y;  2LVK A;  1JFK A;  1NP8 A;  3SG6 A;  4XJK A;  2KHN A;  1MR8 A;  1LVC D;  2JRF A;  4OVN F;  1FI5 A;  4YGE B;  3I5I B;  1NX0 A;  1KK7 Y;  1LA0 A;  1MF8 B;  2VRG A;  2ZN9 A;  1JBA A;  2A4J A;  2LUX A;  2MLF C;  1XFW O;  1L2O B;  1KK8 B;  1YUR A;  2ZN8 A;  3IQO A;  4DUQ A;  1BR1 B;  2EGD A;  2LV7 A;  3JVT C;  1S5G Z;  1YUS A;  1CFC A;  2MLE C;  1WLZ A;  4DRW A;  3LLE A;  1CFD A;  1K9U A;  2M7N A;  3LK0 A;  1XK4 C;  4GUK A;  1YUT A;  1UHN A;  1IWQ A;  4MVF A;  2M0R A;  3BYA A;  2PAS A;  1CB1 A;  4NDD A;  5D69 A;  3D0Y B;  5JJG A;  2LVJ A;  2BBN A;  1A03 A;  1IRJ A;  2E30 A;  4ETO A;  1BG1 A;  3DD4 A;  1SCM B;  4M2P A;  1MXL C;  2JQ6 A;  1LKJ A;  4NDC A;  1Y1A A;  3CTN A;  1KFU S;  4GGF A;  1CDN A;  1KWO B;  1Y6W A;  1TNX A;  1AJ4 A;  2SCP A;  1QX7 A;  1W7J B;  1CKK A;  2BKH B;  1LXF C;  4DIR A;  3LCP C;  1BR4 B;  3A8R A;  2KOT A;  2I7A A;  1SNL A;  5KU1 A;  1TOP A;  4UPG A;  1CFF A;  3DF0 A;  2PRU A;  2HQ8 A;  1TNW A;  1XFX O;  3JTD B;  3VGO A;  1B9A A;  1KQM C;  1J7O A;  3SG5 A;  2F2O A;  1BLQ A;  2JC2 A;  1UUS A;  1IKU A;  1K93 D;  1G8I A;  2EC6 B;  2LMT A;  2IS9 A;  1NCZ A;  2KI6 C;  2OTG B;  2KFF A;  1SKT A;  3I5F C;  3OX6 A;  4IL1 A;  3EVV A;  2M7L A;  1IJ5 A;  1SMG A;  3DVM A;  2LNK A;  2BKI B;  1S26 D;  2PVB A;  2LHI A;  2JZI A;  1M45 A;  4DCK A;  1XFZ O;  1BMO A;  3D10 A;  2KFH A;  3RM1 A;  1A2X A;  2GGM A;  2LUC A;  1XVJ A;  3VRP A;  1BOD A;  1DF0 A;  1XO5 A;  1QVI Y;  4NQG A;  1GJY A;  5J3X A;  5DKN A;  4MZL A;  2JWW A;  2I94 A;  1ZUZ A;  4PHK A;  4MRY A;  1YR5 A;  2K7O A;  4YI9 A;  5AXI A;  3TUY B;  3OX5 A;  3KO0 A;  3ZWH A;  3SG7 A;  1KCY A;  1SYM A;  2P6B B;  3A4U B;  3EK8 A;  1B8L A;  1HQV A;  2JNX A;  3SG3 A;  3OB1 B;  1MQ1 A;  1QTX A;  2F3Z A;  3I5G C;  1OE9 B;  5AAN A;  5I8N A;  4YGC B;  2V53 A;  1QVI Z;  2KYC A;  3AAJ A;  3SG2 A;  1RRO A;  2R2I A;  3OB2 B;  1EJ3 A;  1CM4 A;  2FJU B;  3EK7 A;  1EG3 A;  1UUR A;  4PE1 A;  3SIB A;  2LP2 A;  4P2Y B;  1PVB A;  4GBA A;  2JXL A;  1AP4 A;  3HX4 A;  4C0L A;  3SJS A;  4I5L B;  2WND A;  3AKB A;  3WNX B;  1QV0 A;  4N5X A;  1N2D A;  3SG4 A;  4I5K A;  3GK2 A;  3PN7 C;  2KFG A;  1SL7 A;  2AMI A;  3ICB A;  1K90 D;  1PVA A;  5ER5 A;  2ZND A;  4BY5 A;  4OV2 A;  4FQO A;  3TS5 C;  4JQ0 D;  1QAS A;  2WCF A;  1J1E A;  1SR6 B;  4PDZ A;  5GQQ C;  2L4I A;  1BJF A;  1SK6 D;  1UHI A;  4PE7 A;  2LAP A;  4U8D A;  1IH0 A;  2BL0 C;  5ER4 X;  4GAO A;  1F4O A;  3GK1 A;  3SIA A;  1DJG A;  2BE6 A;  1K94 A;  2KI6 D;  1J1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...