3BXKA

Crystal structure of the p/q-type calcium channel (cav2.1) iq domain and ca2+calmodulin complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
142
structure length
137
Chain Sequence
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the P/Q-type calcium channel (CaV2.1) IQ domain and CA2+calmodulin complex
rcsb
source organism Rattus norvegicus
molecule tags Membrane protein, signaling protein
molecule keywords Calmodulin
total genus 47
structure length 137
sequence length 142
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3bxkA00
4I5NB 2ZKMX 1XK4A 1TNWA 1YR5A 1AUIB 2B1UA 2FCDA 1B9AA 2LLUA 4D1EA 1QV1A 2KGBC 1N0YA 2M29A 1S5GZ 2HETA 4IL1A 3TS5B 5JJGA 5AANA 1KQMC 1QVIY 3EKHA 2BECA 1MWNA 1QATA 2E6WA 1CNPA 2JPTA 1SR6B 2LVJA 5G08A 1CFDA 4JQ0D 3I5FC 2L51A 2F3YA 2FOTA 1F4OA 3A4UB 3EKJA 4NDCA 1C7VA 1PSRA 2JT0A 2M1KB 1DMOA 2KGRA 1LA0A 1CDMA 5B8IB 2M3WA 2QPTA 3EVRA 3DVMA 5KTYA 1CTRA 3AAJA 1L2OB 1YUTA 4MRXA 1J7PA 1LA3A 2ZRSA 1WRKA 2JRFA 1JF2A 2A4JA 3SJSA 1JWDA 1QIWA 4YBHB 2LM5A 2LMTA 1XA5A 4C0LA 3CR2A 4GNKB 1JFJA 1B8LA 1K90D 3LK0A 5ER4X 1MXLC 5FYXA 3BYAA 3A8RA 4F0ZB 3TUYB 2K0JA 4PE4A 1E8AA 3FWBA 1K9UA 1JF0A 1FW4A 1CLLA 1JFKA 1WLZA 3DD4A 2KFGA 1TTXA 5CPVA 1NPQA 1JC2A 1DF0B 2LUXA 4QJ4B 1KFUS 1KFXL 2ZNEA 4YI8A 3O4YA 1NCXA 5AEQA 1UHKA 1HT9A 1XVJA 3JVTC 1OMRA 4YRUA 1SW8A 2KQ6A 1U5IA 2KSPA 4AQIA 5HKZA 3K21A 1AJ5A 1NX1A 3PSRA 3KPXA 4ETOA 1MHOA 1AJ4A 4JPZB 2Y4QA 5HLOA 1VRKA 2NLNA 1J7QA 1QX5B 3GK2A 2NCOA 1DTLA 2SASA 1UHJA 2H61A 2KI4B 4N5XA 1EH2A 1ALWA 1J55A 1SRAA 4OKHA 2BKIB 2CNPA 2MA2A 1SL7A 1S6IA 1NCYA 1N65A 2EC6B 4N1GA 1QS7A 3DVEA 1PVAA 5KSZA 1NX3A 3C1VA 1TIZA 4P5OE 5DKRA 1Q80A 2O60A 2LHIA 2K8MB 3DF0B 3I5IC 3F45A 3SG6A 3BUWB 4WRIA 4NDDA 1S6JA 4XJKB 5J3XA 5AXIA 4I5JA 1DJZA 1CFCA 5AFPA 1WY9A 4PHJA 3PALA 4TNCA 1IWQA 2F33A 3EK4A 2K2FA 2LMVA 3BOWB 4FTGA 3SG3A 2ZNDA 1TNPA 1RFJA 4P2YB 2BCXA 2LHLA 1L2OC 2JZIA 2K61A 2KNEA 1S5GY 1YRUB 3I5GC 2BE4A 4FQOA 1YUSA 1C07A 3SG7A 1DJWA 4GFTA 1JSAA 1DJHA 1WRLA 2K2AA 1KSMA 4HRHA 1A75B 2OS8B 1ZACA 4NQGA 1PULA 2BE6A 2JNFA 4BY5A 4CLNA 2JQ6A 4PHNA 2JTTA 2KDHA 3BXKA 2KI6D 4A4CA 2BCAA 1PVBA 2MHHA 3EK7A 3KF9A 1RECA 1YX7A 1ALVA 2KAYA 2WCFA 2Q4UA 4ZCVA 5I8NA 2O5GA 1OOJA 2P6BB 4OR9B 5AERA 1UHIA 3SIBA 1EL4A 2LVVA 2M7NA 4JWQA 1M39A 5TNCA 1H8BA 1H4BA 2ZFDA 5I2OA 1BG1A 4E68A 2JWWA 1MUXA 1XO5A 4DRWA 4R1EA 1BJFA 1RJVA 1G8IA 2JXCA 2M7LA 4DIRA 1FI6A 1BR1B 1N2DA 3IF7A 3H4SE 1KWOB 2WOSA 2LVIA 5I2QA 4GGFC 1A2XA 4CIDA 1XFWO 1S6CA 1F70A 1J7OA 1FI5A 2K7BA 1BOCA 1BU3A 5HKYA 3JTDB 1UWOA 1DGUA 2MRDA 2L50A 3HCMA 1ODBA 5KU1A 1M63B 2OPOA 3WHTB 4CFQA 1SPYA 1EXRA 1ZOTB 2L0PA 1NSHA 1DGVA 3KEVA 2TN4A 3O78A 2KI6C 1C7WA 2QACA 1KSOA 1CFFA 4U8DA 5D7FA 1CLMA 1G4YR 2JTZA 3I5HB 3BUXB 3CTNA 3D0YB 1ZMZA 3FIAA 4MEWA 1K95A 2OTGB 4PALA 1QV0A 1QX7A 1EJ3A 2WNDA 1U5IB 2IS9A 2R2IA 3OX5A 4AOMA 1J1DA 1RWYA 1TOPA 2D8NA 1UHHA 4YGBB 1J1EA 1AHRA 1J7RA 1QX2A 1IQ3A 3NSIA 3RM1A 1WDCB 2F8PA 1OE9B 3E3RA 1GJYA 3I5GB 2KFHA 1OQPA 3MSEB 2KI4C 3AKBA 1YVHA 1K2HA 1MQ1A 2BCBA 2LAPA 1SCVA 2V53A 2CXJA 3EVUA 1B1GA 2G2BA 3LLEA 1MF8B 1TN4A 1B7TY 2JC2A 1CM4A 1UURA 2L4IA 1IKUA 3IQQA 1SCMC 3OHMB 2KQYA 3I5IB 1F71A 1W7JB 1XFZO 2JNXA 3PATA 3ICBA 1YX8A 1A75A 1HQVA 4I5LB 4USLA 5HYDA 1F55A 1LKJA 2LCPA 4WQ2A 1QLKA 3AAKA 4I5KA 1LVCD 1SNLA 3FS7A 2EC6C 1IH0A 4AQJA 2JULA 2CT9A 1QJTA 2LP3A 3OX6A 4DUQA 2L2EA 1UP5A 1CLBA 3OP0A 4MN0A 2LP2A 4C0KA 1SCMB 3PFVA 2BBMA 1CMGA 1CDLA 2HQWA 1TNXA 2I18A 4MZJA 1OZOA 2GGMA 1GGZA 4QJ5B 1K9PA 1KQVA 1XK4C 1BT6A 1JUOA 1OZSA 2JXLA 2H2KA 1AVSA 2L5XB 2ZRTA 2E30A 1JBAA 4C0JA 4MSPA 5IBWA 5HLVA 3TDUA 2PASA 3BQ3A 2F2OA 4ORBB 1WDCC 1PRWA 1SY9A 1ZFSA 1PK0D 2WORA 3OB1B 4HRGA 2SCPA 2PALA 4PCWA 2KAXA 3TZ1A 4PE1A 3I5FB 3KO0A 1CDNA 1BMOA 1PALA 1YRTB 1KFXS 1KFUL 2ISDA 1NX0A 3GK1A 1DJGA 1EG4A 1YVLA 2I2RE 2LNKA 3NSLA 3QRXA 1SBJA 1YURA 5I2LA 3TUYC 5DKQA 1IGVA 1K8UA 1G33A 2F2PA 2GGZA 2JT8A 2K7CA 1QXPA 2LC5A 2NCPA 2PRUA 3BUOB 1GGWA 1IJ5A 1K93D 4L9MA 3VROA 1L7ZA 2I7AA 2H61C 5JOLA 1KK8C 3HX4A 1NCZA 1MXEA 4YGCB 1D1OA 2CCMA 1A4PA 3PN7C 1RROA 5D69A 1QVIZ 2FCEA 4HREE 2Y1MA 4MVFA 1M46A 2ZN8A 1B47A 4GUKA 1SMGA 2Q91A 4ORCB 2L98A 1DF0A 2AAOA 5BPJA 3TDIA 3AKAA 3WNXB 1KWOC 3WHUB 1A29A 3EK8A 4M2QA 2PMYA 2KYCA 1CDPA 1CKKA 1TCFA 4M2OA 1Y1XA 3DVKA 4YGDB 1MR8A 1F4QA 1IQ5A 3O2PA 1F54A 2MBXA 3WXAA 1AK8A 2M0RA 2PVBA 3PN7B 4OCIA 3CR5X 4OV2A 2DOQA 3PLFB 1K96A 1KK8B 1RK9A 1SL8A 4ORAB 2M97A 4M2PA 3TS5C 1BODA 2M8UA 1F8HA 3D10A 3TDZA 1K94A 5F6TA 2JT3A 3LK1A 4CFRA 4GGNA 1S26D 5CSFA 1FPWA 3CR4X 2LVKA 1GQMA 3LL8B 4Q04A 1LXFC 2CBLA 4PE0A 3PM8A 4A4BA 2OS8C 2BBNA 2RGIA 5HKWA 1B8RA 3ZWHA 1B8CA 2MAZA 1DVIA 2M1UA 1V1GA 2WCBA 3CLNA 5ER5A 3VRQA 1EG3A 2HF5A 3GOFA 3ZNIA 1BR4B 2HPSA 1LINA 4YI9A 2LV7A 1AP4A 2K7OA 4OVNF 1R6PA 4ICBA 1UHNA 2M49B 4GAOA 1W7IB 5CSIA 2NZ0A 4CPVA 1R2UA 3CWGA 1TRFA 2MJWB 4PHKA 1QTXA 1A03A 3RLZA 1M31A 3NXAA 1XFUO 2AUCA 2LUCA 4MBEA 1B4CA 2WC8A 1CFPA 1FF1A 2LE9B 3VGOA 1QLSA 4PE7A 1KK7Z 1NP8A 2BL0C 4PDZA 3SG5A 2BL0B 2Y5IA 1K9KA 1XFYO 2K7DA 1Y6WA 1CM1A 4WQ3A 4ZCUA 3SG4A 2BKHB 3VRNA 3KHEA 4N1FA 1V1FA 1XYDA 1YUUA 2ZN9A 1IJ6A 3D0YA 1S36A 2PSRA 4HSZA 2EGDA 4XJKA 2KBIA 1B7TZ 1PSBA 2WCEA 1IRJA 3OB2B 2MLFC 1SKTA 1CB1A 3VRPA 3BUNB 4UPGA 1BLQA 4GPLB 1S3PA 2GV5A 2KOTA 3VRRA 2L4HA 3JVTB 2LANA 4DS7A 4BY4A 1SL9A 1Y0VH 1NX2A 1S1EA 2MLEC 2G9BA 2I94A 3NSKA 2KYFA 5DKNA 1DJYA 1Y1UA 1TNQA 2LLTA 4GGFA 1RTP1 3IQOA 3LCPC 1KK7Y 2NXQA 2OTGC 1OMDA 2KBMA 1NIWA 2Y1NA 1SYMA 3I5HC 3SG2A 2EHBA 1NUBA 1QIVA 3BOWA 3SIAA 2CTNA 4YGEB 1FBVA 2JU0A 5K89A 1YTZC 2KAVA 3CGAA 1CMFA 3DF0A 2F3ZA 4YGAA 1QASA 3JTDC 1NWDA 1TCOB 2HQ8A 1DT7B 4DCKA 3NSOA 4QJ3B 5CSJA 1NYAA 4MZLA 4PHMA 4MZKA 2LMUA 4GBAA 3CS1A 1OSAA 2COLB 1XFXO 1OMVA 1M45A 1IG5A 1WRZA 1ZUZA 3BUMB 2KFFA 3DVJA 3M0WA 4MLWA 4MRYA 2KHNA 2FJUB 1BF5A 1KCYA 2LLSA 3CZTX 2AMIA 1XFVO 2VRGA 1X02A 5PALA 1SR6C 5GQQC 1UUSA 2M9GA 1DJIA 3O6BA 4NDBA 1DJXA 1SK6D 1WLMA 1Y1AA 3FWCA 2JOJA 3GK4X 1KQMB 3EVVA 5CSNA 4XYNA
chains in the Genus database with same CATH superfamily
4I5NB 4PT1A 2ZKMX 1XK4A 1TNWA 1YR5A 3Q8IA 1AUIB 2B1UA 2FCDA 1B9AA 2LLUA 4D1EA 1QV1A 2KGBC 1N0YA 2M29A 1S5GZ 2HETA 4IL1A 3TS5B 5JJGA 5AANA 1KQMC 1QVIY 3EKHA 2BECA 1MWNA 1QATA 2E6WA 1CNPA 2JPTA 1SR6B 2LVJA 5G08A 1CFDA 4JQ0D 3I5FC 2L51A 2F3YA 2FOTA 1F4OA 3A4UB 3EKJA 4NDCA 1C7VA 1OOIX 1PSRA 2JT0A 2M1KB 1DMOA 2KGRA 1LA0A 1CDMA 5B8IB 2M3WA 2QPTA 3EVRA 3DVMA 5KTYA 3DXLA 1CTRA 3AAJA 1L2OB 1YUTA 4MRXA 1J7PA 1LA3A 2ZRSA 1WRKA 2JRFA 1JF2A 2A4JA 3SJSA 3NHTA 1JWDA 1QIWA 4YBHB 2LM5A 2LMTA 1XA5A 3FE8A 4C0LA 3CR2A 4GNKB 2FJYA 1JFJA 1B8LA 1K90D 1DQEA 3LK0A 5ER4X 1MXLC 5FYXA 3BYAA 3A8RA 4F0ZB 3TUYB 2K0JA 4PE4A 1E8AA 3FWBA 1K9UA 1JF0A 1FW4A 1CLLA 1JFKA 1WLZA 3DD4A 2KFGA 1TTXA 5CPVA 1NPQA 1JC2A 1DF0B 2LUXA 4QJ4B 1KFUS 1KFXL 2ZNEA 4YI8A 3O4YA 1NCXA 5AEQA 2QDIA 1UHKA 1HT9A 1XVJA 2WC5A 3JVTC 1OMRA 4YRUA 1SW8A 2KQ6A 1U5IA 2KSPA 3S0BA 4AQIA 5HKZA 2KPHA 1AJ5A 1NX1A 3K21A 3PSRA 3KPXA 4ETOA 1MHOA 1AJ4A 4JPZB 2Y4QA 5HLOA 3S0AA 1VRKA 2NLNA 1J7QA 1QX5B 3GK2A 2NCOA 1DTLA 2SASA 1UHJA 2H61A 2KI4B 4N5XA 1EH2A 3BFHA 1ALWA 1J55A 1SRAA 4OKHA 2BKIB 2CNPA 3VB1A 3PJIA 2MA2A 1SL7A 1S6IA 1NCYA 1N65A 2EC6B 4N1GA 1QS7A 3DVEA 1PVAA 5KSZA 1NX3A 3C1VA 1TIZA 4P5OE 5DKRA 1Q80A 3CZ0A 2O60A 1OOGA 2LHIA 2K8MB 3DF0B 2KLEA 3I5IC 3F45A 3SG6A 3DYEA 3BUWB 4WRIA 4NDDA 1S6JA 4XJKB 3L4AA 5AXIA 5J3XA 3UO9A 4I5JA 1DJZA 1CFCA 3QMEA 5AFPA 1WY9A 4PHJA 3PALA 4TNCA 3V2LA 1IWQA 2F33A 3EK4A 2K2FA 2LMVA 3BOWB 4FTGA 3SG3A 2ZNDA 1TNPA 1RFJA 4P2YB 2BCXA 2LHLA 1L2OC 2JZIA 2K61A 1DEKA 2KNEA 1S5GY 1YRUB 3I5GC 2BE4A 4FQOA 3SS5A 1YUSA 1C07A 3SG7A 1DJWA 3BFAA 4GFTA 1JSAA 1DJHA 1WRLA 2K2AA 3D75A 1KSMA 4HRHA 1A75B 2OS8B 1ZACA 4NQGA 1PULA 2BE6A 2JNFA 4BY5A 4CLNA 2JQ6A 4PHNA 2JTTA 2KDHA 3BXKA 2KI6D 3O4XA 4A4CA 2BCAA 1PVBA 2MHHA 1LS8A 3EK7A 3KF9A 1RECA 1YX7A 1ALVA 2KAYA 1W9ZA 2Q4UA 1OW4A 2WCFA 4ZCVA 5I8NA 2O5GA 1OOJA 2P6BB 3DY9A 4OR9B 5AERA 1UHIA 3SIBA 1EL4A 2LVVA 2M7NA 4JWQA 1M39A 5TNCA 3S0DA 1H4BA 2ZFDA 5I2OA 1BG1A 1H8BA 4E68A 2WCJA 2JWWA 1MUXA 1XO5A 4DRWA 4R1EA 3B87A 1BJFA 1RJVA 1G8IA 2JXCA 2M7LA 4DIRA 1FI6A 1BR1B 4FQTA 5EL2A 1N2DA 3IF7A 2WCLA 1KWOB 2WOSA 2LVIA 3H4SE 5I2QA 4GGFC 1A2XA 2GTEA 4CIDA 1XFWO 1S6CA 1F70A 1J7OA 1FI5A 2K7BA 1Z4HA 1BOCA 3FE6A 1BU3A 5FI7A 5HKYA 3JTDB 1UWOA 1DGUA 2MRDA 2L50A 3HCMA 1ODBA 5KU1A 1M63B 2OPOA 3WHTB 3D78A 4CFQA 1SPYA 1EXRA 1ZOTB 2L0PA 1NSHA 1DGVA 3KEVA 2TN4A 3O78A 2KI6C 1C7WA 2QACA 1KSOA 1P28A 1CFFA 4U8DA 5D7FA 1CLMA 1G4YR 2JTZA 3I5HB 3BUXB 4OZDA 3CTNA 3SS3A 2PQLA 3D0YB 1ZMZA 3FIAA 4MEWA 1K95A 2OTGB 4PALA 1QV0A 1QX7A 1EJ3A 2WNDA 1U5IB 2IS9A 2R2IA 3OX5A 3B7AA 4AOMA 1J1DA 2P70A 1RWYA 1TOPA 2D8NA 3IVTA 1UHHA 4YGBB 1J1EA 1AHRA 1J7RA 1QX2A 1IQ3A 3CDNA 3NSIA 3RM1A 1WDCB 3SS4A 3D74A 1OE9B 2F8PA 2P71A 3E3RA 1GJYA 3I5GB 2KFHA 1DC1A 1OQPA 3B88A 3MSEB 2KI4C 3AKBA 3L47A 1YVHA 1K2HA 1MQ1A 2BCBA 2LAPA 1SCVA 2V53A 3R72A 3OGNA 2CXJA 4INWA 3EG5B 3EVUA 1B1GA 2G2BA 3LLEA 1MF8B 1TN4A 1Z2CB 1B7TY 2JC2A 1CM4A 1UURA 2L4IA 1IKUA 3IQQA 1SCMC 3OHMB 2KQYA 3I5IB 1F71A 1W7JB 1XFZO 2JNXA 3PATA 3ICBA 1YX8A 1A75A 1OOHA 1HQVA 4I5LB 3D77A 4USLA 1LKJA 5HYDA 1F55A 2H8VA 2LCPA 4WQ2A 1QLKA 3AAKA 4I5KA 1LVCD 1SNLA 3FS7A 2EC6C 1IH0A 4AQJA 3OBVA 2JULA 2CT9A 1QJTA 2LP3A 3OX6A 4IJ7A 4DUQA 2L2EA 1UP5A 1CLBA 3OP0A 4MN0A 2LP2A 4C0KA 1SCMB 3PFVA 2BBMA 1CMGA 1CDLA 2HQWA 2PYQA 1TNXA 1C3YA 2I18A 5FI6A 4MZJA 1OZOA 2GGMA 1ORGA 1GGZA 4QJ5B 1C3ZA 1K9PA 1KQVA 1XK4C 1JUOA 1BT6A 1OZSA 2JXLA 2H2KA 1AVSA 2L5XB 2ZRTA 2E30A 1JBAA 4C0JA 4MSPA 5IBWA 5HLVA 2K60A 3TDUA 2PASA 2L5YA 3BQ3A 1TWOA 1OOFA 1WDCC 2F2OA 4ORBB 1PRWA 1SY9A 1ZFSA 1PK0D 2WORA 3OB1B 4HRGA 2SCPA 2PALA 4PCWA 2KAXA 3TZ1A 4PE1A 3I5FB 3KO0A 1CDNA 1BMOA 1PALA 1YRTB 3UNWA 1KFXS 1KFUL 1DELA 2ISDA 1NX0A 3GK1A 1DJGA 1EG4A 1YVLA 2I2RE 2LNKA 3NSLA 3QRXA 1SBJA 1YURA 5I2LA 3TUYC 5DKQA 1IGVA 1K8UA 1G33A 2F2PA 2GGZA 2JT8A 2K7CA 1QXPA 2LC5A 2NCPA 2PRUA 3BUOB 2KLDA 3S0FA 1GGWA 1IJ5A 1K93D 4L9MA 3VROA 1L7ZA 3RZSA 2I7AA 2H61C 5JOLA 1KK8C 3HX4A 1NCZA 1MXEA 2WC6A 4YGCB 1D1OA 3B86A 2CCMA 1A4PA 3PN7C 1RROA 5D69A 1TUZA 1QVIZ 2FCEA 4HREE 2Y1MA 4MVFA 1M46A 2ZN8A 3L4LA 1B47A 4GUKA 1SMGA 2Q91A 3FE9A 4ORCB 2L98A 1DF0A 2AAOA 5BPJA 3TDIA 3AKAA 3WNXB 1KWOC 3WHUB 1A29A 3EK8A 4M2QA 2PMYA 2KYCA 1CDPA 1CKKA 1TCFA 2WCKA 4M2OA 1Y1XA 3PM2A 3DVKA 4YGDB 1MR8A 3CABA 1F4QA 1IQ5A 3O2PA 4INXA 1F54A 2MBXA 3WXAA 1AK8A 2M0RA 2PVBA 3PN7B 4OCIA 3CR5X 1T14A 2DOQA 4JD9A 4OV2A 3PLFB 1K96A 1KK8B 1RK9A 1SL8A 4ORAB 2M97A 4M2PA 3TS5C 1BODA 2M8UA 1F8HA 3D10A 1XFRA 3TDZA 1K94A 5F6TA 3CZ1A 2JT3A 4F7FA 3LK1A 4CFRA 4GGNA 1S26D 5CSFA 1FPWA 3CR4X 2LVKA 1GQMA 5FI2A 3LL8B 5HL1A 4Q04A 1LXFC 2QEVA 2CBLA 4PE0A 3PM8A 4A4BA 2OS8C 2BBNA 2RGIA 5HKWA 1B8RA 3B6XA 3BJHA 3ZWHA 3CYZA 1B8CA 2MAZA 1DVIA 3D73A 2M1UA 1V1GA 2WCBA 3CLNA 5ER5A 3VRQA 1EG3A 2HF5A 3R1PA 3GOFA 3ZNIA 1BR4B 2BAPA 1LINA 2HPSA 4YI9A 2LV7A 1AP4A 2K7OA 2YGUA 4OVNF 1R6PA 4ICBA 1UHNA 2M49B 3CZ2A 4GAOA 1W7IB 5CSIA 2NZ0A 2BNXA 4CPVA 1R2UA 3CWGA 1TRFA 3N7HA 5D3OA 2QEOA 2MJWB 4PHKA 1QTXA 1A03A 3RLZA 3R1VA 1M31A 3NXAA 1XFUO 2AUCA 2LUCA 3K1EA 4MBEA 2WC8A 1CFPA 1B4CA 1FF1A 2LE9B 3VGOA 1QLSA 4PE7A 1KK7Z 1NP8A 2BL0C 4PDZA 3SG5A 2BL0B 1SSEB 2Y5IA 1K9KA 3R1OA 1XFYO 2K7DA 1Y6WA 3DZTA 1CM1A 4WQ3A 4ZCUA 3SG4A 2BKHB 3VRNA 3KHEA 1GM0A 4N1FA 1V1FA 1XYDA 1YUUA 2ZN9A 1IJ6A 3D0YA 1S36A 2PSRA 4HSZA 2EGDA 4XJKA 2KBIA 1B7TZ 1PSBA 2WCEA 1IRJA 3OB2B 2MLFC 1SKTA 1CB1A 3VRPA 3BUNB 4UPGA 1BLQA 4GPLB 3NGVA 1S3PA 4KYNA 2GV5A 5I94A 2KOTA 3VRRA 2L4HA 3JVTB 2LANA 2QEHA 4DS7A 2L2CA 4BY4A 1SL9A 1Y0VH 1NX2A 1S1EA 2MLEC 2G9BA 2I94A 3NSKA 2WCHA 4JKTA 2KYFA 5DKNA 1DJYA 1Y1UA 1TNQA 3S0GA 3NHIA 2LLTA 4GGFA 1RTP1 3IQOA 3LCPC 1KK7Y 2NXQA 2OTGC 1OMDA 3D76A 2KBMA 1NIWA 2JPOA 2Y1NA 3S0EA 1SYMA 3I5HC 3SG2A 2EHBA 1NUBA 1QIVA 3BOWA 3SIAA 2CTNA 4YGEB 1FBVA 2JU0A 5K89A 1YTZC 2KAVA 3CGAA 1CMFA 3DF0A 2F3ZA 4YGAA 1QASA 3JTDC 1NWDA 1TCOB 1QWVA 2HQ8A 1DT7B 1TUJA 3NSOA 4QJ3B 5CSJA 4DCKA 1NYAA 4MZLA 4PHMA 4MZKA 2LMUA 4GBAA 3CS1A 1OSAA 2COLB 1XFXO 2WCMA 1OMVA 1M45A 1IG5A 1WRZA 1ZUZA 3BUMB 2KFFA 3DVJA 3M0WA 4MLWA 4MRYA 2KHNA 2FJUB 1BF5A 1KCYA 1IIOA 2LLSA 3CZTX 2QEBA 2AMIA 1XFVO 2VRGA 5DICA 1X02A 5PALA 1SR6C 5GQQC 1UUSA 2M9GA 1DJIA 3BFBA 3O6BA 4NDBA 1DJXA 1SK6D 1WLMA 1Y1AA 3FWCA 2JOJA 2ERBA 3GK4X 1KQMB 3EVVA 5CSNA 4XYNA
chains in the Genus database with same CATH topology
4I5NB 2ZKMX 1XK4A 1TNWA 1YR5A 1AUIB 2B1UA 2FCDA 1B9AA 2LLUA 4D1EA 1QV1A 2KGBC 1N0YA 2M29A 1S5GZ 2HETA 4IL1A 3TS5B 5JJGA 5AANA 1KQMC 1QVIY 3EKHA 2BECA 1MWNA 1QATA 2E6WA 1CNPA 2JPTA 1SR6B 2LVJA 5G08A 1CFDA 4JQ0D 3I5FC 2L51A 2F3YA 2FOTA 1F4OA 3A4UB 3EKJA 4NDCA 1C7VA 1PSRA 2JT0A 2M1KB 1DMOA 2KGRA 1LA0A 1CDMA 5B8IB 2M3WA 2QPTA 3EVRA 3DVMA 5KTYA 1CTRA 3AAJA 1L2OB 1YUTA 4MRXA 1J7PA 1LA3A 2ZRSA 1WRKA 2JRFA 1JF2A 2A4JA 3SJSA 1JWDA 1QIWA 4YBHB 2LM5A 2LMTA 1XA5A 4C0LA 3CR2A 4GNKB 1JFJA 1B8LA 1K90D 3LK0A 5ER4X 1MXLC 5FYXA 3BYAA 3A8RA 4F0ZB 3TUYB 2K0JA 4PE4A 1E8AA 3FWBA 1K9UA 1JF0A 1FW4A 1CLLA 1JFKA 1WLZA 3DD4A 2KFGA 1TTXA 5CPVA 1NPQA 1JC2A 1DF0B 2LUXA 4QJ4B 1KFUS 1KFXL 2ZNEA 4YI8A 3O4YA 1NCXA 5AEQA 1UHKA 1HT9A 1XVJA 3JVTC 1OMRA 4YRUA 1SW8A 2KQ6A 1U5IA 2KSPA 4AQIA 5HKZA 3K21A 1AJ5A 1NX1A 3PSRA 3KPXA 4ETOA 1MHOA 1AJ4A 4JPZB 2Y4QA 5HLOA 1VRKA 2NLNA 1J7QA 1QX5B 3GK2A 2NCOA 1DTLA 2SASA 1UHJA 2H61A 2KI4B 4N5XA 1EH2A 1ALWA 1J55A 1SRAA 4OKHA 2BKIB 2CNPA 2MA2A 1SL7A 1S6IA 1NCYA 1N65A 2EC6B 4N1GA 1QS7A 3DVEA 1PVAA 5KSZA 1NX3A 3C1VA 1TIZA 4P5OE 5DKRA 1Q80A 2O60A 2LHIA 2K8MB 3DF0B 3I5IC 3F45A 3SG6A 3BUWB 4WRIA 4NDDA 1S6JA 4XJKB 5J3XA 5AXIA 4I5JA 1DJZA 1CFCA 5AFPA 1WY9A 4PHJA 3PALA 4TNCA 1IWQA 2F33A 3EK4A 2K2FA 2LMVA 3BOWB 4FTGA 3SG3A 2ZNDA 1TNPA 1RFJA 4P2YB 2BCXA 2LHLA 1L2OC 2JZIA 2K61A 2KNEA 1S5GY 1YRUB 3I5GC 2BE4A 4FQOA 1YUSA 1C07A 3SG7A 1DJWA 4GFTA 1JSAA 1DJHA 1WRLA 2K2AA 1KSMA 4HRHA 1A75B 2OS8B 1ZACA 4NQGA 1PULA 2BE6A 2JNFA 4BY5A 4CLNA 2JQ6A 4PHNA 2JTTA 2KDHA 3BXKA 2KI6D 4A4CA 2BCAA 1PVBA 2MHHA 3EK7A 3KF9A 1RECA 1YX7A 1ALVA 2KAYA 2WCFA 2Q4UA 4ZCVA 5I8NA 2O5GA 1OOJA 2P6BB 4OR9B 5AERA 1UHIA 3SIBA 1EL4A 2LVVA 2M7NA 4JWQA 1M39A 5TNCA 1H8BA 1H4BA 2ZFDA 5I2OA 1BG1A 4E68A 2JWWA 1MUXA 1XO5A 4DRWA 4R1EA 1BJFA 1RJVA 1G8IA 2JXCA 2M7LA 4DIRA 1FI6A 1BR1B 1N2DA 3IF7A 3H4SE 1KWOB 2WOSA 2LVIA 5I2QA 4GGFC 1A2XA 4CIDA 1XFWO 1S6CA 1F70A 1J7OA 1FI5A 2K7BA 1BOCA 1BU3A 5HKYA 3JTDB 1UWOA 1DGUA 2MRDA 2L50A 3HCMA 1ODBA 5KU1A 1M63B 2OPOA 3WHTB 4CFQA 1SPYA 1EXRA 1ZOTB 2L0PA 1NSHA 1DGVA 3KEVA 2TN4A 3O78A 2KI6C 1C7WA 2QACA 1KSOA 1CFFA 4U8DA 5D7FA 1CLMA 1G4YR 2JTZA 3I5HB 3BUXB 3CTNA 3D0YB 1ZMZA 3FIAA 4MEWA 1K95A 2OTGB 4PALA 1QV0A 1QX7A 1EJ3A 2WNDA 1U5IB 2IS9A 2R2IA 3OX5A 4AOMA 1J1DA 1RWYA 1TOPA 2D8NA 1UHHA 4YGBB 1J1EA 1AHRA 1J7RA 1QX2A 1IQ3A 3NSIA 3RM1A 1WDCB 2F8PA 1OE9B 3E3RA 1GJYA 3I5GB 2KFHA 1OQPA 3MSEB 2KI4C 3AKBA 1YVHA 1K2HA 1MQ1A 2BCBA 2LAPA 1SCVA 2V53A 2CXJA 3EVUA 1B1GA 2G2BA 3LLEA 1MF8B 1TN4A 1B7TY 2JC2A 1CM4A 1UURA 2L4IA 1IKUA 3IQQA 1SCMC 3OHMB 2KQYA 3I5IB 1F71A 1W7JB 1XFZO 2JNXA 3PATA 3ICBA 1YX8A 1A75A 1HQVA 4I5LB 4USLA 5HYDA 1F55A 1LKJA 2LCPA 4WQ2A 1QLKA 3AAKA 4I5KA 1LVCD 1SNLA 3FS7A 2EC6C 1IH0A 4AQJA 2JULA 2CT9A 1QJTA 2LP3A 3OX6A 4DUQA 2L2EA 1UP5A 1CLBA 3OP0A 4MN0A 2LP2A 4C0KA 1SCMB 3PFVA 2BBMA 1CMGA 1CDLA 2HQWA 1TNXA 2I18A 4MZJA 1OZOA 2GGMA 1GGZA 4QJ5B 1K9PA 1KQVA 1XK4C 1BT6A 1JUOA 1OZSA 2JXLA 2H2KA 1AVSA 2L5XB 2ZRTA 2E30A 1JBAA 4C0JA 4MSPA 5IBWA 5HLVA 3TDUA 2PASA 3BQ3A 2F2OA 4ORBB 1WDCC 1PRWA 1SY9A 1ZFSA 1PK0D 2WORA 3OB1B 4HRGA 2SCPA 2PALA 4PCWA 2KAXA 3TZ1A 4PE1A 3I5FB 3KO0A 1CDNA 1BMOA 1PALA 1YRTB 1KFXS 1KFUL 2ISDA 1NX0A 3GK1A 1DJGA 1EG4A 1YVLA 2I2RE 2LNKA 3NSLA 3QRXA 1SBJA 1YURA 5I2LA 3TUYC 5DKQA 1IGVA 1K8UA 1G33A 2F2PA 2GGZA 2JT8A 2K7CA 1QXPA 2LC5A 2NCPA 2PRUA 3BUOB 1GGWA 1IJ5A 1K93D 4L9MA 3VROA 1L7ZA 2I7AA 2H61C 5JOLA 1KK8C 3HX4A 1NCZA 1MXEA 4YGCB 1D1OA 2CCMA 1A4PA 3PN7C 1RROA 5D69A 1QVIZ 2FCEA 4HREE 2Y1MA 4MVFA 1M46A 2ZN8A 1B47A 4GUKA 1SMGA 2Q91A 4ORCB 2L98A 1DF0A 2AAOA 5BPJA 3TDIA 3AKAA 3WNXB 1KWOC 3WHUB 1A29A 3EK8A 4M2QA 2PMYA 2KYCA 1CDPA 1CKKA 1TCFA 4M2OA 1Y1XA 3DVKA 4YGDB 1MR8A 1F4QA 1IQ5A 3O2PA 1F54A 2MBXA 3WXAA 1AK8A 2M0RA 2PVBA 3PN7B 4OCIA 3CR5X 4OV2A 2DOQA 3PLFB 1K96A 1KK8B 1RK9A 1SL8A 4ORAB 2M97A 4M2PA 3TS5C 1BODA 2M8UA 1F8HA 3D10A 3TDZA 1K94A 5F6TA 2JT3A 3LK1A 4CFRA 4GGNA 1S26D 5CSFA 1FPWA 3CR4X 2LVKA 1GQMA 3LL8B 4Q04A 1LXFC 2CBLA 4PE0A 3PM8A 4A4BA 2OS8C 2BBNA 2RGIA 5HKWA 1B8RA 3ZWHA 1B8CA 2MAZA 1DVIA 2M1UA 1V1GA 2WCBA 3CLNA 5ER5A 3VRQA 1EG3A 2HF5A 3GOFA 3ZNIA 1BR4B 2HPSA 1LINA 4YI9A 2LV7A 1AP4A 2K7OA 4OVNF 1R6PA 4ICBA 1UHNA 2M49B 4GAOA 1W7IB 5CSIA 2NZ0A 4CPVA 1R2UA 3CWGA 1TRFA 2MJWB 4PHKA 1QTXA 1A03A 3RLZA 1M31A 3NXAA 1XFUO 2AUCA 2LUCA 4MBEA 1B4CA 2WC8A 1CFPA 1FF1A 2LE9B 3VGOA 1QLSA 4PE7A 1KK7Z 1NP8A 2BL0C 4PDZA 3SG5A 2BL0B 2Y5IA 1K9KA 1XFYO 2K7DA 1Y6WA 1CM1A 4WQ3A 4ZCUA 3SG4A 2BKHB 3VRNA 3KHEA 4N1FA 1V1FA 1XYDA 1YUUA 2ZN9A 1IJ6A 3D0YA 1S36A 2PSRA 4HSZA 2EGDA 4XJKA 2KBIA 1B7TZ 1PSBA 2WCEA 1IRJA 3OB2B 2MLFC 1SKTA 1CB1A 3VRPA 3BUNB 4UPGA 1BLQA 4GPLB 1S3PA 2GV5A 2KOTA 3VRRA 2L4HA 3JVTB 2LANA 4DS7A 4BY4A 1SL9A 1Y0VH 1NX2A 1S1EA 2MLEC 2G9BA 2I94A 3NSKA 2KYFA 5DKNA 1DJYA 1Y1UA 1TNQA 2LLTA 4GGFA 1RTP1 3IQOA 3LCPC 1KK7Y 2NXQA 2OTGC 1OMDA 2KBMA 1NIWA 2Y1NA 1SYMA 3I5HC 3SG2A 2EHBA 1NUBA 1QIVA 3BOWA 3SIAA 2CTNA 4YGEB 1FBVA 2JU0A 5K89A 1YTZC 2KAVA 3CGAA 1CMFA 3DF0A 2F3ZA 4YGAA 1QASA 3JTDC 1NWDA 1TCOB 2HQ8A 1DT7B 4DCKA 3NSOA 4QJ3B 5CSJA 1NYAA 4MZLA 4PHMA 4MZKA 2LMUA 4GBAA 3CS1A 1OSAA 2COLB 1XFXO 1OMVA 1M45A 1IG5A 1WRZA 1ZUZA 3BUMB 2KFFA 3DVJA 3M0WA 4MLWA 4MRYA 2KHNA 2FJUB 1BF5A 1KCYA 2LLSA 3CZTX 2AMIA 1XFVO 2VRGA 1X02A 5PALA 1SR6C 5GQQC 1UUSA 2M9GA 1DJIA 3O6BA 4NDBA 1DJXA 1SK6D 1WLMA 1Y1AA 3FWCA 2JOJA 3GK4X 1KQMB 3EVVA 5CSNA 4XYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5N B;  2ZKM X;  1XK4 A;  1TNW A;  1YR5 A;  1AUI B;  2B1U A;  2FCD A;  1B9A A;  2LLU A;  4D1E A;  1QV1 A;  2KGB C;  1N0Y A;  2M29 A;  1S5G Z;  2HET A;  4IL1 A;  3TS5 B;  5JJG A;  5AAN A;  1KQM C;  1QVI Y;  3EKH A;  2BEC A;  1MWN A;  1QAT A;  2E6W A;  1CNP A;  2JPT A;  1SR6 B;  2LVJ A;  5G08 A;  1CFD A;  4JQ0 D;  3I5F C;  2L51 A;  2F3Y A;  2FOT A;  1F4O A;  3A4U B;  3EKJ A;  4NDC A;  1C7V A;  1PSR A;  2JT0 A;  2M1K B;  1DMO A;  2KGR A;  1LA0 A;  1CDM A;  5B8I B;  2M3W A;  2QPT A;  3EVR A;  3DVM A;  5KTY A;  1CTR A;  3AAJ A;  1L2O B;  1YUT A;  4MRX A;  1J7P A;  1LA3 A;  2ZRS A;  1WRK A;  2JRF A;  1JF2 A;  2A4J A;  3SJS A;  1JWD A;  1QIW A;  4YBH B;  2LM5 A;  2LMT A;  1XA5 A;  4C0L A;  3CR2 A;  4GNK B;  1JFJ A;  1B8L A;  1K90 D;  3LK0 A;  5ER4 X;  1MXL C;  5FYX A;  3BYA A;  3A8R A;  4F0Z B;  3TUY B;  2K0J A;  4PE4 A;  1E8A A;  3FWB A;  1K9U A;  1JF0 A;  1FW4 A;  1CLL A;  1JFK A;  1WLZ A;  3DD4 A;  2KFG A;  1TTX A;  5CPV A;  1NPQ A;  1JC2 A;  1DF0 B;  2LUX A;  4QJ4 B;  1KFU S;  1KFX L;  2ZNE A;  4YI8 A;  3O4Y A;  1NCX A;  5AEQ A;  1UHK A;  1HT9 A;  1XVJ A;  3JVT C;  1OMR A;  4YRU A;  1SW8 A;  2KQ6 A;  1U5I A;  2KSP A;  4AQI A;  5HKZ A;  3K21 A;  1AJ5 A;  1NX1 A;  3PSR A;  3KPX A;  4ETO A;  1MHO A;  1AJ4 A;  4JPZ B;  2Y4Q A;  5HLO A;  1VRK A;  2NLN A;  1J7Q A;  1QX5 B;  3GK2 A;  2NCO A;  1DTL A;  2SAS A;  1UHJ A;  2H61 A;  2KI4 B;  4N5X A;  1EH2 A;  1ALW A;  1J55 A;  1SRA A;  4OKH A;  2BKI B;  2CNP A;  2MA2 A;  1SL7 A;  1S6I A;  1NCY A;  1N65 A;  2EC6 B;  4N1G A;  1QS7 A;  3DVE A;  1PVA A;  5KSZ A;  1NX3 A;  3C1V A;  1TIZ A;  4P5O E;  5DKR A;  1Q80 A;  2O60 A;  2LHI A;  2K8M B;  3DF0 B;  3I5I C;  3F45 A;  3SG6 A;  3BUW B;  4WRI A;  4NDD A;  1S6J A;  4XJK B;  5J3X A;  5AXI A;  4I5J A;  1DJZ A;  1CFC A;  5AFP A;  1WY9 A;  4PHJ A;  3PAL A;  4TNC A;  1IWQ A;  2F33 A;  3EK4 A;  2K2F A;  2LMV A;  3BOW B;  4FTG A;  3SG3 A;  2ZND A;  1TNP A;  1RFJ A;  4P2Y B;  2BCX A;  2LHL A;  1L2O C;  2JZI A;  2K61 A;  2KNE A;  1S5G Y;  1YRU B;  3I5G C;  2BE4 A;  4FQO A;  1YUS A;  1C07 A;  3SG7 A;  1DJW A;  4GFT A;  1JSA A;  1DJH A;  1WRL A;  2K2A A;  1KSM A;  4HRH A;  1A75 B;  2OS8 B;  1ZAC A;  4NQG A;  1PUL A;  2BE6 A;  2JNF A;  4BY5 A;  4CLN A;  2JQ6 A;  4PHN A;  2JTT A;  2KDH A;  3BXK A;  2KI6 D;  4A4C A;  2BCA A;  1PVB A;  2MHH A;  3EK7 A;  3KF9 A;  1REC A;  1YX7 A;  1ALV A;  2KAY A;  2WCF A;  2Q4U A;  4ZCV A;  5I8N A;  2O5G A;  1OOJ A;  2P6B B;  4OR9 B;  5AER A;  1UHI A;  3SIB A;  1EL4 A;  2LVV A;  2M7N A;  4JWQ A;  1M39 A;  5TNC A;  1H8B A;  1H4B A;  2ZFD A;  5I2O A;  1BG1 A;  4E68 A;  2JWW A;  1MUX A;  1XO5 A;  4DRW A;  4R1E A;  1BJF A;  1RJV A;  1G8I A;  2JXC A;  2M7L A;  4DIR A;  1FI6 A;  1BR1 B;  1N2D A;  3IF7 A;  3H4S E;  1KWO B;  2WOS A;  2LVI A;  5I2Q A;  4GGF C;  1A2X A;  4CID A;  1XFW O;  1S6C A;  1F70 A;  1J7O A;  1FI5 A;  2K7B A;  1BOC A;  1BU3 A;  5HKY A;  3JTD B;  1UWO A;  1DGU A;  2MRD A;  2L50 A;  3HCM A;  1ODB A;  5KU1 A;  1M63 B;  2OPO A;  3WHT B;  4CFQ A;  1SPY A;  1EXR A;  1ZOT B;  2L0P A;  1NSH A;  1DGV A;  3KEV A;  2TN4 A;  3O78 A;  2KI6 C;  1C7W A;  2QAC A;  1KSO A;  1CFF A;  4U8D A;  5D7F A;  1CLM A;  1G4Y R;  2JTZ A;  3I5H B;  3BUX B;  3CTN A;  3D0Y B;  1ZMZ A;  3FIA A;  4MEW A;  1K95 A;  2OTG B;  4PAL A;  1QV0 A;  1QX7 A;  1EJ3 A;  2WND A;  1U5I B;  2IS9 A;  2R2I A;  3OX5 A;  4AOM A;  1J1D A;  1RWY A;  1TOP A;  2D8N A;  1UHH A;  4YGB B;  1J1E A;  1AHR A;  1J7R A;  1QX2 A;  1IQ3 A;  3NSI A;  3RM1 A;  1WDC B;  2F8P A;  1OE9 B;  3E3R A;  1GJY A;  3I5G B;  2KFH A;  1OQP A;  3MSE B;  2KI4 C;  3AKB A;  1YVH A;  1K2H A;  1MQ1 A;  2BCB A;  2LAP A;  1SCV A;  2V53 A;  2CXJ A;  3EVU A;  1B1G A;  2G2B A;  3LLE A;  1MF8 B;  1TN4 A;  1B7T Y;  2JC2 A;  1CM4 A;  1UUR A;  2L4I A;  1IKU A;  3IQQ A;  1SCM C;  3OHM B;  2KQY A;  3I5I B;  1F71 A;  1W7J B;  1XFZ O;  2JNX A;  3PAT A;  3ICB A;  1YX8 A;  1A75 A;  1HQV A;  4I5L B;  4USL A;  5HYD A;  1F55 A;  1LKJ A;  2LCP A;  4WQ2 A;  1QLK A;  3AAK A;  4I5K A;  1LVC D;  1SNL A;  3FS7 A;  2EC6 C;  1IH0 A;  4AQJ A;  2JUL A;  2CT9 A;  1QJT A;  2LP3 A;  3OX6 A;  4DUQ A;  2L2E A;  1UP5 A;  1CLB A;  3OP0 A;  4MN0 A;  2LP2 A;  4C0K A;  1SCM B;  3PFV A;  2BBM A;  1CMG A;  1CDL A;  2HQW A;  1TNX A;  2I18 A;  4MZJ A;  1OZO A;  2GGM A;  1GGZ A;  4QJ5 B;  1K9P A;  1KQV A;  1XK4 C;  1BT6 A;  1JUO A;  1OZS A;  2JXL A;  2H2K A;  1AVS A;  2L5X B;  2ZRT A;  2E30 A;  1JBA A;  4C0J A;  4MSP A;  5IBW A;  5HLV A;  3TDU A;  2PAS A;  3BQ3 A;  2F2O A;  4ORB B;  1WDC C;  1PRW A;  1SY9 A;  1ZFS A;  1PK0 D;  2WOR A;  3OB1 B;  4HRG A;  2SCP A;  2PAL A;  4PCW A;  2KAX A;  3TZ1 A;  4PE1 A;  3I5F B;  3KO0 A;  1CDN A;  1BMO A;  1PAL A;  1YRT B;  1KFX S;  1KFU L;  2ISD A;  1NX0 A;  3GK1 A;  1DJG A;  1EG4 A;  1YVL A;  2I2R E;  2LNK A;  3NSL A;  3QRX A;  1SBJ A;  1YUR A;  5I2L A;  3TUY C;  5DKQ A;  1IGV A;  1K8U A;  1G33 A;  2F2P A;  2GGZ A;  2JT8 A;  2K7C A;  1QXP A;  2LC5 A;  2NCP A;  2PRU A;  3BUO B;  1GGW A;  1IJ5 A;  1K93 D;  4L9M A;  3VRO A;  1L7Z A;  2I7A A;  2H61 C;  5JOL A;  1KK8 C;  3HX4 A;  1NCZ A;  1MXE A;  4YGC B;  1D1O A;  2CCM A;  1A4P A;  3PN7 C;  1RRO A;  5D69 A;  1QVI Z;  2FCE A;  4HRE E;  2Y1M A;  4MVF A;  1M46 A;  2ZN8 A;  1B47 A;  4GUK A;  1SMG A;  2Q91 A;  4ORC B;  2L98 A;  1DF0 A;  2AAO A;  5BPJ A;  3TDI A;  3AKA A;  3WNX B;  1KWO C;  3WHU B;  1A29 A;  3EK8 A;  4M2Q A;  2PMY A;  2KYC A;  1CDP A;  1CKK A;  1TCF A;  4M2O A;  1Y1X A;  3DVK A;  4YGD B;  1MR8 A;  1F4Q A;  1IQ5 A;  3O2P A;  1F54 A;  2MBX A;  3WXA A;  1AK8 A;  2M0R A;  2PVB A;  3PN7 B;  4OCI A;  3CR5 X;  4OV2 A;  2DOQ A;  3PLF B;  1K96 A;  1KK8 B;  1RK9 A;  1SL8 A;  4ORA B;  2M97 A;  4M2P A;  3TS5 C;  1BOD A;  2M8U A;  1F8H A;  3D10 A;  3TDZ A;  1K94 A;  5F6T A;  2JT3 A;  3LK1 A;  4CFR A;  4GGN A;  1S26 D;  5CSF A;  1FPW A;  3CR4 X;  2LVK A;  1GQM A;  3LL8 B;  4Q04 A;  1LXF C;  2CBL A;  4PE0 A;  3PM8 A;  4A4B A;  2OS8 C;  2BBN A;  2RGI A;  5HKW A;  1B8R A;  3ZWH A;  1B8C A;  2MAZ A;  1DVI A;  2M1U A;  1V1G A;  2WCB A;  3CLN A;  5ER5 A;  3VRQ A;  1EG3 A;  2HF5 A;  3GOF A;  3ZNI A;  1BR4 B;  2HPS A;  1LIN A;  4YI9 A;  2LV7 A;  1AP4 A;  2K7O A;  4OVN F;  1R6P A;  4ICB A;  1UHN A;  2M49 B;  4GAO A;  1W7I B;  5CSI A;  2NZ0 A;  4CPV A;  1R2U A;  3CWG A;  1TRF A;  2MJW B;  4PHK A;  1QTX A;  1A03 A;  3RLZ A;  1M31 A;  3NXA A;  1XFU O;  2AUC A;  2LUC A;  4MBE A;  1B4C A;  2WC8 A;  1CFP A;  1FF1 A;  2LE9 B;  3VGO A;  1QLS A;  4PE7 A;  1KK7 Z;  1NP8 A;  2BL0 C;  4PDZ A;  3SG5 A;  2BL0 B;  2Y5I A;  1K9K A;  1XFY O;  2K7D A;  1Y6W A;  1CM1 A;  4WQ3 A;  4ZCU A;  3SG4 A;  2BKH B;  3VRN A;  3KHE A;  4N1F A;  1V1F A;  1XYD A;  1YUU A;  2ZN9 A;  1IJ6 A;  3D0Y A;  1S36 A;  2PSR A;  4HSZ A;  2EGD A;  4XJK A;  2KBI A;  1B7T Z;  1PSB A;  2WCE A;  1IRJ A;  3OB2 B;  2MLF C;  1SKT A;  1CB1 A;  3VRP A;  3BUN B;  4UPG A;  1BLQ A;  4GPL B;  1S3P A;  2GV5 A;  2KOT A;  3VRR A;  2L4H A;  3JVT B;  2LAN A;  4DS7 A;  4BY4 A;  1SL9 A;  1Y0V H;  1NX2 A;  1S1E A;  2MLE C;  2G9B A;  2I94 A;  3NSK A;  2KYF A;  5DKN A;  1DJY A;  1Y1U A;  1TNQ A;  2LLT A;  4GGF A;  1RTP 1;  3IQO A;  3LCP C;  1KK7 Y;  2NXQ A;  2OTG C;  1OMD A;  2KBM A;  1NIW A;  2Y1N A;  1SYM A;  3I5H C;  3SG2 A;  2EHB A;  1NUB A;  1QIV A;  3BOW A;  3SIA A;  2CTN A;  4YGE B;  1FBV A;  2JU0 A;  5K89 A;  1YTZ C;  2KAV A;  3CGA A;  1CMF A;  3DF0 A;  2F3Z A;  4YGA A;  1QAS A;  3JTD C;  1NWD A;  1TCO B;  2HQ8 A;  1DT7 B;  4DCK A;  3NSO A;  4QJ3 B;  5CSJ A;  1NYA A;  4MZL A;  4PHM A;  4MZK A;  2LMU A;  4GBA A;  3CS1 A;  1OSA A;  2COL B;  1XFX O;  1OMV A;  1M45 A;  1IG5 A;  1WRZ A;  1ZUZ A;  3BUM B;  2KFF A;  3DVJ A;  3M0W A;  4MLW A;  4MRY A;  2KHN A;  2FJU B;  1BF5 A;  1KCY A;  2LLS A;  3CZT X;  2AMI A;  1XFV O;  2VRG A;  1X02 A;  5PAL A;  1SR6 C;  5GQQ C;  1UUS A;  2M9G A;  1DJI A;  3O6B A;  4NDB A;  1DJX A;  1SK6 D;  1WLM A;  1Y1A A;  3FWC A;  2JOJ A;  3GK4 X;  1KQM B;  3EVV A;  5CSN A;  4XYN A; 
#chains in the Genus database with same CATH topology
 4I5N B;  4PT1 A;  2ZKM X;  1XK4 A;  1TNW A;  1YR5 A;  3Q8I A;  1AUI B;  2B1U A;  2FCD A;  1B9A A;  2LLU A;  4D1E A;  1QV1 A;  2KGB C;  1N0Y A;  2M29 A;  1S5G Z;  2HET A;  4IL1 A;  3TS5 B;  5JJG A;  5AAN A;  1KQM C;  1QVI Y;  3EKH A;  2BEC A;  1MWN A;  1QAT A;  2E6W A;  1CNP A;  2JPT A;  1SR6 B;  2LVJ A;  5G08 A;  1CFD A;  4JQ0 D;  3I5F C;  2L51 A;  2F3Y A;  2FOT A;  1F4O A;  3A4U B;  3EKJ A;  4NDC A;  1C7V A;  1OOI X;  1PSR A;  2JT0 A;  2M1K B;  1DMO A;  2KGR A;  1LA0 A;  1CDM A;  5B8I B;  2M3W A;  2QPT A;  3EVR A;  3DVM A;  5KTY A;  3DXL A;  1CTR A;  3AAJ A;  1L2O B;  1YUT A;  4MRX A;  1J7P A;  1LA3 A;  2ZRS A;  1WRK A;  2JRF A;  1JF2 A;  2A4J A;  3SJS A;  3NHT A;  1JWD A;  1QIW A;  4YBH B;  2LM5 A;  2LMT A;  1XA5 A;  3FE8 A;  4C0L A;  3CR2 A;  4GNK B;  2FJY A;  1JFJ A;  1B8L A;  1K90 D;  1DQE A;  3LK0 A;  5ER4 X;  1MXL C;  5FYX A;  3BYA A;  3A8R A;  4F0Z B;  3TUY B;  2K0J A;  4PE4 A;  1E8A A;  3FWB A;  1K9U A;  1JF0 A;  1FW4 A;  1CLL A;  1JFK A;  1WLZ A;  3DD4 A;  2KFG A;  1TTX A;  5CPV A;  1NPQ A;  1JC2 A;  1DF0 B;  2LUX A;  4QJ4 B;  1KFU S;  1KFX L;  2ZNE A;  4YI8 A;  3O4Y A;  1NCX A;  5AEQ A;  2QDI A;  1UHK A;  1HT9 A;  1XVJ A;  2WC5 A;  3JVT C;  1OMR A;  4YRU A;  1SW8 A;  2KQ6 A;  1U5I A;  2KSP A;  3S0B A;  4AQI A;  5HKZ A;  2KPH A;  1AJ5 A;  1NX1 A;  3K21 A;  3PSR A;  3KPX A;  4ETO A;  1MHO A;  1AJ4 A;  4JPZ B;  2Y4Q A;  5HLO A;  3S0A A;  1VRK A;  2NLN A;  1J7Q A;  1QX5 B;  3GK2 A;  2NCO A;  1DTL A;  2SAS A;  1UHJ A;  2H61 A;  2KI4 B;  4N5X A;  1EH2 A;  3BFH A;  1ALW A;  1J55 A;  1SRA A;  4OKH A;  2BKI B;  2CNP A;  3VB1 A;  3PJI A;  2MA2 A;  1SL7 A;  1S6I A;  1NCY A;  1N65 A;  2EC6 B;  4N1G A;  1QS7 A;  3DVE A;  1PVA A;  5KSZ A;  1NX3 A;  3C1V A;  1TIZ A;  4P5O E;  5DKR A;  1Q80 A;  3CZ0 A;  2O60 A;  1OOG A;  2LHI A;  2K8M B;  3DF0 B;  2KLE A;  3I5I C;  3F45 A;  3SG6 A;  3DYE A;  3BUW B;  4WRI A;  4NDD A;  1S6J A;  4XJK B;  3L4A A;  5AXI A;  5J3X A;  3UO9 A;  4I5J A;  1DJZ A;  1CFC A;  3QME A;  5AFP A;  1WY9 A;  4PHJ A;  3PAL A;  4TNC A;  3V2L A;  1IWQ A;  2F33 A;  3EK4 A;  2K2F A;  2LMV A;  3BOW B;  4FTG A;  3SG3 A;  2ZND A;  1TNP A;  1RFJ A;  4P2Y B;  2BCX A;  2LHL A;  1L2O C;  2JZI A;  2K61 A;  1DEK A;  2KNE A;  1S5G Y;  1YRU B;  3I5G C;  2BE4 A;  4FQO A;  3SS5 A;  1YUS A;  1C07 A;  3SG7 A;  1DJW A;  3BFA A;  4GFT A;  1JSA A;  1DJH A;  1WRL A;  2K2A A;  3D75 A;  1KSM A;  4HRH A;  1A75 B;  2OS8 B;  1ZAC A;  4NQG A;  1PUL A;  2BE6 A;  2JNF A;  4BY5 A;  4CLN A;  2JQ6 A;  4PHN A;  2JTT A;  2KDH A;  3BXK A;  2KI6 D;  3O4X A;  4A4C A;  2BCA A;  1PVB A;  2MHH A;  1LS8 A;  3EK7 A;  3KF9 A;  1REC A;  1YX7 A;  1ALV A;  2KAY A;  1W9Z A;  2Q4U A;  1OW4 A;  2WCF A;  4ZCV A;  5I8N A;  2O5G A;  1OOJ A;  2P6B B;  3DY9 A;  4OR9 B;  5AER A;  1UHI A;  3SIB A;  1EL4 A;  2LVV A;  2M7N A;  4JWQ A;  1M39 A;  5TNC A;  3S0D A;  1H4B A;  2ZFD A;  5I2O A;  1BG1 A;  1H8B A;  4E68 A;  2WCJ A;  2JWW A;  1MUX A;  1XO5 A;  4DRW A;  4R1E A;  3B87 A;  1BJF A;  1RJV A;  1G8I A;  2JXC A;  2M7L A;  4DIR A;  1FI6 A;  1BR1 B;  4FQT A;  5EL2 A;  1N2D A;  3IF7 A;  2WCL A;  1KWO B;  2WOS A;  2LVI A;  3H4S E;  5I2Q A;  4GGF C;  1A2X A;  2GTE A;  4CID A;  1XFW O;  1S6C A;  1F70 A;  1J7O A;  1FI5 A;  2K7B A;  1Z4H A;  1BOC A;  3FE6 A;  1BU3 A;  5FI7 A;  5HKY A;  3JTD B;  1UWO A;  1DGU A;  2MRD A;  2L50 A;  3HCM A;  1ODB A;  5KU1 A;  1M63 B;  2OPO A;  3WHT B;  3D78 A;  4CFQ A;  1SPY A;  1EXR A;  1ZOT B;  2L0P A;  1NSH A;  1DGV A;  3KEV A;  2TN4 A;  3O78 A;  2KI6 C;  1C7W A;  2QAC A;  1KSO A;  1P28 A;  1CFF A;  4U8D A;  5D7F A;  1CLM A;  1G4Y R;  2JTZ A;  3I5H B;  3BUX B;  4OZD A;  3CTN A;  3SS3 A;  2PQL A;  3D0Y B;  1ZMZ A;  3FIA A;  4MEW A;  1K95 A;  2OTG B;  4PAL A;  1QV0 A;  1QX7 A;  1EJ3 A;  2WND A;  1U5I B;  2IS9 A;  2R2I A;  3OX5 A;  3B7A A;  4AOM A;  1J1D A;  2P70 A;  1RWY A;  1TOP A;  2D8N A;  3IVT A;  1UHH A;  4YGB B;  1J1E A;  1AHR A;  1J7R A;  1QX2 A;  1IQ3 A;  3CDN A;  3NSI A;  3RM1 A;  1WDC B;  3SS4 A;  3D74 A;  1OE9 B;  2F8P A;  2P71 A;  3E3R A;  1GJY A;  3I5G B;  2KFH A;  1DC1 A;  1OQP A;  3B88 A;  3MSE B;  2KI4 C;  3AKB A;  3L47 A;  1YVH A;  1K2H A;  1MQ1 A;  2BCB A;  2LAP A;  1SCV A;  2V53 A;  3R72 A;  3OGN A;  2CXJ A;  4INW A;  3EG5 B;  3EVU A;  1B1G A;  2G2B A;  3LLE A;  1MF8 B;  1TN4 A;  1Z2C B;  1B7T Y;  2JC2 A;  1CM4 A;  1UUR A;  2L4I A;  1IKU A;  3IQQ A;  1SCM C;  3OHM B;  2KQY A;  3I5I B;  1F71 A;  1W7J B;  1XFZ O;  2JNX A;  3PAT A;  3ICB A;  1YX8 A;  1A75 A;  1OOH A;  1HQV A;  4I5L B;  3D77 A;  4USL A;  1LKJ A;  5HYD A;  1F55 A;  2H8V A;  2LCP A;  4WQ2 A;  1QLK A;  3AAK A;  4I5K A;  1LVC D;  1SNL A;  3FS7 A;  2EC6 C;  1IH0 A;  4AQJ A;  3OBV A;  2JUL A;  2CT9 A;  1QJT A;  2LP3 A;  3OX6 A;  4IJ7 A;  4DUQ A;  2L2E A;  1UP5 A;  1CLB A;  3OP0 A;  4MN0 A;  2LP2 A;  4C0K A;  1SCM B;  3PFV A;  2BBM A;  1CMG A;  1CDL A;  2HQW A;  2PYQ A;  1TNX A;  1C3Y A;  2I18 A;  5FI6 A;  4MZJ A;  1OZO A;  2GGM A;  1ORG A;  1GGZ A;  4QJ5 B;  1C3Z A;  1K9P A;  1KQV A;  1XK4 C;  1JUO A;  1BT6 A;  1OZS A;  2JXL A;  2H2K A;  1AVS A;  2L5X B;  2ZRT A;  2E30 A;  1JBA A;  4C0J A;  4MSP A;  5IBW A;  5HLV A;  2K60 A;  3TDU A;  2PAS A;  2L5Y A;  3BQ3 A;  1TWO A;  1OOF A;  1WDC C;  2F2O A;  4ORB B;  1PRW A;  1SY9 A;  1ZFS A;  1PK0 D;  2WOR A;  3OB1 B;  4HRG A;  2SCP A;  2PAL A;  4PCW A;  2KAX A;  3TZ1 A;  4PE1 A;  3I5F B;  3KO0 A;  1CDN A;  1BMO A;  1PAL A;  1YRT B;  3UNW A;  1KFX S;  1KFU L;  1DEL A;  2ISD A;  1NX0 A;  3GK1 A;  1DJG A;  1EG4 A;  1YVL A;  2I2R E;  2LNK A;  3NSL A;  3QRX A;  1SBJ A;  1YUR A;  5I2L A;  3TUY C;  5DKQ A;  1IGV A;  1K8U A;  1G33 A;  2F2P A;  2GGZ A;  2JT8 A;  2K7C A;  1QXP A;  2LC5 A;  2NCP A;  2PRU A;  3BUO B;  2KLD A;  3S0F A;  1GGW A;  1IJ5 A;  1K93 D;  4L9M A;  3VRO A;  1L7Z A;  3RZS A;  2I7A A;  2H61 C;  5JOL A;  1KK8 C;  3HX4 A;  1NCZ A;  1MXE A;  2WC6 A;  4YGC B;  1D1O A;  3B86 A;  2CCM A;  1A4P A;  3PN7 C;  1RRO A;  5D69 A;  1TUZ A;  1QVI Z;  2FCE A;  4HRE E;  2Y1M A;  4MVF A;  1M46 A;  2ZN8 A;  3L4L A;  1B47 A;  4GUK A;  1SMG A;  2Q91 A;  3FE9 A;  4ORC B;  2L98 A;  1DF0 A;  2AAO A;  5BPJ A;  3TDI A;  3AKA A;  3WNX B;  1KWO C;  3WHU B;  1A29 A;  3EK8 A;  4M2Q A;  2PMY A;  2KYC A;  1CDP A;  1CKK A;  1TCF A;  2WCK A;  4M2O A;  1Y1X A;  3PM2 A;  3DVK A;  4YGD B;  1MR8 A;  3CAB A;  1F4Q A;  1IQ5 A;  3O2P A;  4INX A;  1F54 A;  2MBX A;  3WXA A;  1AK8 A;  2M0R A;  2PVB A;  3PN7 B;  4OCI A;  3CR5 X;  1T14 A;  2DOQ A;  4JD9 A;  4OV2 A;  3PLF B;  1K96 A;  1KK8 B;  1RK9 A;  1SL8 A;  4ORA B;  2M97 A;  4M2P A;  3TS5 C;  1BOD A;  2M8U A;  1F8H A;  3D10 A;  1XFR A;  3TDZ A;  1K94 A;  5F6T A;  3CZ1 A;  2JT3 A;  4F7F A;  3LK1 A;  4CFR A;  4GGN A;  1S26 D;  5CSF A;  1FPW A;  3CR4 X;  2LVK A;  1GQM A;  5FI2 A;  3LL8 B;  5HL1 A;  4Q04 A;  1LXF C;  2QEV A;  2CBL A;  4PE0 A;  3PM8 A;  4A4B A;  2OS8 C;  2BBN A;  2RGI A;  5HKW A;  1B8R A;  3B6X A;  3BJH A;  3ZWH A;  3CYZ A;  1B8C A;  2MAZ A;  1DVI A;  3D73 A;  2M1U A;  1V1G A;  2WCB A;  3CLN A;  5ER5 A;  3VRQ A;  1EG3 A;  2HF5 A;  3R1P A;  3GOF A;  3ZNI A;  1BR4 B;  2BAP A;  1LIN A;  2HPS A;  4YI9 A;  2LV7 A;  1AP4 A;  2K7O A;  2YGU A;  4OVN F;  1R6P A;  4ICB A;  1UHN A;  2M49 B;  3CZ2 A;  4GAO A;  1W7I B;  5CSI A;  2NZ0 A;  2BNX A;  4CPV A;  1R2U A;  3CWG A;  1TRF A;  3N7H A;  5D3O A;  2QEO A;  2MJW B;  4PHK A;  1QTX A;  1A03 A;  3RLZ A;  3R1V A;  1M31 A;  3NXA A;  1XFU O;  2AUC A;  2LUC A;  3K1E A;  4MBE A;  2WC8 A;  1CFP A;  1B4C A;  1FF1 A;  2LE9 B;  3VGO A;  1QLS A;  4PE7 A;  1KK7 Z;  1NP8 A;  2BL0 C;  4PDZ A;  3SG5 A;  2BL0 B;  1SSE B;  2Y5I A;  1K9K A;  3R1O A;  1XFY O;  2K7D A;  1Y6W A;  3DZT A;  1CM1 A;  4WQ3 A;  4ZCU A;  3SG4 A;  2BKH B;  3VRN A;  3KHE A;  1GM0 A;  4N1F A;  1V1F A;  1XYD A;  1YUU A;  2ZN9 A;  1IJ6 A;  3D0Y A;  1S36 A;  2PSR A;  4HSZ A;  2EGD A;  4XJK A;  2KBI A;  1B7T Z;  1PSB A;  2WCE A;  1IRJ A;  3OB2 B;  2MLF C;  1SKT A;  1CB1 A;  3VRP A;  3BUN B;  4UPG A;  1BLQ A;  4GPL B;  3NGV A;  1S3P A;  4KYN A;  2GV5 A;  5I94 A;  2KOT A;  3VRR A;  2L4H A;  3JVT B;  2LAN A;  2QEH A;  4DS7 A;  2L2C A;  4BY4 A;  1SL9 A;  1Y0V H;  1NX2 A;  1S1E A;  2MLE C;  2G9B A;  2I94 A;  3NSK A;  2WCH A;  4JKT A;  2KYF A;  5DKN A;  1DJY A;  1Y1U A;  1TNQ A;  3S0G A;  3NHI A;  2LLT A;  4GGF A;  1RTP 1;  3IQO A;  3LCP C;  1KK7 Y;  2NXQ A;  2OTG C;  1OMD A;  3D76 A;  2KBM A;  1NIW A;  2JPO A;  2Y1N A;  3S0E A;  1SYM A;  3I5H C;  3SG2 A;  2EHB A;  1NUB A;  1QIV A;  3BOW A;  3SIA A;  2CTN A;  4YGE B;  1FBV A;  2JU0 A;  5K89 A;  1YTZ C;  2KAV A;  3CGA A;  1CMF A;  3DF0 A;  2F3Z A;  4YGA A;  1QAS A;  3JTD C;  1NWD A;  1TCO B;  1QWV A;  2HQ8 A;  1DT7 B;  1TUJ A;  3NSO A;  4QJ3 B;  5CSJ A;  4DCK A;  1NYA A;  4MZL A;  4PHM A;  4MZK A;  2LMU A;  4GBA A;  3CS1 A;  1OSA A;  2COL B;  1XFX O;  2WCM A;  1OMV A;  1M45 A;  1IG5 A;  1WRZ A;  1ZUZ A;  3BUM B;  2KFF A;  3DVJ A;  3M0W A;  4MLW A;  4MRY A;  2KHN A;  2FJU B;  1BF5 A;  1KCY A;  1IIO A;  2LLS A;  3CZT X;  2QEB A;  2AMI A;  1XFV O;  2VRG A;  5DIC A;  1X02 A;  5PAL A;  1SR6 C;  5GQQ C;  1UUS A;  2M9G A;  1DJI A;  3BFB A;  3O6B A;  4NDB A;  1DJX A;  1SK6 D;  1WLM A;  1Y1A A;  3FWC A;  2JOJ A;  2ERB A;  3GK4 X;  1KQM B;  3EVV A;  5CSN A;  4XYN A; 
#chains in the Genus database with same CATH homology
 4I5N B;  2ZKM X;  1XK4 A;  1TNW A;  1YR5 A;  1AUI B;  2B1U A;  2FCD A;  1B9A A;  2LLU A;  4D1E A;  1QV1 A;  2KGB C;  1N0Y A;  2M29 A;  1S5G Z;  2HET A;  4IL1 A;  3TS5 B;  5JJG A;  5AAN A;  1KQM C;  1QVI Y;  3EKH A;  2BEC A;  1MWN A;  1QAT A;  2E6W A;  1CNP A;  2JPT A;  1SR6 B;  2LVJ A;  5G08 A;  1CFD A;  4JQ0 D;  3I5F C;  2L51 A;  2F3Y A;  2FOT A;  1F4O A;  3A4U B;  3EKJ A;  4NDC A;  1C7V A;  1PSR A;  2JT0 A;  2M1K B;  1DMO A;  2KGR A;  1LA0 A;  1CDM A;  5B8I B;  2M3W A;  2QPT A;  3EVR A;  3DVM A;  5KTY A;  1CTR A;  3AAJ A;  1L2O B;  1YUT A;  4MRX A;  1J7P A;  1LA3 A;  2ZRS A;  1WRK A;  2JRF A;  1JF2 A;  2A4J A;  3SJS A;  1JWD A;  1QIW A;  4YBH B;  2LM5 A;  2LMT A;  1XA5 A;  4C0L A;  3CR2 A;  4GNK B;  1JFJ A;  1B8L A;  1K90 D;  3LK0 A;  5ER4 X;  1MXL C;  5FYX A;  3BYA A;  3A8R A;  4F0Z B;  3TUY B;  2K0J A;  4PE4 A;  1E8A A;  3FWB A;  1K9U A;  1JF0 A;  1FW4 A;  1CLL A;  1JFK A;  1WLZ A;  3DD4 A;  2KFG A;  1TTX A;  5CPV A;  1NPQ A;  1JC2 A;  1DF0 B;  2LUX A;  4QJ4 B;  1KFU S;  1KFX L;  2ZNE A;  4YI8 A;  3O4Y A;  1NCX A;  5AEQ A;  1UHK A;  1HT9 A;  1XVJ A;  3JVT C;  1OMR A;  4YRU A;  1SW8 A;  2KQ6 A;  1U5I A;  2KSP A;  4AQI A;  5HKZ A;  3K21 A;  1AJ5 A;  1NX1 A;  3PSR A;  3KPX A;  4ETO A;  1MHO A;  1AJ4 A;  4JPZ B;  2Y4Q A;  5HLO A;  1VRK A;  2NLN A;  1J7Q A;  1QX5 B;  3GK2 A;  2NCO A;  1DTL A;  2SAS A;  1UHJ A;  2H61 A;  2KI4 B;  4N5X A;  1EH2 A;  1ALW A;  1J55 A;  1SRA A;  4OKH A;  2BKI B;  2CNP A;  2MA2 A;  1SL7 A;  1S6I A;  1NCY A;  1N65 A;  2EC6 B;  4N1G A;  1QS7 A;  3DVE A;  1PVA A;  5KSZ A;  1NX3 A;  3C1V A;  1TIZ A;  4P5O E;  5DKR A;  1Q80 A;  2O60 A;  2LHI A;  2K8M B;  3DF0 B;  3I5I C;  3F45 A;  3SG6 A;  3BUW B;  4WRI A;  4NDD A;  1S6J A;  4XJK B;  5J3X A;  5AXI A;  4I5J A;  1DJZ A;  1CFC A;  5AFP A;  1WY9 A;  4PHJ A;  3PAL A;  4TNC A;  1IWQ A;  2F33 A;  3EK4 A;  2K2F A;  2LMV A;  3BOW B;  4FTG A;  3SG3 A;  2ZND A;  1TNP A;  1RFJ A;  4P2Y B;  2BCX A;  2LHL A;  1L2O C;  2JZI A;  2K61 A;  2KNE A;  1S5G Y;  1YRU B;  3I5G C;  2BE4 A;  4FQO A;  1YUS A;  1C07 A;  3SG7 A;  1DJW A;  4GFT A;  1JSA A;  1DJH A;  1WRL A;  2K2A A;  1KSM A;  4HRH A;  1A75 B;  2OS8 B;  1ZAC A;  4NQG A;  1PUL A;  2BE6 A;  2JNF A;  4BY5 A;  4CLN A;  2JQ6 A;  4PHN A;  2JTT A;  2KDH A;  3BXK A;  2KI6 D;  4A4C A;  2BCA A;  1PVB A;  2MHH A;  3EK7 A;  3KF9 A;  1REC A;  1YX7 A;  1ALV A;  2KAY A;  2WCF A;  2Q4U A;  4ZCV A;  5I8N A;  2O5G A;  1OOJ A;  2P6B B;  4OR9 B;  5AER A;  1UHI A;  3SIB A;  1EL4 A;  2LVV A;  2M7N A;  4JWQ A;  1M39 A;  5TNC A;  1H8B A;  1H4B A;  2ZFD A;  5I2O A;  1BG1 A;  4E68 A;  2JWW A;  1MUX A;  1XO5 A;  4DRW A;  4R1E A;  1BJF A;  1RJV A;  1G8I A;  2JXC A;  2M7L A;  4DIR A;  1FI6 A;  1BR1 B;  1N2D A;  3IF7 A;  3H4S E;  1KWO B;  2WOS A;  2LVI A;  5I2Q A;  4GGF C;  1A2X A;  4CID A;  1XFW O;  1S6C A;  1F70 A;  1J7O A;  1FI5 A;  2K7B A;  1BOC A;  1BU3 A;  5HKY A;  3JTD B;  1UWO A;  1DGU A;  2MRD A;  2L50 A;  3HCM A;  1ODB A;  5KU1 A;  1M63 B;  2OPO A;  3WHT B;  4CFQ A;  1SPY A;  1EXR A;  1ZOT B;  2L0P A;  1NSH A;  1DGV A;  3KEV A;  2TN4 A;  3O78 A;  2KI6 C;  1C7W A;  2QAC A;  1KSO A;  1CFF A;  4U8D A;  5D7F A;  1CLM A;  1G4Y R;  2JTZ A;  3I5H B;  3BUX B;  3CTN A;  3D0Y B;  1ZMZ A;  3FIA A;  4MEW A;  1K95 A;  2OTG B;  4PAL A;  1QV0 A;  1QX7 A;  1EJ3 A;  2WND A;  1U5I B;  2IS9 A;  2R2I A;  3OX5 A;  4AOM A;  1J1D A;  1RWY A;  1TOP A;  2D8N A;  1UHH A;  4YGB B;  1J1E A;  1AHR A;  1J7R A;  1QX2 A;  1IQ3 A;  3NSI A;  3RM1 A;  1WDC B;  2F8P A;  1OE9 B;  3E3R A;  1GJY A;  3I5G B;  2KFH A;  1OQP A;  3MSE B;  2KI4 C;  3AKB A;  1YVH A;  1K2H A;  1MQ1 A;  2BCB A;  2LAP A;  1SCV A;  2V53 A;  2CXJ A;  3EVU A;  1B1G A;  2G2B A;  3LLE A;  1MF8 B;  1TN4 A;  1B7T Y;  2JC2 A;  1CM4 A;  1UUR A;  2L4I A;  1IKU A;  3IQQ A;  1SCM C;  3OHM B;  2KQY A;  3I5I B;  1F71 A;  1W7J B;  1XFZ O;  2JNX A;  3PAT A;  3ICB A;  1YX8 A;  1A75 A;  1HQV A;  4I5L B;  4USL A;  5HYD A;  1F55 A;  1LKJ A;  2LCP A;  4WQ2 A;  1QLK A;  3AAK A;  4I5K A;  1LVC D;  1SNL A;  3FS7 A;  2EC6 C;  1IH0 A;  4AQJ A;  2JUL A;  2CT9 A;  1QJT A;  2LP3 A;  3OX6 A;  4DUQ A;  2L2E A;  1UP5 A;  1CLB A;  3OP0 A;  4MN0 A;  2LP2 A;  4C0K A;  1SCM B;  3PFV A;  2BBM A;  1CMG A;  1CDL A;  2HQW A;  1TNX A;  2I18 A;  4MZJ A;  1OZO A;  2GGM A;  1GGZ A;  4QJ5 B;  1K9P A;  1KQV A;  1XK4 C;  1BT6 A;  1JUO A;  1OZS A;  2JXL A;  2H2K A;  1AVS A;  2L5X B;  2ZRT A;  2E30 A;  1JBA A;  4C0J A;  4MSP A;  5IBW A;  5HLV A;  3TDU A;  2PAS A;  3BQ3 A;  2F2O A;  4ORB B;  1WDC C;  1PRW A;  1SY9 A;  1ZFS A;  1PK0 D;  2WOR A;  3OB1 B;  4HRG A;  2SCP A;  2PAL A;  4PCW A;  2KAX A;  3TZ1 A;  4PE1 A;  3I5F B;  3KO0 A;  1CDN A;  1BMO A;  1PAL A;  1YRT B;  1KFX S;  1KFU L;  2ISD A;  1NX0 A;  3GK1 A;  1DJG A;  1EG4 A;  1YVL A;  2I2R E;  2LNK A;  3NSL A;  3QRX A;  1SBJ A;  1YUR A;  5I2L A;  3TUY C;  5DKQ A;  1IGV A;  1K8U A;  1G33 A;  2F2P A;  2GGZ A;  2JT8 A;  2K7C A;  1QXP A;  2LC5 A;  2NCP A;  2PRU A;  3BUO B;  1GGW A;  1IJ5 A;  1K93 D;  4L9M A;  3VRO A;  1L7Z A;  2I7A A;  2H61 C;  5JOL A;  1KK8 C;  3HX4 A;  1NCZ A;  1MXE A;  4YGC B;  1D1O A;  2CCM A;  1A4P A;  3PN7 C;  1RRO A;  5D69 A;  1QVI Z;  2FCE A;  4HRE E;  2Y1M A;  4MVF A;  1M46 A;  2ZN8 A;  1B47 A;  4GUK A;  1SMG A;  2Q91 A;  4ORC B;  2L98 A;  1DF0 A;  2AAO A;  5BPJ A;  3TDI A;  3AKA A;  3WNX B;  1KWO C;  3WHU B;  1A29 A;  3EK8 A;  4M2Q A;  2PMY A;  2KYC A;  1CDP A;  1CKK A;  1TCF A;  4M2O A;  1Y1X A;  3DVK A;  4YGD B;  1MR8 A;  1F4Q A;  1IQ5 A;  3O2P A;  1F54 A;  2MBX A;  3WXA A;  1AK8 A;  2M0R A;  2PVB A;  3PN7 B;  4OCI A;  3CR5 X;  4OV2 A;  2DOQ A;  3PLF B;  1K96 A;  1KK8 B;  1RK9 A;  1SL8 A;  4ORA B;  2M97 A;  4M2P A;  3TS5 C;  1BOD A;  2M8U A;  1F8H A;  3D10 A;  3TDZ A;  1K94 A;  5F6T A;  2JT3 A;  3LK1 A;  4CFR A;  4GGN A;  1S26 D;  5CSF A;  1FPW A;  3CR4 X;  2LVK A;  1GQM A;  3LL8 B;  4Q04 A;  1LXF C;  2CBL A;  4PE0 A;  3PM8 A;  4A4B A;  2OS8 C;  2BBN A;  2RGI A;  5HKW A;  1B8R A;  3ZWH A;  1B8C A;  2MAZ A;  1DVI A;  2M1U A;  1V1G A;  2WCB A;  3CLN A;  5ER5 A;  3VRQ A;  1EG3 A;  2HF5 A;  3GOF A;  3ZNI A;  1BR4 B;  2HPS A;  1LIN A;  4YI9 A;  2LV7 A;  1AP4 A;  2K7O A;  4OVN F;  1R6P A;  4ICB A;  1UHN A;  2M49 B;  4GAO A;  1W7I B;  5CSI A;  2NZ0 A;  4CPV A;  1R2U A;  3CWG A;  1TRF A;  2MJW B;  4PHK A;  1QTX A;  1A03 A;  3RLZ A;  1M31 A;  3NXA A;  1XFU O;  2AUC A;  2LUC A;  4MBE A;  1B4C A;  2WC8 A;  1CFP A;  1FF1 A;  2LE9 B;  3VGO A;  1QLS A;  4PE7 A;  1KK7 Z;  1NP8 A;  2BL0 C;  4PDZ A;  3SG5 A;  2BL0 B;  2Y5I A;  1K9K A;  1XFY O;  2K7D A;  1Y6W A;  1CM1 A;  4WQ3 A;  4ZCU A;  3SG4 A;  2BKH B;  3VRN A;  3KHE A;  4N1F A;  1V1F A;  1XYD A;  1YUU A;  2ZN9 A;  1IJ6 A;  3D0Y A;  1S36 A;  2PSR A;  4HSZ A;  2EGD A;  4XJK A;  2KBI A;  1B7T Z;  1PSB A;  2WCE A;  1IRJ A;  3OB2 B;  2MLF C;  1SKT A;  1CB1 A;  3VRP A;  3BUN B;  4UPG A;  1BLQ A;  4GPL B;  1S3P A;  2GV5 A;  2KOT A;  3VRR A;  2L4H A;  3JVT B;  2LAN A;  4DS7 A;  4BY4 A;  1SL9 A;  1Y0V H;  1NX2 A;  1S1E A;  2MLE C;  2G9B A;  2I94 A;  3NSK A;  2KYF A;  5DKN A;  1DJY A;  1Y1U A;  1TNQ A;  2LLT A;  4GGF A;  1RTP 1;  3IQO A;  3LCP C;  1KK7 Y;  2NXQ A;  2OTG C;  1OMD A;  2KBM A;  1NIW A;  2Y1N A;  1SYM A;  3I5H C;  3SG2 A;  2EHB A;  1NUB A;  1QIV A;  3BOW A;  3SIA A;  2CTN A;  4YGE B;  1FBV A;  2JU0 A;  5K89 A;  1YTZ C;  2KAV A;  3CGA A;  1CMF A;  3DF0 A;  2F3Z A;  4YGA A;  1QAS A;  3JTD C;  1NWD A;  1TCO B;  2HQ8 A;  1DT7 B;  4DCK A;  3NSO A;  4QJ3 B;  5CSJ A;  1NYA A;  4MZL A;  4PHM A;  4MZK A;  2LMU A;  4GBA A;  3CS1 A;  1OSA A;  2COL B;  1XFX O;  1OMV A;  1M45 A;  1IG5 A;  1WRZ A;  1ZUZ A;  3BUM B;  2KFF A;  3DVJ A;  3M0W A;  4MLW A;  4MRY A;  2KHN A;  2FJU B;  1BF5 A;  1KCY A;  2LLS A;  3CZT X;  2AMI A;  1XFV O;  2VRG A;  1X02 A;  5PAL A;  1SR6 C;  5GQQ C;  1UUS A;  2M9G A;  1DJI A;  3O6B A;  4NDB A;  1DJX A;  1SK6 D;  1WLM A;  1Y1A A;  3FWC A;  2JOJ A;  3GK4 X;  1KQM B;  3EVV A;  5CSN A;  4XYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...