4PHNA

The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
173
structure length
173
Chain Sequence
b'EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain small subunit 1
publication title The structural basis of differential inhibition of human calpain by indole and phenyl alpha-mercaptoacrylic acids.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 65
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4phnA00
3TS5B 3WHTB 2L5XB 3GK2A 4NDBA 1EH2A 3CGAA 1IQ3A 2K2FA 1B9AA 1UP5A 3JVTC 1XVJA 1HQVA 2O5GA 2FCDA 3FWCA 3QRXA 3EK4A 1QASA 1XFVO 3BOWB 4I5JA 1YUUA 1Y0VH 2G2BA 2L50A 4ZCUA 1B8RA 1SRAA 1V1GA 1BR1B 4PDZA 1R2UA 2CCMA 2PRUA 3A4UB 3CLNA 1JF0A 1KWOC 2H61C 3PFVA 4L9MA 1WDCB 4GPLB 2CXJA 4C0LA 2M29A 2PSRA 3WXAA 2FOTA 2I18A 2KQYA 3OB1B 3KHEA 4PHMA 2OS8C 5BPJA 2LMTA 1S5GZ 1W7IB 3F45A 4I5KA 4ZCVA 1K9PA 3O6BA 3D10A 1BG1A 1KCYA 2M0RA 1SL7A 1SL9A 3CR2A 1IH0A 1WRZA 3AAJA 1MQ1A 1NPQA 1EG3A 3SJSA 2ZNEA 2H61A 5CPVA 1MWNA 2BCAA 2G9BA 1K9KA 4GAOA 2HETA 1C07A 1K94A 5CSFA 5AANA 1XO5A 2K0JA 1TRFA 2Y1MA 3IQOA 4CFQA 1QV0A 1TCOB 1FPWA 1QTXA 1S36A 3KPXA 1JSAA 1QJTA 4YGEB 1JC2A 1DGUA 1SR6B 3O78A 3EKHA 2MA2A 4GNKB 1IJ5A 2E30A 2KFHA 4FTGA 2JNFA 4GBAA 2JT3A 2JT8A 4R1EA 3E3RA 1HT9A 2COLB 3SG2A 1BT6A 2LM5A 3VGOA 1NP8A 3PLFB 1J1DA 1KSOA 1D1OA 1MHOA 2KI6D 2BL0B 1DJGA 2M9GA 4MLWA 1OE9B 5D69A 4CLNA 3TUYC 1QLKA 3SIAA 3I5FB 1F8HA 3HX4A 2HQ8A 2K8MB 3I5GC 2KBIA 1UHNA 2DOQA 1QX2A 2LV7A 1CM1A 1NSHA 2EHBA 2M49B 2K7CA 1YVLA 1S3PA 1JBAA 3HCMA 1NCZA 4YRUA 1RECA 2NXQA 2LAPA 1SCMB 1PVAA 3I5HB 1PSBA 4DRWA 1W7JB 4BY5A 1L7ZA 2M1KB 2NLNA 1UUSA 2K7DA 3VRQA 1ODBA 5KSZA 1NCXA 3ICBA 1KQMB 2CTNA 2H2KA 3PN7C 3AKBA 3C1VA 1AK8A 4MZLA 2LHIA 3PALA 2BBNA 1M31A 1BODA 1XFWO 1MUXA 1JFKA 2MAZA 2ZN8A 1A03A 1OMVA 1N0YA 4USLA 3IQQA 3TZ1A 2ZN9A 2M7LA 4YI8A 1NYAA 1FI5A 1B8LA 1ZMZA 1G8IA 3LLEA 1H8BA 4JWQA 2HQWA 3SG3A 2WNDA 1BU3A 4XJKB 1DMOA 1KFXL 1IJ6A 1F54A 1S6CA 2NCPA 4NDCA 3OX6A 2E6WA 2KHNA 1SMGA 1YRTB 4YGBB 2KAVA 2GGZA 1KK8B 4AQJA 4PCWA 3H4SE 1B8CA 4YGAA 3LL8B 1QV1A 1XFYO 1Q80A 1UHKA 2A4JA 2KYCA 3NSLA 3VROA 5GQQC 3VRPA 3CWGA 2LC5A 3DF0A 1BLQA 3BQ3A 3FS7A 4HRHA 4OV2A 1A4PA 1CDPA 4A4CA 2JWWA 2F33A 3CR5X 3OB2B 4DCKA 1IGVA 1XFXO 3DVMA 1RFJA 2NCOA 1CTRA 1WLMA 1Y1UA 2CBLA 3O4YA 2LMUA 2CNPA 5DKNA 5HYDA 2HF5A 3OP0A 3AKAA 1H4BA 2FJUB 4OKHA 1UURA 2L0PA 5JOLA 2KI6C 2KAYA 1E8AA 3EVUA 1CLLA 1M63B 2LMVA 2PASA 1Y6WA 1YURA 1Y1AA 2BCXA 4C0KA 1CFPA 4PHNA 1BOCA 2Y4QA 1UHIA 1CB1A 3VRNA 1A75A 2AUCA 4YGDB 5CSIA 1AHRA 1TNPA 5ER4X 1CNPA 5FYXA 1DF0A 2FCEA 4N1GA 2BCBA 3JVTB 3TDUA 1PALA 3A8RA 4D1EA 3CS1A 1XK4C 1MXLC 2D8NA 2TN4A 5HKWA 5HKZA 4OCIA 3K21A 4YBHB 3PATA 2I94A 3KF9A 1K90D 1OQPA 2CT9A 2BE4A 4BY4A 4NQGA 5AERA 4IL1A 2BE6A 1AVSA 1QVIY 1M46A 1SBJA 4FQOA 2JU0A 2L4HA 3KEVA 1RWYA 1F4QA 1KWOB 2QACA 1A29A 1SK6D 1XFZO 1XK4A 2MHHA 3I5IC 3TDZA 1CKKA 1TNQA 1OOJA 1C7WA 1NCYA 1B47A 1L2OC 2PALA 2OS8B 1GQMA 4HRGA 3SG4A 4PE7A 4E68A 5KTYA 2EC6C 1U5IA 4MBEA 4PE4A 1X02A 1F4OA 4AOMA 2KGBC 1CMGA 1IWQA 3RLZA 4DS7A 3JTDB 1CFDA 3SG5A 2MJWB 3CTNA 1QX7A 3OHMB 4M2QA 1ZACA 2WCBA 3EKJA 3EVRA 3BUOB 2LHLA 1SCVA 2K7BA 1ALVA 2KOTA 4P2YB 5G08A 1DGVA 1CDNA 5CSNA 4CIDA 2KAXA 4A4BA 2KYFA 2M1UA 3WHUB 1JF2A 5F6TA 1PULA 2PVBA 2GGMA 5I2OA 3EVVA 1QIWA 2L2EA 5HLVA 1FI6A 1QX5B 2GV5A 4P5OE 4JPZB 1CLBA 3TUYB 2LLSA 1SY9A 4MZKA 2KBMA 2Y1NA 5HLOA 2KI4C 2B1UA 3DVKA 2ZNDA 1WLZA 3I5GB 5KU1A 4PE0A 2L51A 1QS7A 1J7RA 1GGWA 1TOPA 1DVIA 1TNWA 1EXRA 1NX1A 2O60A 4AQIA 3M0WA 2PMYA 4CPVA 1EL4A 2NZ0A 1J1EA 2LE9B 4ICBA 2JXLA 1UHHA 2VRGA 2KGRA 2LP2A 1YR5A 5D7FA 1S1EA 3OX5A 4ETOA 4CFRA 2F3ZA 2JC2A 3BUWB 3PN7B 3SIBA 2JZIA 4UPGA 4WQ2A 1PRWA 1NIWA 3VRRA 2KSPA 2IS9A 1V1FA 2MRDA 4WQ3A 4MZJA 2WCFA 2L98A 3LK0A 1AP4A 1JUOA 1FW4A 1S26D 2AAOA 1QVIZ 2QPTA 1JFJA 3TDIA 3D0YA 1Y1XA 3RM1A 3BXKA 5AXIA 1OSAA 2OTGC 1BR4B 1SL8A 1GGZA 4Q04A 3IF7A 1F70A 1KFUL 2JULA 3GOFA 1TCFA 3NSOA 3MSEB 3LK1A 1M39A 3DF0B 3EK8A 3DVEA 2MLFC 4F0ZB 1KFXS 3FIAA 5I2QA 2ZRSA 1B7TZ 2JXCA 1J55A 2JT0A 4PHJA 1AUIB 2LLUA 3CZTX 1B4CA 1K95A 1SYMA 1MXEA 1TTXA 1YVHA 3GK1A 4ORBB 2RGIA 5ER5A 3TS5C 4DUQA 1DJYA 5B8IB 2I7AA 5AFPA 2WORA 1KQVA 1GJYA 4I5LB 1EG4A 2F2OA 2ZFDA 4MN0A 3NSKA 4GGNA 2BBMA 2ZRTA 1YX7A 4GUKA 2JTTA 1A75B 1QXPA 2KDHA 1TN4A 5JJGA 4MEWA 1AJ4A 2LLTA 1DTLA 1DF0B 1YX8A 1TNXA 5PALA 1B1GA 1WDCC 2K61A 1M45A 2LVJA 4I5NB 3BOWA 4MRYA 3BUMB 1YUSA 3CR4X 4GGFC 1K93D 2KQ6A 4M2OA 4PALA 2R2IA 1RJVA 2L4IA 1XYDA 1KSMA 1NWDA 1NX3A 1RTP1 1A2XA 5DKRA 2ISDA 1OZSA 1BJFA 2WOSA 1WRKA 4QJ5B 1F71A 2HPSA 1PK0D 1FBVA 2SASA 4JQ0D 1JWDA 2BKHB 3O2PA 2LVKA 3NXAA 3SG7A 4GGFA 3BUNB 1OMRA 2LNKA 2JRFA 2SCPA 1UWOA 1B7TY 1SR6C 2M97A 2F8PA 1U5IB 3BYAA 1SPYA 1WRLA 4MVFA 1YTZC 5K89A 1KK7Y 2JTZA 1CLMA 3I5IB 4C0JA 3JTDC 1NX0A 2LP3A 1ZUZA 1J7PA 1L2OB 1N65A 5DKQA 1CFCA 1CDLA 2V53A 4WRIA 2BL0C 2EC6B 4MRXA 3GK4X 4DIRA 5I2LA 3LCPC 4QJ3B 3ZNIA 2LANA 2WC8A 3I5FC 1SW8A 3KO0A 1VRKA 1K96A 2KFGA 3AAKA 2M7NA 2WCEA 2JPTA 1G4YR 2KNEA 4QJ4B 2LVIA 1QLSA 4OR9B 2BKIB 1SCMC 1IKUA 3I5HC 1NX2A 2ZKMX 2F2PA 2KFFA 3DVJA 5AEQA 3SG6A 1MF8B 2Q4UA 1LVCD 1DJWA 4N1FA 1ALWA 1KQMC 1DJHA 1TIZA 1RROA 2MLEC 2AMIA 1IQ5A 4HREE 2P6BB 1YRUB 1K9UA 4XYNA 3FWBA 1G33A 1MR8A 2MBXA 5TNCA 1SNLA 1LXFC 1S5GY 1LINA 2OPOA 3NSIA 2KI4B 2JNXA 1CDMA 1S6IA 3PM8A 1F55A 1CFFA 2LUXA 5IBWA 4YI9A 1RK9A 1R6PA 1J7OA 1DJIA 2M3WA 4MSPA 2M8UA 4ORCB 4M2PA 1XA5A 4PHKA 1J7QA 1LA0A 1KK8C 2LUCA 1OMDA 1AJ5A 1QIVA 2BECA 1IRJA 1OZOA 4GFTA 3D0YB 1LKJA 4XJKA 2JQ6A 1FF1A 1QATA 3BUXB 5CSJA 1S6JA 2JOJA 1EJ3A 2K7OA 4NDDA 1BMOA 2LVVA 3ZWHA 2EGDA 4TNCA 2LCPA 3EK7A 1CMFA 4PE1A 1KK7Z 4HSZA 2OTGB 5J3XA 4N5XA 1YUTA 1PVBA 1NUBA 1PSRA 1DJXA 2F3YA 2Y5IA 1CM4A 1K2HA 1N2DA 5I8NA 1KFUS 1XFUO 4YGCB 1UHJA 1IG5A 1WY9A 1DJZA 3PSRA 1ZOTB 1DT7B 1LA3A 4OVNF 5HKYA 2Q91A 1BF5A 4ORAB 2I2RE 3DD4A 4U8DA 1C7VA 1SKTA 1K8UA 1ZFSA 2K2AA 3WNXB
chains in the Genus database with same CATH superfamily
3TS5B 3WHTB 2L5XB 3GK2A 4NDBA 1EH2A 2WC5A 3CGAA 1IQ3A 2K2FA 1B9AA 1UP5A 3JVTC 4JKTA 3NHIA 1XVJA 1HQVA 2O5GA 2FCDA 3FWCA 3QRXA 3EK4A 3SS4A 1QASA 1XFVO 3BOWB 4I5JA 1YUUA 1Y0VH 2G2BA 2L50A 4ZCUA 1B8RA 3D73A 1SRAA 1V1GA 1BR1B 4PDZA 1R2UA 2CCMA 2PRUA 3A4UB 3BFAA 2L5YA 3CLNA 1JF0A 1KWOC 2H61C 3PFVA 4L9MA 3D76A 1WDCB 4GPLB 2CXJA 4C0LA 2M29A 2PSRA 3WXAA 2FOTA 2I18A 2KQYA 3OB1B 3KHEA 4PHMA 2OS8C 5BPJA 2LMTA 1S5GZ 1W7IB 3F45A 4I5KA 4ZCVA 1K9PA 3O6BA 3D10A 1BG1A 1KCYA 2M0RA 1SL7A 1SL9A 3CR2A 5I94A 1IH0A 1WRZA 3AAJA 1MQ1A 1NPQA 1EG3A 3Q8IA 2ZNEA 2H61A 1P28A 1MWNA 5CPVA 2BCAA 3SJSA 2G9BA 1K9KA 4GAOA 2HETA 3B86A 1C07A 1K94A 5CSFA 5AANA 1XO5A 1TWOA 2K0JA 1TRFA 2Y1MA 3IQOA 4CFQA 1QV0A 1TCOB 3BFBA 1FPWA 1QTXA 1S36A 3KPXA 1JSAA 1QJTA 4YGEB 1JC2A 1DGUA 1SR6B 3O78A 3EKHA 2MA2A 4GNKB 1IJ5A 3R1PA 2E30A 2KFHA 1TUJA 2JNFA 4FTGA 4GBAA 2JT3A 2JT8A 4R1EA 3E3RA 1HT9A 2COLB 2BNXA 1BT6A 2LM5A 3SG2A 3VGOA 1NP8A 3PLFB 3CDNA 1J1DA 1KSOA 1D1OA 1MHOA 2KI6D 2BL0B 1DJGA 2M9GA 4MLWA 1OE9B 5D69A 4CLNA 3TUYC 1QLKA 2WC6A 3SIAA 3S0AA 3I5FB 1F8HA 3HX4A 2HQ8A 2K8MB 3I5GC 2ERBA 1UHNA 2DOQA 2KBIA 1QX2A 2LV7A 1CM1A 1NSHA 2EHBA 2M49B 2K7CA 1YVLA 1S3PA 4PALA 1JBAA 3B88A 3HCMA 1NCZA 4FQTA 4YRUA 1RECA 2NXQA 2LAPA 1SCMB 1PVAA 3I5HB 1PSBA 4DRWA 1W7JB 4BY5A 1L7ZA 2M1KB 2NLNA 1UUSA 2K7DA 3VRQA 1ODBA 5KSZA 1NCXA 3ICBA 1KQMB 2CTNA 2H2KA 1OOGA 3PN7C 3S0BA 3AKBA 3B6XA 2KLDA 3C1VA 4IJ7A 1AK8A 4MZLA 2LHIA 3PALA 2BBNA 1M31A 2KLEA 1BODA 1XFWO 1MUXA 1JFKA 2MAZA 2ZN8A 1A03A 1OMVA 3NHTA 1N0YA 4USLA 3IQQA 3TZ1A 2ZN9A 2M7LA 4YI8A 1NYAA 3FE8A 1FI5A 1B8LA 1ZMZA 3B7AA 1G8IA 3LLEA 1H8BA 4JWQA 1OOHA 2HQWA 2QEOA 2WNDA 3SG3A 1BU3A 4XJKB 1DMOA 1KFXL 1IJ6A 1F54A 1S6CA 2NCPA 4NDCA 3OX6A 2E6WA 3S0EA 2KHNA 1SMGA 1YRTB 4YGBB 2KAVA 1QWVA 2GGZA 1KK8B 3QMEA 4AQJA 4PCWA 3H4SE 1B8CA 2JPOA 4YGAA 2QEVA 3LL8B 1QV1A 1XFYO 1Q80A 1UHKA 2A4JA 2KYCA 3NSLA 3VROA 1SSEB 5GQQC 3VRPA 3CWGA 2LC5A 3DF0A 3OGNA 3BQ3A 3FS7A 4HRHA 3VB1A 4OV2A 1BLQA 1A4PA 1CDPA 4A4CA 2JWWA 2F33A 3CR5X 3OB2B 4DCKA 1IGVA 1XFXO 4INWA 3DVMA 1RFJA 3R1VA 2NCOA 1DC1A 1CTRA 3L4LA 1WLMA 1Y1UA 2CBLA 3O4YA 2LMUA 2CNPA 5DKNA 5HYDA 2HF5A 1GM0A 3FE9A 3OP0A 3AKAA 1H4BA 3S0DA 2FJUB 4OKHA 1UURA 2L0PA 5JOLA 2KI6C 2KAYA 1E8AA 3UNWA 3EVUA 1CLLA 1M63B 2LMVA 2L2CA 2PASA 1DEKA 1Y6WA 1YURA 5FI7A 1Y1AA 2BCXA 4C0KA 1CFPA 4PHNA 1BOCA 2Y4QA 1UHIA 1CB1A 3VRNA 1A75A 2AUCA 4YGDB 5CSIA 5D3OA 2PQLA 1AHRA 1TNPA 3EG5B 5ER4X 5FI6A 1CNPA 5FYXA 1DF0A 2FCEA 4N1GA 2BCBA 3CABA 1DQEA 3JVTB 1PALA 3TDUA 3A8RA 4D1EA 3CS1A 1XK4C 1MXLC 3D75A 2D8NA 2TN4A 5HKWA 5HKZA 4OCIA 3K21A 4YBHB 3PATA 2I94A 3KF9A 1K90D 1OQPA 2CT9A 2BE4A 4BY4A 4NQGA 3D78A 4IL1A 2BE6A 5AERA 1AVSA 1QVIY 1M46A 1SBJA 1T14A 4FQOA 2JU0A 2L4HA 3KEVA 1RWYA 1F4QA 1KWOB 2QACA 1A29A 1SK6D 1XFZO 1XK4A 2MHHA 3I5IC 3TDZA 3S0FA 1CKKA 1TNQA 1OOJA 1C7WA 1NCYA 1B47A 1L2OC 2PALA 2OS8B 1GQMA 4HRGA 3SG4A 4PE7A 4E68A 5KTYA 2EC6C 2QEBA 1U5IA 4MBEA 4PE4A 1X02A 1F4OA 4AOMA 5HL1A 2KGBC 1CMGA 1IWQA 3RLZA 4DS7A 3JTDB 1CFDA 2H8VA 3SG5A 2MJWB 3CTNA 1QX7A 3OHMB 4M2QA 1ZACA 2WCBA 3EKJA 3EVRA 3BUOB 3DY9A 2LHLA 3RZSA 3BJHA 1SCVA 2K7BA 1ALVA 2KOTA 3L4AA 4P2YB 5G08A 1DGVA 1DELA 2WCMA 1CDNA 5CSNA 4CIDA 2KAXA 3O4XA 4A4BA 2KYFA 2M1UA 3WHUB 1JF2A 5F6TA 1PULA 2PVBA 2GGMA 5I2OA 3EVVA 1QIWA 2L2EA 5HLVA 1FI6A 1QX5B 2GV5A 4P5OE 4JPZB 1CLBA 3SS3A 3TUYB 2LLSA 3D74A 1SY9A 4MZKA 2KBMA 2Y1NA 5HLOA 5FI2A 2KI4C 2B1UA 3DVKA 2ZNDA 1WLZA 3I5GB 5KU1A 4PE0A 2L51A 1QS7A 1J7RA 1GGWA 1TOPA 3CZ2A 1DVIA 1TNWA 1EXRA 1NX1A 2O60A 4AQIA 3NGVA 3R1OA 1LS8A 3M0WA 1TUZA 2PMYA 4CPVA 1EL4A 2NZ0A 1J1EA 2LE9B 4ICBA 2JXLA 1UHHA 2VRGA 2PYQA 2KGRA 2LP2A 1YR5A 5D7FA 1S1EA 3OX5A 4ETOA 4CFRA 2F3ZA 2JC2A 3BUWB 3PN7B 3S0GA 2JZIA 3SIBA 4WQ2A 1PRWA 4UPGA 1NIWA 3IVTA 3VRRA 2KSPA 2IS9A 1XFRA 1V1FA 2MRDA 4WQ3A 4MZJA 1C3YA 2WCFA 1ORGA 2L98A 3LK0A 1AP4A 1JUOA 1FW4A 1S26D 2AAOA 1QVIZ 2QPTA 1JFJA 3TDIA 3D0YA 1Y1XA 3RM1A 3R72A 3BXKA 5AXIA 1OSAA 2OTGC 1BR4B 1SL8A 1GGZA 4Q04A 3IF7A 1F70A 1KFUL 2JULA 3GOFA 1TCFA 3DZTA 3NSOA 3MSEB 5DICA 2WCLA 3K1EA 3LK1A 1M39A 3DF0B 3EK8A 2FJYA 2MLFC 3DVEA 1KFXS 3FIAA 4F0ZB 5I2QA 2ZRSA 1B7TZ 3N7HA 2JXCA 1J55A 2JT0A 4PHJA 1AUIB 2LLUA 3CZTX 1B4CA 1K95A 1SYMA 1MXEA 1TTXA 1YVHA 1OOFA 3GK1A 2RGIA 4ORBB 5ER5A 3TS5C 4DUQA 1DJYA 5B8IB 2I7AA 5AFPA 2WORA 1KQVA 4KYNA 1GJYA 4I5LB 2K60A 1EG4A 2F2OA 2ZFDA 3OBVA 4MN0A 2BAPA 3NSKA 4GGNA 2BBMA 2ZRTA 1YX7A 4GUKA 2JTTA 1A75B 1QXPA 2KDHA 1TN4A 5JJGA 4MEWA 1AJ4A 2LLTA 1DTLA 1DF0B 1YX8A 1TNXA 5PALA 1B1GA 1WDCC 2K61A 1M45A 2LVJA 4I5NB 3BOWA 4MRYA 1OW4A 3BUMB 4JD9A 1YUSA 3CR4X 4GGFC 1K93D 2KQ6A 2P70A 1Z2CB 2R2IA 1RJVA 2L4IA 4M2OA 1XYDA 1KSMA 1NWDA 1NX3A 1RTP1 1A2XA 5DKRA 3CZ1A 2ISDA 1OZSA 1BJFA 1Z4HA 2WOSA 1WRKA 4QJ5B 1F71A 2HPSA 1PK0D 1FBVA 2SASA 4JQ0D 1JWDA 2BKHB 3O2PA 2LVKA 3NXAA 3SG7A 4GGFA 3DXLA 3BUNB 1OMRA 2LNKA 2JRFA 3PM2A 2SCPA 1UWOA 3CYZA 1B7TY 1SR6C 2M97A 2F8PA 1U5IB 3BYAA 1SPYA 1WRLA 4MVFA 3B87A 1YTZC 2WCJA 5K89A 1KK7Y 2JTZA 1CLMA 1IIOA 3I5IB 4C0JA 3D77A 3JTDC 1NX0A 2LP3A 1ZUZA 1J7PA 2YGUA 1L2OB 1N65A 5DKQA 1CFCA 1CDLA 2V53A 4WRIA 2BL0C 2EC6B 4MRXA 3GK4X 4DIRA 5I2LA 3LCPC 4QJ3B 3ZNIA 2LANA 2WC8A 3I5FC 1SW8A 3KO0A 1VRKA 1K96A 2KFGA 3AAKA 2M7NA 2WCEA 2JPTA 1G4YR 2KNEA 4QJ4B 2LVIA 3L47A 1QLSA 1W9ZA 4OR9B 3DYEA 2BKIB 3SS5A 1SCMC 1IKUA 3I5HC 1NX2A 2ZKMX 2F2PA 2KFFA 3DVJA 5AEQA 3SG6A 1MF8B 2Q4UA 1LVCD 1DJWA 4N1FA 1ALWA 1KQMC 3PJIA 1DJHA 2WCHA 1TIZA 1RROA 2MLEC 5EL2A 2AMIA 1IQ5A 4HREE 2P6BB 1YRUB 1K9UA 4XYNA 3FWBA 1G33A 1MR8A 2MBXA 2GTEA 5TNCA 1SNLA 1LXFC 1S5GY 1LINA 2OPOA 3FE6A 3NSIA 2KI4B 2JNXA 1CDMA 1S6IA 3PM8A 1F55A 1CFFA 4INXA 4F7FA 2LUXA 5IBWA 3CZ0A 4YI9A 1RK9A 1R6PA 1J7OA 3V2LA 1DJIA 2M3WA 4MSPA 2M8UA 4ORCB 4M2PA 1XA5A 4PHKA 1J7QA 1LA0A 1KK8C 2LUCA 1OMDA 1AJ5A 1QIVA 2WCKA 2BECA 1IRJA 1OZOA 4GFTA 3D0YB 1LKJA 4XJKA 2JQ6A 1FF1A 1QATA 3BUXB 5CSJA 1S6JA 2JOJA 2P71A 1EJ3A 2K7OA 4NDDA 1BMOA 2LVVA 4PT1A 3ZWHA 2EGDA 4TNCA 2LCPA 3EK7A 1CMFA 3UO9A 4PE1A 2KPHA 2QEHA 1KK7Z 4HSZA 2OTGB 5J3XA 3BFHA 4N5XA 1YUTA 1PVBA 1NUBA 1PSRA 1DJXA 2F3YA 2Y5IA 1CM4A 2QDIA 1K2HA 1N2DA 5I8NA 1KFUS 1XFUO 4YGCB 1UHJA 1IG5A 1WY9A 1DJZA 3PSRA 1ZOTB 4OZDA 1DT7B 1LA3A 4OVNF 5HKYA 1C3ZA 2Q91A 1BF5A 4ORAB 1OOIX 2I2RE 3DD4A 4U8DA 1SKTA 1K8UA 1C7VA 1ZFSA 2K2AA 3WNXB
chains in the Genus database with same CATH topology
3TS5B 3WHTB 2L5XB 3GK2A 4NDBA 1EH2A 3CGAA 1IQ3A 2K2FA 1B9AA 1UP5A 3JVTC 1XVJA 1HQVA 2O5GA 2FCDA 3FWCA 3QRXA 3EK4A 1QASA 1XFVO 3BOWB 4I5JA 1YUUA 1Y0VH 2G2BA 2L50A 4ZCUA 1B8RA 1SRAA 1V1GA 1BR1B 4PDZA 1R2UA 2CCMA 2PRUA 3A4UB 3CLNA 1JF0A 1KWOC 2H61C 3PFVA 4L9MA 1WDCB 4GPLB 2CXJA 4C0LA 2M29A 2PSRA 3WXAA 2FOTA 2I18A 2KQYA 3OB1B 3KHEA 4PHMA 2OS8C 5BPJA 2LMTA 1S5GZ 1W7IB 3F45A 4I5KA 4ZCVA 1K9PA 3O6BA 3D10A 1BG1A 1KCYA 2M0RA 1SL7A 1SL9A 3CR2A 1IH0A 1WRZA 3AAJA 1MQ1A 1NPQA 1EG3A 3SJSA 2ZNEA 2H61A 5CPVA 1MWNA 2BCAA 2G9BA 1K9KA 4GAOA 2HETA 1C07A 1K94A 5CSFA 5AANA 1XO5A 2K0JA 1TRFA 2Y1MA 3IQOA 4CFQA 1QV0A 1TCOB 1FPWA 1QTXA 1S36A 3KPXA 1JSAA 1QJTA 4YGEB 1JC2A 1DGUA 1SR6B 3O78A 3EKHA 2MA2A 4GNKB 1IJ5A 2E30A 2KFHA 4FTGA 2JNFA 4GBAA 2JT3A 2JT8A 4R1EA 3E3RA 1HT9A 2COLB 3SG2A 1BT6A 2LM5A 3VGOA 1NP8A 3PLFB 1J1DA 1KSOA 1D1OA 1MHOA 2KI6D 2BL0B 1DJGA 2M9GA 4MLWA 1OE9B 5D69A 4CLNA 3TUYC 1QLKA 3SIAA 3I5FB 1F8HA 3HX4A 2HQ8A 2K8MB 3I5GC 2KBIA 1UHNA 2DOQA 1QX2A 2LV7A 1CM1A 1NSHA 2EHBA 2M49B 2K7CA 1YVLA 1S3PA 1JBAA 3HCMA 1NCZA 4YRUA 1RECA 2NXQA 2LAPA 1SCMB 1PVAA 3I5HB 1PSBA 4DRWA 1W7JB 4BY5A 1L7ZA 2M1KB 2NLNA 1UUSA 2K7DA 3VRQA 1ODBA 5KSZA 1NCXA 3ICBA 1KQMB 2CTNA 2H2KA 3PN7C 3AKBA 3C1VA 1AK8A 4MZLA 2LHIA 3PALA 2BBNA 1M31A 1BODA 1XFWO 1MUXA 1JFKA 2MAZA 2ZN8A 1A03A 1OMVA 1N0YA 4USLA 3IQQA 3TZ1A 2ZN9A 2M7LA 4YI8A 1NYAA 1FI5A 1B8LA 1ZMZA 1G8IA 3LLEA 1H8BA 4JWQA 2HQWA 3SG3A 2WNDA 1BU3A 4XJKB 1DMOA 1KFXL 1IJ6A 1F54A 1S6CA 2NCPA 4NDCA 3OX6A 2E6WA 2KHNA 1SMGA 1YRTB 4YGBB 2KAVA 2GGZA 1KK8B 4AQJA 4PCWA 3H4SE 1B8CA 4YGAA 3LL8B 1QV1A 1XFYO 1Q80A 1UHKA 2A4JA 2KYCA 3NSLA 3VROA 5GQQC 3VRPA 3CWGA 2LC5A 3DF0A 1BLQA 3BQ3A 3FS7A 4HRHA 4OV2A 1A4PA 1CDPA 4A4CA 2JWWA 2F33A 3CR5X 3OB2B 4DCKA 1IGVA 1XFXO 3DVMA 1RFJA 2NCOA 1CTRA 1WLMA 1Y1UA 2CBLA 3O4YA 2LMUA 2CNPA 5DKNA 5HYDA 2HF5A 3OP0A 3AKAA 1H4BA 2FJUB 4OKHA 1UURA 2L0PA 5JOLA 2KI6C 2KAYA 1E8AA 3EVUA 1CLLA 1M63B 2LMVA 2PASA 1Y6WA 1YURA 1Y1AA 2BCXA 4C0KA 1CFPA 4PHNA 1BOCA 2Y4QA 1UHIA 1CB1A 3VRNA 1A75A 2AUCA 4YGDB 5CSIA 1AHRA 1TNPA 5ER4X 1CNPA 5FYXA 1DF0A 2FCEA 4N1GA 2BCBA 3JVTB 3TDUA 1PALA 3A8RA 4D1EA 3CS1A 1XK4C 1MXLC 2D8NA 2TN4A 5HKWA 5HKZA 4OCIA 3K21A 4YBHB 3PATA 2I94A 3KF9A 1K90D 1OQPA 2CT9A 2BE4A 4BY4A 4NQGA 5AERA 4IL1A 2BE6A 1AVSA 1QVIY 1M46A 1SBJA 4FQOA 2JU0A 2L4HA 3KEVA 1RWYA 1F4QA 1KWOB 2QACA 1A29A 1SK6D 1XFZO 1XK4A 2MHHA 3I5IC 3TDZA 1CKKA 1TNQA 1OOJA 1C7WA 1NCYA 1B47A 1L2OC 2PALA 2OS8B 1GQMA 4HRGA 3SG4A 4PE7A 4E68A 5KTYA 2EC6C 1U5IA 4MBEA 4PE4A 1X02A 1F4OA 4AOMA 2KGBC 1CMGA 1IWQA 3RLZA 4DS7A 3JTDB 1CFDA 3SG5A 2MJWB 3CTNA 1QX7A 3OHMB 4M2QA 1ZACA 2WCBA 3EKJA 3EVRA 3BUOB 2LHLA 1SCVA 2K7BA 1ALVA 2KOTA 4P2YB 5G08A 1DGVA 1CDNA 5CSNA 4CIDA 2KAXA 4A4BA 2KYFA 2M1UA 3WHUB 1JF2A 5F6TA 1PULA 2PVBA 2GGMA 5I2OA 3EVVA 1QIWA 2L2EA 5HLVA 1FI6A 1QX5B 2GV5A 4P5OE 4JPZB 1CLBA 3TUYB 2LLSA 1SY9A 4MZKA 2KBMA 2Y1NA 5HLOA 2KI4C 2B1UA 3DVKA 2ZNDA 1WLZA 3I5GB 5KU1A 4PE0A 2L51A 1QS7A 1J7RA 1GGWA 1TOPA 1DVIA 1TNWA 1EXRA 1NX1A 2O60A 4AQIA 3M0WA 2PMYA 4CPVA 1EL4A 2NZ0A 1J1EA 2LE9B 4ICBA 2JXLA 1UHHA 2VRGA 2KGRA 2LP2A 1YR5A 5D7FA 1S1EA 3OX5A 4ETOA 4CFRA 2F3ZA 2JC2A 3BUWB 3PN7B 3SIBA 2JZIA 4UPGA 4WQ2A 1PRWA 1NIWA 3VRRA 2KSPA 2IS9A 1V1FA 2MRDA 4WQ3A 4MZJA 2WCFA 2L98A 3LK0A 1AP4A 1JUOA 1FW4A 1S26D 2AAOA 1QVIZ 2QPTA 1JFJA 3TDIA 3D0YA 1Y1XA 3RM1A 3BXKA 5AXIA 1OSAA 2OTGC 1BR4B 1SL8A 1GGZA 4Q04A 3IF7A 1F70A 1KFUL 2JULA 3GOFA 1TCFA 3NSOA 3MSEB 3LK1A 1M39A 3DF0B 3EK8A 3DVEA 2MLFC 4F0ZB 1KFXS 3FIAA 5I2QA 2ZRSA 1B7TZ 2JXCA 1J55A 2JT0A 4PHJA 1AUIB 2LLUA 3CZTX 1B4CA 1K95A 1SYMA 1MXEA 1TTXA 1YVHA 3GK1A 4ORBB 2RGIA 5ER5A 3TS5C 4DUQA 1DJYA 5B8IB 2I7AA 5AFPA 2WORA 1KQVA 1GJYA 4I5LB 1EG4A 2F2OA 2ZFDA 4MN0A 3NSKA 4GGNA 2BBMA 2ZRTA 1YX7A 4GUKA 2JTTA 1A75B 1QXPA 2KDHA 1TN4A 5JJGA 4MEWA 1AJ4A 2LLTA 1DTLA 1DF0B 1YX8A 1TNXA 5PALA 1B1GA 1WDCC 2K61A 1M45A 2LVJA 4I5NB 3BOWA 4MRYA 3BUMB 1YUSA 3CR4X 4GGFC 1K93D 2KQ6A 4M2OA 4PALA 2R2IA 1RJVA 2L4IA 1XYDA 1KSMA 1NWDA 1NX3A 1RTP1 1A2XA 5DKRA 2ISDA 1OZSA 1BJFA 2WOSA 1WRKA 4QJ5B 1F71A 2HPSA 1PK0D 1FBVA 2SASA 4JQ0D 1JWDA 2BKHB 3O2PA 2LVKA 3NXAA 3SG7A 4GGFA 3BUNB 1OMRA 2LNKA 2JRFA 2SCPA 1UWOA 1B7TY 1SR6C 2M97A 2F8PA 1U5IB 3BYAA 1SPYA 1WRLA 4MVFA 1YTZC 5K89A 1KK7Y 2JTZA 1CLMA 3I5IB 4C0JA 3JTDC 1NX0A 2LP3A 1ZUZA 1J7PA 1L2OB 1N65A 5DKQA 1CFCA 1CDLA 2V53A 4WRIA 2BL0C 2EC6B 4MRXA 3GK4X 4DIRA 5I2LA 3LCPC 4QJ3B 3ZNIA 2LANA 2WC8A 3I5FC 1SW8A 3KO0A 1VRKA 1K96A 2KFGA 3AAKA 2M7NA 2WCEA 2JPTA 1G4YR 2KNEA 4QJ4B 2LVIA 1QLSA 4OR9B 2BKIB 1SCMC 1IKUA 3I5HC 1NX2A 2ZKMX 2F2PA 2KFFA 3DVJA 5AEQA 3SG6A 1MF8B 2Q4UA 1LVCD 1DJWA 4N1FA 1ALWA 1KQMC 1DJHA 1TIZA 1RROA 2MLEC 2AMIA 1IQ5A 4HREE 2P6BB 1YRUB 1K9UA 4XYNA 3FWBA 1G33A 1MR8A 2MBXA 5TNCA 1SNLA 1LXFC 1S5GY 1LINA 2OPOA 3NSIA 2KI4B 2JNXA 1CDMA 1S6IA 3PM8A 1F55A 1CFFA 2LUXA 5IBWA 4YI9A 1RK9A 1R6PA 1J7OA 1DJIA 2M3WA 4MSPA 2M8UA 4ORCB 4M2PA 1XA5A 4PHKA 1J7QA 1LA0A 1KK8C 2LUCA 1OMDA 1AJ5A 1QIVA 2BECA 1IRJA 1OZOA 4GFTA 3D0YB 1LKJA 4XJKA 2JQ6A 1FF1A 1QATA 3BUXB 5CSJA 1S6JA 2JOJA 1EJ3A 2K7OA 4NDDA 1BMOA 2LVVA 3ZWHA 2EGDA 4TNCA 2LCPA 3EK7A 1CMFA 4PE1A 1KK7Z 4HSZA 2OTGB 5J3XA 4N5XA 1YUTA 1PVBA 1NUBA 1PSRA 1DJXA 2F3YA 2Y5IA 1CM4A 1K2HA 1N2DA 5I8NA 1KFUS 1XFUO 4YGCB 1UHJA 1IG5A 1WY9A 1DJZA 3PSRA 1ZOTB 1DT7B 1LA3A 4OVNF 5HKYA 2Q91A 1BF5A 4ORAB 2I2RE 3DD4A 4U8DA 1C7VA 1SKTA 1K8UA 1ZFSA 2K2AA 3WNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TS5 B;  3WHT B;  2L5X B;  3GK2 A;  4NDB A;  1EH2 A;  3CGA A;  1IQ3 A;  2K2F A;  1B9A A;  1UP5 A;  3JVT C;  1XVJ A;  1HQV A;  2O5G A;  2FCD A;  3FWC A;  3QRX A;  3EK4 A;  1QAS A;  1XFV O;  3BOW B;  4I5J A;  1YUU A;  1Y0V H;  2G2B A;  2L50 A;  4ZCU A;  1B8R A;  1SRA A;  1V1G A;  1BR1 B;  4PDZ A;  1R2U A;  2CCM A;  2PRU A;  3A4U B;  3CLN A;  1JF0 A;  1KWO C;  2H61 C;  3PFV A;  4L9M A;  1WDC B;  4GPL B;  2CXJ A;  4C0L A;  2M29 A;  2PSR A;  3WXA A;  2FOT A;  2I18 A;  2KQY A;  3OB1 B;  3KHE A;  4PHM A;  2OS8 C;  5BPJ A;  2LMT A;  1S5G Z;  1W7I B;  3F45 A;  4I5K A;  4ZCV A;  1K9P A;  3O6B A;  3D10 A;  1BG1 A;  1KCY A;  2M0R A;  1SL7 A;  1SL9 A;  3CR2 A;  1IH0 A;  1WRZ A;  3AAJ A;  1MQ1 A;  1NPQ A;  1EG3 A;  3SJS A;  2ZNE A;  2H61 A;  5CPV A;  1MWN A;  2BCA A;  2G9B A;  1K9K A;  4GAO A;  2HET A;  1C07 A;  1K94 A;  5CSF A;  5AAN A;  1XO5 A;  2K0J A;  1TRF A;  2Y1M A;  3IQO A;  4CFQ A;  1QV0 A;  1TCO B;  1FPW A;  1QTX A;  1S36 A;  3KPX A;  1JSA A;  1QJT A;  4YGE B;  1JC2 A;  1DGU A;  1SR6 B;  3O78 A;  3EKH A;  2MA2 A;  4GNK B;  1IJ5 A;  2E30 A;  2KFH A;  4FTG A;  2JNF A;  4GBA A;  2JT3 A;  2JT8 A;  4R1E A;  3E3R A;  1HT9 A;  2COL B;  3SG2 A;  1BT6 A;  2LM5 A;  3VGO A;  1NP8 A;  3PLF B;  1J1D A;  1KSO A;  1D1O A;  1MHO A;  2KI6 D;  2BL0 B;  1DJG A;  2M9G A;  4MLW A;  1OE9 B;  5D69 A;  4CLN A;  3TUY C;  1QLK A;  3SIA A;  3I5F B;  1F8H A;  3HX4 A;  2HQ8 A;  2K8M B;  3I5G C;  2KBI A;  1UHN A;  2DOQ A;  1QX2 A;  2LV7 A;  1CM1 A;  1NSH A;  2EHB A;  2M49 B;  2K7C A;  1YVL A;  1S3P A;  1JBA A;  3HCM A;  1NCZ A;  4YRU A;  1REC A;  2NXQ A;  2LAP A;  1SCM B;  1PVA A;  3I5H B;  1PSB A;  4DRW A;  1W7J B;  4BY5 A;  1L7Z A;  2M1K B;  2NLN A;  1UUS A;  2K7D A;  3VRQ A;  1ODB A;  5KSZ A;  1NCX A;  3ICB A;  1KQM B;  2CTN A;  2H2K A;  3PN7 C;  3AKB A;  3C1V A;  1AK8 A;  4MZL A;  2LHI A;  3PAL A;  2BBN A;  1M31 A;  1BOD A;  1XFW O;  1MUX A;  1JFK A;  2MAZ A;  2ZN8 A;  1A03 A;  1OMV A;  1N0Y A;  4USL A;  3IQQ A;  3TZ1 A;  2ZN9 A;  2M7L A;  4YI8 A;  1NYA A;  1FI5 A;  1B8L A;  1ZMZ A;  1G8I A;  3LLE A;  1H8B A;  4JWQ A;  2HQW A;  3SG3 A;  2WND A;  1BU3 A;  4XJK B;  1DMO A;  1KFX L;  1IJ6 A;  1F54 A;  1S6C A;  2NCP A;  4NDC A;  3OX6 A;  2E6W A;  2KHN A;  1SMG A;  1YRT B;  4YGB B;  2KAV A;  2GGZ A;  1KK8 B;  4AQJ A;  4PCW A;  3H4S E;  1B8C A;  4YGA A;  3LL8 B;  1QV1 A;  1XFY O;  1Q80 A;  1UHK A;  2A4J A;  2KYC A;  3NSL A;  3VRO A;  5GQQ C;  3VRP A;  3CWG A;  2LC5 A;  3DF0 A;  1BLQ A;  3BQ3 A;  3FS7 A;  4HRH A;  4OV2 A;  1A4P A;  1CDP A;  4A4C A;  2JWW A;  2F33 A;  3CR5 X;  3OB2 B;  4DCK A;  1IGV A;  1XFX O;  3DVM A;  1RFJ A;  2NCO A;  1CTR A;  1WLM A;  1Y1U A;  2CBL A;  3O4Y A;  2LMU A;  2CNP A;  5DKN A;  5HYD A;  2HF5 A;  3OP0 A;  3AKA A;  1H4B A;  2FJU B;  4OKH A;  1UUR A;  2L0P A;  5JOL A;  2KI6 C;  2KAY A;  1E8A A;  3EVU A;  1CLL A;  1M63 B;  2LMV A;  2PAS A;  1Y6W A;  1YUR A;  1Y1A A;  2BCX A;  4C0K A;  1CFP A;  4PHN A;  1BOC A;  2Y4Q A;  1UHI A;  1CB1 A;  3VRN A;  1A75 A;  2AUC A;  4YGD B;  5CSI A;  1AHR A;  1TNP A;  5ER4 X;  1CNP A;  5FYX A;  1DF0 A;  2FCE A;  4N1G A;  2BCB A;  3JVT B;  3TDU A;  1PAL A;  3A8R A;  4D1E A;  3CS1 A;  1XK4 C;  1MXL C;  2D8N A;  2TN4 A;  5HKW A;  5HKZ A;  4OCI A;  3K21 A;  4YBH B;  3PAT A;  2I94 A;  3KF9 A;  1K90 D;  1OQP A;  2CT9 A;  2BE4 A;  4BY4 A;  4NQG A;  5AER A;  4IL1 A;  2BE6 A;  1AVS A;  1QVI Y;  1M46 A;  1SBJ A;  4FQO A;  2JU0 A;  2L4H A;  3KEV A;  1RWY A;  1F4Q A;  1KWO B;  2QAC A;  1A29 A;  1SK6 D;  1XFZ O;  1XK4 A;  2MHH A;  3I5I C;  3TDZ A;  1CKK A;  1TNQ A;  1OOJ A;  1C7W A;  1NCY A;  1B47 A;  1L2O C;  2PAL A;  2OS8 B;  1GQM A;  4HRG A;  3SG4 A;  4PE7 A;  4E68 A;  5KTY A;  2EC6 C;  1U5I A;  4MBE A;  4PE4 A;  1X02 A;  1F4O A;  4AOM A;  2KGB C;  1CMG A;  1IWQ A;  3RLZ A;  4DS7 A;  3JTD B;  1CFD A;  3SG5 A;  2MJW B;  3CTN A;  1QX7 A;  3OHM B;  4M2Q A;  1ZAC A;  2WCB A;  3EKJ A;  3EVR A;  3BUO B;  2LHL A;  1SCV A;  2K7B A;  1ALV A;  2KOT A;  4P2Y B;  5G08 A;  1DGV A;  1CDN A;  5CSN A;  4CID A;  2KAX A;  4A4B A;  2KYF A;  2M1U A;  3WHU B;  1JF2 A;  5F6T A;  1PUL A;  2PVB A;  2GGM A;  5I2O A;  3EVV A;  1QIW A;  2L2E A;  5HLV A;  1FI6 A;  1QX5 B;  2GV5 A;  4P5O E;  4JPZ B;  1CLB A;  3TUY B;  2LLS A;  1SY9 A;  4MZK A;  2KBM A;  2Y1N A;  5HLO A;  2KI4 C;  2B1U A;  3DVK A;  2ZND A;  1WLZ A;  3I5G B;  5KU1 A;  4PE0 A;  2L51 A;  1QS7 A;  1J7R A;  1GGW A;  1TOP A;  1DVI A;  1TNW A;  1EXR A;  1NX1 A;  2O60 A;  4AQI A;  3M0W A;  2PMY A;  4CPV A;  1EL4 A;  2NZ0 A;  1J1E A;  2LE9 B;  4ICB A;  2JXL A;  1UHH A;  2VRG A;  2KGR A;  2LP2 A;  1YR5 A;  5D7F A;  1S1E A;  3OX5 A;  4ETO A;  4CFR A;  2F3Z A;  2JC2 A;  3BUW B;  3PN7 B;  3SIB A;  2JZI A;  4UPG A;  4WQ2 A;  1PRW A;  1NIW A;  3VRR A;  2KSP A;  2IS9 A;  1V1F A;  2MRD A;  4WQ3 A;  4MZJ A;  2WCF A;  2L98 A;  3LK0 A;  1AP4 A;  1JUO A;  1FW4 A;  1S26 D;  2AAO A;  1QVI Z;  2QPT A;  1JFJ A;  3TDI A;  3D0Y A;  1Y1X A;  3RM1 A;  3BXK A;  5AXI A;  1OSA A;  2OTG C;  1BR4 B;  1SL8 A;  1GGZ A;  4Q04 A;  3IF7 A;  1F70 A;  1KFU L;  2JUL A;  3GOF A;  1TCF A;  3NSO A;  3MSE B;  3LK1 A;  1M39 A;  3DF0 B;  3EK8 A;  3DVE A;  2MLF C;  4F0Z B;  1KFX S;  3FIA A;  5I2Q A;  2ZRS A;  1B7T Z;  2JXC A;  1J55 A;  2JT0 A;  4PHJ A;  1AUI B;  2LLU A;  3CZT X;  1B4C A;  1K95 A;  1SYM A;  1MXE A;  1TTX A;  1YVH A;  3GK1 A;  4ORB B;  2RGI A;  5ER5 A;  3TS5 C;  4DUQ A;  1DJY A;  5B8I B;  2I7A A;  5AFP A;  2WOR A;  1KQV A;  1GJY A;  4I5L B;  1EG4 A;  2F2O A;  2ZFD A;  4MN0 A;  3NSK A;  4GGN A;  2BBM A;  2ZRT A;  1YX7 A;  4GUK A;  2JTT A;  1A75 B;  1QXP A;  2KDH A;  1TN4 A;  5JJG A;  4MEW A;  1AJ4 A;  2LLT A;  1DTL A;  1DF0 B;  1YX8 A;  1TNX A;  5PAL A;  1B1G A;  1WDC C;  2K61 A;  1M45 A;  2LVJ A;  4I5N B;  3BOW A;  4MRY A;  3BUM B;  1YUS A;  3CR4 X;  4GGF C;  1K93 D;  2KQ6 A;  4M2O A;  4PAL A;  2R2I A;  1RJV A;  2L4I A;  1XYD A;  1KSM A;  1NWD A;  1NX3 A;  1RTP 1;  1A2X A;  5DKR A;  2ISD A;  1OZS A;  1BJF A;  2WOS A;  1WRK A;  4QJ5 B;  1F71 A;  2HPS A;  1PK0 D;  1FBV A;  2SAS A;  4JQ0 D;  1JWD A;  2BKH B;  3O2P A;  2LVK A;  3NXA A;  3SG7 A;  4GGF A;  3BUN B;  1OMR A;  2LNK A;  2JRF A;  2SCP A;  1UWO A;  1B7T Y;  1SR6 C;  2M97 A;  2F8P A;  1U5I B;  3BYA A;  1SPY A;  1WRL A;  4MVF A;  1YTZ C;  5K89 A;  1KK7 Y;  2JTZ A;  1CLM A;  3I5I B;  4C0J A;  3JTD C;  1NX0 A;  2LP3 A;  1ZUZ A;  1J7P A;  1L2O B;  1N65 A;  5DKQ A;  1CFC A;  1CDL A;  2V53 A;  4WRI A;  2BL0 C;  2EC6 B;  4MRX A;  3GK4 X;  4DIR A;  5I2L A;  3LCP C;  4QJ3 B;  3ZNI A;  2LAN A;  2WC8 A;  3I5F C;  1SW8 A;  3KO0 A;  1VRK A;  1K96 A;  2KFG A;  3AAK A;  2M7N A;  2WCE A;  2JPT A;  1G4Y R;  2KNE A;  4QJ4 B;  2LVI A;  1QLS A;  4OR9 B;  2BKI B;  1SCM C;  1IKU A;  3I5H C;  1NX2 A;  2ZKM X;  2F2P A;  2KFF A;  3DVJ A;  5AEQ A;  3SG6 A;  1MF8 B;  2Q4U A;  1LVC D;  1DJW A;  4N1F A;  1ALW A;  1KQM C;  1DJH A;  1TIZ A;  1RRO A;  2MLE C;  2AMI A;  1IQ5 A;  4HRE E;  2P6B B;  1YRU B;  1K9U A;  4XYN A;  3FWB A;  1G33 A;  1MR8 A;  2MBX A;  5TNC A;  1SNL A;  1LXF C;  1S5G Y;  1LIN A;  2OPO A;  3NSI A;  2KI4 B;  2JNX A;  1CDM A;  1S6I A;  3PM8 A;  1F55 A;  1CFF A;  2LUX A;  5IBW A;  4YI9 A;  1RK9 A;  1R6P A;  1J7O A;  1DJI A;  2M3W A;  4MSP A;  2M8U A;  4ORC B;  4M2P A;  1XA5 A;  4PHK A;  1J7Q A;  1LA0 A;  1KK8 C;  2LUC A;  1OMD A;  1AJ5 A;  1QIV A;  2BEC A;  1IRJ A;  1OZO A;  4GFT A;  3D0Y B;  1LKJ A;  4XJK A;  2JQ6 A;  1FF1 A;  1QAT A;  3BUX B;  5CSJ A;  1S6J A;  2JOJ A;  1EJ3 A;  2K7O A;  4NDD A;  1BMO A;  2LVV A;  3ZWH A;  2EGD A;  4TNC A;  2LCP A;  3EK7 A;  1CMF A;  4PE1 A;  1KK7 Z;  4HSZ A;  2OTG B;  5J3X A;  4N5X A;  1YUT A;  1PVB A;  1NUB A;  1PSR A;  1DJX A;  2F3Y A;  2Y5I A;  1CM4 A;  1K2H A;  1N2D A;  5I8N A;  1KFU S;  1XFU O;  4YGC B;  1UHJ A;  1IG5 A;  1WY9 A;  1DJZ A;  3PSR A;  1ZOT B;  1DT7 B;  1LA3 A;  4OVN F;  5HKY A;  2Q91 A;  1BF5 A;  4ORA B;  2I2R E;  3DD4 A;  4U8D A;  1C7V A;  1SKT A;  1K8U A;  1ZFS A;  2K2A A;  3WNX B; 
#chains in the Genus database with same CATH topology
 3TS5 B;  3WHT B;  2L5X B;  3GK2 A;  4NDB A;  1EH2 A;  2WC5 A;  3CGA A;  1IQ3 A;  2K2F A;  1B9A A;  1UP5 A;  3JVT C;  4JKT A;  3NHI A;  1XVJ A;  1HQV A;  2O5G A;  2FCD A;  3FWC A;  3QRX A;  3EK4 A;  3SS4 A;  1QAS A;  1XFV O;  3BOW B;  4I5J A;  1YUU A;  1Y0V H;  2G2B A;  2L50 A;  4ZCU A;  1B8R A;  3D73 A;  1SRA A;  1V1G A;  1BR1 B;  4PDZ A;  1R2U A;  2CCM A;  2PRU A;  3A4U B;  3BFA A;  2L5Y A;  3CLN A;  1JF0 A;  1KWO C;  2H61 C;  3PFV A;  4L9M A;  3D76 A;  1WDC B;  4GPL B;  2CXJ A;  4C0L A;  2M29 A;  2PSR A;  3WXA A;  2FOT A;  2I18 A;  2KQY A;  3OB1 B;  3KHE A;  4PHM A;  2OS8 C;  5BPJ A;  2LMT A;  1S5G Z;  1W7I B;  3F45 A;  4I5K A;  4ZCV A;  1K9P A;  3O6B A;  3D10 A;  1BG1 A;  1KCY A;  2M0R A;  1SL7 A;  1SL9 A;  3CR2 A;  5I94 A;  1IH0 A;  1WRZ A;  3AAJ A;  1MQ1 A;  1NPQ A;  1EG3 A;  3Q8I A;  2ZNE A;  2H61 A;  1P28 A;  1MWN A;  5CPV A;  2BCA A;  3SJS A;  2G9B A;  1K9K A;  4GAO A;  2HET A;  3B86 A;  1C07 A;  1K94 A;  5CSF A;  5AAN A;  1XO5 A;  1TWO A;  2K0J A;  1TRF A;  2Y1M A;  3IQO A;  4CFQ A;  1QV0 A;  1TCO B;  3BFB A;  1FPW A;  1QTX A;  1S36 A;  3KPX A;  1JSA A;  1QJT A;  4YGE B;  1JC2 A;  1DGU A;  1SR6 B;  3O78 A;  3EKH A;  2MA2 A;  4GNK B;  1IJ5 A;  3R1P A;  2E30 A;  2KFH A;  1TUJ A;  2JNF A;  4FTG A;  4GBA A;  2JT3 A;  2JT8 A;  4R1E A;  3E3R A;  1HT9 A;  2COL B;  2BNX A;  1BT6 A;  2LM5 A;  3SG2 A;  3VGO A;  1NP8 A;  3PLF B;  3CDN A;  1J1D A;  1KSO A;  1D1O A;  1MHO A;  2KI6 D;  2BL0 B;  1DJG A;  2M9G A;  4MLW A;  1OE9 B;  5D69 A;  4CLN A;  3TUY C;  1QLK A;  2WC6 A;  3SIA A;  3S0A A;  3I5F B;  1F8H A;  3HX4 A;  2HQ8 A;  2K8M B;  3I5G C;  2ERB A;  1UHN A;  2DOQ A;  2KBI A;  1QX2 A;  2LV7 A;  1CM1 A;  1NSH A;  2EHB A;  2M49 B;  2K7C A;  1YVL A;  1S3P A;  4PAL A;  1JBA A;  3B88 A;  3HCM A;  1NCZ A;  4FQT A;  4YRU A;  1REC A;  2NXQ A;  2LAP A;  1SCM B;  1PVA A;  3I5H B;  1PSB A;  4DRW A;  1W7J B;  4BY5 A;  1L7Z A;  2M1K B;  2NLN A;  1UUS A;  2K7D A;  3VRQ A;  1ODB A;  5KSZ A;  1NCX A;  3ICB A;  1KQM B;  2CTN A;  2H2K A;  1OOG A;  3PN7 C;  3S0B A;  3AKB A;  3B6X A;  2KLD A;  3C1V A;  4IJ7 A;  1AK8 A;  4MZL A;  2LHI A;  3PAL A;  2BBN A;  1M31 A;  2KLE A;  1BOD A;  1XFW O;  1MUX A;  1JFK A;  2MAZ A;  2ZN8 A;  1A03 A;  1OMV A;  3NHT A;  1N0Y A;  4USL A;  3IQQ A;  3TZ1 A;  2ZN9 A;  2M7L A;  4YI8 A;  1NYA A;  3FE8 A;  1FI5 A;  1B8L A;  1ZMZ A;  3B7A A;  1G8I A;  3LLE A;  1H8B A;  4JWQ A;  1OOH A;  2HQW A;  2QEO A;  2WND A;  3SG3 A;  1BU3 A;  4XJK B;  1DMO A;  1KFX L;  1IJ6 A;  1F54 A;  1S6C A;  2NCP A;  4NDC A;  3OX6 A;  2E6W A;  3S0E A;  2KHN A;  1SMG A;  1YRT B;  4YGB B;  2KAV A;  1QWV A;  2GGZ A;  1KK8 B;  3QME A;  4AQJ A;  4PCW A;  3H4S E;  1B8C A;  2JPO A;  4YGA A;  2QEV A;  3LL8 B;  1QV1 A;  1XFY O;  1Q80 A;  1UHK A;  2A4J A;  2KYC A;  3NSL A;  3VRO A;  1SSE B;  5GQQ C;  3VRP A;  3CWG A;  2LC5 A;  3DF0 A;  3OGN A;  3BQ3 A;  3FS7 A;  4HRH A;  3VB1 A;  4OV2 A;  1BLQ A;  1A4P A;  1CDP A;  4A4C A;  2JWW A;  2F33 A;  3CR5 X;  3OB2 B;  4DCK A;  1IGV A;  1XFX O;  4INW A;  3DVM A;  1RFJ A;  3R1V A;  2NCO A;  1DC1 A;  1CTR A;  3L4L A;  1WLM A;  1Y1U A;  2CBL A;  3O4Y A;  2LMU A;  2CNP A;  5DKN A;  5HYD A;  2HF5 A;  1GM0 A;  3FE9 A;  3OP0 A;  3AKA A;  1H4B A;  3S0D A;  2FJU B;  4OKH A;  1UUR A;  2L0P A;  5JOL A;  2KI6 C;  2KAY A;  1E8A A;  3UNW A;  3EVU A;  1CLL A;  1M63 B;  2LMV A;  2L2C A;  2PAS A;  1DEK A;  1Y6W A;  1YUR A;  5FI7 A;  1Y1A A;  2BCX A;  4C0K A;  1CFP A;  4PHN A;  1BOC A;  2Y4Q A;  1UHI A;  1CB1 A;  3VRN A;  1A75 A;  2AUC A;  4YGD B;  5CSI A;  5D3O A;  2PQL A;  1AHR A;  1TNP A;  3EG5 B;  5ER4 X;  5FI6 A;  1CNP A;  5FYX A;  1DF0 A;  2FCE A;  4N1G A;  2BCB A;  3CAB A;  1DQE A;  3JVT B;  1PAL A;  3TDU A;  3A8R A;  4D1E A;  3CS1 A;  1XK4 C;  1MXL C;  3D75 A;  2D8N A;  2TN4 A;  5HKW A;  5HKZ A;  4OCI A;  3K21 A;  4YBH B;  3PAT A;  2I94 A;  3KF9 A;  1K90 D;  1OQP A;  2CT9 A;  2BE4 A;  4BY4 A;  4NQG A;  3D78 A;  4IL1 A;  2BE6 A;  5AER A;  1AVS A;  1QVI Y;  1M46 A;  1SBJ A;  1T14 A;  4FQO A;  2JU0 A;  2L4H A;  3KEV A;  1RWY A;  1F4Q A;  1KWO B;  2QAC A;  1A29 A;  1SK6 D;  1XFZ O;  1XK4 A;  2MHH A;  3I5I C;  3TDZ A;  3S0F A;  1CKK A;  1TNQ A;  1OOJ A;  1C7W A;  1NCY A;  1B47 A;  1L2O C;  2PAL A;  2OS8 B;  1GQM A;  4HRG A;  3SG4 A;  4PE7 A;  4E68 A;  5KTY A;  2EC6 C;  2QEB A;  1U5I A;  4MBE A;  4PE4 A;  1X02 A;  1F4O A;  4AOM A;  5HL1 A;  2KGB C;  1CMG A;  1IWQ A;  3RLZ A;  4DS7 A;  3JTD B;  1CFD A;  2H8V A;  3SG5 A;  2MJW B;  3CTN A;  1QX7 A;  3OHM B;  4M2Q A;  1ZAC A;  2WCB A;  3EKJ A;  3EVR A;  3BUO B;  3DY9 A;  2LHL A;  3RZS A;  3BJH A;  1SCV A;  2K7B A;  1ALV A;  2KOT A;  3L4A A;  4P2Y B;  5G08 A;  1DGV A;  1DEL A;  2WCM A;  1CDN A;  5CSN A;  4CID A;  2KAX A;  3O4X A;  4A4B A;  2KYF A;  2M1U A;  3WHU B;  1JF2 A;  5F6T A;  1PUL A;  2PVB A;  2GGM A;  5I2O A;  3EVV A;  1QIW A;  2L2E A;  5HLV A;  1FI6 A;  1QX5 B;  2GV5 A;  4P5O E;  4JPZ B;  1CLB A;  3SS3 A;  3TUY B;  2LLS A;  3D74 A;  1SY9 A;  4MZK A;  2KBM A;  2Y1N A;  5HLO A;  5FI2 A;  2KI4 C;  2B1U A;  3DVK A;  2ZND A;  1WLZ A;  3I5G B;  5KU1 A;  4PE0 A;  2L51 A;  1QS7 A;  1J7R A;  1GGW A;  1TOP A;  3CZ2 A;  1DVI A;  1TNW A;  1EXR A;  1NX1 A;  2O60 A;  4AQI A;  3NGV A;  3R1O A;  1LS8 A;  3M0W A;  1TUZ A;  2PMY A;  4CPV A;  1EL4 A;  2NZ0 A;  1J1E A;  2LE9 B;  4ICB A;  2JXL A;  1UHH A;  2VRG A;  2PYQ A;  2KGR A;  2LP2 A;  1YR5 A;  5D7F A;  1S1E A;  3OX5 A;  4ETO A;  4CFR A;  2F3Z A;  2JC2 A;  3BUW B;  3PN7 B;  3S0G A;  2JZI A;  3SIB A;  4WQ2 A;  1PRW A;  4UPG A;  1NIW A;  3IVT A;  3VRR A;  2KSP A;  2IS9 A;  1XFR A;  1V1F A;  2MRD A;  4WQ3 A;  4MZJ A;  1C3Y A;  2WCF A;  1ORG A;  2L98 A;  3LK0 A;  1AP4 A;  1JUO A;  1FW4 A;  1S26 D;  2AAO A;  1QVI Z;  2QPT A;  1JFJ A;  3TDI A;  3D0Y A;  1Y1X A;  3RM1 A;  3R72 A;  3BXK A;  5AXI A;  1OSA A;  2OTG C;  1BR4 B;  1SL8 A;  1GGZ A;  4Q04 A;  3IF7 A;  1F70 A;  1KFU L;  2JUL A;  3GOF A;  1TCF A;  3DZT A;  3NSO A;  3MSE B;  5DIC A;  2WCL A;  3K1E A;  3LK1 A;  1M39 A;  3DF0 B;  3EK8 A;  2FJY A;  2MLF C;  3DVE A;  1KFX S;  3FIA A;  4F0Z B;  5I2Q A;  2ZRS A;  1B7T Z;  3N7H A;  2JXC A;  1J55 A;  2JT0 A;  4PHJ A;  1AUI B;  2LLU A;  3CZT X;  1B4C A;  1K95 A;  1SYM A;  1MXE A;  1TTX A;  1YVH A;  1OOF A;  3GK1 A;  2RGI A;  4ORB B;  5ER5 A;  3TS5 C;  4DUQ A;  1DJY A;  5B8I B;  2I7A A;  5AFP A;  2WOR A;  1KQV A;  4KYN A;  1GJY A;  4I5L B;  2K60 A;  1EG4 A;  2F2O A;  2ZFD A;  3OBV A;  4MN0 A;  2BAP A;  3NSK A;  4GGN A;  2BBM A;  2ZRT A;  1YX7 A;  4GUK A;  2JTT A;  1A75 B;  1QXP A;  2KDH A;  1TN4 A;  5JJG A;  4MEW A;  1AJ4 A;  2LLT A;  1DTL A;  1DF0 B;  1YX8 A;  1TNX A;  5PAL A;  1B1G A;  1WDC C;  2K61 A;  1M45 A;  2LVJ A;  4I5N B;  3BOW A;  4MRY A;  1OW4 A;  3BUM B;  4JD9 A;  1YUS A;  3CR4 X;  4GGF C;  1K93 D;  2KQ6 A;  2P70 A;  1Z2C B;  2R2I A;  1RJV A;  2L4I A;  4M2O A;  1XYD A;  1KSM A;  1NWD A;  1NX3 A;  1RTP 1;  1A2X A;  5DKR A;  3CZ1 A;  2ISD A;  1OZS A;  1BJF A;  1Z4H A;  2WOS A;  1WRK A;  4QJ5 B;  1F71 A;  2HPS A;  1PK0 D;  1FBV A;  2SAS A;  4JQ0 D;  1JWD A;  2BKH B;  3O2P A;  2LVK A;  3NXA A;  3SG7 A;  4GGF A;  3DXL A;  3BUN B;  1OMR A;  2LNK A;  2JRF A;  3PM2 A;  2SCP A;  1UWO A;  3CYZ A;  1B7T Y;  1SR6 C;  2M97 A;  2F8P A;  1U5I B;  3BYA A;  1SPY A;  1WRL A;  4MVF A;  3B87 A;  1YTZ C;  2WCJ A;  5K89 A;  1KK7 Y;  2JTZ A;  1CLM A;  1IIO A;  3I5I B;  4C0J A;  3D77 A;  3JTD C;  1NX0 A;  2LP3 A;  1ZUZ A;  1J7P A;  2YGU A;  1L2O B;  1N65 A;  5DKQ A;  1CFC A;  1CDL A;  2V53 A;  4WRI A;  2BL0 C;  2EC6 B;  4MRX A;  3GK4 X;  4DIR A;  5I2L A;  3LCP C;  4QJ3 B;  3ZNI A;  2LAN A;  2WC8 A;  3I5F C;  1SW8 A;  3KO0 A;  1VRK A;  1K96 A;  2KFG A;  3AAK A;  2M7N A;  2WCE A;  2JPT A;  1G4Y R;  2KNE A;  4QJ4 B;  2LVI A;  3L47 A;  1QLS A;  1W9Z A;  4OR9 B;  3DYE A;  2BKI B;  3SS5 A;  1SCM C;  1IKU A;  3I5H C;  1NX2 A;  2ZKM X;  2F2P A;  2KFF A;  3DVJ A;  5AEQ A;  3SG6 A;  1MF8 B;  2Q4U A;  1LVC D;  1DJW A;  4N1F A;  1ALW A;  1KQM C;  3PJI A;  1DJH A;  2WCH A;  1TIZ A;  1RRO A;  2MLE C;  5EL2 A;  2AMI A;  1IQ5 A;  4HRE E;  2P6B B;  1YRU B;  1K9U A;  4XYN A;  3FWB A;  1G33 A;  1MR8 A;  2MBX A;  2GTE A;  5TNC A;  1SNL A;  1LXF C;  1S5G Y;  1LIN A;  2OPO A;  3FE6 A;  3NSI A;  2KI4 B;  2JNX A;  1CDM A;  1S6I A;  3PM8 A;  1F55 A;  1CFF A;  4INX A;  4F7F A;  2LUX A;  5IBW A;  3CZ0 A;  4YI9 A;  1RK9 A;  1R6P A;  1J7O A;  3V2L A;  1DJI A;  2M3W A;  4MSP A;  2M8U A;  4ORC B;  4M2P A;  1XA5 A;  4PHK A;  1J7Q A;  1LA0 A;  1KK8 C;  2LUC A;  1OMD A;  1AJ5 A;  1QIV A;  2WCK A;  2BEC A;  1IRJ A;  1OZO A;  4GFT A;  3D0Y B;  1LKJ A;  4XJK A;  2JQ6 A;  1FF1 A;  1QAT A;  3BUX B;  5CSJ A;  1S6J A;  2JOJ A;  2P71 A;  1EJ3 A;  2K7O A;  4NDD A;  1BMO A;  2LVV A;  4PT1 A;  3ZWH A;  2EGD A;  4TNC A;  2LCP A;  3EK7 A;  1CMF A;  3UO9 A;  4PE1 A;  2KPH A;  2QEH A;  1KK7 Z;  4HSZ A;  2OTG B;  5J3X A;  3BFH A;  4N5X A;  1YUT A;  1PVB A;  1NUB A;  1PSR A;  1DJX A;  2F3Y A;  2Y5I A;  1CM4 A;  2QDI A;  1K2H A;  1N2D A;  5I8N A;  1KFU S;  1XFU O;  4YGC B;  1UHJ A;  1IG5 A;  1WY9 A;  1DJZ A;  3PSR A;  1ZOT B;  4OZD A;  1DT7 B;  1LA3 A;  4OVN F;  5HKY A;  1C3Z A;  2Q91 A;  1BF5 A;  4ORA B;  1OOI X;  2I2R E;  3DD4 A;  4U8D A;  1SKT A;  1K8U A;  1C7V A;  1ZFS A;  2K2A A;  3WNX B; 
#chains in the Genus database with same CATH homology
 3TS5 B;  3WHT B;  2L5X B;  3GK2 A;  4NDB A;  1EH2 A;  3CGA A;  1IQ3 A;  2K2F A;  1B9A A;  1UP5 A;  3JVT C;  1XVJ A;  1HQV A;  2O5G A;  2FCD A;  3FWC A;  3QRX A;  3EK4 A;  1QAS A;  1XFV O;  3BOW B;  4I5J A;  1YUU A;  1Y0V H;  2G2B A;  2L50 A;  4ZCU A;  1B8R A;  1SRA A;  1V1G A;  1BR1 B;  4PDZ A;  1R2U A;  2CCM A;  2PRU A;  3A4U B;  3CLN A;  1JF0 A;  1KWO C;  2H61 C;  3PFV A;  4L9M A;  1WDC B;  4GPL B;  2CXJ A;  4C0L A;  2M29 A;  2PSR A;  3WXA A;  2FOT A;  2I18 A;  2KQY A;  3OB1 B;  3KHE A;  4PHM A;  2OS8 C;  5BPJ A;  2LMT A;  1S5G Z;  1W7I B;  3F45 A;  4I5K A;  4ZCV A;  1K9P A;  3O6B A;  3D10 A;  1BG1 A;  1KCY A;  2M0R A;  1SL7 A;  1SL9 A;  3CR2 A;  1IH0 A;  1WRZ A;  3AAJ A;  1MQ1 A;  1NPQ A;  1EG3 A;  3SJS A;  2ZNE A;  2H61 A;  5CPV A;  1MWN A;  2BCA A;  2G9B A;  1K9K A;  4GAO A;  2HET A;  1C07 A;  1K94 A;  5CSF A;  5AAN A;  1XO5 A;  2K0J A;  1TRF A;  2Y1M A;  3IQO A;  4CFQ A;  1QV0 A;  1TCO B;  1FPW A;  1QTX A;  1S36 A;  3KPX A;  1JSA A;  1QJT A;  4YGE B;  1JC2 A;  1DGU A;  1SR6 B;  3O78 A;  3EKH A;  2MA2 A;  4GNK B;  1IJ5 A;  2E30 A;  2KFH A;  4FTG A;  2JNF A;  4GBA A;  2JT3 A;  2JT8 A;  4R1E A;  3E3R A;  1HT9 A;  2COL B;  3SG2 A;  1BT6 A;  2LM5 A;  3VGO A;  1NP8 A;  3PLF B;  1J1D A;  1KSO A;  1D1O A;  1MHO A;  2KI6 D;  2BL0 B;  1DJG A;  2M9G A;  4MLW A;  1OE9 B;  5D69 A;  4CLN A;  3TUY C;  1QLK A;  3SIA A;  3I5F B;  1F8H A;  3HX4 A;  2HQ8 A;  2K8M B;  3I5G C;  2KBI A;  1UHN A;  2DOQ A;  1QX2 A;  2LV7 A;  1CM1 A;  1NSH A;  2EHB A;  2M49 B;  2K7C A;  1YVL A;  1S3P A;  1JBA A;  3HCM A;  1NCZ A;  4YRU A;  1REC A;  2NXQ A;  2LAP A;  1SCM B;  1PVA A;  3I5H B;  1PSB A;  4DRW A;  1W7J B;  4BY5 A;  1L7Z A;  2M1K B;  2NLN A;  1UUS A;  2K7D A;  3VRQ A;  1ODB A;  5KSZ A;  1NCX A;  3ICB A;  1KQM B;  2CTN A;  2H2K A;  3PN7 C;  3AKB A;  3C1V A;  1AK8 A;  4MZL A;  2LHI A;  3PAL A;  2BBN A;  1M31 A;  1BOD A;  1XFW O;  1MUX A;  1JFK A;  2MAZ A;  2ZN8 A;  1A03 A;  1OMV A;  1N0Y A;  4USL A;  3IQQ A;  3TZ1 A;  2ZN9 A;  2M7L A;  4YI8 A;  1NYA A;  1FI5 A;  1B8L A;  1ZMZ A;  1G8I A;  3LLE A;  1H8B A;  4JWQ A;  2HQW A;  3SG3 A;  2WND A;  1BU3 A;  4XJK B;  1DMO A;  1KFX L;  1IJ6 A;  1F54 A;  1S6C A;  2NCP A;  4NDC A;  3OX6 A;  2E6W A;  2KHN A;  1SMG A;  1YRT B;  4YGB B;  2KAV A;  2GGZ A;  1KK8 B;  4AQJ A;  4PCW A;  3H4S E;  1B8C A;  4YGA A;  3LL8 B;  1QV1 A;  1XFY O;  1Q80 A;  1UHK A;  2A4J A;  2KYC A;  3NSL A;  3VRO A;  5GQQ C;  3VRP A;  3CWG A;  2LC5 A;  3DF0 A;  1BLQ A;  3BQ3 A;  3FS7 A;  4HRH A;  4OV2 A;  1A4P A;  1CDP A;  4A4C A;  2JWW A;  2F33 A;  3CR5 X;  3OB2 B;  4DCK A;  1IGV A;  1XFX O;  3DVM A;  1RFJ A;  2NCO A;  1CTR A;  1WLM A;  1Y1U A;  2CBL A;  3O4Y A;  2LMU A;  2CNP A;  5DKN A;  5HYD A;  2HF5 A;  3OP0 A;  3AKA A;  1H4B A;  2FJU B;  4OKH A;  1UUR A;  2L0P A;  5JOL A;  2KI6 C;  2KAY A;  1E8A A;  3EVU A;  1CLL A;  1M63 B;  2LMV A;  2PAS A;  1Y6W A;  1YUR A;  1Y1A A;  2BCX A;  4C0K A;  1CFP A;  4PHN A;  1BOC A;  2Y4Q A;  1UHI A;  1CB1 A;  3VRN A;  1A75 A;  2AUC A;  4YGD B;  5CSI A;  1AHR A;  1TNP A;  5ER4 X;  1CNP A;  5FYX A;  1DF0 A;  2FCE A;  4N1G A;  2BCB A;  3JVT B;  3TDU A;  1PAL A;  3A8R A;  4D1E A;  3CS1 A;  1XK4 C;  1MXL C;  2D8N A;  2TN4 A;  5HKW A;  5HKZ A;  4OCI A;  3K21 A;  4YBH B;  3PAT A;  2I94 A;  3KF9 A;  1K90 D;  1OQP A;  2CT9 A;  2BE4 A;  4BY4 A;  4NQG A;  5AER A;  4IL1 A;  2BE6 A;  1AVS A;  1QVI Y;  1M46 A;  1SBJ A;  4FQO A;  2JU0 A;  2L4H A;  3KEV A;  1RWY A;  1F4Q A;  1KWO B;  2QAC A;  1A29 A;  1SK6 D;  1XFZ O;  1XK4 A;  2MHH A;  3I5I C;  3TDZ A;  1CKK A;  1TNQ A;  1OOJ A;  1C7W A;  1NCY A;  1B47 A;  1L2O C;  2PAL A;  2OS8 B;  1GQM A;  4HRG A;  3SG4 A;  4PE7 A;  4E68 A;  5KTY A;  2EC6 C;  1U5I A;  4MBE A;  4PE4 A;  1X02 A;  1F4O A;  4AOM A;  2KGB C;  1CMG A;  1IWQ A;  3RLZ A;  4DS7 A;  3JTD B;  1CFD A;  3SG5 A;  2MJW B;  3CTN A;  1QX7 A;  3OHM B;  4M2Q A;  1ZAC A;  2WCB A;  3EKJ A;  3EVR A;  3BUO B;  2LHL A;  1SCV A;  2K7B A;  1ALV A;  2KOT A;  4P2Y B;  5G08 A;  1DGV A;  1CDN A;  5CSN A;  4CID A;  2KAX A;  4A4B A;  2KYF A;  2M1U A;  3WHU B;  1JF2 A;  5F6T A;  1PUL A;  2PVB A;  2GGM A;  5I2O A;  3EVV A;  1QIW A;  2L2E A;  5HLV A;  1FI6 A;  1QX5 B;  2GV5 A;  4P5O E;  4JPZ B;  1CLB A;  3TUY B;  2LLS A;  1SY9 A;  4MZK A;  2KBM A;  2Y1N A;  5HLO A;  2KI4 C;  2B1U A;  3DVK A;  2ZND A;  1WLZ A;  3I5G B;  5KU1 A;  4PE0 A;  2L51 A;  1QS7 A;  1J7R A;  1GGW A;  1TOP A;  1DVI A;  1TNW A;  1EXR A;  1NX1 A;  2O60 A;  4AQI A;  3M0W A;  2PMY A;  4CPV A;  1EL4 A;  2NZ0 A;  1J1E A;  2LE9 B;  4ICB A;  2JXL A;  1UHH A;  2VRG A;  2KGR A;  2LP2 A;  1YR5 A;  5D7F A;  1S1E A;  3OX5 A;  4ETO A;  4CFR A;  2F3Z A;  2JC2 A;  3BUW B;  3PN7 B;  3SIB A;  2JZI A;  4UPG A;  4WQ2 A;  1PRW A;  1NIW A;  3VRR A;  2KSP A;  2IS9 A;  1V1F A;  2MRD A;  4WQ3 A;  4MZJ A;  2WCF A;  2L98 A;  3LK0 A;  1AP4 A;  1JUO A;  1FW4 A;  1S26 D;  2AAO A;  1QVI Z;  2QPT A;  1JFJ A;  3TDI A;  3D0Y A;  1Y1X A;  3RM1 A;  3BXK A;  5AXI A;  1OSA A;  2OTG C;  1BR4 B;  1SL8 A;  1GGZ A;  4Q04 A;  3IF7 A;  1F70 A;  1KFU L;  2JUL A;  3GOF A;  1TCF A;  3NSO A;  3MSE B;  3LK1 A;  1M39 A;  3DF0 B;  3EK8 A;  3DVE A;  2MLF C;  4F0Z B;  1KFX S;  3FIA A;  5I2Q A;  2ZRS A;  1B7T Z;  2JXC A;  1J55 A;  2JT0 A;  4PHJ A;  1AUI B;  2LLU A;  3CZT X;  1B4C A;  1K95 A;  1SYM A;  1MXE A;  1TTX A;  1YVH A;  3GK1 A;  4ORB B;  2RGI A;  5ER5 A;  3TS5 C;  4DUQ A;  1DJY A;  5B8I B;  2I7A A;  5AFP A;  2WOR A;  1KQV A;  1GJY A;  4I5L B;  1EG4 A;  2F2O A;  2ZFD A;  4MN0 A;  3NSK A;  4GGN A;  2BBM A;  2ZRT A;  1YX7 A;  4GUK A;  2JTT A;  1A75 B;  1QXP A;  2KDH A;  1TN4 A;  5JJG A;  4MEW A;  1AJ4 A;  2LLT A;  1DTL A;  1DF0 B;  1YX8 A;  1TNX A;  5PAL A;  1B1G A;  1WDC C;  2K61 A;  1M45 A;  2LVJ A;  4I5N B;  3BOW A;  4MRY A;  3BUM B;  1YUS A;  3CR4 X;  4GGF C;  1K93 D;  2KQ6 A;  4M2O A;  4PAL A;  2R2I A;  1RJV A;  2L4I A;  1XYD A;  1KSM A;  1NWD A;  1NX3 A;  1RTP 1;  1A2X A;  5DKR A;  2ISD A;  1OZS A;  1BJF A;  2WOS A;  1WRK A;  4QJ5 B;  1F71 A;  2HPS A;  1PK0 D;  1FBV A;  2SAS A;  4JQ0 D;  1JWD A;  2BKH B;  3O2P A;  2LVK A;  3NXA A;  3SG7 A;  4GGF A;  3BUN B;  1OMR A;  2LNK A;  2JRF A;  2SCP A;  1UWO A;  1B7T Y;  1SR6 C;  2M97 A;  2F8P A;  1U5I B;  3BYA A;  1SPY A;  1WRL A;  4MVF A;  1YTZ C;  5K89 A;  1KK7 Y;  2JTZ A;  1CLM A;  3I5I B;  4C0J A;  3JTD C;  1NX0 A;  2LP3 A;  1ZUZ A;  1J7P A;  1L2O B;  1N65 A;  5DKQ A;  1CFC A;  1CDL A;  2V53 A;  4WRI A;  2BL0 C;  2EC6 B;  4MRX A;  3GK4 X;  4DIR A;  5I2L A;  3LCP C;  4QJ3 B;  3ZNI A;  2LAN A;  2WC8 A;  3I5F C;  1SW8 A;  3KO0 A;  1VRK A;  1K96 A;  2KFG A;  3AAK A;  2M7N A;  2WCE A;  2JPT A;  1G4Y R;  2KNE A;  4QJ4 B;  2LVI A;  1QLS A;  4OR9 B;  2BKI B;  1SCM C;  1IKU A;  3I5H C;  1NX2 A;  2ZKM X;  2F2P A;  2KFF A;  3DVJ A;  5AEQ A;  3SG6 A;  1MF8 B;  2Q4U A;  1LVC D;  1DJW A;  4N1F A;  1ALW A;  1KQM C;  1DJH A;  1TIZ A;  1RRO A;  2MLE C;  2AMI A;  1IQ5 A;  4HRE E;  2P6B B;  1YRU B;  1K9U A;  4XYN A;  3FWB A;  1G33 A;  1MR8 A;  2MBX A;  5TNC A;  1SNL A;  1LXF C;  1S5G Y;  1LIN A;  2OPO A;  3NSI A;  2KI4 B;  2JNX A;  1CDM A;  1S6I A;  3PM8 A;  1F55 A;  1CFF A;  2LUX A;  5IBW A;  4YI9 A;  1RK9 A;  1R6P A;  1J7O A;  1DJI A;  2M3W A;  4MSP A;  2M8U A;  4ORC B;  4M2P A;  1XA5 A;  4PHK A;  1J7Q A;  1LA0 A;  1KK8 C;  2LUC A;  1OMD A;  1AJ5 A;  1QIV A;  2BEC A;  1IRJ A;  1OZO A;  4GFT A;  3D0Y B;  1LKJ A;  4XJK A;  2JQ6 A;  1FF1 A;  1QAT A;  3BUX B;  5CSJ A;  1S6J A;  2JOJ A;  1EJ3 A;  2K7O A;  4NDD A;  1BMO A;  2LVV A;  3ZWH A;  2EGD A;  4TNC A;  2LCP A;  3EK7 A;  1CMF A;  4PE1 A;  1KK7 Z;  4HSZ A;  2OTG B;  5J3X A;  4N5X A;  1YUT A;  1PVB A;  1NUB A;  1PSR A;  1DJX A;  2F3Y A;  2Y5I A;  1CM4 A;  1K2H A;  1N2D A;  5I8N A;  1KFU S;  1XFU O;  4YGC B;  1UHJ A;  1IG5 A;  1WY9 A;  1DJZ A;  3PSR A;  1ZOT B;  1DT7 B;  1LA3 A;  4OVN F;  5HKY A;  2Q91 A;  1BF5 A;  4ORA B;  2I2R E;  3DD4 A;  4U8D A;  1C7V A;  1SKT A;  1K8U A;  1ZFS A;  2K2A A;  3WNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...