4PHNA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phnA00
1CLBA 2HPSA 1LINA 1AJ5A 1NX2A 2AUCA 2BECA 3EK8A 1KFUL 2BE6A 3I5HB 1R6PA 4GBAA 1JWDA 2OS8B 3KEVA 4MVFA 2OTGB 4YRUA 1W7JB 2JRFA 4F0ZB 2I18A 1QATA 1SL8A 1YUTA 2JTTA 2KAVA 5HKZA 1IG5A 1K90D 1NUBA 2F2PA 4GGFC 1L7ZA 4CLNA 1DJYA 3NXAA 2Y4QA 3CLNA 3I5FB 1YUSA 3PATA 1CDMA 1QX5B 3D10A 1K95A 2WCEA 3CR2A 4CFRA 1S1EA 3BYAA 1XK4A 3SG6A 1S26D 1IWQA 1KK8B 1TNWA 1UHIA 1SKTA 1XVJA 2AAOA 2KFHA 2SCPA 2MHHA 1JFJA 3I5FC 2L0PA 1NCZA 1KK7Z 1YX8A 2QACA 3LK0A 1RWYA 1BF5A 1CMGA 5DKQA 4JQ0D 1E8AA 3EKHA 3LLEA 1S3PA 1NSHA 1KQMC 1DJXA 3VRPA 3SJSA 2JT0A 1J55A 2ZKMX 4IL1A 1AHRA 2G9BA 1X02A 2JWWA 4YGDB 1CFPA 2EC6B 3LK1A 1KWOB 1Y1AA 2F2OA 3A4UB 2GV5A 3I5IB 1AK8A 1QLKA 2MLEC 3BOWA 2EHBA 5DKRA 1MUXA 3O4YA 4HREE 4MBEA 4GGFA 3VGOA 4PE7A 1PSRA 4MRYA 4MZJA 1WLMA 2JT3A 1DMOA 2I2RE 4OR9B 4C0KA 1TNQA 1EG3A 2EC6C 4DRWA 1KWOC 1R2UA 1CLLA 1S36A 3I5IC 1DVIA 4GAOA 3RM1A 1FI6A 2V53A 2BBNA 2WNDA 2MA2A 3KO0A 4WQ3A 1NP8A 2M97A 2GGMA 2QPTA 4DCKA 3D0YA 1F70A 1IJ5A 1DGVA 1L2OB 1MR8A 2LVVA 2E6WA 5AXIA 1XFVO 1M45A 1YURA 1NCXA 3AAJA 2KQYA 3TZ1A 2I7AA 3VRNA 1K93D 2A4JA 1SY9A 1SYMA 1WLZA 4NQGA 1J7OA 3EVVA 1XFXO 3HCMA 1QV0A 1N65A 2H2KA 2M8UA 1TCFA 3JTDB 1NPQA 4YBHB 2KAXA 5KSZA 4N1FA 2CTNA 1EG4A 1QTXA 2I94A 2JU0A 1L2OC 2KYFA 4HSZA 1UHHA 2KNEA 1N0YA 1CTRA 4OV2A 1CDPA 2PVBA 2M1UA 5G08A 1B9AA 2ISDA 4MSPA 1FF1A 1IKUA 1SNLA 5HKWA 4Q04A 1NYAA 2LLSA 3NSOA 4AQIA 1YUUA 1NCYA 1TN4A 3EKJA 1J7PA 1EH2A 3JTDC 4GGNA 2CBLA 1F8HA 1FBVA 1M39A 1CM4A 3SG2A 1CMFA 5KU1A 1ALVA 1AJ4A 1NX3A 1U5IB 3PN7C 1YR5A 1YRUB 3GK1A 1MXLC 3OB1B 3E3RA 3VRQA 2BBMA 1K96A 1IQ5A 1FPWA 4ORBB 1SMGA 3H4SE 1B8CA 1OQPA 3ICBA 3FS7A 1OZOA 1QVIZ 1XYDA 4NDCA 3IQQA 2KGRA 1DT7B 2MAZA 2BL0B 1A29A 3LCPC 1F4QA 4I5NB 3AKAA 4YGCB 1WY9A 1B7TY 3DVEA 1ZUZA 1ZFSA 2LNKA 3TS5B 5GQQC 1DJIA 4NDBA 2LM5A 2WCBA 5CSFA 3VROA 4QJ4B 3BQ3A 1WRZA 4FQOA 4M2PA 2M3WA 4AQJA 2CCMA 2BL0C 2JT8A 4OCIA 5FYXA 2JNFA 1QS7A 1G4YR 4MZKA 1JBAA 2K7BA 3EVUA 4GNKB 1SBJA 3D0YB 3TS5C 4L9MA 4DS7A 2KI6D 4N5XA 1F4OA 2KI6C 1SL9A 1S5GZ 1KQMB 2L4HA 1KFUS 2K8MB 4BY4A 5HKYA 1LA0A 5JJGA 1CB1A 1JSAA 2JZIA 2F3ZA 4PHMA 4WRIA 2NXQA 1XO5A 3BUWB 1PK0D 2L51A 1KCYA 1U5IA 1K8UA 2NCOA 1K9KA 3KF9A 2L4IA 4PCWA 2HQ8A 4MEWA 4YI8A 1AP4A 1N2DA 2K2FA 2KAYA 1TRFA 4HRHA 1UWOA 2ZFDA 1B8LA 1IQ3A 2LP3A 3CTNA 4YGEB 3OB2B 3KHEA 1W7IB 1C7VA 2KSPA 1J1DA 2P6BB 1J1EA 1XFUO 1BG1A 1C07A 4PHKA 2NZ0A 2LMVA 4ZCUA 5D7FA 4GPLB 2Y1NA 1MF8B 1TTXA 3CS1A 1RK9A 1YTZC 2LE9B 2K61A 1UHKA 2Q4UA 1B4CA 2LUCA 1RTP1 2CT9A 4N1GA 3TUYB 4HRGA 2NLNA 3TDZA 1F54A 3RLZA 2MRDA 4GUKA 3VRRA 4WQ2A 4P2YB 5KTYA 3JVTC 1BMOA 4OKHA 1TIZA 2KFFA 2HF5A 3WHTB 2BCAA 1YVHA 5I8NA 3PLFB 3DD4A 4GFTA 4P5OE 1NX0A 3BUMB 1OE9B 1XFWO 1QV1A 4MN0A 4AOMA 3TUYC 2K7CA 2BCBA 4CPVA 3TDUA 1QIVA 2H61C 2K2AA 2KHNA 2F33A 5AEQA 2ZN9A 2M7LA 1OMVA 3EK4A 4I5KA 4M2QA 4I5LB 2EGDA 3F45A 1BOCA 1GJYA 1A75A 4MLWA 2ZRTA 1Y0VH 5J3XA 3PM8A 2LLTA 4YGBB 5I2QA 1SK6D 2WOSA 1G8IA 1S6JA 2KGBC 3PN7B 2MLFC 1LVCD 1SCMB 3DF0A 3M0WA 2L50A 3O2PA 3I5GC 4A4BA 1GQMA 2JXLA 1QIWA 3OX6A 1PVAA 3BUNB 2JTZA 2M29A 2KI4C 1JC2A 1KSOA 1YX7A 4YI9A 4FTGA 3KPXA 3PALA 3TDIA 2LV7A 1KFXL 1SCMC 2PSRA 1B47A 2JULA 2PASA 3LL8B 1RECA 1BODA 5PALA 4PE4A 1J7RA 4DIRA 2LUXA 2WORA 1DGUA 1DJZA 4M2OA 2K7OA 3NSKA 2H61A 3FIAA 2JXCA 3OP0A 3CGAA 1SL7A 1Y1UA 2JNXA 3WXAA 2BCXA 2PALA 1AVSA 2ZNEA 1XA5A 2Q91A 1BLQA 2JQ6A 2LANA 4UPGA 1QX2A 2WCFA 1S6CA 3ZNIA 1WDCB 1QASA 2CXJA 1UP5A 3BUXB 1QX7A 3SG4A 1KQVA 2E30A 3PSRA 1MXEA 1A2XA 2IS9A 3WNXB 2OPOA 1A4PA 5CSJA 1CM1A 2SASA 4ORAB 1A03A 1OOJA 1IH0A 5HYDA 1TCOB 1V1FA 1H4BA 1ZOTB 1WDCC 1YRTB 1HQVA 5ER4X 2COLB 1NWDA 1F71A 5D69A 5HLVA 2LMUA 1B8RA 1OMDA 2L5XB 1EXRA 1BJFA 3FWBA 4JPZB 4MRXA 1NX1A 1WRLA 3NSIA 3OX5A 1GGWA 1FI5A 1M46A 3DVJA 3GK4X 5IBWA 1SR6B 1DJWA 2M49B 2ZN8A 3K21A 4R1EA 1JUOA 2G2BA 1PVBA 2TN4A 4E68A 2LVKA 4XJKB 1CNPA 1A75B 1S5GY 2LHIA 3CWGA 2K0JA 4PE0A 1EL4A 1NIWA 2KBMA 1HT9A 3AKBA 3NSLA 3SIAA 4U8DA 2M9GA 3I5HC 1MHOA 3DF0B 1DTLA 2OS8C 1DF0A 1LXFC 1SR6C 2OTGC 1BR1B 1JFKA 1CDLA 2WC8A 3EK7A 1DJHA 1KK7Y 2L2EA 1K94A 2FJUB 4ETOA 5AERA 1SPYA 3PFVA 2LHLA 2KBIA 3A8RA 4YGAA 3BUOB 1XFZO 1RFJA 4ZCVA 3JVTB 5K89A 3C1VA 2FOTA 1FW4A 2D8NA 4D1EA 2CNPA 2PMYA 1PULA 3AAKA 1V1GA 3HX4A 4XYNA 2M0RA 1KSMA 5CPVA 1XFYO 1DJGA 4PDZA 3SG3A 1C7WA 4PHJA 4PALA 1KK8C 5F6TA 1G33A 2MJWB 1TNXA 2Y1MA 2LLUA 3WHUB 3DVKA 1EJ3A 5DKNA 5AFPA 2KQ6A 3O78A 1SCVA 4C0JA 1CKKA 4C0LA 2KFGA 1M63B 2LAPA 4I5JA 2JPTA 2GGZA 1BU3A 3MSEB 1TOPA 2VRGA 2F3YA 4PHNA 5I2LA 1JF2A 1CFDA 1OMRA 3I5GB 1QJTA 1MWNA 1VRKA 1CLMA 1IRJA 4XJKA 1D1OA 2LVJA 1UHNA 1QLSA 3IQOA 1QXPA 2KI4B 1S6IA 1ZACA 2R2IA 1UUSA 4MZLA 1IJ6A 2M1KB 2L98A 2BE4A 2KYCA 5JOLA 5ER5A 1JF0A 3CR4X 1RJVA 2Y5IA 2RGIA 1MQ1A 3DVMA 2JC2A 4JWQA 4OVNF 2O60A 3GK2A 1CFFA 5TNCA 2FCDA 3SG7A 3SIBA 1GGZA 1UURA 3BXKA 3OHMB 1K2HA 4A4CA 5HLOA 4ICBA 5AANA 1Y1XA 1LKJA 1CFCA 4NDDA 4ORCB 4TNCA 2AMIA 4DUQA 1DF0B 1ZMZA 5B8IB 1PSBA 1OSAA 2HQWA 2FCEA 4BY5A 1M31A 1WRKA 2NCPA 2LVIA 2B1UA 4CFQA 2KOTA 2LP2A 3IF7A 2O5GA 5BPJA 1J7QA 2JOJA 1IGVA 1K9UA 2K7DA 1PRWA 1CDNA 1K9PA 2ZRSA 1OZSA 2LCPA 3O6BA 1AUIB 2KDHA 3QRXA 1RROA 4QJ3B 3CZTX 1LA3A 1YVLA 2LMTA 2BKIB 1QVIY 1Y6WA 1ALWA 1KFXS 2DOQA 2M7NA 3CR5X 1TNPA 2ZNDA 4USLA 5CSNA 2PRUA 4CIDA 1B7TZ 2BKHB 1B1GA 1H8BA 4QJ5B 1SRAA 1XK4C 1ODBA 3FWCA 3SG5A 1BT6A 2MBXA 1F55A 3ZWHA 2HETA 1UHJA 2F8PA 4PE1A 5I2OA 3EVRA 3BOWB 1Q80A 1PALA 3GOFA 2LC5A 1SW8A 1BR4B 5CSIA
chains in the Genus database with same CATH superfamily
1CLBA 2HPSA 1LINA 1AJ5A 1NX2A 2AUCA 2BECA 3EK8A 1KFUL 2BE6A 2FJYA 3I5HB 3R1PA 1R6PA 4GBAA 1JWDA 2OS8B 3KEVA 4MVFA 2OTGB 4YRUA 1W7JB 2JRFA 4F0ZB 2I18A 1QATA 1SL8A 1YUTA 2JTTA 2KAVA 5HKZA 1IG5A 1OOGA 1K90D 1NUBA 2F2PA 2KLEA 4GGFC 1L7ZA 4CLNA 1DJYA 2L5YA 3NXAA 2Y4QA 3CLNA 3I5FB 1DEKA 1YUSA 3PATA 1CDMA 1QX5B 3D10A 1K95A 2WCEA 3CR2A 3VB1A 3R1OA 4CFRA 3CZ2A 1S1EA 3OGNA 3BYAA 1XK4A 3SG6A 1S26D 1IWQA 1KK8B 1TNWA 1UHIA 1SKTA 1XVJA 2AAOA 2KFHA 2KPHA 2MHHA 2SCPA 3I5FC 2L0PA 1NCZA 1KK7Z 1YX8A 2QACA 3LK0A 3O4XA 3V2LA 1RWYA 1BF5A 1CMGA 5DKQA 4JQ0D 1E8AA 3BFBA 3EKHA 3LLEA 1S3PA 1NSHA 1KQMC 1DJXA 3VRPA 3SJSA 2JT0A 1J55A 2ZKMX 4IL1A 1AHRA 2G9BA 1X02A 2JWWA 4YGDB 1CFPA 2EC6B 3LK1A 1KWOB 1Y1AA 2F2OA 3A4UB 2GV5A 3I5IB 1AK8A 1QLKA 2JPOA 2MLEC 2WC6A 3BOWA 2EHBA 3BFAA 3D73A 5DKRA 1MUXA 3O4YA 4HREE 4MBEA 4GGFA 3VGOA 4PE7A 1PSRA 4MRYA 4MZJA 4PT1A 1WLMA 2JT3A 1DMOA 2I2RE 2QEBA 3NHIA 4OR9B 4C0KA 1TNQA 1EG3A 1TUJA 2EC6C 3B86A 4DRWA 3UNWA 1KWOC 1R2UA 1CLLA 1S36A 3I5IC 1DVIA 4GAOA 3RM1A 1FI6A 2V53A 2BBNA 2WNDA 2MA2A 3KO0A 4WQ3A 1NP8A 3S0AA 2M97A 4JKTA 2GGMA 2QPTA 4DCKA 3D0YA 1F70A 1IJ5A 1DGVA 1L2OB 1MR8A 2LVVA 2E6WA 2YGUA 4FQTA 1XFVO 5AXIA 1M45A 1YURA 1NCXA 3AAJA 2KQYA 2PYQA 2I7AA 4INWA 3TZ1A 3VRNA 3RZSA 1K93D 2A4JA 1SY9A 1SYMA 2L2CA 1WLZA 4NQGA 1J7OA 3EVVA 1XFXO 3HCMA 1QV0A 1N65A 2H8VA 2H2KA 2M8UA 1TCFA 3JTDB 1NPQA 4YBHB 2KAXA 5KSZA 4N1FA 2CTNA 1EG4A 1QTXA 2I94A 2JU0A 1L2OC 3D77A 2KYFA 4HSZA 1UHHA 2KNEA 1N0YA 1CTRA 4OV2A 1CDPA 2PVBA 2M1UA 5G08A 1B9AA 2ISDA 4MSPA 1FF1A 1TUZA 1IKUA 1SNLA 5HKWA 4Q04A 1NYAA 2LLSA 3NSOA 4AQIA 1YUUA 1NCYA 1TN4A 3EKJA 1J7PA 1EH2A 3JTDC 4GGNA 2CBLA 1F8HA 1FBVA 1M39A 1CM4A 3SG2A 5HL1A 1CMFA 5KU1A 1ALVA 1AJ4A 1NX3A 1U5IB 2P71A 3PN7C 1T14A 1YR5A 1YRUB 3GK1A 1MXLC 3OB1B 3E3RA 3VRQA 2BBMA 1K96A 1IQ5A 1FPWA 4ORBB 1SMGA 3H4SE 3FE8A 1B8CA 1OQPA 3CZ1A 3FS7A 3ICBA 3S0BA 1OZOA 1QVIZ 1XYDA 4NDCA 3IQQA 5FI6A 2KGRA 1DT7B 2MAZA 3B87A 2BL0B 3B6XA 1GM0A 1A29A 3LCPC 1F4QA 4I5NB 3FE6A 3AKAA 4YGCB 1WY9A 1B7TY 3DVEA 1ZUZA 1ZFSA 2LNKA 3TS5B 5GQQC 1DJIA 4NDBA 2LM5A 2WCBA 5CSFA 3VROA 4QJ4B 3BQ3A 1WRZA 4FQOA 4M2PA 2M3WA 3IVTA 4AQJA 2CCMA 2BL0C 2JT8A 4OCIA 5FYXA 2JNFA 1QS7A 1G4YR 4MZKA 1JBAA 2K7BA 3EVUA 4GNKB 1SBJA 3D0YB 3TS5C 4L9MA 4DS7A 2KI6D 2WCJA 1F4OA 2KI6C 1SL9A 4N5XA 1S5GZ 1KQMB 2L4HA 3L4LA 1KFUS 2K8MB 4BY4A 5HKYA 1LA0A 5JJGA 1CB1A 1JSAA 2K60A 2JZIA 2F3ZA 4PHMA 4WRIA 2NXQA 2QDIA 4KYNA 3SS3A 1XO5A 3BUWB 1PK0D 2L51A 1KCYA 1U5IA 1OOHA 1K8UA 2NCOA 1K9KA 3KF9A 2L4IA 4PCWA 2HQ8A 4MEWA 4YI8A 1AP4A 1N2DA 2K2FA 2KAYA 1TRFA 4HRHA 1UWOA 2ZFDA 1B8LA 1IQ3A 2LP3A 1C3YA 3CTNA 4YGEB 3OB2B 3KHEA 1W7IB 1C7VA 2KSPA 1J1DA 2P6BB 1J1EA 1XFUO 1BG1A 5I94A 1C07A 4PHKA 2NZ0A 2LMVA 4ZCUA 5D7FA 4GPLB 2Y1NA 3DXLA 1JFJA 1MF8B 1TTXA 3CS1A 3D75A 1RK9A 1YTZC 2LE9B 2K61A 1UHKA 2Q4UA 1W9ZA 1B4CA 2LUCA 1RTP1 2CT9A 4N1GA 5FI2A 3TUYB 4HRGA 2NLNA 3TDZA 1F54A 3RLZA 2MRDA 4GUKA 3VRRA 4WQ2A 3QMEA 4OZDA 4P2YB 3D76A 5KTYA 3JVTC 1BMOA 2WCKA 1TIZA 2KFFA 4OKHA 2HF5A 3WHTB 2BCAA 1YVHA 5I8NA 3PLFB 3DD4A 4GFTA 4P5OE 1NX0A 3BUMB 3L47A 3CDNA 1OE9B 1XFWO 1OW4A 1QV1A 4MN0A 3EG5B 4AOMA 3D78A 2K7CA 3TUYC 2BCBA 4CPVA 3TDUA 2P70A 1QIVA 2H61C 2K2AA 3D74A 2KHNA 2F33A 5AEQA 2ZN9A 2M7LA 1OMVA 3EK4A 4I5KA 4M2QA 4I5LB 4F7FA 2EGDA 3F45A 1BOCA 1GJYA 1A75A 4MLWA 2ZRTA 1Y0VH 5J3XA 3PM8A 2LLTA 4YGBB 5I2QA 1SK6D 2WOSA 1G8IA 1S6JA 2KGBC 3OBVA 2MLFC 3PN7B 1LVCD 3BFHA 1SCMB 3DF0A 3M0WA 2L50A 3S0FA 3O2PA 3I5GC 4A4BA 1GQMA 2JXLA 1QIWA 3OX6A 1PVAA 3BUNB 2JTZA 2M29A 2KI4C 1JC2A 1KSOA 1YX7A 4YI9A 4FTGA 3KPXA 3R72A 3DY9A 5DICA 1LS8A 3PALA 3TDIA 2BAPA 2LV7A 3SS5A 1KFXL 1SCMC 3NHTA 3BJHA 2PSRA 1B47A 2JULA 2PASA 3LL8B 1RECA 1BODA 5FI7A 5PALA 4PE4A 1J7RA 4DIRA 2LUXA 2WCLA 3CZ0A 3DZTA 2WORA 1DGUA 1DJZA 4INXA 1DELA 4M2OA 2K7OA 3NSKA 2H61A 3FIAA 2JXCA 3OP0A 3PM2A 3CGAA 1SL7A 1Y1UA 1ORGA 2JNXA 3WXAA 2BCXA 2PALA 1AVSA 3SS4A 2ZNEA 1XA5A 1XFRA 2Q91A 2JQ6A 2LANA 2WC5A 4UPGA 1BLQA 1QX2A 2WCFA 1S6CA 3ZNIA 1WDCB 1QASA 2CXJA 1UP5A 3BUXB 1QX7A 3SG4A 1KQVA 2E30A 3PSRA 1MXEA 1A2XA 2IS9A 3WNXB 2OPOA 1A4PA 5CSJA 1CM1A 2SASA 4ORAB 1A03A 1OOJA 1IH0A 5HYDA 1Z2CB 1TCOB 1V1FA 1H4BA 1ZOTB 1WDCC 1YRTB 1HQVA 5ER4X 2COLB 1NWDA 1F71A 5D69A 5HLVA 2LMUA 1B8RA 1OMDA 2L5XB 1EXRA 1BJFA 3FWBA 4JPZB 4MRXA 1NX1A 1WRLA 3NSIA 3OX5A 1GGWA 1FI5A 1M46A 3DVJA 3GK4X 5IBWA 1SR6B 1DC1A 1DJWA 2M49B 2ZN8A 3K21A 2QEHA 4R1EA 1JUOA 2G2BA 1PVBA 2TN4A 4E68A 2LVKA 2GTEA 4XJKB 1CNPA 1A75B 1S5GY 2LHIA 3CWGA 2K0JA 1C3ZA 1EL4A 1NIWA 4PE0A 2KBMA 3CYZA 1HT9A 3AKBA 3NSLA 1Z4HA 3SIAA 4U8DA 2M9GA 3I5HC 1MHOA 3DF0B 1DTLA 3FE9A 2OS8C 1DF0A 1LXFC 1SR6C 2OTGC 1IIOA 1BR1B 1JFKA 1CDLA 2WC8A 3EK7A 1DJHA 1KK7Y 2L2EA 3L4AA 1K94A 2FJUB 3UO9A 3S0EA 4ETOA 5AERA 1SPYA 3PFVA 3B7AA 2LHLA 2KBIA 3A8RA 4YGAA 3BUOB 1XFZO 1RFJA 4ZCVA 3JVTB 5K89A 3C1VA 2FOTA 1FW4A 2D8NA 4D1EA 2CNPA 2PMYA 1PULA 3AAKA 1V1GA 3HX4A 2WCMA 3DYEA 2KLDA 2M0RA 1KSMA 4XYNA 1QWVA 5CPVA 1XFYO 1DJGA 4PDZA 3R1VA 3SG3A 1C7WA 4PHJA 4PALA 1KK8C 5F6TA 1G33A 2MJWB 1TNXA 2Y1MA 2LLUA 3WHUB 3DVKA 2QEVA 1EJ3A 5DKNA 3Q8IA 5AFPA 2KQ6A 3O78A 1SSEB 1SCVA 4C0JA 1CKKA 4C0LA 2KFGA 1M63B 2LAPA 1P28A 4I5JA 4IJ7A 2JPTA 2GGZA 1BU3A 3MSEB 1TOPA 2PQLA 2F3YA 2VRGA 3N7HA 4PHNA 3B88A 1JF2A 5I2LA 1CFDA 1OMRA 3I5GB 1QJTA 1MWNA 1VRKA 1CLMA 1IRJA 4XJKA 1D1OA 2LVJA 1UHNA 1QLSA 3S0GA 3IQOA 1QXPA 2KI4B 1S6IA 1ZACA 2R2IA 1UUSA 3PJIA 1IJ6A 4MZLA 2M1KB 2L98A 2BE4A 2KYCA 5JOLA 5ER5A 1JF0A 3CR4X 1RJVA 2Y5IA 2RGIA 1MQ1A 3DVMA 2JC2A 4JWQA 4OVNF 2O60A 3GK2A 1CFFA 5TNCA 4JD9A 2FCDA 1OOFA 5EL2A 3SG7A 3SIBA 1GGZA 1UURA 3BXKA 3OHMB 1K2HA 4A4CA 5HLOA 4ICBA 5AANA 1Y1XA 2BNXA 1LKJA 1CFCA 4NDDA 4ORCB 4TNCA 2ERBA 2AMIA 4DUQA 1DF0B 1ZMZA 5B8IB 1PSBA 1OSAA 2HQWA 2FCEA 4BY5A 1M31A 5D3OA 1WRKA 2NCPA 2LVIA 3CABA 3S0DA 2B1UA 4CFQA 2KOTA 1OOIX 2LP2A 3IF7A 2O5GA 5BPJA 1J7QA 2JOJA 1IGVA 1K9UA 2K7DA 1PRWA 1CDNA 1K9PA 2ZRSA 2WCHA 1OZSA 2LCPA 3O6BA 1AUIB 1DQEA 2KDHA 3QRXA 1TWOA 1RROA 4QJ3B 3CZTX 1LA3A 1YVLA 2LMTA 2BKIB 1QVIY 1Y6WA 1ALWA 1KFXS 2DOQA 2M7NA 3CR5X 1TNPA 2ZNDA 4USLA 5CSNA 2PRUA 4CIDA 1B7TZ 2BKHB 1B1GA 1H8BA 4QJ5B 1SRAA 1XK4C 2QEOA 1ODBA 3FWCA 3SG5A 1BT6A 2MBXA 3NGVA 1F55A 3ZWHA 2HETA 1UHJA 2F8PA 4PE1A 5I2OA 3EVRA 3BOWB 1Q80A 1PALA 3GOFA 2LC5A 1SW8A 1BR4B 5CSIA 3K1EA
chains in the Genus database with same CATH topology
1CLBA 2HPSA 1LINA 1AJ5A 1NX2A 2AUCA 2BECA 3EK8A 1KFUL 2BE6A 3I5HB 1R6PA 4GBAA 1JWDA 2OS8B 3KEVA 4MVFA 2OTGB 4YRUA 1W7JB 2JRFA 4F0ZB 2I18A 1QATA 1SL8A 1YUTA 2JTTA 2KAVA 5HKZA 1IG5A 1K90D 1NUBA 2F2PA 4GGFC 1L7ZA 4CLNA 1DJYA 3NXAA 2Y4QA 3CLNA 3I5FB 1YUSA 3PATA 1CDMA 1QX5B 3D10A 1K95A 2WCEA 3CR2A 4CFRA 1S1EA 3BYAA 1XK4A 3SG6A 1S26D 1IWQA 1KK8B 1TNWA 1UHIA 1SKTA 1XVJA 2AAOA 2KFHA 2SCPA 2MHHA 1JFJA 3I5FC 2L0PA 1NCZA 1KK7Z 1YX8A 2QACA 3LK0A 1RWYA 1BF5A 1CMGA 5DKQA 4JQ0D 1E8AA 3EKHA 3LLEA 1S3PA 1NSHA 1KQMC 1DJXA 3VRPA 3SJSA 2JT0A 1J55A 2ZKMX 4IL1A 1AHRA 2G9BA 1X02A 2JWWA 4YGDB 1CFPA 2EC6B 3LK1A 1KWOB 1Y1AA 2F2OA 3A4UB 2GV5A 3I5IB 1AK8A 1QLKA 2MLEC 3BOWA 2EHBA 5DKRA 1MUXA 3O4YA 4HREE 4MBEA 4GGFA 3VGOA 4PE7A 1PSRA 4MRYA 4MZJA 1WLMA 2JT3A 1DMOA 2I2RE 4OR9B 4C0KA 1TNQA 1EG3A 2EC6C 4DRWA 1KWOC 1R2UA 1CLLA 1S36A 3I5IC 1DVIA 4GAOA 3RM1A 1FI6A 2V53A 2BBNA 2WNDA 2MA2A 3KO0A 4WQ3A 1NP8A 2M97A 2GGMA 2QPTA 4DCKA 3D0YA 1F70A 1IJ5A 1DGVA 1L2OB 1MR8A 2LVVA 2E6WA 5AXIA 1XFVO 1M45A 1YURA 1NCXA 3AAJA 2KQYA 3TZ1A 2I7AA 3VRNA 1K93D 2A4JA 1SY9A 1SYMA 1WLZA 4NQGA 1J7OA 3EVVA 1XFXO 3HCMA 1QV0A 1N65A 2H2KA 2M8UA 1TCFA 3JTDB 1NPQA 4YBHB 2KAXA 5KSZA 4N1FA 2CTNA 1EG4A 1QTXA 2I94A 2JU0A 1L2OC 2KYFA 4HSZA 1UHHA 2KNEA 1N0YA 1CTRA 4OV2A 1CDPA 2PVBA 2M1UA 5G08A 1B9AA 2ISDA 4MSPA 1FF1A 1IKUA 1SNLA 5HKWA 4Q04A 1NYAA 2LLSA 3NSOA 4AQIA 1YUUA 1NCYA 1TN4A 3EKJA 1J7PA 1EH2A 3JTDC 4GGNA 2CBLA 1F8HA 1FBVA 1M39A 1CM4A 3SG2A 1CMFA 5KU1A 1ALVA 1AJ4A 1NX3A 1U5IB 3PN7C 1YR5A 1YRUB 3GK1A 1MXLC 3OB1B 3E3RA 3VRQA 2BBMA 1K96A 1IQ5A 1FPWA 4ORBB 1SMGA 3H4SE 1B8CA 1OQPA 3ICBA 3FS7A 1OZOA 1QVIZ 1XYDA 4NDCA 3IQQA 2KGRA 1DT7B 2MAZA 2BL0B 1A29A 3LCPC 1F4QA 4I5NB 3AKAA 4YGCB 1WY9A 1B7TY 3DVEA 1ZUZA 1ZFSA 2LNKA 3TS5B 5GQQC 1DJIA 4NDBA 2LM5A 2WCBA 5CSFA 3VROA 4QJ4B 3BQ3A 1WRZA 4FQOA 4M2PA 2M3WA 4AQJA 2CCMA 2BL0C 2JT8A 4OCIA 5FYXA 2JNFA 1QS7A 1G4YR 4MZKA 1JBAA 2K7BA 3EVUA 4GNKB 1SBJA 3D0YB 3TS5C 4L9MA 4DS7A 2KI6D 4N5XA 1F4OA 2KI6C 1SL9A 1S5GZ 1KQMB 2L4HA 1KFUS 2K8MB 4BY4A 5HKYA 1LA0A 5JJGA 1CB1A 1JSAA 2JZIA 2F3ZA 4PHMA 4WRIA 2NXQA 1XO5A 3BUWB 1PK0D 2L51A 1KCYA 1U5IA 1K8UA 2NCOA 1K9KA 3KF9A 2L4IA 4PCWA 2HQ8A 4MEWA 4YI8A 1AP4A 1N2DA 2K2FA 2KAYA 1TRFA 4HRHA 1UWOA 2ZFDA 1B8LA 1IQ3A 2LP3A 3CTNA 4YGEB 3OB2B 3KHEA 1W7IB 1C7VA 2KSPA 1J1DA 2P6BB 1J1EA 1XFUO 1BG1A 1C07A 4PHKA 2NZ0A 2LMVA 4ZCUA 5D7FA 4GPLB 2Y1NA 1MF8B 1TTXA 3CS1A 1RK9A 1YTZC 2LE9B 2K61A 1UHKA 2Q4UA 1B4CA 2LUCA 1RTP1 2CT9A 4N1GA 3TUYB 4HRGA 2NLNA 3TDZA 1F54A 3RLZA 2MRDA 4GUKA 3VRRA 4WQ2A 4P2YB 5KTYA 3JVTC 1BMOA 4OKHA 1TIZA 2KFFA 2HF5A 3WHTB 2BCAA 1YVHA 5I8NA 3PLFB 3DD4A 4GFTA 4P5OE 1NX0A 3BUMB 1OE9B 1XFWO 1QV1A 4MN0A 4AOMA 3TUYC 2K7CA 2BCBA 4CPVA 3TDUA 1QIVA 2H61C 2K2AA 2KHNA 2F33A 5AEQA 2ZN9A 2M7LA 1OMVA 3EK4A 4I5KA 4M2QA 4I5LB 2EGDA 3F45A 1BOCA 1GJYA 1A75A 4MLWA 2ZRTA 1Y0VH 5J3XA 3PM8A 2LLTA 4YGBB 5I2QA 1SK6D 2WOSA 1G8IA 1S6JA 2KGBC 3PN7B 2MLFC 1LVCD 1SCMB 3DF0A 3M0WA 2L50A 3O2PA 3I5GC 4A4BA 1GQMA 2JXLA 1QIWA 3OX6A 1PVAA 3BUNB 2JTZA 2M29A 2KI4C 1JC2A 1KSOA 1YX7A 4YI9A 4FTGA 3KPXA 3PALA 3TDIA 2LV7A 1KFXL 1SCMC 2PSRA 1B47A 2JULA 2PASA 3LL8B 1RECA 1BODA 5PALA 4PE4A 1J7RA 4DIRA 2LUXA 2WORA 1DGUA 1DJZA 4M2OA 2K7OA 3NSKA 2H61A 3FIAA 2JXCA 3OP0A 3CGAA 1SL7A 1Y1UA 2JNXA 3WXAA 2BCXA 2PALA 1AVSA 2ZNEA 1XA5A 2Q91A 1BLQA 2JQ6A 2LANA 4UPGA 1QX2A 2WCFA 1S6CA 3ZNIA 1WDCB 1QASA 2CXJA 1UP5A 3BUXB 1QX7A 3SG4A 1KQVA 2E30A 3PSRA 1MXEA 1A2XA 2IS9A 3WNXB 2OPOA 1A4PA 5CSJA 1CM1A 2SASA 4ORAB 1A03A 1OOJA 1IH0A 5HYDA 1TCOB 1V1FA 1H4BA 1ZOTB 1WDCC 1YRTB 1HQVA 5ER4X 2COLB 1NWDA 1F71A 5D69A 5HLVA 2LMUA 1B8RA 1OMDA 2L5XB 1EXRA 1BJFA 3FWBA 4JPZB 4MRXA 1NX1A 1WRLA 3NSIA 3OX5A 1GGWA 1FI5A 1M46A 3DVJA 3GK4X 5IBWA 1SR6B 1DJWA 2M49B 2ZN8A 3K21A 4R1EA 1JUOA 2G2BA 1PVBA 2TN4A 4E68A 2LVKA 4XJKB 1CNPA 1A75B 1S5GY 2LHIA 3CWGA 2K0JA 4PE0A 1EL4A 1NIWA 2KBMA 1HT9A 3AKBA 3NSLA 3SIAA 4U8DA 2M9GA 3I5HC 1MHOA 3DF0B 1DTLA 2OS8C 1DF0A 1LXFC 1SR6C 2OTGC 1BR1B 1JFKA 1CDLA 2WC8A 3EK7A 1DJHA 1KK7Y 2L2EA 1K94A 2FJUB 4ETOA 5AERA 1SPYA 3PFVA 2LHLA 2KBIA 3A8RA 4YGAA 3BUOB 1XFZO 1RFJA 4ZCVA 3JVTB 5K89A 3C1VA 2FOTA 1FW4A 2D8NA 4D1EA 2CNPA 2PMYA 1PULA 3AAKA 1V1GA 3HX4A 4XYNA 2M0RA 1KSMA 5CPVA 1XFYO 1DJGA 4PDZA 3SG3A 1C7WA 4PHJA 4PALA 1KK8C 5F6TA 1G33A 2MJWB 1TNXA 2Y1MA 2LLUA 3WHUB 3DVKA 1EJ3A 5DKNA 5AFPA 2KQ6A 3O78A 1SCVA 4C0JA 1CKKA 4C0LA 2KFGA 1M63B 2LAPA 4I5JA 2JPTA 2GGZA 1BU3A 3MSEB 1TOPA 2VRGA 2F3YA 4PHNA 5I2LA 1JF2A 1CFDA 1OMRA 3I5GB 1QJTA 1MWNA 1VRKA 1CLMA 1IRJA 4XJKA 1D1OA 2LVJA 1UHNA 1QLSA 3IQOA 1QXPA 2KI4B 1S6IA 1ZACA 2R2IA 1UUSA 4MZLA 1IJ6A 2M1KB 2L98A 2BE4A 2KYCA 5JOLA 5ER5A 1JF0A 3CR4X 1RJVA 2Y5IA 2RGIA 1MQ1A 3DVMA 2JC2A 4JWQA 4OVNF 2O60A 3GK2A 1CFFA 5TNCA 2FCDA 3SG7A 3SIBA 1GGZA 1UURA 3BXKA 3OHMB 1K2HA 4A4CA 5HLOA 4ICBA 5AANA 1Y1XA 1LKJA 1CFCA 4NDDA 4ORCB 4TNCA 2AMIA 4DUQA 1DF0B 1ZMZA 5B8IB 1PSBA 1OSAA 2HQWA 2FCEA 4BY5A 1M31A 1WRKA 2NCPA 2LVIA 2B1UA 4CFQA 2KOTA 2LP2A 3IF7A 2O5GA 5BPJA 1J7QA 2JOJA 1IGVA 1K9UA 2K7DA 1PRWA 1CDNA 1K9PA 2ZRSA 1OZSA 2LCPA 3O6BA 1AUIB 2KDHA 3QRXA 1RROA 4QJ3B 3CZTX 1LA3A 1YVLA 2LMTA 2BKIB 1QVIY 1Y6WA 1ALWA 1KFXS 2DOQA 2M7NA 3CR5X 1TNPA 2ZNDA 4USLA 5CSNA 2PRUA 4CIDA 1B7TZ 2BKHB 1B1GA 1H8BA 4QJ5B 1SRAA 1XK4C 1ODBA 3FWCA 3SG5A 1BT6A 2MBXA 1F55A 3ZWHA 2HETA 1UHJA 2F8PA 4PE1A 5I2OA 3EVRA 3BOWB 1Q80A 1PALA 3GOFA 2LC5A 1SW8A 1BR4B 5CSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLB A;  2HPS A;  1LIN A;  1AJ5 A;  1NX2 A;  2AUC A;  2BEC A;  3EK8 A;  1KFU L;  2BE6 A;  3I5H B;  1R6P A;  4GBA A;  1JWD A;  2OS8 B;  3KEV A;  4MVF A;  2OTG B;  4YRU A;  1W7J B;  2JRF A;  4F0Z B;  2I18 A;  1QAT A;  1SL8 A;  1YUT A;  2JTT A;  2KAV A;  5HKZ A;  1IG5 A;  1K90 D;  1NUB A;  2F2P A;  4GGF C;  1L7Z A;  4CLN A;  1DJY A;  3NXA A;  2Y4Q A;  3CLN A;  3I5F B;  1YUS A;  3PAT A;  1CDM A;  1QX5 B;  3D10 A;  1K95 A;  2WCE A;  3CR2 A;  4CFR A;  1S1E A;  3BYA A;  1XK4 A;  3SG6 A;  1S26 D;  1IWQ A;  1KK8 B;  1TNW A;  1UHI A;  1SKT A;  1XVJ A;  2AAO A;  2KFH A;  2SCP A;  2MHH A;  1JFJ A;  3I5F C;  2L0P A;  1NCZ A;  1KK7 Z;  1YX8 A;  2QAC A;  3LK0 A;  1RWY A;  1BF5 A;  1CMG A;  5DKQ A;  4JQ0 D;  1E8A A;  3EKH A;  3LLE A;  1S3P A;  1NSH A;  1KQM C;  1DJX A;  3VRP A;  3SJS A;  2JT0 A;  1J55 A;  2ZKM X;  4IL1 A;  1AHR A;  2G9B A;  1X02 A;  2JWW A;  4YGD B;  1CFP A;  2EC6 B;  3LK1 A;  1KWO B;  1Y1A A;  2F2O A;  3A4U B;  2GV5 A;  3I5I B;  1AK8 A;  1QLK A;  2MLE C;  3BOW A;  2EHB A;  5DKR A;  1MUX A;  3O4Y A;  4HRE E;  4MBE A;  4GGF A;  3VGO A;  4PE7 A;  1PSR A;  4MRY A;  4MZJ A;  1WLM A;  2JT3 A;  1DMO A;  2I2R E;  4OR9 B;  4C0K A;  1TNQ A;  1EG3 A;  2EC6 C;  4DRW A;  1KWO C;  1R2U A;  1CLL A;  1S36 A;  3I5I C;  1DVI A;  4GAO A;  3RM1 A;  1FI6 A;  2V53 A;  2BBN A;  2WND A;  2MA2 A;  3KO0 A;  4WQ3 A;  1NP8 A;  2M97 A;  2GGM A;  2QPT A;  4DCK A;  3D0Y A;  1F70 A;  1IJ5 A;  1DGV A;  1L2O B;  1MR8 A;  2LVV A;  2E6W A;  5AXI A;  1XFV O;  1M45 A;  1YUR A;  1NCX A;  3AAJ A;  2KQY A;  3TZ1 A;  2I7A A;  3VRN A;  1K93 D;  2A4J A;  1SY9 A;  1SYM A;  1WLZ A;  4NQG A;  1J7O A;  3EVV A;  1XFX O;  3HCM A;  1QV0 A;  1N65 A;  2H2K A;  2M8U A;  1TCF A;  3JTD B;  1NPQ A;  4YBH B;  2KAX A;  5KSZ A;  4N1F A;  2CTN A;  1EG4 A;  1QTX A;  2I94 A;  2JU0 A;  1L2O C;  2KYF A;  4HSZ A;  1UHH A;  2KNE A;  1N0Y A;  1CTR A;  4OV2 A;  1CDP A;  2PVB A;  2M1U A;  5G08 A;  1B9A A;  2ISD A;  4MSP A;  1FF1 A;  1IKU A;  1SNL A;  5HKW A;  4Q04 A;  1NYA A;  2LLS A;  3NSO A;  4AQI A;  1YUU A;  1NCY A;  1TN4 A;  3EKJ A;  1J7P A;  1EH2 A;  3JTD C;  4GGN A;  2CBL A;  1F8H A;  1FBV A;  1M39 A;  1CM4 A;  3SG2 A;  1CMF A;  5KU1 A;  1ALV A;  1AJ4 A;  1NX3 A;  1U5I B;  3PN7 C;  1YR5 A;  1YRU B;  3GK1 A;  1MXL C;  3OB1 B;  3E3R A;  3VRQ A;  2BBM A;  1K96 A;  1IQ5 A;  1FPW A;  4ORB B;  1SMG A;  3H4S E;  1B8C A;  1OQP A;  3ICB A;  3FS7 A;  1OZO A;  1QVI Z;  1XYD A;  4NDC A;  3IQQ A;  2KGR A;  1DT7 B;  2MAZ A;  2BL0 B;  1A29 A;  3LCP C;  1F4Q A;  4I5N B;  3AKA A;  4YGC B;  1WY9 A;  1B7T Y;  3DVE A;  1ZUZ A;  1ZFS A;  2LNK A;  3TS5 B;  5GQQ C;  1DJI A;  4NDB A;  2LM5 A;  2WCB A;  5CSF A;  3VRO A;  4QJ4 B;  3BQ3 A;  1WRZ A;  4FQO A;  4M2P A;  2M3W A;  4AQJ A;  2CCM A;  2BL0 C;  2JT8 A;  4OCI A;  5FYX A;  2JNF A;  1QS7 A;  1G4Y R;  4MZK A;  1JBA A;  2K7B A;  3EVU A;  4GNK B;  1SBJ A;  3D0Y B;  3TS5 C;  4L9M A;  4DS7 A;  2KI6 D;  4N5X A;  1F4O A;  2KI6 C;  1SL9 A;  1S5G Z;  1KQM B;  2L4H A;  1KFU S;  2K8M B;  4BY4 A;  5HKY A;  1LA0 A;  5JJG A;  1CB1 A;  1JSA A;  2JZI A;  2F3Z A;  4PHM A;  4WRI A;  2NXQ A;  1XO5 A;  3BUW B;  1PK0 D;  2L51 A;  1KCY A;  1U5I A;  1K8U A;  2NCO A;  1K9K A;  3KF9 A;  2L4I A;  4PCW A;  2HQ8 A;  4MEW A;  4YI8 A;  1AP4 A;  1N2D A;  2K2F A;  2KAY A;  1TRF A;  4HRH A;  1UWO A;  2ZFD A;  1B8L A;  1IQ3 A;  2LP3 A;  3CTN A;  4YGE B;  3OB2 B;  3KHE A;  1W7I B;  1C7V A;  2KSP A;  1J1D A;  2P6B B;  1J1E A;  1XFU O;  1BG1 A;  1C07 A;  4PHK A;  2NZ0 A;  2LMV A;  4ZCU A;  5D7F A;  4GPL B;  2Y1N A;  1MF8 B;  1TTX A;  3CS1 A;  1RK9 A;  1YTZ C;  2LE9 B;  2K61 A;  1UHK A;  2Q4U A;  1B4C A;  2LUC A;  1RTP 1;  2CT9 A;  4N1G A;  3TUY B;  4HRG A;  2NLN A;  3TDZ A;  1F54 A;  3RLZ A;  2MRD A;  4GUK A;  3VRR A;  4WQ2 A;  4P2Y B;  5KTY A;  3JVT C;  1BMO A;  4OKH A;  1TIZ A;  2KFF A;  2HF5 A;  3WHT B;  2BCA A;  1YVH A;  5I8N A;  3PLF B;  3DD4 A;  4GFT A;  4P5O E;  1NX0 A;  3BUM B;  1OE9 B;  1XFW O;  1QV1 A;  4MN0 A;  4AOM A;  3TUY C;  2K7C A;  2BCB A;  4CPV A;  3TDU A;  1QIV A;  2H61 C;  2K2A A;  2KHN A;  2F33 A;  5AEQ A;  2ZN9 A;  2M7L A;  1OMV A;  3EK4 A;  4I5K A;  4M2Q A;  4I5L B;  2EGD A;  3F45 A;  1BOC A;  1GJY A;  1A75 A;  4MLW A;  2ZRT A;  1Y0V H;  5J3X A;  3PM8 A;  2LLT A;  4YGB B;  5I2Q A;  1SK6 D;  2WOS A;  1G8I A;  1S6J A;  2KGB C;  3PN7 B;  2MLF C;  1LVC D;  1SCM B;  3DF0 A;  3M0W A;  2L50 A;  3O2P A;  3I5G C;  4A4B A;  1GQM A;  2JXL A;  1QIW A;  3OX6 A;  1PVA A;  3BUN B;  2JTZ A;  2M29 A;  2KI4 C;  1JC2 A;  1KSO A;  1YX7 A;  4YI9 A;  4FTG A;  3KPX A;  3PAL A;  3TDI A;  2LV7 A;  1KFX L;  1SCM C;  2PSR A;  1B47 A;  2JUL A;  2PAS A;  3LL8 B;  1REC A;  1BOD A;  5PAL A;  4PE4 A;  1J7R A;  4DIR A;  2LUX A;  2WOR A;  1DGU A;  1DJZ A;  4M2O A;  2K7O A;  3NSK A;  2H61 A;  3FIA A;  2JXC A;  3OP0 A;  3CGA A;  1SL7 A;  1Y1U A;  2JNX A;  3WXA A;  2BCX A;  2PAL A;  1AVS A;  2ZNE A;  1XA5 A;  2Q91 A;  1BLQ A;  2JQ6 A;  2LAN A;  4UPG A;  1QX2 A;  2WCF A;  1S6C A;  3ZNI A;  1WDC B;  1QAS A;  2CXJ A;  1UP5 A;  3BUX B;  1QX7 A;  3SG4 A;  1KQV A;  2E30 A;  3PSR A;  1MXE A;  1A2X A;  2IS9 A;  3WNX B;  2OPO A;  1A4P A;  5CSJ A;  1CM1 A;  2SAS A;  4ORA B;  1A03 A;  1OOJ A;  1IH0 A;  5HYD A;  1TCO B;  1V1F A;  1H4B A;  1ZOT B;  1WDC C;  1YRT B;  1HQV A;  5ER4 X;  2COL B;  1NWD A;  1F71 A;  5D69 A;  5HLV A;  2LMU A;  1B8R A;  1OMD A;  2L5X B;  1EXR A;  1BJF A;  3FWB A;  4JPZ B;  4MRX A;  1NX1 A;  1WRL A;  3NSI A;  3OX5 A;  1GGW A;  1FI5 A;  1M46 A;  3DVJ A;  3GK4 X;  5IBW A;  1SR6 B;  1DJW A;  2M49 B;  2ZN8 A;  3K21 A;  4R1E A;  1JUO A;  2G2B A;  1PVB A;  2TN4 A;  4E68 A;  2LVK A;  4XJK B;  1CNP A;  1A75 B;  1S5G Y;  2LHI A;  3CWG A;  2K0J A;  4PE0 A;  1EL4 A;  1NIW A;  2KBM A;  1HT9 A;  3AKB A;  3NSL A;  3SIA A;  4U8D A;  2M9G A;  3I5H C;  1MHO A;  3DF0 B;  1DTL A;  2OS8 C;  1DF0 A;  1LXF C;  1SR6 C;  2OTG C;  1BR1 B;  1JFK A;  1CDL A;  2WC8 A;  3EK7 A;  1DJH A;  1KK7 Y;  2L2E A;  1K94 A;  2FJU B;  4ETO A;  5AER A;  1SPY A;  3PFV A;  2LHL A;  2KBI A;  3A8R A;  4YGA A;  3BUO B;  1XFZ O;  1RFJ A;  4ZCV A;  3JVT B;  5K89 A;  3C1V A;  2FOT A;  1FW4 A;  2D8N A;  4D1E A;  2CNP A;  2PMY A;  1PUL A;  3AAK A;  1V1G A;  3HX4 A;  4XYN A;  2M0R A;  1KSM A;  5CPV A;  1XFY O;  1DJG A;  4PDZ A;  3SG3 A;  1C7W A;  4PHJ A;  4PAL A;  1KK8 C;  5F6T A;  1G33 A;  2MJW B;  1TNX A;  2Y1M A;  2LLU A;  3WHU B;  3DVK A;  1EJ3 A;  5DKN A;  5AFP A;  2KQ6 A;  3O78 A;  1SCV A;  4C0J A;  1CKK A;  4C0L A;  2KFG A;  1M63 B;  2LAP A;  4I5J A;  2JPT A;  2GGZ A;  1BU3 A;  3MSE B;  1TOP A;  2VRG A;  2F3Y A;  4PHN A;  5I2L A;  1JF2 A;  1CFD A;  1OMR A;  3I5G B;  1QJT A;  1MWN A;  1VRK A;  1CLM A;  1IRJ A;  4XJK A;  1D1O A;  2LVJ A;  1UHN A;  1QLS A;  3IQO A;  1QXP A;  2KI4 B;  1S6I A;  1ZAC A;  2R2I A;  1UUS A;  4MZL A;  1IJ6 A;  2M1K B;  2L98 A;  2BE4 A;  2KYC A;  5JOL A;  5ER5 A;  1JF0 A;  3CR4 X;  1RJV A;  2Y5I A;  2RGI A;  1MQ1 A;  3DVM A;  2JC2 A;  4JWQ A;  4OVN F;  2O60 A;  3GK2 A;  1CFF A;  5TNC A;  2FCD A;  3SG7 A;  3SIB A;  1GGZ A;  1UUR A;  3BXK A;  3OHM B;  1K2H A;  4A4C A;  5HLO A;  4ICB A;  5AAN A;  1Y1X A;  1LKJ A;  1CFC A;  4NDD A;  4ORC B;  4TNC A;  2AMI A;  4DUQ A;  1DF0 B;  1ZMZ A;  5B8I B;  1PSB A;  1OSA A;  2HQW A;  2FCE A;  4BY5 A;  1M31 A;  1WRK A;  2NCP A;  2LVI A;  2B1U A;  4CFQ A;  2KOT A;  2LP2 A;  3IF7 A;  2O5G A;  5BPJ A;  1J7Q A;  2JOJ A;  1IGV A;  1K9U A;  2K7D A;  1PRW A;  1CDN A;  1K9P A;  2ZRS A;  1OZS A;  2LCP A;  3O6B A;  1AUI B;  2KDH A;  3QRX A;  1RRO A;  4QJ3 B;  3CZT X;  1LA3 A;  1YVL A;  2LMT A;  2BKI B;  1QVI Y;  1Y6W A;  1ALW A;  1KFX S;  2DOQ A;  2M7N A;  3CR5 X;  1TNP A;  2ZND A;  4USL A;  5CSN A;  2PRU A;  4CID A;  1B7T Z;  2BKH B;  1B1G A;  1H8B A;  4QJ5 B;  1SRA A;  1XK4 C;  1ODB A;  3FWC A;  3SG5 A;  1BT6 A;  2MBX A;  1F55 A;  3ZWH A;  2HET A;  1UHJ A;  2F8P A;  4PE1 A;  5I2O A;  3EVR A;  3BOW B;  1Q80 A;  1PAL A;  3GOF A;  2LC5 A;  1SW8 A;  1BR4 B;  5CSI A; 
#chains in the Genus database with same CATH topology
 1CLB A;  2HPS A;  1LIN A;  1AJ5 A;  1NX2 A;  2AUC A;  2BEC A;  3EK8 A;  1KFU L;  2BE6 A;  2FJY A;  3I5H B;  3R1P A;  1R6P A;  4GBA A;  1JWD A;  2OS8 B;  3KEV A;  4MVF A;  2OTG B;  4YRU A;  1W7J B;  2JRF A;  4F0Z B;  2I18 A;  1QAT A;  1SL8 A;  1YUT A;  2JTT A;  2KAV A;  5HKZ A;  1IG5 A;  1OOG A;  1K90 D;  1NUB A;  2F2P A;  2KLE A;  4GGF C;  1L7Z A;  4CLN A;  1DJY A;  2L5Y A;  3NXA A;  2Y4Q A;  3CLN A;  3I5F B;  1DEK A;  1YUS A;  3PAT A;  1CDM A;  1QX5 B;  3D10 A;  1K95 A;  2WCE A;  3CR2 A;  3VB1 A;  3R1O A;  4CFR A;  3CZ2 A;  1S1E A;  3OGN A;  3BYA A;  1XK4 A;  3SG6 A;  1S26 D;  1IWQ A;  1KK8 B;  1TNW A;  1UHI A;  1SKT A;  1XVJ A;  2AAO A;  2KFH A;  2KPH A;  2MHH A;  2SCP A;  3I5F C;  2L0P A;  1NCZ A;  1KK7 Z;  1YX8 A;  2QAC A;  3LK0 A;  3O4X A;  3V2L A;  1RWY A;  1BF5 A;  1CMG A;  5DKQ A;  4JQ0 D;  1E8A A;  3BFB A;  3EKH A;  3LLE A;  1S3P A;  1NSH A;  1KQM C;  1DJX A;  3VRP A;  3SJS A;  2JT0 A;  1J55 A;  2ZKM X;  4IL1 A;  1AHR A;  2G9B A;  1X02 A;  2JWW A;  4YGD B;  1CFP A;  2EC6 B;  3LK1 A;  1KWO B;  1Y1A A;  2F2O A;  3A4U B;  2GV5 A;  3I5I B;  1AK8 A;  1QLK A;  2JPO A;  2MLE C;  2WC6 A;  3BOW A;  2EHB A;  3BFA A;  3D73 A;  5DKR A;  1MUX A;  3O4Y A;  4HRE E;  4MBE A;  4GGF A;  3VGO A;  4PE7 A;  1PSR A;  4MRY A;  4MZJ A;  4PT1 A;  1WLM A;  2JT3 A;  1DMO A;  2I2R E;  2QEB A;  3NHI A;  4OR9 B;  4C0K A;  1TNQ A;  1EG3 A;  1TUJ A;  2EC6 C;  3B86 A;  4DRW A;  3UNW A;  1KWO C;  1R2U A;  1CLL A;  1S36 A;  3I5I C;  1DVI A;  4GAO A;  3RM1 A;  1FI6 A;  2V53 A;  2BBN A;  2WND A;  2MA2 A;  3KO0 A;  4WQ3 A;  1NP8 A;  3S0A A;  2M97 A;  4JKT A;  2GGM A;  2QPT A;  4DCK A;  3D0Y A;  1F70 A;  1IJ5 A;  1DGV A;  1L2O B;  1MR8 A;  2LVV A;  2E6W A;  2YGU A;  4FQT A;  1XFV O;  5AXI A;  1M45 A;  1YUR A;  1NCX A;  3AAJ A;  2KQY A;  2PYQ A;  2I7A A;  4INW A;  3TZ1 A;  3VRN A;  3RZS A;  1K93 D;  2A4J A;  1SY9 A;  1SYM A;  2L2C A;  1WLZ A;  4NQG A;  1J7O A;  3EVV A;  1XFX O;  3HCM A;  1QV0 A;  1N65 A;  2H8V A;  2H2K A;  2M8U A;  1TCF A;  3JTD B;  1NPQ A;  4YBH B;  2KAX A;  5KSZ A;  4N1F A;  2CTN A;  1EG4 A;  1QTX A;  2I94 A;  2JU0 A;  1L2O C;  3D77 A;  2KYF A;  4HSZ A;  1UHH A;  2KNE A;  1N0Y A;  1CTR A;  4OV2 A;  1CDP A;  2PVB A;  2M1U A;  5G08 A;  1B9A A;  2ISD A;  4MSP A;  1FF1 A;  1TUZ A;  1IKU A;  1SNL A;  5HKW A;  4Q04 A;  1NYA A;  2LLS A;  3NSO A;  4AQI A;  1YUU A;  1NCY A;  1TN4 A;  3EKJ A;  1J7P A;  1EH2 A;  3JTD C;  4GGN A;  2CBL A;  1F8H A;  1FBV A;  1M39 A;  1CM4 A;  3SG2 A;  5HL1 A;  1CMF A;  5KU1 A;  1ALV A;  1AJ4 A;  1NX3 A;  1U5I B;  2P71 A;  3PN7 C;  1T14 A;  1YR5 A;  1YRU B;  3GK1 A;  1MXL C;  3OB1 B;  3E3R A;  3VRQ A;  2BBM A;  1K96 A;  1IQ5 A;  1FPW A;  4ORB B;  1SMG A;  3H4S E;  3FE8 A;  1B8C A;  1OQP A;  3CZ1 A;  3FS7 A;  3ICB A;  3S0B A;  1OZO A;  1QVI Z;  1XYD A;  4NDC A;  3IQQ A;  5FI6 A;  2KGR A;  1DT7 B;  2MAZ A;  3B87 A;  2BL0 B;  3B6X A;  1GM0 A;  1A29 A;  3LCP C;  1F4Q A;  4I5N B;  3FE6 A;  3AKA A;  4YGC B;  1WY9 A;  1B7T Y;  3DVE A;  1ZUZ A;  1ZFS A;  2LNK A;  3TS5 B;  5GQQ C;  1DJI A;  4NDB A;  2LM5 A;  2WCB A;  5CSF A;  3VRO A;  4QJ4 B;  3BQ3 A;  1WRZ A;  4FQO A;  4M2P A;  2M3W A;  3IVT A;  4AQJ A;  2CCM A;  2BL0 C;  2JT8 A;  4OCI A;  5FYX A;  2JNF A;  1QS7 A;  1G4Y R;  4MZK A;  1JBA A;  2K7B A;  3EVU A;  4GNK B;  1SBJ A;  3D0Y B;  3TS5 C;  4L9M A;  4DS7 A;  2KI6 D;  2WCJ A;  1F4O A;  2KI6 C;  1SL9 A;  4N5X A;  1S5G Z;  1KQM B;  2L4H A;  3L4L A;  1KFU S;  2K8M B;  4BY4 A;  5HKY A;  1LA0 A;  5JJG A;  1CB1 A;  1JSA A;  2K60 A;  2JZI A;  2F3Z A;  4PHM A;  4WRI A;  2NXQ A;  2QDI A;  4KYN A;  3SS3 A;  1XO5 A;  3BUW B;  1PK0 D;  2L51 A;  1KCY A;  1U5I A;  1OOH A;  1K8U A;  2NCO A;  1K9K A;  3KF9 A;  2L4I A;  4PCW A;  2HQ8 A;  4MEW A;  4YI8 A;  1AP4 A;  1N2D A;  2K2F A;  2KAY A;  1TRF A;  4HRH A;  1UWO A;  2ZFD A;  1B8L A;  1IQ3 A;  2LP3 A;  1C3Y A;  3CTN A;  4YGE B;  3OB2 B;  3KHE A;  1W7I B;  1C7V A;  2KSP A;  1J1D A;  2P6B B;  1J1E A;  1XFU O;  1BG1 A;  5I94 A;  1C07 A;  4PHK A;  2NZ0 A;  2LMV A;  4ZCU A;  5D7F A;  4GPL B;  2Y1N A;  3DXL A;  1JFJ A;  1MF8 B;  1TTX A;  3CS1 A;  3D75 A;  1RK9 A;  1YTZ C;  2LE9 B;  2K61 A;  1UHK A;  2Q4U A;  1W9Z A;  1B4C A;  2LUC A;  1RTP 1;  2CT9 A;  4N1G A;  5FI2 A;  3TUY B;  4HRG A;  2NLN A;  3TDZ A;  1F54 A;  3RLZ A;  2MRD A;  4GUK A;  3VRR A;  4WQ2 A;  3QME A;  4OZD A;  4P2Y B;  3D76 A;  5KTY A;  3JVT C;  1BMO A;  2WCK A;  1TIZ A;  2KFF A;  4OKH A;  2HF5 A;  3WHT B;  2BCA A;  1YVH A;  5I8N A;  3PLF B;  3DD4 A;  4GFT A;  4P5O E;  1NX0 A;  3BUM B;  3L47 A;  3CDN A;  1OE9 B;  1XFW O;  1OW4 A;  1QV1 A;  4MN0 A;  3EG5 B;  4AOM A;  3D78 A;  2K7C A;  3TUY C;  2BCB A;  4CPV A;  3TDU A;  2P70 A;  1QIV A;  2H61 C;  2K2A A;  3D74 A;  2KHN A;  2F33 A;  5AEQ A;  2ZN9 A;  2M7L A;  1OMV A;  3EK4 A;  4I5K A;  4M2Q A;  4I5L B;  4F7F A;  2EGD A;  3F45 A;  1BOC A;  1GJY A;  1A75 A;  4MLW A;  2ZRT A;  1Y0V H;  5J3X A;  3PM8 A;  2LLT A;  4YGB B;  5I2Q A;  1SK6 D;  2WOS A;  1G8I A;  1S6J A;  2KGB C;  3OBV A;  2MLF C;  3PN7 B;  1LVC D;  3BFH A;  1SCM B;  3DF0 A;  3M0W A;  2L50 A;  3S0F A;  3O2P A;  3I5G C;  4A4B A;  1GQM A;  2JXL A;  1QIW A;  3OX6 A;  1PVA A;  3BUN B;  2JTZ A;  2M29 A;  2KI4 C;  1JC2 A;  1KSO A;  1YX7 A;  4YI9 A;  4FTG A;  3KPX A;  3R72 A;  3DY9 A;  5DIC A;  1LS8 A;  3PAL A;  3TDI A;  2BAP A;  2LV7 A;  3SS5 A;  1KFX L;  1SCM C;  3NHT A;  3BJH A;  2PSR A;  1B47 A;  2JUL A;  2PAS A;  3LL8 B;  1REC A;  1BOD A;  5FI7 A;  5PAL A;  4PE4 A;  1J7R A;  4DIR A;  2LUX A;  2WCL A;  3CZ0 A;  3DZT A;  2WOR A;  1DGU A;  1DJZ A;  4INX A;  1DEL A;  4M2O A;  2K7O A;  3NSK A;  2H61 A;  3FIA A;  2JXC A;  3OP0 A;  3PM2 A;  3CGA A;  1SL7 A;  1Y1U A;  1ORG A;  2JNX A;  3WXA A;  2BCX A;  2PAL A;  1AVS A;  3SS4 A;  2ZNE A;  1XA5 A;  1XFR A;  2Q91 A;  2JQ6 A;  2LAN A;  2WC5 A;  4UPG A;  1BLQ A;  1QX2 A;  2WCF A;  1S6C A;  3ZNI A;  1WDC B;  1QAS A;  2CXJ A;  1UP5 A;  3BUX B;  1QX7 A;  3SG4 A;  1KQV A;  2E30 A;  3PSR A;  1MXE A;  1A2X A;  2IS9 A;  3WNX B;  2OPO A;  1A4P A;  5CSJ A;  1CM1 A;  2SAS A;  4ORA B;  1A03 A;  1OOJ A;  1IH0 A;  5HYD A;  1Z2C B;  1TCO B;  1V1F A;  1H4B A;  1ZOT B;  1WDC C;  1YRT B;  1HQV A;  5ER4 X;  2COL B;  1NWD A;  1F71 A;  5D69 A;  5HLV A;  2LMU A;  1B8R A;  1OMD A;  2L5X B;  1EXR A;  1BJF A;  3FWB A;  4JPZ B;  4MRX A;  1NX1 A;  1WRL A;  3NSI A;  3OX5 A;  1GGW A;  1FI5 A;  1M46 A;  3DVJ A;  3GK4 X;  5IBW A;  1SR6 B;  1DC1 A;  1DJW A;  2M49 B;  2ZN8 A;  3K21 A;  2QEH A;  4R1E A;  1JUO A;  2G2B A;  1PVB A;  2TN4 A;  4E68 A;  2LVK A;  2GTE A;  4XJK B;  1CNP A;  1A75 B;  1S5G Y;  2LHI A;  3CWG A;  2K0J A;  1C3Z A;  1EL4 A;  1NIW A;  4PE0 A;  2KBM A;  3CYZ A;  1HT9 A;  3AKB A;  3NSL A;  1Z4H A;  3SIA A;  4U8D A;  2M9G A;  3I5H C;  1MHO A;  3DF0 B;  1DTL A;  3FE9 A;  2OS8 C;  1DF0 A;  1LXF C;  1SR6 C;  2OTG C;  1IIO A;  1BR1 B;  1JFK A;  1CDL A;  2WC8 A;  3EK7 A;  1DJH A;  1KK7 Y;  2L2E A;  3L4A A;  1K94 A;  2FJU B;  3UO9 A;  3S0E A;  4ETO A;  5AER A;  1SPY A;  3PFV A;  3B7A A;  2LHL A;  2KBI A;  3A8R A;  4YGA A;  3BUO B;  1XFZ O;  1RFJ A;  4ZCV A;  3JVT B;  5K89 A;  3C1V A;  2FOT A;  1FW4 A;  2D8N A;  4D1E A;  2CNP A;  2PMY A;  1PUL A;  3AAK A;  1V1G A;  3HX4 A;  2WCM A;  3DYE A;  2KLD A;  2M0R A;  1KSM A;  4XYN A;  1QWV A;  5CPV A;  1XFY O;  1DJG A;  4PDZ A;  3R1V A;  3SG3 A;  1C7W A;  4PHJ A;  4PAL A;  1KK8 C;  5F6T A;  1G33 A;  2MJW B;  1TNX A;  2Y1M A;  2LLU A;  3WHU B;  3DVK A;  2QEV A;  1EJ3 A;  5DKN A;  3Q8I A;  5AFP A;  2KQ6 A;  3O78 A;  1SSE B;  1SCV A;  4C0J A;  1CKK A;  4C0L A;  2KFG A;  1M63 B;  2LAP A;  1P28 A;  4I5J A;  4IJ7 A;  2JPT A;  2GGZ A;  1BU3 A;  3MSE B;  1TOP A;  2PQL A;  2F3Y A;  2VRG A;  3N7H A;  4PHN A;  3B88 A;  1JF2 A;  5I2L A;  1CFD A;  1OMR A;  3I5G B;  1QJT A;  1MWN A;  1VRK A;  1CLM A;  1IRJ A;  4XJK A;  1D1O A;  2LVJ A;  1UHN A;  1QLS A;  3S0G A;  3IQO A;  1QXP A;  2KI4 B;  1S6I A;  1ZAC A;  2R2I A;  1UUS A;  3PJI A;  1IJ6 A;  4MZL A;  2M1K B;  2L98 A;  2BE4 A;  2KYC A;  5JOL A;  5ER5 A;  1JF0 A;  3CR4 X;  1RJV A;  2Y5I A;  2RGI A;  1MQ1 A;  3DVM A;  2JC2 A;  4JWQ A;  4OVN F;  2O60 A;  3GK2 A;  1CFF A;  5TNC A;  4JD9 A;  2FCD A;  1OOF A;  5EL2 A;  3SG7 A;  3SIB A;  1GGZ A;  1UUR A;  3BXK A;  3OHM B;  1K2H A;  4A4C A;  5HLO A;  4ICB A;  5AAN A;  1Y1X A;  2BNX A;  1LKJ A;  1CFC A;  4NDD A;  4ORC B;  4TNC A;  2ERB A;  2AMI A;  4DUQ A;  1DF0 B;  1ZMZ A;  5B8I B;  1PSB A;  1OSA A;  2HQW A;  2FCE A;  4BY5 A;  1M31 A;  5D3O A;  1WRK A;  2NCP A;  2LVI A;  3CAB A;  3S0D A;  2B1U A;  4CFQ A;  2KOT A;  1OOI X;  2LP2 A;  3IF7 A;  2O5G A;  5BPJ A;  1J7Q A;  2JOJ A;  1IGV A;  1K9U A;  2K7D A;  1PRW A;  1CDN A;  1K9P A;  2ZRS A;  2WCH A;  1OZS A;  2LCP A;  3O6B A;  1AUI B;  1DQE A;  2KDH A;  3QRX A;  1TWO A;  1RRO A;  4QJ3 B;  3CZT X;  1LA3 A;  1YVL A;  2LMT A;  2BKI B;  1QVI Y;  1Y6W A;  1ALW A;  1KFX S;  2DOQ A;  2M7N A;  3CR5 X;  1TNP A;  2ZND A;  4USL A;  5CSN A;  2PRU A;  4CID A;  1B7T Z;  2BKH B;  1B1G A;  1H8B A;  4QJ5 B;  1SRA A;  1XK4 C;  2QEO A;  1ODB A;  3FWC A;  3SG5 A;  1BT6 A;  2MBX A;  3NGV A;  1F55 A;  3ZWH A;  2HET A;  1UHJ A;  2F8P A;  4PE1 A;  5I2O A;  3EVR A;  3BOW B;  1Q80 A;  1PAL A;  3GOF A;  2LC5 A;  1SW8 A;  1BR4 B;  5CSI A;  3K1E A; 
#chains in the Genus database with same CATH homology
 1CLB A;  2HPS A;  1LIN A;  1AJ5 A;  1NX2 A;  2AUC A;  2BEC A;  3EK8 A;  1KFU L;  2BE6 A;  3I5H B;  1R6P A;  4GBA A;  1JWD A;  2OS8 B;  3KEV A;  4MVF A;  2OTG B;  4YRU A;  1W7J B;  2JRF A;  4F0Z B;  2I18 A;  1QAT A;  1SL8 A;  1YUT A;  2JTT A;  2KAV A;  5HKZ A;  1IG5 A;  1K90 D;  1NUB A;  2F2P A;  4GGF C;  1L7Z A;  4CLN A;  1DJY A;  3NXA A;  2Y4Q A;  3CLN A;  3I5F B;  1YUS A;  3PAT A;  1CDM A;  1QX5 B;  3D10 A;  1K95 A;  2WCE A;  3CR2 A;  4CFR A;  1S1E A;  3BYA A;  1XK4 A;  3SG6 A;  1S26 D;  1IWQ A;  1KK8 B;  1TNW A;  1UHI A;  1SKT A;  1XVJ A;  2AAO A;  2KFH A;  2SCP A;  2MHH A;  1JFJ A;  3I5F C;  2L0P A;  1NCZ A;  1KK7 Z;  1YX8 A;  2QAC A;  3LK0 A;  1RWY A;  1BF5 A;  1CMG A;  5DKQ A;  4JQ0 D;  1E8A A;  3EKH A;  3LLE A;  1S3P A;  1NSH A;  1KQM C;  1DJX A;  3VRP A;  3SJS A;  2JT0 A;  1J55 A;  2ZKM X;  4IL1 A;  1AHR A;  2G9B A;  1X02 A;  2JWW A;  4YGD B;  1CFP A;  2EC6 B;  3LK1 A;  1KWO B;  1Y1A A;  2F2O A;  3A4U B;  2GV5 A;  3I5I B;  1AK8 A;  1QLK A;  2MLE C;  3BOW A;  2EHB A;  5DKR A;  1MUX A;  3O4Y A;  4HRE E;  4MBE A;  4GGF A;  3VGO A;  4PE7 A;  1PSR A;  4MRY A;  4MZJ A;  1WLM A;  2JT3 A;  1DMO A;  2I2R E;  4OR9 B;  4C0K A;  1TNQ A;  1EG3 A;  2EC6 C;  4DRW A;  1KWO C;  1R2U A;  1CLL A;  1S36 A;  3I5I C;  1DVI A;  4GAO A;  3RM1 A;  1FI6 A;  2V53 A;  2BBN A;  2WND A;  2MA2 A;  3KO0 A;  4WQ3 A;  1NP8 A;  2M97 A;  2GGM A;  2QPT A;  4DCK A;  3D0Y A;  1F70 A;  1IJ5 A;  1DGV A;  1L2O B;  1MR8 A;  2LVV A;  2E6W A;  5AXI A;  1XFV O;  1M45 A;  1YUR A;  1NCX A;  3AAJ A;  2KQY A;  3TZ1 A;  2I7A A;  3VRN A;  1K93 D;  2A4J A;  1SY9 A;  1SYM A;  1WLZ A;  4NQG A;  1J7O A;  3EVV A;  1XFX O;  3HCM A;  1QV0 A;  1N65 A;  2H2K A;  2M8U A;  1TCF A;  3JTD B;  1NPQ A;  4YBH B;  2KAX A;  5KSZ A;  4N1F A;  2CTN A;  1EG4 A;  1QTX A;  2I94 A;  2JU0 A;  1L2O C;  2KYF A;  4HSZ A;  1UHH A;  2KNE A;  1N0Y A;  1CTR A;  4OV2 A;  1CDP A;  2PVB A;  2M1U A;  5G08 A;  1B9A A;  2ISD A;  4MSP A;  1FF1 A;  1IKU A;  1SNL A;  5HKW A;  4Q04 A;  1NYA A;  2LLS A;  3NSO A;  4AQI A;  1YUU A;  1NCY A;  1TN4 A;  3EKJ A;  1J7P A;  1EH2 A;  3JTD C;  4GGN A;  2CBL A;  1F8H A;  1FBV A;  1M39 A;  1CM4 A;  3SG2 A;  1CMF A;  5KU1 A;  1ALV A;  1AJ4 A;  1NX3 A;  1U5I B;  3PN7 C;  1YR5 A;  1YRU B;  3GK1 A;  1MXL C;  3OB1 B;  3E3R A;  3VRQ A;  2BBM A;  1K96 A;  1IQ5 A;  1FPW A;  4ORB B;  1SMG A;  3H4S E;  1B8C A;  1OQP A;  3ICB A;  3FS7 A;  1OZO A;  1QVI Z;  1XYD A;  4NDC A;  3IQQ A;  2KGR A;  1DT7 B;  2MAZ A;  2BL0 B;  1A29 A;  3LCP C;  1F4Q A;  4I5N B;  3AKA A;  4YGC B;  1WY9 A;  1B7T Y;  3DVE A;  1ZUZ A;  1ZFS A;  2LNK A;  3TS5 B;  5GQQ C;  1DJI A;  4NDB A;  2LM5 A;  2WCB A;  5CSF A;  3VRO A;  4QJ4 B;  3BQ3 A;  1WRZ A;  4FQO A;  4M2P A;  2M3W A;  4AQJ A;  2CCM A;  2BL0 C;  2JT8 A;  4OCI A;  5FYX A;  2JNF A;  1QS7 A;  1G4Y R;  4MZK A;  1JBA A;  2K7B A;  3EVU A;  4GNK B;  1SBJ A;  3D0Y B;  3TS5 C;  4L9M A;  4DS7 A;  2KI6 D;  4N5X A;  1F4O A;  2KI6 C;  1SL9 A;  1S5G Z;  1KQM B;  2L4H A;  1KFU S;  2K8M B;  4BY4 A;  5HKY A;  1LA0 A;  5JJG A;  1CB1 A;  1JSA A;  2JZI A;  2F3Z A;  4PHM A;  4WRI A;  2NXQ A;  1XO5 A;  3BUW B;  1PK0 D;  2L51 A;  1KCY A;  1U5I A;  1K8U A;  2NCO A;  1K9K A;  3KF9 A;  2L4I A;  4PCW A;  2HQ8 A;  4MEW A;  4YI8 A;  1AP4 A;  1N2D A;  2K2F A;  2KAY A;  1TRF A;  4HRH A;  1UWO A;  2ZFD A;  1B8L A;  1IQ3 A;  2LP3 A;  3CTN A;  4YGE B;  3OB2 B;  3KHE A;  1W7I B;  1C7V A;  2KSP A;  1J1D A;  2P6B B;  1J1E A;  1XFU O;  1BG1 A;  1C07 A;  4PHK A;  2NZ0 A;  2LMV A;  4ZCU A;  5D7F A;  4GPL B;  2Y1N A;  1MF8 B;  1TTX A;  3CS1 A;  1RK9 A;  1YTZ C;  2LE9 B;  2K61 A;  1UHK A;  2Q4U A;  1B4C A;  2LUC A;  1RTP 1;  2CT9 A;  4N1G A;  3TUY B;  4HRG A;  2NLN A;  3TDZ A;  1F54 A;  3RLZ A;  2MRD A;  4GUK A;  3VRR A;  4WQ2 A;  4P2Y B;  5KTY A;  3JVT C;  1BMO A;  4OKH A;  1TIZ A;  2KFF A;  2HF5 A;  3WHT B;  2BCA A;  1YVH A;  5I8N A;  3PLF B;  3DD4 A;  4GFT A;  4P5O E;  1NX0 A;  3BUM B;  1OE9 B;  1XFW O;  1QV1 A;  4MN0 A;  4AOM A;  3TUY C;  2K7C A;  2BCB A;  4CPV A;  3TDU A;  1QIV A;  2H61 C;  2K2A A;  2KHN A;  2F33 A;  5AEQ A;  2ZN9 A;  2M7L A;  1OMV A;  3EK4 A;  4I5K A;  4M2Q A;  4I5L B;  2EGD A;  3F45 A;  1BOC A;  1GJY A;  1A75 A;  4MLW A;  2ZRT A;  1Y0V H;  5J3X A;  3PM8 A;  2LLT A;  4YGB B;  5I2Q A;  1SK6 D;  2WOS A;  1G8I A;  1S6J A;  2KGB C;  3PN7 B;  2MLF C;  1LVC D;  1SCM B;  3DF0 A;  3M0W A;  2L50 A;  3O2P A;  3I5G C;  4A4B A;  1GQM A;  2JXL A;  1QIW A;  3OX6 A;  1PVA A;  3BUN B;  2JTZ A;  2M29 A;  2KI4 C;  1JC2 A;  1KSO A;  1YX7 A;  4YI9 A;  4FTG A;  3KPX A;  3PAL A;  3TDI A;  2LV7 A;  1KFX L;  1SCM C;  2PSR A;  1B47 A;  2JUL A;  2PAS A;  3LL8 B;  1REC A;  1BOD A;  5PAL A;  4PE4 A;  1J7R A;  4DIR A;  2LUX A;  2WOR A;  1DGU A;  1DJZ A;  4M2O A;  2K7O A;  3NSK A;  2H61 A;  3FIA A;  2JXC A;  3OP0 A;  3CGA A;  1SL7 A;  1Y1U A;  2JNX A;  3WXA A;  2BCX A;  2PAL A;  1AVS A;  2ZNE A;  1XA5 A;  2Q91 A;  1BLQ A;  2JQ6 A;  2LAN A;  4UPG A;  1QX2 A;  2WCF A;  1S6C A;  3ZNI A;  1WDC B;  1QAS A;  2CXJ A;  1UP5 A;  3BUX B;  1QX7 A;  3SG4 A;  1KQV A;  2E30 A;  3PSR A;  1MXE A;  1A2X A;  2IS9 A;  3WNX B;  2OPO A;  1A4P A;  5CSJ A;  1CM1 A;  2SAS A;  4ORA B;  1A03 A;  1OOJ A;  1IH0 A;  5HYD A;  1TCO B;  1V1F A;  1H4B A;  1ZOT B;  1WDC C;  1YRT B;  1HQV A;  5ER4 X;  2COL B;  1NWD A;  1F71 A;  5D69 A;  5HLV A;  2LMU A;  1B8R A;  1OMD A;  2L5X B;  1EXR A;  1BJF A;  3FWB A;  4JPZ B;  4MRX A;  1NX1 A;  1WRL A;  3NSI A;  3OX5 A;  1GGW A;  1FI5 A;  1M46 A;  3DVJ A;  3GK4 X;  5IBW A;  1SR6 B;  1DJW A;  2M49 B;  2ZN8 A;  3K21 A;  4R1E A;  1JUO A;  2G2B A;  1PVB A;  2TN4 A;  4E68 A;  2LVK A;  4XJK B;  1CNP A;  1A75 B;  1S5G Y;  2LHI A;  3CWG A;  2K0J A;  4PE0 A;  1EL4 A;  1NIW A;  2KBM A;  1HT9 A;  3AKB A;  3NSL A;  3SIA A;  4U8D A;  2M9G A;  3I5H C;  1MHO A;  3DF0 B;  1DTL A;  2OS8 C;  1DF0 A;  1LXF C;  1SR6 C;  2OTG C;  1BR1 B;  1JFK A;  1CDL A;  2WC8 A;  3EK7 A;  1DJH A;  1KK7 Y;  2L2E A;  1K94 A;  2FJU B;  4ETO A;  5AER A;  1SPY A;  3PFV A;  2LHL A;  2KBI A;  3A8R A;  4YGA A;  3BUO B;  1XFZ O;  1RFJ A;  4ZCV A;  3JVT B;  5K89 A;  3C1V A;  2FOT A;  1FW4 A;  2D8N A;  4D1E A;  2CNP A;  2PMY A;  1PUL A;  3AAK A;  1V1G A;  3HX4 A;  4XYN A;  2M0R A;  1KSM A;  5CPV A;  1XFY O;  1DJG A;  4PDZ A;  3SG3 A;  1C7W A;  4PHJ A;  4PAL A;  1KK8 C;  5F6T A;  1G33 A;  2MJW B;  1TNX A;  2Y1M A;  2LLU A;  3WHU B;  3DVK A;  1EJ3 A;  5DKN A;  5AFP A;  2KQ6 A;  3O78 A;  1SCV A;  4C0J A;  1CKK A;  4C0L A;  2KFG A;  1M63 B;  2LAP A;  4I5J A;  2JPT A;  2GGZ A;  1BU3 A;  3MSE B;  1TOP A;  2VRG A;  2F3Y A;  4PHN A;  5I2L A;  1JF2 A;  1CFD A;  1OMR A;  3I5G B;  1QJT A;  1MWN A;  1VRK A;  1CLM A;  1IRJ A;  4XJK A;  1D1O A;  2LVJ A;  1UHN A;  1QLS A;  3IQO A;  1QXP A;  2KI4 B;  1S6I A;  1ZAC A;  2R2I A;  1UUS A;  4MZL A;  1IJ6 A;  2M1K B;  2L98 A;  2BE4 A;  2KYC A;  5JOL A;  5ER5 A;  1JF0 A;  3CR4 X;  1RJV A;  2Y5I A;  2RGI A;  1MQ1 A;  3DVM A;  2JC2 A;  4JWQ A;  4OVN F;  2O60 A;  3GK2 A;  1CFF A;  5TNC A;  2FCD A;  3SG7 A;  3SIB A;  1GGZ A;  1UUR A;  3BXK A;  3OHM B;  1K2H A;  4A4C A;  5HLO A;  4ICB A;  5AAN A;  1Y1X A;  1LKJ A;  1CFC A;  4NDD A;  4ORC B;  4TNC A;  2AMI A;  4DUQ A;  1DF0 B;  1ZMZ A;  5B8I B;  1PSB A;  1OSA A;  2HQW A;  2FCE A;  4BY5 A;  1M31 A;  1WRK A;  2NCP A;  2LVI A;  2B1U A;  4CFQ A;  2KOT A;  2LP2 A;  3IF7 A;  2O5G A;  5BPJ A;  1J7Q A;  2JOJ A;  1IGV A;  1K9U A;  2K7D A;  1PRW A;  1CDN A;  1K9P A;  2ZRS A;  1OZS A;  2LCP A;  3O6B A;  1AUI B;  2KDH A;  3QRX A;  1RRO A;  4QJ3 B;  3CZT X;  1LA3 A;  1YVL A;  2LMT A;  2BKI B;  1QVI Y;  1Y6W A;  1ALW A;  1KFX S;  2DOQ A;  2M7N A;  3CR5 X;  1TNP A;  2ZND A;  4USL A;  5CSN A;  2PRU A;  4CID A;  1B7T Z;  2BKH B;  1B1G A;  1H8B A;  4QJ5 B;  1SRA A;  1XK4 C;  1ODB A;  3FWC A;  3SG5 A;  1BT6 A;  2MBX A;  1F55 A;  3ZWH A;  2HET A;  1UHJ A;  2F8P A;  4PE1 A;  5I2O A;  3EVR A;  3BOW B;  1Q80 A;  1PAL A;  3GOF A;  2LC5 A;  1SW8 A;  1BR4 B;  5CSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...