4PHNA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Sus scrofa
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phnA00
2NCPA 2LP3A 4GAOA 1MWNA 1QVIZ 3I5GC 1B9AA 4GUKA 5D7FA 3TUYB 5I8NA 3LL8B 5ER5A 4AOMA 1MUXA 2JT8A 4WRIA 1H4BA 1AJ4A 1SL9A 2CCMA 2LM5A 3SG7A 5HKWA 3TDZA 1U5IA 2K7OA 3DVJA 1SPYA 5TNCA 3VRPA 1J7QA 3FS7A 1YX7A 1R6PA 1HT9A 1EH2A 2LNKA 2F2OA 1XFXO 2CT9A 3JTDB 1AVSA 1XO5A 1M39A 1OQPA 1W7JB 1TNPA 4PHNA 2LLUA 1YTZC 2AAOA 2BE4A 2M49B 3DF0B 1BODA 2M9GA 1AHRA 2QPTA 2ZRSA 1MXLC 4I5NB 1C07A 1YUSA 4CPVA 1OMRA 1OSAA 5CSJA 2LVIA 1D1OA 1R2UA 3NXAA 2NZ0A 1NX0A 4M2OA 4M2PA 1A03A 1SMGA 3I5FB 2K7CA 4OCIA 1PULA 1QIWA 4PHKA 4WQ2A 4PHJA 1CMFA 1EL4A 1F8HA 1TNXA 1TCOB 4MEWA 1XYDA 2EGDA 2FCEA 1Q80A 1QLSA 1K96A 1RK9A 2MAZA 1S6IA 4PE0A 3SG6A 1WDCC 1Y1AA 1Y1XA 2BBNA 1VRKA 4GPLB 2WOSA 3TZ1A 3ZNIA 4JWQA 3CWGA 1G33A 1YR5A 4XJKA 4YGEB 1PALA 2F3ZA 4MZLA 1GJYA 3KEVA 1M45A 3ZWHA 1DTLA 1SBJA 2COLB 3SG2A 4PE4A 1NCXA 1K93D 2NXQA 3D0YB 3LCPC 1S36A 4FQOA 1MXEA 4GGFA 1BF5A 2EC6B 1IKUA 2GGMA 3BQ3A 3NSLA 4ZCVA 5BPJA 2JQ6A 1GGWA 2FCDA 3PN7C 1JBAA 2PASA 1IJ5A 1YVHA 1W7IB 1BMOA 1SR6B 1CMGA 2LCPA 5AEQA 1J1DA 3BUMB 4CFRA 1M31A 1DGUA 4R1EA 1B1GA 2G9BA 1WRLA 2HETA 2L98A 3KHEA 1CDLA 1TCFA 3BOWB 2KBIA 1YRUB 3FWBA 1K9UA 3CS1A 2K61A 4F0ZB 1B8RA 3TS5C 3SIBA 1ZUZA 3RLZA 1IG5A 2LHLA 1SL8A 3EK8A 1AK8A 1BOCA 2MA2A 2KDHA 5I2LA 2LHIA 2LP2A 1FI6A 3VRNA 5GQQC 1F54A 4YI8A 1K8UA 3DVEA 4NDBA 1JFJA 2KFHA 1FI5A 1KK7Y 3EKJA 3I5HB 1K90D 2LVKA 2MBXA 1MF8B 1A75A 1QX2A 1JC2A 1CLLA 2BL0C 1S6JA 1NCZA 2KI6D 4OVNF 4N1FA 3BXKA 2MJWB 5FYXA 4MVFA 4PCWA 1SCVA 2E30A 2K7DA 2M0RA 4U8DA 3CLNA 3AAKA 1A29A 1FF1A 3NSIA 4MLWA 1JF0A 1QX7A 1QIVA 1PSRA 2OS8C 1QVIY 3I5IC 1SYMA 2M29A 1UHNA 3O6BA 1B7TZ 4JQ0D 3LK0A 4AQJA 1KQVA 1SW8A 1YX8A 2K2FA 3SG3A 3CZTX 3OP0A 1CFPA 1PK0D 2L4HA 3BUWB 4E68A 1L2OB 1N2DA 3OX5A 4Q04A 1DT7B 1BT6A 4BY5A 1XK4A 1ODBA 1UWOA 1KFXS 1U5IB 2KOTA 2LUXA 1WLZA 1WLMA 5CSFA 2FOTA 3KPXA 2ZFDA 2JWWA 1OMVA 3HCMA 2KGBC 5PALA 1DJXA 4WQ3A 4OV2A 2K8MB 1GGZA 2GV5A 2SASA 3OB1B 2BKHB 1K95A 2M97A 2LE9B 3CTNA 3OHMB 5G08A 5JJGA 2M1KB 1KQMB 2KYCA 3AKBA 3JVTB 1KCYA 1XVJA 3D10A 4PALA 2V53A 3TDUA 1QV1A 3MSEB 3AAJA 3HX4A 1DJZA 2F33A 2Q91A 4FTGA 5AFPA 2I94A 1BG1A 4AQIA 1UHKA 2I18A 2Q4UA 2WNDA 5AERA 4N1GA 4ORBB 1ZACA 1NX3A 1KSOA 4HREE 4YRUA 2HPSA 1NUBA 4I5KA 4GFTA 1K94A 4C0KA 1CDPA 1EXRA 1BJFA 4A4BA 1Y1UA 1DMOA 2KQ6A 1NX2A 1XFVO 3VRRA 1ZFSA 2KI6C 2OTGC 2PRUA 1B47A 4XJKB 2KQYA 5KTYA 2DOQA 1CDNA 3OB2B 2G2BA 1NP8A 3OX6A 4C0LA 3KF9A 2KFGA 2KHNA 2KI4B 5F6TA 1OE9B 1ZOTB 1QTXA 3GK4X 3TUYC 1MR8A 2EHBA 1DJGA 1DJHA 1LA0A 1RWYA 1DVIA 2JZIA 3BYAA 1SY9A 1KWOB 1X02A 2CBLA 3C1VA 4MRXA 5AXIA 4ORCB 2BBMA 4CFQA 4P5OE 4GGNA 1QX5B 3FIAA 5J3XA 4YI9A 3GK1A 4M2QA 1OZOA 2K7BA 4N5XA 4YGCB 4CIDA 1KFUS 2I7AA 3EK4A 1UHHA 4I5JA 2WORA 2RGIA 1B4CA 1IWQA 3JTDC 1S5GZ 3EK7A 2H2KA 2BKIB 2A4JA 1IH0A 1SCMB 4CLNA 2Y5IA 2B1UA 4YGBB 1CM4A 3A4UB 1OOJA 1S6CA 4QJ3B 2JT0A 1TIZA 2FJUB 3CR4X 1CM1A 1KK8B 1RJVA 1DJYA 2H61A 4ICBA 5HLOA 1DF0A 1TNWA 1NYAA 2BCBA 2Y1NA 3CR2A 3I5FC 1QATA 1LXFC 2M8UA 3AKAA 1CFCA 1RROA 1A75B 2O5GA 1XFYO 1QJTA 4OKHA 1TRFA 2P6BB 3O78A 3E3RA 1N0YA 4MSPA 3EVUA 3QRXA 3I5GB 1WY9A 1XFUO 2LMUA 2WCBA 1XFWO 4GGFC 5CSIA 1B7TY 4TNCA 5CSNA 4MZJA 2LMTA 4DUQA 3M0WA 1QASA 2JXLA 2KFFA 2LMVA 1F71A 2L4IA 2LC5A 1IQ3A 2ZNEA 2JOJA 1DJWA 1PSBA 3K21A 2WC8A 2EC6C 5I2OA 1NWDA 4IL1A 1Y6WA 4DIRA 2GGZA 2K2AA 1L7ZA 2JTTA 1EJ3A 2JXCA 1J7OA 3BUOB 2I2RE 1GQMA 2KNEA 3WNXB 1CLBA 1ALVA 2CXJA 2ZN9A 1SR6C 1BLQA 2L51A 1CFDA 4YGDB 1LKJA 1KFXL 3BUNB 1EG4A 2IS9A 3KO0A 5IBWA 1AP4A 4XYNA 2BECA 2MRDA 1IRJA 1LINA 2KAVA 1C7WA 2LLTA 2NLNA 4UPGA 4NDCA 2LVJA 3DVMA 1V1FA 2TN4A 4PHMA 2ISDA 2KGRA 5D69A 2BCXA 1A2XA 2JPTA 1UHIA 2L2EA 1SNLA 1J7RA 4MZKA 1OZSA 3GOFA 2KSPA 2L50A 1TOPA 2ZKMX 4PDZA 1F70A 4GNKB 4HRHA 3SG5A 2HQWA 1WDCB 2BCAA 5HYDA 1M63B 3SJSA 3I5HC 1SKTA 3DVKA 4ORAB 5KSZA 2PVBA 1BR4B 1E8AA 1UURA 1WRZA 2MLFC 2AMIA 2Y4QA 5KU1A 2CNPA 3RM1A 1SL7A 1PVBA 4L9MA 5HKZA 3WHTB 1CTRA 2D8NA 1J1EA 1XA5A 3ICBA 1HQVA 3BUXB 2ZRTA 1YUTA 3PN7B 2SCPA 4NQGA 1NCYA 2LANA 4ETOA 1RFJA 1FPWA 1JSAA 1JWDA 2WCEA 2JU0A 5DKNA 1XK4C 2F3YA 3PLFB 5CPVA 2QACA 1J7PA 4P2YB 2LUCA 4BY4A 3O2PA 1L2OC 3PALA 1J55A 1YVLA 1YURA 2WCFA 4ZCUA 1V1GA 1WRKA 1QXPA 4OR9B 3SG4A 2PMYA 5DKQA 3PM8A 2F2PA 1IGVA 3DF0A 5JOLA 1UP5A 1B8LA 3O4YA 3TS5B 1C7VA 1KSMA 1QLKA 1S5GY 5ER4X 1B8CA 2JT3A 1CKKA 2R2IA 2KAYA 3NSKA 4YBHB 1DJIA 1KFUL 1ALWA 1TNQA 2Y1MA 1KQMC 3LK1A 3A8RA 3H4SE 4I5LB 2M3WA 3VROA 3JVTC 1QV0A 4NDDA 3IQOA 1H8BA 2AUCA 2BL0B 4PE1A 2LAPA 4QJ4B 4A4CA 2LLSA 1ZMZA 3FWCA 5B8IB 1MQ1A 1BU3A 3IQQA 4DCKA 1DF0B 2L0PA 2K0JA 2JNFA 3TDIA 1K9KA 3EVVA 1SRAA 3LLEA 4DRWA 5I2QA 5HLVA 2HF5A 1TN4A 2OS8B 3F45A 4C0JA 3DD4A 2JNXA 2M1UA 2MHHA 3I5IB 1UHJA 1MHOA 1K2HA 1RTP1 3D0YA 2NCOA 1F4QA 1PRWA 4USLA 1CLMA 1YRTB 5HKYA 3IF7A 1EG3A 4D1EA 3CGAA 1G8IA 3CR5X 1UUSA 1NX1A 3EKHA 1QS7A 1CB1A 3PFVA 2BE6A 1JFKA 2KI4C 4MRYA 2M7LA 1AJ5A 1Y0VH 4QJ5B 1SK6D 4GBAA 1AUIB 2M7NA 3PATA 3VGOA 5DKRA 3GK2A 2KAXA 2JRFA 1S1EA 2CTNA 3BOWA 1KWOC 5K89A 1M46A 4MBEA 1F4OA 4JPZB 1IJ6A 1JF2A 1F55A 1DGVA 1TTXA 1RECA 1N65A 1S3PA 2ZN8A 1A4PA 1JUOA 2O60A 2PSRA 2LV7A 3VRQA 3NSOA 1K9PA 2LVVA 1IQ5A 1SCMC 2H61C 4HRGA 4MN0A 1G4YR 4PE7A 2JULA 2OPOA 2PALA 4HSZA 2VRGA 1XFZO 3PSRA 2ZNDA 5AANA 1CNPA 1LVCD 2HQ8A 1KK8C 1S26D 1PVAA 1CDMA 1KK7Z 1BR1B 2KYFA 3WHUB 4DS7A 1OMDA 2F8PA 2OTGB 1NIWA 2JTZA 2JC2A 1FBVA 3SIAA 1YUUA 1CFFA 2MLEC 1LA3A 2E6WA 4YGAA 1NPQA 1NSHA 2KBMA 1FW4A 3EVRA 2L5XB 3WXAA
chains in the Genus database with same CATH superfamily
2NCPA 2LP3A 4GAOA 1MWNA 1QVIZ 3I5GC 1B9AA 4GUKA 5D7FA 3TUYB 5I8NA 3LL8B 5ER5A 3NGVA 4AOMA 3BFAA 3DYEA 1MUXA 2JT8A 4WRIA 1H4BA 1AJ4A 1SL9A 2CCMA 2LM5A 3SG7A 3OGNA 5HKWA 3TDZA 1U5IA 2K7OA 3DVJA 1SPYA 5TNCA 3VRPA 1J7QA 3FS7A 5D3OA 1YX7A 2L2CA 1R6PA 1HT9A 1EH2A 2LNKA 2F2OA 1XFXO 2CT9A 3JTDB 1AVSA 1XO5A 1M39A 1OQPA 1W7JB 5HL1A 1TNPA 4PHNA 2LLUA 1YTZC 2AAOA 2BE4A 2M49B 1OOGA 3DF0B 1BODA 2M9GA 1AHRA 2QPTA 2ZRSA 1MXLC 3D77A 4I5NB 1YUSA 1TUJA 1C07A 4CPVA 1OMRA 1OSAA 5CSJA 2LVIA 1D1OA 1R2UA 1ORGA 3B6XA 3NXAA 3SS4A 2NZ0A 1NX0A 4M2OA 4M2PA 1A03A 1SMGA 3I5FB 2K7CA 4OCIA 1PULA 1QIWA 4PHKA 2KPHA 4PHJA 4WQ2A 1CMFA 1EL4A 1F8HA 1TNXA 1TCOB 4MEWA 1XYDA 2EGDA 2FCEA 1Q80A 1QLSA 1K96A 1RK9A 2MAZA 1S6IA 4PE0A 2PYQA 3SG6A 1WDCC 1Y1AA 1Y1XA 2BBNA 1VRKA 4GPLB 2WOSA 3TZ1A 3UO9A 3ZNIA 3IVTA 4JWQA 3UNWA 3CWGA 1G33A 1YR5A 4XJKA 4YGEB 1PALA 2F3ZA 4MZLA 1GJYA 3KEVA 1M45A 3ZWHA 1DTLA 1SBJA 2COLB 3FE9A 3L47A 1XFRA 4PE4A 3SG2A 1NCXA 1K93D 2NXQA 3D0YB 3LCPC 1S36A 4FQOA 1MXEA 4GGFA 1BF5A 2EC6B 1IKUA 2GGMA 3BQ3A 3NSLA 4ZCVA 5BPJA 2JQ6A 1GGWA 2FCDA 3PN7C 1DELA 3S0EA 1JBAA 2PASA 3S0FA 1IJ5A 1YVHA 1W7IB 1BMOA 1SR6B 1CMGA 2LCPA 1LS8A 5AEQA 1J1DA 3BUMB 4CFRA 1M31A 2FJYA 1DGUA 4R1EA 1B1GA 2G9BA 1WRLA 2HETA 2L98A 2WCHA 3KHEA 1CDLA 1TCFA 3BOWB 2KBIA 3S0DA 1YRUB 3FWBA 1K9UA 3BFBA 3CS1A 2K61A 4F0ZB 1B8RA 3TS5C 3SIBA 1ZUZA 3RLZA 1IG5A 1Z2CB 2P71A 2LHLA 1SL8A 3EK8A 1AK8A 1BOCA 2MA2A 2KDHA 5I2LA 2LHIA 2LP2A 2QEBA 1FI6A 3VRNA 5GQQC 1F54A 4YI8A 1K8UA 3DVEA 3R1VA 4NDBA 1JFJA 2KFHA 1FI5A 1Z4HA 1KK7Y 3EKJA 3I5HB 1K90D 2LVKA 2MBXA 1MF8B 1A75A 1QX2A 1TUZA 1JC2A 1CLLA 2BL0C 1S6JA 1NCZA 2KI6D 4OVNF 4N1FA 3BXKA 2MJWB 5FYXA 4MVFA 4PCWA 1SCVA 3FE6A 2E30A 2K7DA 2M0RA 4U8DA 3CLNA 4F7FA 3AAKA 1A29A 1FF1A 3NSIA 4MLWA 2WCLA 1JF0A 1QX7A 1QIVA 1PSRA 2OS8C 1QVIY 3I5IC 1SYMA 2M29A 1TWOA 1UHNA 3O6BA 1B7TZ 4JQ0D 3LK0A 4AQJA 1KQVA 1SW8A 1W9ZA 1YX8A 2K2FA 3SG3A 2QEOA 3CZTX 3OP0A 1CFPA 2BNXA 1PK0D 2L4HA 3BUWB 4E68A 1L2OB 1N2DA 3OX5A 4Q04A 1DT7B 1BT6A 4BY5A 1XK4A 1ODBA 1UWOA 1KFXS 1U5IB 2KOTA 2LUXA 2WCJA 1WLZA 1WLMA 5CSFA 2FOTA 3KPXA 2ZFDA 2JWWA 1OMVA 3HCMA 2KGBC 5PALA 1DJXA 3V2LA 4WQ3A 4OV2A 1DC1A 2K8MB 1GGZA 2GV5A 2SASA 3CABA 3OB1B 4PT1A 2BKHB 1K95A 2M97A 2LE9B 1GM0A 3CTNA 3OHMB 3B86A 5G08A 5JJGA 2M1KB 1KQMB 2KYCA 3DY9A 3NHIA 3AKBA 3JVTB 5I94A 1KCYA 3QMEA 1XVJA 3D10A 4PALA 2V53A 1C3YA 3TDUA 3D73A 1QV1A 3MSEB 3AAJA 1OW4A 1DJZA 2F33A 2Q91A 3HX4A 4FTGA 5AFPA 2I94A 1BG1A 4AQIA 1UHKA 2I18A 2Q4UA 2WNDA 5AERA 4N1GA 4ORBB 1ZACA 1NX3A 3BFHA 5FI6A 1KSOA 4HREE 4YRUA 2HPSA 1NUBA 4I5KA 2KLEA 3D78A 4GFTA 1K94A 4C0KA 1CDPA 1EXRA 1BJFA 4A4BA 1Y1UA 3B87A 2KQ6A 1DMOA 1NX2A 1XFVO 3VRRA 1ZFSA 2KI6C 2OTGC 2PRUA 1B47A 4XJKB 2KQYA 5KTYA 2DOQA 1CDNA 3OB2B 2G2BA 1NP8A 3OX6A 4KYNA 4C0LA 3KF9A 2KFGA 2KHNA 2KI4B 5F6TA 1OE9B 1ZOTB 1QTXA 3GK4X 3O4XA 3TUYC 1MR8A 2QDIA 2EHBA 1DJGA 1DJHA 1LA0A 1RWYA 1DVIA 2JZIA 3BYAA 1SY9A 1KWOB 1X02A 2CBLA 3C1VA 2WC6A 4MRXA 4ORCB 2BBMA 5AXIA 4CFQA 4P5OE 4GGNA 1QX5B 3FIAA 5J3XA 4YI9A 2WCMA 3GK1A 4M2QA 1OZOA 2K7BA 4N5XA 4YGCB 4CIDA 1KFUS 2I7AA 3EK4A 1UHHA 4I5JA 2WORA 2RGIA 1B4CA 1IWQA 3JTDC 1S5GZ 3EK7A 2H2KA 2BKIB 3D74A 2A4JA 1IH0A 1SCMB 4CLNA 2Y5IA 2B1UA 4YGBB 1CM4A 3A4UB 1OOJA 1S6CA 4QJ3B 2JT0A 1TIZA 2FJUB 3CR4X 1CM1A 1KK8B 1RJVA 5FI7A 1DJYA 1OOIX 2H61A 3OBVA 3R1OA 4ICBA 5HLOA 2WC5A 1DF0A 1TNWA 1NYAA 2BCBA 2Y1NA 3CR2A 3I5FC 3Q8IA 2GTEA 2K60A 1QATA 1LXFC 2M8UA 3AKAA 1CFCA 3CZ0A 1RROA 1A75B 2O5GA 1XFYO 1QJTA 4OKHA 3S0AA 1TRFA 1T14A 2P6BB 3O78A 3E3RA 1N0YA 4MSPA 3EVUA 3QRXA 1DEKA 3I5GB 1WY9A 1XFUO 2LMUA 2PQLA 1XFWO 2WCBA 1QWVA 4GGFC 5CSIA 1B7TY 4TNCA 5CSNA 4MZJA 2LMTA 4DUQA 3M0WA 1QASA 2JXLA 2KFFA 2LMVA 1F71A 2L4IA 2LC5A 1IQ3A 2ZNEA 2JOJA 1DJWA 1PSBA 3S0BA 2BAPA 3K21A 2WC8A 2EC6C 5I2OA 1NWDA 4IL1A 1Y6WA 3PM2A 4DIRA 2GGZA 2K2AA 1L7ZA 2JTTA 4IJ7A 1EJ3A 2JXCA 1J7OA 3BUOB 3DXLA 2I2RE 1GQMA 2KNEA 3WNXB 1CLBA 1ALVA 2CXJA 2ZN9A 1SR6C 1BLQA 2L51A 1CFDA 4YGDB 1LKJA 1KFXL 3BUNB 1EG4A 2IS9A 3KO0A 2QEVA 3K1EA 5IBWA 1AP4A 4XYNA 2BECA 2MRDA 2H8VA 2KLDA 4INXA 1IRJA 1LINA 2KAVA 1C7WA 2LLTA 2NLNA 4UPGA 4NDCA 2LVJA 3DVMA 1V1FA 2TN4A 4PHMA 4JD9A 2ISDA 2KGRA 3CZ2A 5D69A 2BCXA 1A2XA 2JPTA 1UHIA 2L2EA 1SNLA 3SS5A 1J7RA 4MZKA 2L5YA 1OZSA 3GOFA 2KSPA 4OZDA 2L50A 1TOPA 2ZKMX 4PDZA 1F70A 4GNKB 3DZTA 4HRHA 3SG5A 2HQWA 1WDCB 2BCAA 5HYDA 3BJHA 1M63B 3SJSA 3I5HC 1SKTA 3DVKA 3CZ1A 4ORAB 5KSZA 2PVBA 1BR4B 1E8AA 1UURA 1WRZA 2MLFC 5FI2A 2AMIA 2Y4QA 3L4LA 5KU1A 2CNPA 3RM1A 1SL7A 1PVBA 1SSEB 4L9MA 5HKZA 3WHTB 1CTRA 2D8NA 1OOFA 1J1EA 1XA5A 3ICBA 1HQVA 3BUXB 2ZRTA 1YUTA 3PN7B 2SCPA 4NQGA 1NCYA 2LANA 4ETOA 1RFJA 1FPWA 1JSAA 1JWDA 2WCEA 2JU0A 5DKNA 1XK4C 2F3YA 4JKTA 3PLFB 5CPVA 2QACA 1J7PA 4P2YB 2LUCA 4BY4A 3O2PA 5EL2A 1L2OC 3PALA 3FE8A 1J55A 1YVLA 1YURA 2WCFA 4ZCUA 1V1GA 1WRKA 1QXPA 4OR9B 3SG4A 2PMYA 5DKQA 3PM8A 2F2PA 1IGVA 3DF0A 5JOLA 1UP5A 1B8LA 3O4YA 3TS5B 1C7VA 1KSMA 1QLKA 1S5GY 5ER4X 1B8CA 2JPOA 3B88A 2JT3A 1CKKA 2R2IA 2KAYA 3NSKA 4YBHB 1DJIA 1KFUL 1ALWA 3EG5B 1TNQA 2Y1MA 5DICA 1KQMC 3SS3A 3LK1A 3A8RA 3H4SE 4I5LB 2M3WA 3VROA 3JVTC 1QV0A 4NDDA 3IQOA 1H8BA 2AUCA 2BL0B 3D76A 4PE1A 1DQEA 4INWA 2LAPA 4QJ4B 4A4CA 2LLSA 3RZSA 1ZMZA 3FWCA 3PJIA 1MQ1A 5B8IB 1BU3A 2P70A 3IQQA 4DCKA 1DF0B 2L0PA 2K0JA 2JNFA 3TDIA 1K9KA 3EVVA 1SRAA 3LLEA 4DRWA 3N7HA 2YGUA 5I2QA 5HLVA 2HF5A 1TN4A 2OS8B 3F45A 3NHTA 3DD4A 2JNXA 2M1UA 2MHHA 3I5IB 4C0JA 1UHJA 1MHOA 1K2HA 1RTP1 3D0YA 2NCOA 1F4QA 1PRWA 4USLA 1CLMA 1YRTB 1P28A 5HKYA 3IF7A 1EG3A 4D1EA 3CGAA 1G8IA 3CR5X 1UUSA 3S0GA 1NX1A 3EKHA 1QS7A 1CB1A 3PFVA 2BE6A 1JFKA 1C3ZA 2KI4C 4FQTA 1AJ5A 1Y0VH 4MRYA 2M7LA 1OOHA 1SK6D 4QJ5B 4GBAA 1AUIB 2M7NA 3PATA 3VGOA 5DKRA 3GK2A 2ERBA 2KAXA 2JRFA 1S1EA 2CTNA 3BOWA 1KWOC 5K89A 1M46A 3D75A 4MBEA 1F4OA 4JPZB 3VB1A 1IJ6A 2QEHA 1JF2A 1F55A 1DGVA 1TTXA 1RECA 1N65A 1S3PA 2ZN8A 1A4PA 1JUOA 2O60A 2PSRA 2LV7A 3VRQA 3NSOA 1K9PA 2LVVA 1IQ5A 1SCMC 2H61C 3R1PA 4HRGA 4MN0A 1G4YR 4PE7A 3B7AA 2JULA 2OPOA 2PALA 4HSZA 2VRGA 1XFZO 3CYZA 3PSRA 2ZNDA 5AANA 1CNPA 1LVCD 2HQ8A 1KK8C 1S26D 1PVAA 1CDMA 1KK7Z 1BR1B 3L4AA 2KYFA 3WHUB 2WCKA 4DS7A 1OMDA 2F8PA 2OTGB 3R72A 1NIWA 2JTZA 2JC2A 1FBVA 3SIAA 1YUUA 1CFFA 3CDNA 2MLEC 1LA3A 2E6WA 4YGAA 1NPQA 1NSHA 2KBMA 1FW4A 3EVRA 1IIOA 2L5XB 3WXAA
chains in the Genus database with same CATH topology
2NCPA 2LP3A 4GAOA 1MWNA 1QVIZ 3I5GC 1B9AA 4GUKA 5D7FA 3TUYB 5I8NA 3LL8B 5ER5A 4AOMA 1MUXA 2JT8A 4WRIA 1H4BA 1AJ4A 1SL9A 2CCMA 2LM5A 3SG7A 5HKWA 3TDZA 1U5IA 2K7OA 3DVJA 1SPYA 5TNCA 3VRPA 1J7QA 3FS7A 1YX7A 1R6PA 1HT9A 1EH2A 2LNKA 2F2OA 1XFXO 2CT9A 3JTDB 1AVSA 1XO5A 1M39A 1OQPA 1W7JB 1TNPA 4PHNA 2LLUA 1YTZC 2AAOA 2BE4A 2M49B 3DF0B 1BODA 2M9GA 1AHRA 2QPTA 2ZRSA 1MXLC 4I5NB 1C07A 1YUSA 4CPVA 1OMRA 1OSAA 5CSJA 2LVIA 1D1OA 1R2UA 3NXAA 2NZ0A 1NX0A 4M2OA 4M2PA 1A03A 1SMGA 3I5FB 2K7CA 4OCIA 1PULA 1QIWA 4PHKA 4WQ2A 4PHJA 1CMFA 1EL4A 1F8HA 1TNXA 1TCOB 4MEWA 1XYDA 2EGDA 2FCEA 1Q80A 1QLSA 1K96A 1RK9A 2MAZA 1S6IA 4PE0A 3SG6A 1WDCC 1Y1AA 1Y1XA 2BBNA 1VRKA 4GPLB 2WOSA 3TZ1A 3ZNIA 4JWQA 3CWGA 1G33A 1YR5A 4XJKA 4YGEB 1PALA 2F3ZA 4MZLA 1GJYA 3KEVA 1M45A 3ZWHA 1DTLA 1SBJA 2COLB 3SG2A 4PE4A 1NCXA 1K93D 2NXQA 3D0YB 3LCPC 1S36A 4FQOA 1MXEA 4GGFA 1BF5A 2EC6B 1IKUA 2GGMA 3BQ3A 3NSLA 4ZCVA 5BPJA 2JQ6A 1GGWA 2FCDA 3PN7C 1JBAA 2PASA 1IJ5A 1YVHA 1W7IB 1BMOA 1SR6B 1CMGA 2LCPA 5AEQA 1J1DA 3BUMB 4CFRA 1M31A 1DGUA 4R1EA 1B1GA 2G9BA 1WRLA 2HETA 2L98A 3KHEA 1CDLA 1TCFA 3BOWB 2KBIA 1YRUB 3FWBA 1K9UA 3CS1A 2K61A 4F0ZB 1B8RA 3TS5C 3SIBA 1ZUZA 3RLZA 1IG5A 2LHLA 1SL8A 3EK8A 1AK8A 1BOCA 2MA2A 2KDHA 5I2LA 2LHIA 2LP2A 1FI6A 3VRNA 5GQQC 1F54A 4YI8A 1K8UA 3DVEA 4NDBA 1JFJA 2KFHA 1FI5A 1KK7Y 3EKJA 3I5HB 1K90D 2LVKA 2MBXA 1MF8B 1A75A 1QX2A 1JC2A 1CLLA 2BL0C 1S6JA 1NCZA 2KI6D 4OVNF 4N1FA 3BXKA 2MJWB 5FYXA 4MVFA 4PCWA 1SCVA 2E30A 2K7DA 2M0RA 4U8DA 3CLNA 3AAKA 1A29A 1FF1A 3NSIA 4MLWA 1JF0A 1QX7A 1QIVA 1PSRA 2OS8C 1QVIY 3I5IC 1SYMA 2M29A 1UHNA 3O6BA 1B7TZ 4JQ0D 3LK0A 4AQJA 1KQVA 1SW8A 1YX8A 2K2FA 3SG3A 3CZTX 3OP0A 1CFPA 1PK0D 2L4HA 3BUWB 4E68A 1L2OB 1N2DA 3OX5A 4Q04A 1DT7B 1BT6A 4BY5A 1XK4A 1ODBA 1UWOA 1KFXS 1U5IB 2KOTA 2LUXA 1WLZA 1WLMA 5CSFA 2FOTA 3KPXA 2ZFDA 2JWWA 1OMVA 3HCMA 2KGBC 5PALA 1DJXA 4WQ3A 4OV2A 2K8MB 1GGZA 2GV5A 2SASA 3OB1B 2BKHB 1K95A 2M97A 2LE9B 3CTNA 3OHMB 5G08A 5JJGA 2M1KB 1KQMB 2KYCA 3AKBA 3JVTB 1KCYA 1XVJA 3D10A 4PALA 2V53A 3TDUA 1QV1A 3MSEB 3AAJA 3HX4A 1DJZA 2F33A 2Q91A 4FTGA 5AFPA 2I94A 1BG1A 4AQIA 1UHKA 2I18A 2Q4UA 2WNDA 5AERA 4N1GA 4ORBB 1ZACA 1NX3A 1KSOA 4HREE 4YRUA 2HPSA 1NUBA 4I5KA 4GFTA 1K94A 4C0KA 1CDPA 1EXRA 1BJFA 4A4BA 1Y1UA 1DMOA 2KQ6A 1NX2A 1XFVO 3VRRA 1ZFSA 2KI6C 2OTGC 2PRUA 1B47A 4XJKB 2KQYA 5KTYA 2DOQA 1CDNA 3OB2B 2G2BA 1NP8A 3OX6A 4C0LA 3KF9A 2KFGA 2KHNA 2KI4B 5F6TA 1OE9B 1ZOTB 1QTXA 3GK4X 3TUYC 1MR8A 2EHBA 1DJGA 1DJHA 1LA0A 1RWYA 1DVIA 2JZIA 3BYAA 1SY9A 1KWOB 1X02A 2CBLA 3C1VA 4MRXA 5AXIA 4ORCB 2BBMA 4CFQA 4P5OE 4GGNA 1QX5B 3FIAA 5J3XA 4YI9A 3GK1A 4M2QA 1OZOA 2K7BA 4N5XA 4YGCB 4CIDA 1KFUS 2I7AA 3EK4A 1UHHA 4I5JA 2WORA 2RGIA 1B4CA 1IWQA 3JTDC 1S5GZ 3EK7A 2H2KA 2BKIB 2A4JA 1IH0A 1SCMB 4CLNA 2Y5IA 2B1UA 4YGBB 1CM4A 3A4UB 1OOJA 1S6CA 4QJ3B 2JT0A 1TIZA 2FJUB 3CR4X 1CM1A 1KK8B 1RJVA 1DJYA 2H61A 4ICBA 5HLOA 1DF0A 1TNWA 1NYAA 2BCBA 2Y1NA 3CR2A 3I5FC 1QATA 1LXFC 2M8UA 3AKAA 1CFCA 1RROA 1A75B 2O5GA 1XFYO 1QJTA 4OKHA 1TRFA 2P6BB 3O78A 3E3RA 1N0YA 4MSPA 3EVUA 3QRXA 3I5GB 1WY9A 1XFUO 2LMUA 2WCBA 1XFWO 4GGFC 5CSIA 1B7TY 4TNCA 5CSNA 4MZJA 2LMTA 4DUQA 3M0WA 1QASA 2JXLA 2KFFA 2LMVA 1F71A 2L4IA 2LC5A 1IQ3A 2ZNEA 2JOJA 1DJWA 1PSBA 3K21A 2WC8A 2EC6C 5I2OA 1NWDA 4IL1A 1Y6WA 4DIRA 2GGZA 2K2AA 1L7ZA 2JTTA 1EJ3A 2JXCA 1J7OA 3BUOB 2I2RE 1GQMA 2KNEA 3WNXB 1CLBA 1ALVA 2CXJA 2ZN9A 1SR6C 1BLQA 2L51A 1CFDA 4YGDB 1LKJA 1KFXL 3BUNB 1EG4A 2IS9A 3KO0A 5IBWA 1AP4A 4XYNA 2BECA 2MRDA 1IRJA 1LINA 2KAVA 1C7WA 2LLTA 2NLNA 4UPGA 4NDCA 2LVJA 3DVMA 1V1FA 2TN4A 4PHMA 2ISDA 2KGRA 5D69A 2BCXA 1A2XA 2JPTA 1UHIA 2L2EA 1SNLA 1J7RA 4MZKA 1OZSA 3GOFA 2KSPA 2L50A 1TOPA 2ZKMX 4PDZA 1F70A 4GNKB 4HRHA 3SG5A 2HQWA 1WDCB 2BCAA 5HYDA 1M63B 3SJSA 3I5HC 1SKTA 3DVKA 4ORAB 5KSZA 2PVBA 1BR4B 1E8AA 1UURA 1WRZA 2MLFC 2AMIA 2Y4QA 5KU1A 2CNPA 3RM1A 1SL7A 1PVBA 4L9MA 5HKZA 3WHTB 1CTRA 2D8NA 1J1EA 1XA5A 3ICBA 1HQVA 3BUXB 2ZRTA 1YUTA 3PN7B 2SCPA 4NQGA 1NCYA 2LANA 4ETOA 1RFJA 1FPWA 1JSAA 1JWDA 2WCEA 2JU0A 5DKNA 1XK4C 2F3YA 3PLFB 5CPVA 2QACA 1J7PA 4P2YB 2LUCA 4BY4A 3O2PA 1L2OC 3PALA 1J55A 1YVLA 1YURA 2WCFA 4ZCUA 1V1GA 1WRKA 1QXPA 4OR9B 3SG4A 2PMYA 5DKQA 3PM8A 2F2PA 1IGVA 3DF0A 5JOLA 1UP5A 1B8LA 3O4YA 3TS5B 1C7VA 1KSMA 1QLKA 1S5GY 5ER4X 1B8CA 2JT3A 1CKKA 2R2IA 2KAYA 3NSKA 4YBHB 1DJIA 1KFUL 1ALWA 1TNQA 2Y1MA 1KQMC 3LK1A 3A8RA 3H4SE 4I5LB 2M3WA 3VROA 3JVTC 1QV0A 4NDDA 3IQOA 1H8BA 2AUCA 2BL0B 4PE1A 2LAPA 4QJ4B 4A4CA 2LLSA 1ZMZA 3FWCA 5B8IB 1MQ1A 1BU3A 3IQQA 4DCKA 1DF0B 2L0PA 2K0JA 2JNFA 3TDIA 1K9KA 3EVVA 1SRAA 3LLEA 4DRWA 5I2QA 5HLVA 2HF5A 1TN4A 2OS8B 3F45A 4C0JA 3DD4A 2JNXA 2M1UA 2MHHA 3I5IB 1UHJA 1MHOA 1K2HA 1RTP1 3D0YA 2NCOA 1F4QA 1PRWA 4USLA 1CLMA 1YRTB 5HKYA 3IF7A 1EG3A 4D1EA 3CGAA 1G8IA 3CR5X 1UUSA 1NX1A 3EKHA 1QS7A 1CB1A 3PFVA 2BE6A 1JFKA 2KI4C 4MRYA 2M7LA 1AJ5A 1Y0VH 4QJ5B 1SK6D 4GBAA 1AUIB 2M7NA 3PATA 3VGOA 5DKRA 3GK2A 2KAXA 2JRFA 1S1EA 2CTNA 3BOWA 1KWOC 5K89A 1M46A 4MBEA 1F4OA 4JPZB 1IJ6A 1JF2A 1F55A 1DGVA 1TTXA 1RECA 1N65A 1S3PA 2ZN8A 1A4PA 1JUOA 2O60A 2PSRA 2LV7A 3VRQA 3NSOA 1K9PA 2LVVA 1IQ5A 1SCMC 2H61C 4HRGA 4MN0A 1G4YR 4PE7A 2JULA 2OPOA 2PALA 4HSZA 2VRGA 1XFZO 3PSRA 2ZNDA 5AANA 1CNPA 1LVCD 2HQ8A 1KK8C 1S26D 1PVAA 1CDMA 1KK7Z 1BR1B 2KYFA 3WHUB 4DS7A 1OMDA 2F8PA 2OTGB 1NIWA 2JTZA 2JC2A 1FBVA 3SIAA 1YUUA 1CFFA 2MLEC 1LA3A 2E6WA 4YGAA 1NPQA 1NSHA 2KBMA 1FW4A 3EVRA 2L5XB 3WXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCP A;  2LP3 A;  4GAO A;  1MWN A;  1QVI Z;  3I5G C;  1B9A A;  4GUK A;  5D7F A;  3TUY B;  5I8N A;  3LL8 B;  5ER5 A;  4AOM A;  1MUX A;  2JT8 A;  4WRI A;  1H4B A;  1AJ4 A;  1SL9 A;  2CCM A;  2LM5 A;  3SG7 A;  5HKW A;  3TDZ A;  1U5I A;  2K7O A;  3DVJ A;  1SPY A;  5TNC A;  3VRP A;  1J7Q A;  3FS7 A;  1YX7 A;  1R6P A;  1HT9 A;  1EH2 A;  2LNK A;  2F2O A;  1XFX O;  2CT9 A;  3JTD B;  1AVS A;  1XO5 A;  1M39 A;  1OQP A;  1W7J B;  1TNP A;  4PHN A;  2LLU A;  1YTZ C;  2AAO A;  2BE4 A;  2M49 B;  3DF0 B;  1BOD A;  2M9G A;  1AHR A;  2QPT A;  2ZRS A;  1MXL C;  4I5N B;  1C07 A;  1YUS A;  4CPV A;  1OMR A;  1OSA A;  5CSJ A;  2LVI A;  1D1O A;  1R2U A;  3NXA A;  2NZ0 A;  1NX0 A;  4M2O A;  4M2P A;  1A03 A;  1SMG A;  3I5F B;  2K7C A;  4OCI A;  1PUL A;  1QIW A;  4PHK A;  4WQ2 A;  4PHJ A;  1CMF A;  1EL4 A;  1F8H A;  1TNX A;  1TCO B;  4MEW A;  1XYD A;  2EGD A;  2FCE A;  1Q80 A;  1QLS A;  1K96 A;  1RK9 A;  2MAZ A;  1S6I A;  4PE0 A;  3SG6 A;  1WDC C;  1Y1A A;  1Y1X A;  2BBN A;  1VRK A;  4GPL B;  2WOS A;  3TZ1 A;  3ZNI A;  4JWQ A;  3CWG A;  1G33 A;  1YR5 A;  4XJK A;  4YGE B;  1PAL A;  2F3Z A;  4MZL A;  1GJY A;  3KEV A;  1M45 A;  3ZWH A;  1DTL A;  1SBJ A;  2COL B;  3SG2 A;  4PE4 A;  1NCX A;  1K93 D;  2NXQ A;  3D0Y B;  3LCP C;  1S36 A;  4FQO A;  1MXE A;  4GGF A;  1BF5 A;  2EC6 B;  1IKU A;  2GGM A;  3BQ3 A;  3NSL A;  4ZCV A;  5BPJ A;  2JQ6 A;  1GGW A;  2FCD A;  3PN7 C;  1JBA A;  2PAS A;  1IJ5 A;  1YVH A;  1W7I B;  1BMO A;  1SR6 B;  1CMG A;  2LCP A;  5AEQ A;  1J1D A;  3BUM B;  4CFR A;  1M31 A;  1DGU A;  4R1E A;  1B1G A;  2G9B A;  1WRL A;  2HET A;  2L98 A;  3KHE A;  1CDL A;  1TCF A;  3BOW B;  2KBI A;  1YRU B;  3FWB A;  1K9U A;  3CS1 A;  2K61 A;  4F0Z B;  1B8R A;  3TS5 C;  3SIB A;  1ZUZ A;  3RLZ A;  1IG5 A;  2LHL A;  1SL8 A;  3EK8 A;  1AK8 A;  1BOC A;  2MA2 A;  2KDH A;  5I2L A;  2LHI A;  2LP2 A;  1FI6 A;  3VRN A;  5GQQ C;  1F54 A;  4YI8 A;  1K8U A;  3DVE A;  4NDB A;  1JFJ A;  2KFH A;  1FI5 A;  1KK7 Y;  3EKJ A;  3I5H B;  1K90 D;  2LVK A;  2MBX A;  1MF8 B;  1A75 A;  1QX2 A;  1JC2 A;  1CLL A;  2BL0 C;  1S6J A;  1NCZ A;  2KI6 D;  4OVN F;  4N1F A;  3BXK A;  2MJW B;  5FYX A;  4MVF A;  4PCW A;  1SCV A;  2E30 A;  2K7D A;  2M0R A;  4U8D A;  3CLN A;  3AAK A;  1A29 A;  1FF1 A;  3NSI A;  4MLW A;  1JF0 A;  1QX7 A;  1QIV A;  1PSR A;  2OS8 C;  1QVI Y;  3I5I C;  1SYM A;  2M29 A;  1UHN A;  3O6B A;  1B7T Z;  4JQ0 D;  3LK0 A;  4AQJ A;  1KQV A;  1SW8 A;  1YX8 A;  2K2F A;  3SG3 A;  3CZT X;  3OP0 A;  1CFP A;  1PK0 D;  2L4H A;  3BUW B;  4E68 A;  1L2O B;  1N2D A;  3OX5 A;  4Q04 A;  1DT7 B;  1BT6 A;  4BY5 A;  1XK4 A;  1ODB A;  1UWO A;  1KFX S;  1U5I B;  2KOT A;  2LUX A;  1WLZ A;  1WLM A;  5CSF A;  2FOT A;  3KPX A;  2ZFD A;  2JWW A;  1OMV A;  3HCM A;  2KGB C;  5PAL A;  1DJX A;  4WQ3 A;  4OV2 A;  2K8M B;  1GGZ A;  2GV5 A;  2SAS A;  3OB1 B;  2BKH B;  1K95 A;  2M97 A;  2LE9 B;  3CTN A;  3OHM B;  5G08 A;  5JJG A;  2M1K B;  1KQM B;  2KYC A;  3AKB A;  3JVT B;  1KCY A;  1XVJ A;  3D10 A;  4PAL A;  2V53 A;  3TDU A;  1QV1 A;  3MSE B;  3AAJ A;  3HX4 A;  1DJZ A;  2F33 A;  2Q91 A;  4FTG A;  5AFP A;  2I94 A;  1BG1 A;  4AQI A;  1UHK A;  2I18 A;  2Q4U A;  2WND A;  5AER A;  4N1G A;  4ORB B;  1ZAC A;  1NX3 A;  1KSO A;  4HRE E;  4YRU A;  2HPS A;  1NUB A;  4I5K A;  4GFT A;  1K94 A;  4C0K A;  1CDP A;  1EXR A;  1BJF A;  4A4B A;  1Y1U A;  1DMO A;  2KQ6 A;  1NX2 A;  1XFV O;  3VRR A;  1ZFS A;  2KI6 C;  2OTG C;  2PRU A;  1B47 A;  4XJK B;  2KQY A;  5KTY A;  2DOQ A;  1CDN A;  3OB2 B;  2G2B A;  1NP8 A;  3OX6 A;  4C0L A;  3KF9 A;  2KFG A;  2KHN A;  2KI4 B;  5F6T A;  1OE9 B;  1ZOT B;  1QTX A;  3GK4 X;  3TUY C;  1MR8 A;  2EHB A;  1DJG A;  1DJH A;  1LA0 A;  1RWY A;  1DVI A;  2JZI A;  3BYA A;  1SY9 A;  1KWO B;  1X02 A;  2CBL A;  3C1V A;  4MRX A;  5AXI A;  4ORC B;  2BBM A;  4CFQ A;  4P5O E;  4GGN A;  1QX5 B;  3FIA A;  5J3X A;  4YI9 A;  3GK1 A;  4M2Q A;  1OZO A;  2K7B A;  4N5X A;  4YGC B;  4CID A;  1KFU S;  2I7A A;  3EK4 A;  1UHH A;  4I5J A;  2WOR A;  2RGI A;  1B4C A;  1IWQ A;  3JTD C;  1S5G Z;  3EK7 A;  2H2K A;  2BKI B;  2A4J A;  1IH0 A;  1SCM B;  4CLN A;  2Y5I A;  2B1U A;  4YGB B;  1CM4 A;  3A4U B;  1OOJ A;  1S6C A;  4QJ3 B;  2JT0 A;  1TIZ A;  2FJU B;  3CR4 X;  1CM1 A;  1KK8 B;  1RJV A;  1DJY A;  2H61 A;  4ICB A;  5HLO A;  1DF0 A;  1TNW A;  1NYA A;  2BCB A;  2Y1N A;  3CR2 A;  3I5F C;  1QAT A;  1LXF C;  2M8U A;  3AKA A;  1CFC A;  1RRO A;  1A75 B;  2O5G A;  1XFY O;  1QJT A;  4OKH A;  1TRF A;  2P6B B;  3O78 A;  3E3R A;  1N0Y A;  4MSP A;  3EVU A;  3QRX A;  3I5G B;  1WY9 A;  1XFU O;  2LMU A;  2WCB A;  1XFW O;  4GGF C;  5CSI A;  1B7T Y;  4TNC A;  5CSN A;  4MZJ A;  2LMT A;  4DUQ A;  3M0W A;  1QAS A;  2JXL A;  2KFF A;  2LMV A;  1F71 A;  2L4I A;  2LC5 A;  1IQ3 A;  2ZNE A;  2JOJ A;  1DJW A;  1PSB A;  3K21 A;  2WC8 A;  2EC6 C;  5I2O A;  1NWD A;  4IL1 A;  1Y6W A;  4DIR A;  2GGZ A;  2K2A A;  1L7Z A;  2JTT A;  1EJ3 A;  2JXC A;  1J7O A;  3BUO B;  2I2R E;  1GQM A;  2KNE A;  3WNX B;  1CLB A;  1ALV A;  2CXJ A;  2ZN9 A;  1SR6 C;  1BLQ A;  2L51 A;  1CFD A;  4YGD B;  1LKJ A;  1KFX L;  3BUN B;  1EG4 A;  2IS9 A;  3KO0 A;  5IBW A;  1AP4 A;  4XYN A;  2BEC A;  2MRD A;  1IRJ A;  1LIN A;  2KAV A;  1C7W A;  2LLT A;  2NLN A;  4UPG A;  4NDC A;  2LVJ A;  3DVM A;  1V1F A;  2TN4 A;  4PHM A;  2ISD A;  2KGR A;  5D69 A;  2BCX A;  1A2X A;  2JPT A;  1UHI A;  2L2E A;  1SNL A;  1J7R A;  4MZK A;  1OZS A;  3GOF A;  2KSP A;  2L50 A;  1TOP A;  2ZKM X;  4PDZ A;  1F70 A;  4GNK B;  4HRH A;  3SG5 A;  2HQW A;  1WDC B;  2BCA A;  5HYD A;  1M63 B;  3SJS A;  3I5H C;  1SKT A;  3DVK A;  4ORA B;  5KSZ A;  2PVB A;  1BR4 B;  1E8A A;  1UUR A;  1WRZ A;  2MLF C;  2AMI A;  2Y4Q A;  5KU1 A;  2CNP A;  3RM1 A;  1SL7 A;  1PVB A;  4L9M A;  5HKZ A;  3WHT B;  1CTR A;  2D8N A;  1J1E A;  1XA5 A;  3ICB A;  1HQV A;  3BUX B;  2ZRT A;  1YUT A;  3PN7 B;  2SCP A;  4NQG A;  1NCY A;  2LAN A;  4ETO A;  1RFJ A;  1FPW A;  1JSA A;  1JWD A;  2WCE A;  2JU0 A;  5DKN A;  1XK4 C;  2F3Y A;  3PLF B;  5CPV A;  2QAC A;  1J7P A;  4P2Y B;  2LUC A;  4BY4 A;  3O2P A;  1L2O C;  3PAL A;  1J55 A;  1YVL A;  1YUR A;  2WCF A;  4ZCU A;  1V1G A;  1WRK A;  1QXP A;  4OR9 B;  3SG4 A;  2PMY A;  5DKQ A;  3PM8 A;  2F2P A;  1IGV A;  3DF0 A;  5JOL A;  1UP5 A;  1B8L A;  3O4Y A;  3TS5 B;  1C7V A;  1KSM A;  1QLK A;  1S5G Y;  5ER4 X;  1B8C A;  2JT3 A;  1CKK A;  2R2I A;  2KAY A;  3NSK A;  4YBH B;  1DJI A;  1KFU L;  1ALW A;  1TNQ A;  2Y1M A;  1KQM C;  3LK1 A;  3A8R A;  3H4S E;  4I5L B;  2M3W A;  3VRO A;  3JVT C;  1QV0 A;  4NDD A;  3IQO A;  1H8B A;  2AUC A;  2BL0 B;  4PE1 A;  2LAP A;  4QJ4 B;  4A4C A;  2LLS A;  1ZMZ A;  3FWC A;  5B8I B;  1MQ1 A;  1BU3 A;  3IQQ A;  4DCK A;  1DF0 B;  2L0P A;  2K0J A;  2JNF A;  3TDI A;  1K9K A;  3EVV A;  1SRA A;  3LLE A;  4DRW A;  5I2Q A;  5HLV A;  2HF5 A;  1TN4 A;  2OS8 B;  3F45 A;  4C0J A;  3DD4 A;  2JNX A;  2M1U A;  2MHH A;  3I5I B;  1UHJ A;  1MHO A;  1K2H A;  1RTP 1;  3D0Y A;  2NCO A;  1F4Q A;  1PRW A;  4USL A;  1CLM A;  1YRT B;  5HKY A;  3IF7 A;  1EG3 A;  4D1E A;  3CGA A;  1G8I A;  3CR5 X;  1UUS A;  1NX1 A;  3EKH A;  1QS7 A;  1CB1 A;  3PFV A;  2BE6 A;  1JFK A;  2KI4 C;  4MRY A;  2M7L A;  1AJ5 A;  1Y0V H;  4QJ5 B;  1SK6 D;  4GBA A;  1AUI B;  2M7N A;  3PAT A;  3VGO A;  5DKR A;  3GK2 A;  2KAX A;  2JRF A;  1S1E A;  2CTN A;  3BOW A;  1KWO C;  5K89 A;  1M46 A;  4MBE A;  1F4O A;  4JPZ B;  1IJ6 A;  1JF2 A;  1F55 A;  1DGV A;  1TTX A;  1REC A;  1N65 A;  1S3P A;  2ZN8 A;  1A4P A;  1JUO A;  2O60 A;  2PSR A;  2LV7 A;  3VRQ A;  3NSO A;  1K9P A;  2LVV A;  1IQ5 A;  1SCM C;  2H61 C;  4HRG A;  4MN0 A;  1G4Y R;  4PE7 A;  2JUL A;  2OPO A;  2PAL A;  4HSZ A;  2VRG A;  1XFZ O;  3PSR A;  2ZND A;  5AAN A;  1CNP A;  1LVC D;  2HQ8 A;  1KK8 C;  1S26 D;  1PVA A;  1CDM A;  1KK7 Z;  1BR1 B;  2KYF A;  3WHU B;  4DS7 A;  1OMD A;  2F8P A;  2OTG B;  1NIW A;  2JTZ A;  2JC2 A;  1FBV A;  3SIA A;  1YUU A;  1CFF A;  2MLE C;  1LA3 A;  2E6W A;  4YGA A;  1NPQ A;  1NSH A;  2KBM A;  1FW4 A;  3EVR A;  2L5X B;  3WXA A; 
#chains in the Genus database with same CATH topology
 2NCP A;  2LP3 A;  4GAO A;  1MWN A;  1QVI Z;  3I5G C;  1B9A A;  4GUK A;  5D7F A;  3TUY B;  5I8N A;  3LL8 B;  5ER5 A;  3NGV A;  4AOM A;  3BFA A;  3DYE A;  1MUX A;  2JT8 A;  4WRI A;  1H4B A;  1AJ4 A;  1SL9 A;  2CCM A;  2LM5 A;  3SG7 A;  3OGN A;  5HKW A;  3TDZ A;  1U5I A;  2K7O A;  3DVJ A;  1SPY A;  5TNC A;  3VRP A;  1J7Q A;  3FS7 A;  5D3O A;  1YX7 A;  2L2C A;  1R6P A;  1HT9 A;  1EH2 A;  2LNK A;  2F2O A;  1XFX O;  2CT9 A;  3JTD B;  1AVS A;  1XO5 A;  1M39 A;  1OQP A;  1W7J B;  5HL1 A;  1TNP A;  4PHN A;  2LLU A;  1YTZ C;  2AAO A;  2BE4 A;  2M49 B;  1OOG A;  3DF0 B;  1BOD A;  2M9G A;  1AHR A;  2QPT A;  2ZRS A;  1MXL C;  3D77 A;  4I5N B;  1YUS A;  1TUJ A;  1C07 A;  4CPV A;  1OMR A;  1OSA A;  5CSJ A;  2LVI A;  1D1O A;  1R2U A;  1ORG A;  3B6X A;  3NXA A;  3SS4 A;  2NZ0 A;  1NX0 A;  4M2O A;  4M2P A;  1A03 A;  1SMG A;  3I5F B;  2K7C A;  4OCI A;  1PUL A;  1QIW A;  4PHK A;  2KPH A;  4PHJ A;  4WQ2 A;  1CMF A;  1EL4 A;  1F8H A;  1TNX A;  1TCO B;  4MEW A;  1XYD A;  2EGD A;  2FCE A;  1Q80 A;  1QLS A;  1K96 A;  1RK9 A;  2MAZ A;  1S6I A;  4PE0 A;  2PYQ A;  3SG6 A;  1WDC C;  1Y1A A;  1Y1X A;  2BBN A;  1VRK A;  4GPL B;  2WOS A;  3TZ1 A;  3UO9 A;  3ZNI A;  3IVT A;  4JWQ A;  3UNW A;  3CWG A;  1G33 A;  1YR5 A;  4XJK A;  4YGE B;  1PAL A;  2F3Z A;  4MZL A;  1GJY A;  3KEV A;  1M45 A;  3ZWH A;  1DTL A;  1SBJ A;  2COL B;  3FE9 A;  3L47 A;  1XFR A;  4PE4 A;  3SG2 A;  1NCX A;  1K93 D;  2NXQ A;  3D0Y B;  3LCP C;  1S36 A;  4FQO A;  1MXE A;  4GGF A;  1BF5 A;  2EC6 B;  1IKU A;  2GGM A;  3BQ3 A;  3NSL A;  4ZCV A;  5BPJ A;  2JQ6 A;  1GGW A;  2FCD A;  3PN7 C;  1DEL A;  3S0E A;  1JBA A;  2PAS A;  3S0F A;  1IJ5 A;  1YVH A;  1W7I B;  1BMO A;  1SR6 B;  1CMG A;  2LCP A;  1LS8 A;  5AEQ A;  1J1D A;  3BUM B;  4CFR A;  1M31 A;  2FJY A;  1DGU A;  4R1E A;  1B1G A;  2G9B A;  1WRL A;  2HET A;  2L98 A;  2WCH A;  3KHE A;  1CDL A;  1TCF A;  3BOW B;  2KBI A;  3S0D A;  1YRU B;  3FWB A;  1K9U A;  3BFB A;  3CS1 A;  2K61 A;  4F0Z B;  1B8R A;  3TS5 C;  3SIB A;  1ZUZ A;  3RLZ A;  1IG5 A;  1Z2C B;  2P71 A;  2LHL A;  1SL8 A;  3EK8 A;  1AK8 A;  1BOC A;  2MA2 A;  2KDH A;  5I2L A;  2LHI A;  2LP2 A;  2QEB A;  1FI6 A;  3VRN A;  5GQQ C;  1F54 A;  4YI8 A;  1K8U A;  3DVE A;  3R1V A;  4NDB A;  1JFJ A;  2KFH A;  1FI5 A;  1Z4H A;  1KK7 Y;  3EKJ A;  3I5H B;  1K90 D;  2LVK A;  2MBX A;  1MF8 B;  1A75 A;  1QX2 A;  1TUZ A;  1JC2 A;  1CLL A;  2BL0 C;  1S6J A;  1NCZ A;  2KI6 D;  4OVN F;  4N1F A;  3BXK A;  2MJW B;  5FYX A;  4MVF A;  4PCW A;  1SCV A;  3FE6 A;  2E30 A;  2K7D A;  2M0R A;  4U8D A;  3CLN A;  4F7F A;  3AAK A;  1A29 A;  1FF1 A;  3NSI A;  4MLW A;  2WCL A;  1JF0 A;  1QX7 A;  1QIV A;  1PSR A;  2OS8 C;  1QVI Y;  3I5I C;  1SYM A;  2M29 A;  1TWO A;  1UHN A;  3O6B A;  1B7T Z;  4JQ0 D;  3LK0 A;  4AQJ A;  1KQV A;  1SW8 A;  1W9Z A;  1YX8 A;  2K2F A;  3SG3 A;  2QEO A;  3CZT X;  3OP0 A;  1CFP A;  2BNX A;  1PK0 D;  2L4H A;  3BUW B;  4E68 A;  1L2O B;  1N2D A;  3OX5 A;  4Q04 A;  1DT7 B;  1BT6 A;  4BY5 A;  1XK4 A;  1ODB A;  1UWO A;  1KFX S;  1U5I B;  2KOT A;  2LUX A;  2WCJ A;  1WLZ A;  1WLM A;  5CSF A;  2FOT A;  3KPX A;  2ZFD A;  2JWW A;  1OMV A;  3HCM A;  2KGB C;  5PAL A;  1DJX A;  3V2L A;  4WQ3 A;  4OV2 A;  1DC1 A;  2K8M B;  1GGZ A;  2GV5 A;  2SAS A;  3CAB A;  3OB1 B;  4PT1 A;  2BKH B;  1K95 A;  2M97 A;  2LE9 B;  1GM0 A;  3CTN A;  3OHM B;  3B86 A;  5G08 A;  5JJG A;  2M1K B;  1KQM B;  2KYC A;  3DY9 A;  3NHI A;  3AKB A;  3JVT B;  5I94 A;  1KCY A;  3QME A;  1XVJ A;  3D10 A;  4PAL A;  2V53 A;  1C3Y A;  3TDU A;  3D73 A;  1QV1 A;  3MSE B;  3AAJ A;  1OW4 A;  1DJZ A;  2F33 A;  2Q91 A;  3HX4 A;  4FTG A;  5AFP A;  2I94 A;  1BG1 A;  4AQI A;  1UHK A;  2I18 A;  2Q4U A;  2WND A;  5AER A;  4N1G A;  4ORB B;  1ZAC A;  1NX3 A;  3BFH A;  5FI6 A;  1KSO A;  4HRE E;  4YRU A;  2HPS A;  1NUB A;  4I5K A;  2KLE A;  3D78 A;  4GFT A;  1K94 A;  4C0K A;  1CDP A;  1EXR A;  1BJF A;  4A4B A;  1Y1U A;  3B87 A;  2KQ6 A;  1DMO A;  1NX2 A;  1XFV O;  3VRR A;  1ZFS A;  2KI6 C;  2OTG C;  2PRU A;  1B47 A;  4XJK B;  2KQY A;  5KTY A;  2DOQ A;  1CDN A;  3OB2 B;  2G2B A;  1NP8 A;  3OX6 A;  4KYN A;  4C0L A;  3KF9 A;  2KFG A;  2KHN A;  2KI4 B;  5F6T A;  1OE9 B;  1ZOT B;  1QTX A;  3GK4 X;  3O4X A;  3TUY C;  1MR8 A;  2QDI A;  2EHB A;  1DJG A;  1DJH A;  1LA0 A;  1RWY A;  1DVI A;  2JZI A;  3BYA A;  1SY9 A;  1KWO B;  1X02 A;  2CBL A;  3C1V A;  2WC6 A;  4MRX A;  4ORC B;  2BBM A;  5AXI A;  4CFQ A;  4P5O E;  4GGN A;  1QX5 B;  3FIA A;  5J3X A;  4YI9 A;  2WCM A;  3GK1 A;  4M2Q A;  1OZO A;  2K7B A;  4N5X A;  4YGC B;  4CID A;  1KFU S;  2I7A A;  3EK4 A;  1UHH A;  4I5J A;  2WOR A;  2RGI A;  1B4C A;  1IWQ A;  3JTD C;  1S5G Z;  3EK7 A;  2H2K A;  2BKI B;  3D74 A;  2A4J A;  1IH0 A;  1SCM B;  4CLN A;  2Y5I A;  2B1U A;  4YGB B;  1CM4 A;  3A4U B;  1OOJ A;  1S6C A;  4QJ3 B;  2JT0 A;  1TIZ A;  2FJU B;  3CR4 X;  1CM1 A;  1KK8 B;  1RJV A;  5FI7 A;  1DJY A;  1OOI X;  2H61 A;  3OBV A;  3R1O A;  4ICB A;  5HLO A;  2WC5 A;  1DF0 A;  1TNW A;  1NYA A;  2BCB A;  2Y1N A;  3CR2 A;  3I5F C;  3Q8I A;  2GTE A;  2K60 A;  1QAT A;  1LXF C;  2M8U A;  3AKA A;  1CFC A;  3CZ0 A;  1RRO A;  1A75 B;  2O5G A;  1XFY O;  1QJT A;  4OKH A;  3S0A A;  1TRF A;  1T14 A;  2P6B B;  3O78 A;  3E3R A;  1N0Y A;  4MSP A;  3EVU A;  3QRX A;  1DEK A;  3I5G B;  1WY9 A;  1XFU O;  2LMU A;  2PQL A;  1XFW O;  2WCB A;  1QWV A;  4GGF C;  5CSI A;  1B7T Y;  4TNC A;  5CSN A;  4MZJ A;  2LMT A;  4DUQ A;  3M0W A;  1QAS A;  2JXL A;  2KFF A;  2LMV A;  1F71 A;  2L4I A;  2LC5 A;  1IQ3 A;  2ZNE A;  2JOJ A;  1DJW A;  1PSB A;  3S0B A;  2BAP A;  3K21 A;  2WC8 A;  2EC6 C;  5I2O A;  1NWD A;  4IL1 A;  1Y6W A;  3PM2 A;  4DIR A;  2GGZ A;  2K2A A;  1L7Z A;  2JTT A;  4IJ7 A;  1EJ3 A;  2JXC A;  1J7O A;  3BUO B;  3DXL A;  2I2R E;  1GQM A;  2KNE A;  3WNX B;  1CLB A;  1ALV A;  2CXJ A;  2ZN9 A;  1SR6 C;  1BLQ A;  2L51 A;  1CFD A;  4YGD B;  1LKJ A;  1KFX L;  3BUN B;  1EG4 A;  2IS9 A;  3KO0 A;  2QEV A;  3K1E A;  5IBW A;  1AP4 A;  4XYN A;  2BEC A;  2MRD A;  2H8V A;  2KLD A;  4INX A;  1IRJ A;  1LIN A;  2KAV A;  1C7W A;  2LLT A;  2NLN A;  4UPG A;  4NDC A;  2LVJ A;  3DVM A;  1V1F A;  2TN4 A;  4PHM A;  4JD9 A;  2ISD A;  2KGR A;  3CZ2 A;  5D69 A;  2BCX A;  1A2X A;  2JPT A;  1UHI A;  2L2E A;  1SNL A;  3SS5 A;  1J7R A;  4MZK A;  2L5Y A;  1OZS A;  3GOF A;  2KSP A;  4OZD A;  2L50 A;  1TOP A;  2ZKM X;  4PDZ A;  1F70 A;  4GNK B;  3DZT A;  4HRH A;  3SG5 A;  2HQW A;  1WDC B;  2BCA A;  5HYD A;  3BJH A;  1M63 B;  3SJS A;  3I5H C;  1SKT A;  3DVK A;  3CZ1 A;  4ORA B;  5KSZ A;  2PVB A;  1BR4 B;  1E8A A;  1UUR A;  1WRZ A;  2MLF C;  5FI2 A;  2AMI A;  2Y4Q A;  3L4L A;  5KU1 A;  2CNP A;  3RM1 A;  1SL7 A;  1PVB A;  1SSE B;  4L9M A;  5HKZ A;  3WHT B;  1CTR A;  2D8N A;  1OOF A;  1J1E A;  1XA5 A;  3ICB A;  1HQV A;  3BUX B;  2ZRT A;  1YUT A;  3PN7 B;  2SCP A;  4NQG A;  1NCY A;  2LAN A;  4ETO A;  1RFJ A;  1FPW A;  1JSA A;  1JWD A;  2WCE A;  2JU0 A;  5DKN A;  1XK4 C;  2F3Y A;  4JKT A;  3PLF B;  5CPV A;  2QAC A;  1J7P A;  4P2Y B;  2LUC A;  4BY4 A;  3O2P A;  5EL2 A;  1L2O C;  3PAL A;  3FE8 A;  1J55 A;  1YVL A;  1YUR A;  2WCF A;  4ZCU A;  1V1G A;  1WRK A;  1QXP A;  4OR9 B;  3SG4 A;  2PMY A;  5DKQ A;  3PM8 A;  2F2P A;  1IGV A;  3DF0 A;  5JOL A;  1UP5 A;  1B8L A;  3O4Y A;  3TS5 B;  1C7V A;  1KSM A;  1QLK A;  1S5G Y;  5ER4 X;  1B8C A;  2JPO A;  3B88 A;  2JT3 A;  1CKK A;  2R2I A;  2KAY A;  3NSK A;  4YBH B;  1DJI A;  1KFU L;  1ALW A;  3EG5 B;  1TNQ A;  2Y1M A;  5DIC A;  1KQM C;  3SS3 A;  3LK1 A;  3A8R A;  3H4S E;  4I5L B;  2M3W A;  3VRO A;  3JVT C;  1QV0 A;  4NDD A;  3IQO A;  1H8B A;  2AUC A;  2BL0 B;  3D76 A;  4PE1 A;  1DQE A;  4INW A;  2LAP A;  4QJ4 B;  4A4C A;  2LLS A;  3RZS A;  1ZMZ A;  3FWC A;  3PJI A;  1MQ1 A;  5B8I B;  1BU3 A;  2P70 A;  3IQQ A;  4DCK A;  1DF0 B;  2L0P A;  2K0J A;  2JNF A;  3TDI A;  1K9K A;  3EVV A;  1SRA A;  3LLE A;  4DRW A;  3N7H A;  2YGU A;  5I2Q A;  5HLV A;  2HF5 A;  1TN4 A;  2OS8 B;  3F45 A;  3NHT A;  3DD4 A;  2JNX A;  2M1U A;  2MHH A;  3I5I B;  4C0J A;  1UHJ A;  1MHO A;  1K2H A;  1RTP 1;  3D0Y A;  2NCO A;  1F4Q A;  1PRW A;  4USL A;  1CLM A;  1YRT B;  1P28 A;  5HKY A;  3IF7 A;  1EG3 A;  4D1E A;  3CGA A;  1G8I A;  3CR5 X;  1UUS A;  3S0G A;  1NX1 A;  3EKH A;  1QS7 A;  1CB1 A;  3PFV A;  2BE6 A;  1JFK A;  1C3Z A;  2KI4 C;  4FQT A;  1AJ5 A;  1Y0V H;  4MRY A;  2M7L A;  1OOH A;  1SK6 D;  4QJ5 B;  4GBA A;  1AUI B;  2M7N A;  3PAT A;  3VGO A;  5DKR A;  3GK2 A;  2ERB A;  2KAX A;  2JRF A;  1S1E A;  2CTN A;  3BOW A;  1KWO C;  5K89 A;  1M46 A;  3D75 A;  4MBE A;  1F4O A;  4JPZ B;  3VB1 A;  1IJ6 A;  2QEH A;  1JF2 A;  1F55 A;  1DGV A;  1TTX A;  1REC A;  1N65 A;  1S3P A;  2ZN8 A;  1A4P A;  1JUO A;  2O60 A;  2PSR A;  2LV7 A;  3VRQ A;  3NSO A;  1K9P A;  2LVV A;  1IQ5 A;  1SCM C;  2H61 C;  3R1P A;  4HRG A;  4MN0 A;  1G4Y R;  4PE7 A;  3B7A A;  2JUL A;  2OPO A;  2PAL A;  4HSZ A;  2VRG A;  1XFZ O;  3CYZ A;  3PSR A;  2ZND A;  5AAN A;  1CNP A;  1LVC D;  2HQ8 A;  1KK8 C;  1S26 D;  1PVA A;  1CDM A;  1KK7 Z;  1BR1 B;  3L4A A;  2KYF A;  3WHU B;  2WCK A;  4DS7 A;  1OMD A;  2F8P A;  2OTG B;  3R72 A;  1NIW A;  2JTZ A;  2JC2 A;  1FBV A;  3SIA A;  1YUU A;  1CFF A;  3CDN A;  2MLE C;  1LA3 A;  2E6W A;  4YGA A;  1NPQ A;  1NSH A;  2KBM A;  1FW4 A;  3EVR A;  1IIO A;  2L5X B;  3WXA A; 
#chains in the Genus database with same CATH homology
 2NCP A;  2LP3 A;  4GAO A;  1MWN A;  1QVI Z;  3I5G C;  1B9A A;  4GUK A;  5D7F A;  3TUY B;  5I8N A;  3LL8 B;  5ER5 A;  4AOM A;  1MUX A;  2JT8 A;  4WRI A;  1H4B A;  1AJ4 A;  1SL9 A;  2CCM A;  2LM5 A;  3SG7 A;  5HKW A;  3TDZ A;  1U5I A;  2K7O A;  3DVJ A;  1SPY A;  5TNC A;  3VRP A;  1J7Q A;  3FS7 A;  1YX7 A;  1R6P A;  1HT9 A;  1EH2 A;  2LNK A;  2F2O A;  1XFX O;  2CT9 A;  3JTD B;  1AVS A;  1XO5 A;  1M39 A;  1OQP A;  1W7J B;  1TNP A;  4PHN A;  2LLU A;  1YTZ C;  2AAO A;  2BE4 A;  2M49 B;  3DF0 B;  1BOD A;  2M9G A;  1AHR A;  2QPT A;  2ZRS A;  1MXL C;  4I5N B;  1C07 A;  1YUS A;  4CPV A;  1OMR A;  1OSA A;  5CSJ A;  2LVI A;  1D1O A;  1R2U A;  3NXA A;  2NZ0 A;  1NX0 A;  4M2O A;  4M2P A;  1A03 A;  1SMG A;  3I5F B;  2K7C A;  4OCI A;  1PUL A;  1QIW A;  4PHK A;  4WQ2 A;  4PHJ A;  1CMF A;  1EL4 A;  1F8H A;  1TNX A;  1TCO B;  4MEW A;  1XYD A;  2EGD A;  2FCE A;  1Q80 A;  1QLS A;  1K96 A;  1RK9 A;  2MAZ A;  1S6I A;  4PE0 A;  3SG6 A;  1WDC C;  1Y1A A;  1Y1X A;  2BBN A;  1VRK A;  4GPL B;  2WOS A;  3TZ1 A;  3ZNI A;  4JWQ A;  3CWG A;  1G33 A;  1YR5 A;  4XJK A;  4YGE B;  1PAL A;  2F3Z A;  4MZL A;  1GJY A;  3KEV A;  1M45 A;  3ZWH A;  1DTL A;  1SBJ A;  2COL B;  3SG2 A;  4PE4 A;  1NCX A;  1K93 D;  2NXQ A;  3D0Y B;  3LCP C;  1S36 A;  4FQO A;  1MXE A;  4GGF A;  1BF5 A;  2EC6 B;  1IKU A;  2GGM A;  3BQ3 A;  3NSL A;  4ZCV A;  5BPJ A;  2JQ6 A;  1GGW A;  2FCD A;  3PN7 C;  1JBA A;  2PAS A;  1IJ5 A;  1YVH A;  1W7I B;  1BMO A;  1SR6 B;  1CMG A;  2LCP A;  5AEQ A;  1J1D A;  3BUM B;  4CFR A;  1M31 A;  1DGU A;  4R1E A;  1B1G A;  2G9B A;  1WRL A;  2HET A;  2L98 A;  3KHE A;  1CDL A;  1TCF A;  3BOW B;  2KBI A;  1YRU B;  3FWB A;  1K9U A;  3CS1 A;  2K61 A;  4F0Z B;  1B8R A;  3TS5 C;  3SIB A;  1ZUZ A;  3RLZ A;  1IG5 A;  2LHL A;  1SL8 A;  3EK8 A;  1AK8 A;  1BOC A;  2MA2 A;  2KDH A;  5I2L A;  2LHI A;  2LP2 A;  1FI6 A;  3VRN A;  5GQQ C;  1F54 A;  4YI8 A;  1K8U A;  3DVE A;  4NDB A;  1JFJ A;  2KFH A;  1FI5 A;  1KK7 Y;  3EKJ A;  3I5H B;  1K90 D;  2LVK A;  2MBX A;  1MF8 B;  1A75 A;  1QX2 A;  1JC2 A;  1CLL A;  2BL0 C;  1S6J A;  1NCZ A;  2KI6 D;  4OVN F;  4N1F A;  3BXK A;  2MJW B;  5FYX A;  4MVF A;  4PCW A;  1SCV A;  2E30 A;  2K7D A;  2M0R A;  4U8D A;  3CLN A;  3AAK A;  1A29 A;  1FF1 A;  3NSI A;  4MLW A;  1JF0 A;  1QX7 A;  1QIV A;  1PSR A;  2OS8 C;  1QVI Y;  3I5I C;  1SYM A;  2M29 A;  1UHN A;  3O6B A;  1B7T Z;  4JQ0 D;  3LK0 A;  4AQJ A;  1KQV A;  1SW8 A;  1YX8 A;  2K2F A;  3SG3 A;  3CZT X;  3OP0 A;  1CFP A;  1PK0 D;  2L4H A;  3BUW B;  4E68 A;  1L2O B;  1N2D A;  3OX5 A;  4Q04 A;  1DT7 B;  1BT6 A;  4BY5 A;  1XK4 A;  1ODB A;  1UWO A;  1KFX S;  1U5I B;  2KOT A;  2LUX A;  1WLZ A;  1WLM A;  5CSF A;  2FOT A;  3KPX A;  2ZFD A;  2JWW A;  1OMV A;  3HCM A;  2KGB C;  5PAL A;  1DJX A;  4WQ3 A;  4OV2 A;  2K8M B;  1GGZ A;  2GV5 A;  2SAS A;  3OB1 B;  2BKH B;  1K95 A;  2M97 A;  2LE9 B;  3CTN A;  3OHM B;  5G08 A;  5JJG A;  2M1K B;  1KQM B;  2KYC A;  3AKB A;  3JVT B;  1KCY A;  1XVJ A;  3D10 A;  4PAL A;  2V53 A;  3TDU A;  1QV1 A;  3MSE B;  3AAJ A;  3HX4 A;  1DJZ A;  2F33 A;  2Q91 A;  4FTG A;  5AFP A;  2I94 A;  1BG1 A;  4AQI A;  1UHK A;  2I18 A;  2Q4U A;  2WND A;  5AER A;  4N1G A;  4ORB B;  1ZAC A;  1NX3 A;  1KSO A;  4HRE E;  4YRU A;  2HPS A;  1NUB A;  4I5K A;  4GFT A;  1K94 A;  4C0K A;  1CDP A;  1EXR A;  1BJF A;  4A4B A;  1Y1U A;  1DMO A;  2KQ6 A;  1NX2 A;  1XFV O;  3VRR A;  1ZFS A;  2KI6 C;  2OTG C;  2PRU A;  1B47 A;  4XJK B;  2KQY A;  5KTY A;  2DOQ A;  1CDN A;  3OB2 B;  2G2B A;  1NP8 A;  3OX6 A;  4C0L A;  3KF9 A;  2KFG A;  2KHN A;  2KI4 B;  5F6T A;  1OE9 B;  1ZOT B;  1QTX A;  3GK4 X;  3TUY C;  1MR8 A;  2EHB A;  1DJG A;  1DJH A;  1LA0 A;  1RWY A;  1DVI A;  2JZI A;  3BYA A;  1SY9 A;  1KWO B;  1X02 A;  2CBL A;  3C1V A;  4MRX A;  5AXI A;  4ORC B;  2BBM A;  4CFQ A;  4P5O E;  4GGN A;  1QX5 B;  3FIA A;  5J3X A;  4YI9 A;  3GK1 A;  4M2Q A;  1OZO A;  2K7B A;  4N5X A;  4YGC B;  4CID A;  1KFU S;  2I7A A;  3EK4 A;  1UHH A;  4I5J A;  2WOR A;  2RGI A;  1B4C A;  1IWQ A;  3JTD C;  1S5G Z;  3EK7 A;  2H2K A;  2BKI B;  2A4J A;  1IH0 A;  1SCM B;  4CLN A;  2Y5I A;  2B1U A;  4YGB B;  1CM4 A;  3A4U B;  1OOJ A;  1S6C A;  4QJ3 B;  2JT0 A;  1TIZ A;  2FJU B;  3CR4 X;  1CM1 A;  1KK8 B;  1RJV A;  1DJY A;  2H61 A;  4ICB A;  5HLO A;  1DF0 A;  1TNW A;  1NYA A;  2BCB A;  2Y1N A;  3CR2 A;  3I5F C;  1QAT A;  1LXF C;  2M8U A;  3AKA A;  1CFC A;  1RRO A;  1A75 B;  2O5G A;  1XFY O;  1QJT A;  4OKH A;  1TRF A;  2P6B B;  3O78 A;  3E3R A;  1N0Y A;  4MSP A;  3EVU A;  3QRX A;  3I5G B;  1WY9 A;  1XFU O;  2LMU A;  2WCB A;  1XFW O;  4GGF C;  5CSI A;  1B7T Y;  4TNC A;  5CSN A;  4MZJ A;  2LMT A;  4DUQ A;  3M0W A;  1QAS A;  2JXL A;  2KFF A;  2LMV A;  1F71 A;  2L4I A;  2LC5 A;  1IQ3 A;  2ZNE A;  2JOJ A;  1DJW A;  1PSB A;  3K21 A;  2WC8 A;  2EC6 C;  5I2O A;  1NWD A;  4IL1 A;  1Y6W A;  4DIR A;  2GGZ A;  2K2A A;  1L7Z A;  2JTT A;  1EJ3 A;  2JXC A;  1J7O A;  3BUO B;  2I2R E;  1GQM A;  2KNE A;  3WNX B;  1CLB A;  1ALV A;  2CXJ A;  2ZN9 A;  1SR6 C;  1BLQ A;  2L51 A;  1CFD A;  4YGD B;  1LKJ A;  1KFX L;  3BUN B;  1EG4 A;  2IS9 A;  3KO0 A;  5IBW A;  1AP4 A;  4XYN A;  2BEC A;  2MRD A;  1IRJ A;  1LIN A;  2KAV A;  1C7W A;  2LLT A;  2NLN A;  4UPG A;  4NDC A;  2LVJ A;  3DVM A;  1V1F A;  2TN4 A;  4PHM A;  2ISD A;  2KGR A;  5D69 A;  2BCX A;  1A2X A;  2JPT A;  1UHI A;  2L2E A;  1SNL A;  1J7R A;  4MZK A;  1OZS A;  3GOF A;  2KSP A;  2L50 A;  1TOP A;  2ZKM X;  4PDZ A;  1F70 A;  4GNK B;  4HRH A;  3SG5 A;  2HQW A;  1WDC B;  2BCA A;  5HYD A;  1M63 B;  3SJS A;  3I5H C;  1SKT A;  3DVK A;  4ORA B;  5KSZ A;  2PVB A;  1BR4 B;  1E8A A;  1UUR A;  1WRZ A;  2MLF C;  2AMI A;  2Y4Q A;  5KU1 A;  2CNP A;  3RM1 A;  1SL7 A;  1PVB A;  4L9M A;  5HKZ A;  3WHT B;  1CTR A;  2D8N A;  1J1E A;  1XA5 A;  3ICB A;  1HQV A;  3BUX B;  2ZRT A;  1YUT A;  3PN7 B;  2SCP A;  4NQG A;  1NCY A;  2LAN A;  4ETO A;  1RFJ A;  1FPW A;  1JSA A;  1JWD A;  2WCE A;  2JU0 A;  5DKN A;  1XK4 C;  2F3Y A;  3PLF B;  5CPV A;  2QAC A;  1J7P A;  4P2Y B;  2LUC A;  4BY4 A;  3O2P A;  1L2O C;  3PAL A;  1J55 A;  1YVL A;  1YUR A;  2WCF A;  4ZCU A;  1V1G A;  1WRK A;  1QXP A;  4OR9 B;  3SG4 A;  2PMY A;  5DKQ A;  3PM8 A;  2F2P A;  1IGV A;  3DF0 A;  5JOL A;  1UP5 A;  1B8L A;  3O4Y A;  3TS5 B;  1C7V A;  1KSM A;  1QLK A;  1S5G Y;  5ER4 X;  1B8C A;  2JT3 A;  1CKK A;  2R2I A;  2KAY A;  3NSK A;  4YBH B;  1DJI A;  1KFU L;  1ALW A;  1TNQ A;  2Y1M A;  1KQM C;  3LK1 A;  3A8R A;  3H4S E;  4I5L B;  2M3W A;  3VRO A;  3JVT C;  1QV0 A;  4NDD A;  3IQO A;  1H8B A;  2AUC A;  2BL0 B;  4PE1 A;  2LAP A;  4QJ4 B;  4A4C A;  2LLS A;  1ZMZ A;  3FWC A;  5B8I B;  1MQ1 A;  1BU3 A;  3IQQ A;  4DCK A;  1DF0 B;  2L0P A;  2K0J A;  2JNF A;  3TDI A;  1K9K A;  3EVV A;  1SRA A;  3LLE A;  4DRW A;  5I2Q A;  5HLV A;  2HF5 A;  1TN4 A;  2OS8 B;  3F45 A;  4C0J A;  3DD4 A;  2JNX A;  2M1U A;  2MHH A;  3I5I B;  1UHJ A;  1MHO A;  1K2H A;  1RTP 1;  3D0Y A;  2NCO A;  1F4Q A;  1PRW A;  4USL A;  1CLM A;  1YRT B;  5HKY A;  3IF7 A;  1EG3 A;  4D1E A;  3CGA A;  1G8I A;  3CR5 X;  1UUS A;  1NX1 A;  3EKH A;  1QS7 A;  1CB1 A;  3PFV A;  2BE6 A;  1JFK A;  2KI4 C;  4MRY A;  2M7L A;  1AJ5 A;  1Y0V H;  4QJ5 B;  1SK6 D;  4GBA A;  1AUI B;  2M7N A;  3PAT A;  3VGO A;  5DKR A;  3GK2 A;  2KAX A;  2JRF A;  1S1E A;  2CTN A;  3BOW A;  1KWO C;  5K89 A;  1M46 A;  4MBE A;  1F4O A;  4JPZ B;  1IJ6 A;  1JF2 A;  1F55 A;  1DGV A;  1TTX A;  1REC A;  1N65 A;  1S3P A;  2ZN8 A;  1A4P A;  1JUO A;  2O60 A;  2PSR A;  2LV7 A;  3VRQ A;  3NSO A;  1K9P A;  2LVV A;  1IQ5 A;  1SCM C;  2H61 C;  4HRG A;  4MN0 A;  1G4Y R;  4PE7 A;  2JUL A;  2OPO A;  2PAL A;  4HSZ A;  2VRG A;  1XFZ O;  3PSR A;  2ZND A;  5AAN A;  1CNP A;  1LVC D;  2HQ8 A;  1KK8 C;  1S26 D;  1PVA A;  1CDM A;  1KK7 Z;  1BR1 B;  2KYF A;  3WHU B;  4DS7 A;  1OMD A;  2F8P A;  2OTG B;  1NIW A;  2JTZ A;  2JC2 A;  1FBV A;  3SIA A;  1YUU A;  1CFF A;  2MLE C;  1LA3 A;  2E6W A;  4YGA A;  1NPQ A;  1NSH A;  2KBM A;  1FW4 A;  3EVR A;  2L5X B;  3WXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...