3BXKA

Crystal structure of the p/q-type calcium channel (cav2.1) iq domain and ca2+calmodulin complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
142
structure length
137
Chain Sequence
b'LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Crystal structure of the P/Q-type calcium channel (CaV2.1) IQ domain and CA2+calmodulin complex
rcsb
source organism Rattus norvegicus
molecule tags Membrane protein, signaling protein
total genus 47
structure length 137
sequence length 142
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3bxkA00
1B7TZ 3RLZA 3VROA 1BMOA 3H4SE 2KOTA 1CFCA 3TS5C 2M3WA 1KK8C 3D0YB 3FS7A 3I5FC 3NSKA 4YGEB 1FF1A 3OX5A 1TIZA 3BQ3A 2K7OA 4MZJA 1LA0A 4ZCUA 3KPXA 1G33A 2LVKA 2ZNEA 3VRPA 4R1EA 3I5GB 1OMVA 3NSOA 4CPVA 2EC6C 1YUSA 1J7OA 2E30A 4MLWA 3PATA 2KQYA 1M46A 2LVVA 3LL8B 4ZCVA 2BBNA 1SR6C 2P6BB 1J1DA 3KO0A 1ZACA 2M49B 3I5HB 2MJWB 3A8RA 1S5GY 3DVEA 2M0RA 1F70A 2JC2A 1DJGA 1S5GZ 4BY5A 2LC5A 2BL0C 1IWQA 3LK0A 4PE1A 2NXQA 5BPJA 1XFVO 3OHMB 2MHHA 1TNWA 1UP5A 5JOLA 2LANA 2MA2A 1K93D 1QASA 2BECA 1M63B 1CB1A 2FCDA 2LM5A 3GK2A 3TS5B 1J7QA 1E8AA 3LCPC 1A4PA 3SG2A 2KDHA 2O5GA 1B9AA 2M7LA 2JZIA 2LVIA 1TN4A 3O4YA 1KFUS 1WY9A 2H61A 1PVAA 2K2FA 2CNPA 1YRTB 1AUIB 2GGMA 1IKUA 1PRWA 1VRKA 1L7ZA 4GFTA 1BODA 2HETA 5HKWA 2EC6B 3WXAA 4MN0A 1WDCC 2LVJA 4DS7A 2F3ZA 5AFPA 2LHIA 1SR6B 1UHNA 1OQPA 1XYDA 1GJYA 1WRKA 2Y5IA 1QX2A 2BE6A 1RFJA 1IQ5A 1HT9A 1MF8B 5PALA 4D1EA 2Y1MA 2KSPA 1NPQA 2BL0B 1ALWA 1GQMA 1K9KA 1RECA 3AAJA 3GK1A 3FIAA 1QX5B 2M29A 4GNKB 1XO5A 1SY9A 1ZMZA 1LVCD 5FYXA 3CTNA 1SBJA 2JXCA 1S6JA 1F4OA 1A2XA 1WLZA 1TCOB 4XJKB 2ZKMX 5CSJA 5ER4X 2PRUA 3M0WA 1CDPA 1NIWA 1YUTA 1J55A 2NLNA 1WLMA 1OOJA 3CS1A 4NDDA 1KSOA 1M45A 2KI6C 1A75B 4M2QA 4PHMA 1YRUB 1J7PA 1FI5A 4M2OA 2I2RE 1A03A 1S36A 3CZTX 1BU3A 1KFXS 2Y4QA 3TUYC 1SNLA 4GGNA 1DJHA 2L4IA 2LLSA 4JWQA 1B4CA 1NX0A 2LHLA 1N0YA 4OV2A 2KGRA 1SL9A 5DKNA 5F6TA 1XFWO 2M1KB 1H8BA 2MAZA 1XFXO 3NSLA 1UURA 1UWOA 1WDCB 1TOPA 1DGUA 2F2OA 2GV5A 1NX1A 2L98A 1B8LA 1PK0D 2M1UA 2KI4C 4OKHA 1S1EA 2L2EA 2WC8A 3C1VA 2RGIA 1C07A 4BY4A 1CDMA 1UHHA 2SASA 2L5XB 3I5IC 1QLKA 1M39A 1G4YR 4PE0A 1UHKA 3WHTB 4MZLA 1IJ6A 1NSHA 1UHIA 5JJGA 4TNCA 1UUSA 1M31A 3TDUA 1PALA 4CLNA 3GOFA 1S3PA 2ZN8A 2K0JA 3HX4A 2FOTA 4XYNA 2WOSA 4P2YB 3SG7A 5KU1A 1LINA 2V53A 1DT7B 2TN4A 4NQGA 3D0YA 1N2DA 2JRFA 2PASA 3SG4A 1F4QA 4ORAB 3TUYB 1BLQA 1SMGA 4N5XA 4YGBB 1SPYA 2LLUA 1G8IA 1BR4B 2L51A 3OB1B 1YURA 2AMIA 2KAVA 1LKJA 2KNEA 2MBXA 2LLTA 1QX7A 2Y1NA 3RM1A 2EHBA 3PN7C 2DOQA 2PMYA 2MLFC 1DGVA 2K8MB 2ZN9A 1DTLA 3FWBA 3AKAA 1OSAA 3KHEA 1F71A 2KI4B 1MHOA 1V1FA 1K9PA 2B1UA 2K7DA 2QACA 3TDZA 4OVNF 1JFKA 3SG6A 2JXLA 3KF9A 4ETOA 3JVTC 2CT9A 1XA5A 3I5IB 1AJ5A 3BOWA 3O2PA 1BF5A 2F3YA 3O78A 1GGZA 2LP2A 1DJIA 4E68A 1NWDA 1PSBA 2CXJA 1DVIA 4ORBB 2KGBC 3BOWB 1C7WA 4I5JA 4C0JA 1CDNA 2NCPA 1SK6D 3BXKA 2F2PA 4N1FA 4DIRA 2KYFA 3K21A 3EK7A 3PALA 1F55A 1DJWA 1CLBA 1QS7A 1L2OB 2R2IA 2KI6D 4HSZA 4YI8A 4YRUA 1Y1AA 4A4BA 1JF0A 2JOJA 2G2BA 5CSFA 2AAOA 1K94A 4USLA 3SG5A 1K95A 4U8DA 1RROA 4QJ4B 1B1GA 4GPLB 2K7CA 3PN7B 5CSNA 5D69A 1TNQA 4OR9B 1H4BA 1XFYO 3WHUB 1SYMA 1KWOC 1CM1A 4GBAA 2L4HA 3SIBA 3KEVA 3EK8A 2IS9A 2I18A 2WCFA 5I2OA 3JVTB 2I7AA 1IH0A 4F0ZB 2BKHB 4GGFC 1QV0A 2BCXA 4JQ0D 4HRGA 3IQOA 3BUNB 3EVUA 3CGAA 1BG1A 1PSRA 4C0KA 2MLEC 4L9MA 1EG4A 2M97A 5DKRA 3EVRA 4DUQA 3OP0A 4IL1A 3HCMA 1U5IA 4PHKA 2FJUB 4ICBA 1XFZO 4XJKA 1EJ3A 1YUUA 2LAPA 4YBHB 1QJTA 1J7RA 2HPSA 3DVJA 1A75A 1DF0A 1S6IA 1U5IB 1QLSA 1KFUL 2BKIB 2K61A 4GUKA 5CPVA 3ZWHA 1DJYA 5TNCA 2Q91A 1X02A 1NX3A 1QVIY 1TCFA 1DF0B 1YX8A 1JWDA 5J3XA 4MEWA 1OMDA 2F8PA 3ICBA 1CFPA 1KWOB 4GGFA 2L50A 4MRYA 1CLLA 2BE4A 3BUMB 3ZNIA 5HKYA 1JC2A 2KHNA 2JTTA 1K8UA 3SIAA 2JPTA 2LUCA 3PLFB 1AVSA 3LK1A 4M2PA 2KFFA 3JTDC 4HRHA 5I8NA 2KBMA 1ALVA 4JPZB 1DJZA 1LXFC 4DCKA 2ISDA 3FWCA 1MUXA 1KK7Y 2PALA 3NSIA 5AEQA 2JNFA 2LCPA 2M7NA 2D8NA 2LMVA 4MRXA 2K7BA 1CMFA 1FPWA 2ZRSA 1S26D 3SJSA 2H2KA 2L0PA 1D1OA 3F45A 1CLMA 2CTNA 3DVMA 1YR5A 1R6PA 1ZFSA 4OCIA 3PM8A 2HQ8A 3NXAA 5HKZA 4DRWA 4AOMA 2CCMA 3A4UB 4CFRA 4QJ5B 1C7VA 1CKKA 2BBMA 1KQVA 1JUOA 2A4JA 4YGDB 1WRZA 3IQQA 1L2OC 1XVJA 2PSRA 5HYDA 1SL7A 1KCYA 2LMUA 4YGAA 4I5KA 1Y0VH 1S6CA 4P5OE 1YVLA 2LP3A 1YVHA 2BCBA 2COLB 4FQOA 3DD4A 1OE9B 1K2HA 5D7FA 5G08A 2LNKA 4MZKA 2ZNDA 1CTRA 3DVKA 2K2AA 4A4CA 1BR1B 2FCEA 3VRRA 1RWYA 3JTDB 1YX7A 2LMTA 1SKTA 1IJ5A 1V1GA 2EGDA 3VRNA 1R2UA 4YGCB 2KFGA 3PSRA 1SL8A 1SCMC 1HQVA 1BT6A 3CWGA 1B7TY 1NYAA 3WNXB 1K9UA 1B8CA 1GGWA 3GK4X 3EKJA 1JBAA 2OPOA 1BOCA 2GGZA 2JULA 3MSEB 3IF7A 5AXIA 4FTGA 1IRJA 1QATA 1AK8A 2KFHA 1F8HA 2JWWA 4WRIA 1JFJA 1UHJA 1FBVA 1CNPA 2KAXA 1QV1A 4CIDA 2Q4UA 5B8IB 3D10A 1AHRA 1NP8A 3AAKA 1CFFA 3BUWB 1PVBA 4YI9A 1KQMC 1Q80A 2H61C 1IGVA 1Y1UA 2ZRTA 2OTGC 3O6BA 4PE7A 5AERA 4PE4A 2G9BA 3LLEA 1RK9A 3SG3A 3DF0A 3EVVA 2OS8C 1SW8A 2NCOA 2JT0A 1ZOTB 4WQ3A 2E6WA 2JNXA 2VRGA 4N1GA 4PCWA 2WCEA 2LE9B 4MBEA 3DF0B 4PDZA 1SCMB 1B47A 3VGOA 1NUBA 2KBIA 3CR2A 1A29A 3OB2B 4GAOA 4PHJA 3QRXA 1XFUO 5CSIA 1MXEA 5IBWA 1QXPA 1F54A 1KK8B 3I5FB 1TNXA 2LV7A 1SCVA 5I2LA 5DKQA 3EKHA 1EL4A 1Y1XA 1PULA 1ZUZA 5GQQC 1NCZA 1IG5A 2SCPA 1XK4C 4AQJA 1SRAA 1CFDA 2JT8A 1TRFA 1KQMB 4I5LB 5ER5A 4AQIA 3OX6A 4ORCB 2OTGB 1BJFA 2JT3A 1QVIZ 3CLNA 5AANA 2NZ0A 2QPTA 1IQ3A 2OS8B 2PVBA 1NCXA 1EH2A 1Y6WA 3CR4X 2M8UA 1AP4A 1OZSA 2WCBA 3VRQA 1RJVA 4PALA 2ZFDA 2JQ6A 1DJXA 5K89A 5HLVA 3TZ1A 4MSPA 3BUOB 1MWNA 1MQ1A 1RTP1 2WNDA 4I5NB 1CDLA 1FI6A 1FW4A 2JU0A 3AKBA 5KSZA 5KTYA 1KK7Z 1XK4A 2KQ6A 1QIWA 1W7JB 1N65A 5I2QA 1AJ4A 2I94A 1JSAA 2KAYA 2KYCA 1NX2A 2BCAA 1MR8A 1KFXL 1TNPA 1TTXA 4UPGA 2F33A 1NCYA 4PHNA 1OZOA 4NDBA 1QIVA 3EK4A 2LUXA 1J1EA 3TDIA 1MXLC 1YTZC 4Q04A 1W7IB 1ODBA 2CBLA 1JF2A 1KSMA 4NDCA 3E3RA 1EG3A 4CFQA 1OMRA 4HREE 2O60A 3I5GC 1DMOA 1B8RA 2HF5A 4QJ3B 2M9GA 1K90D 4MVFA 3BYAA 4C0LA 1QTXA 2HQWA 1WRLA 2MRDA 5HLOA 1CMGA 3I5HC 2JTZA 1K96A 1CM4A 3CR5X 3BUXB 1EXRA 1LA3A 3PFVA 2AUCA 2WORA 4WQ2A
chains in the Genus database with same CATH superfamily
1B7TZ 3RLZA 3VROA 1BMOA 3H4SE 2KOTA 1CFCA 3TS5C 2M3WA 1KK8C 3D0YB 3FS7A 3I5FC 3NSKA 4YGEB 1FF1A 3OX5A 1TIZA 2L2CA 3BQ3A 2K7OA 4MZJA 1LA0A 4ZCUA 2K60A 3KPXA 1G33A 2LVKA 2QEBA 2ZNEA 3VRPA 4R1EA 3I5GB 1OMVA 3NSOA 4CPVA 2EC6C 1YUSA 3S0DA 1J7OA 2E30A 4MLWA 3PATA 2KQYA 1M46A 2LVVA 3LL8B 4ZCVA 2WC5A 2BBNA 1SR6C 2P6BB 1J1DA 3KO0A 1ZACA 2M49B 3I5HB 4FQTA 2MJWB 3A8RA 1S5GY 3DVEA 2M0RA 3PJIA 1F70A 2JC2A 1DJGA 1S5GZ 4BY5A 2ERBA 3BFAA 2LC5A 2BL0C 1IWQA 3LK0A 4PE1A 2NXQA 5BPJA 1XFVO 3OHMB 2MHHA 1TNWA 1UP5A 5JOLA 2LANA 2MA2A 3EG5B 4JD9A 1K93D 1QASA 2BECA 1M63B 1CB1A 1IIOA 2FCDA 2LM5A 3GK2A 3TS5B 1J7QA 1E8AA 3FE8A 3LCPC 1A4PA 3SG2A 2KDHA 2O5GA 1B9AA 2M7LA 2JZIA 3R1PA 2LVIA 1TN4A 3O4YA 1KFUS 1WY9A 2H61A 1OOHA 1PVAA 2CNPA 2K2FA 1YRTB 1AUIB 5EL2A 2GGMA 1IKUA 1PRWA 1VRKA 1L7ZA 3B6XA 4GFTA 1BODA 2HETA 3SS5A 5HKWA 2EC6B 3WXAA 4MN0A 1WDCC 2LVJA 4DS7A 2F3ZA 5AFPA 2LHIA 1GM0A 1SR6B 1UHNA 1OQPA 1XYDA 1GJYA 1WRKA 2Y5IA 1QX2A 2BE6A 1RFJA 1IQ5A 1HT9A 1MF8B 5PALA 3V2LA 4D1EA 2Y1MA 2KSPA 1NPQA 2BL0B 1ALWA 1GQMA 1K9KA 1RECA 3AAJA 3GK1A 3FIAA 1QX5B 2M29A 4GNKB 1XO5A 1SY9A 1ZMZA 1LVCD 5FYXA 3R1VA 3CTNA 1SBJA 5DICA 2JXCA 1S6JA 1F4OA 1A2XA 1WLZA 1TCOB 4XJKB 2ZKMX 5CSJA 5ER4X 2PRUA 3M0WA 1CDPA 1NIWA 1YUTA 2KPHA 1J55A 2NLNA 1WLMA 1OOJA 3CS1A 1XFRA 3IVTA 4NDDA 1KSOA 1M45A 2KI6C 1A75B 4M2QA 4PHMA 1YRUB 1J7PA 1FI5A 4M2OA 2I2RE 1A03A 1S36A 3CZTX 1BU3A 1KFXS 2Y4QA 3TUYC 1SNLA 4GGNA 1DJHA 2L4IA 2LLSA 4JWQA 1B4CA 1NX0A 1QWVA 2LHLA 1N0YA 4OV2A 2KGRA 1SL9A 5DKNA 5F6TA 1XFWO 2M1KB 4QJ4B 1H8BA 2MAZA 3D73A 1XFXO 3NSLA 1UURA 3D78A 1UWOA 1SSEB 2WCJA 1WDCB 1TOPA 1DGUA 2F2OA 2GV5A 1NX1A 2L98A 1B8LA 3OBVA 1PK0D 1OOGA 2M1UA 2KI4C 4OKHA 1S1EA 2L2EA 2WC8A 3C1VA 2RGIA 1C07A 4BY4A 1CDMA 1UHHA 2YGUA 2SASA 2L5XB 1TUZA 3I5IC 1QLKA 1M39A 1G4YR 4PE0A 1UHKA 3WHTB 4MZLA 1IJ6A 1NSHA 1UHIA 5JJGA 5D3OA 4TNCA 1TWOA 1UUSA 1M31A 3TDUA 1PALA 4CLNA 1DELA 3GOFA 1S3PA 2ZN8A 2K0JA 2WCHA 3HX4A 2FOTA 4XYNA 2WOSA 4P2YB 3SG7A 5KU1A 1LINA 2V53A 1DT7B 2TN4A 4NQGA 3D0YA 1N2DA 2JRFA 2PASA 3B88A 3SG4A 1F4QA 4ORAB 1C3ZA 3TUYB 1BLQA 1SMGA 4N5XA 4YGBB 1SPYA 2LLUA 1G8IA 1BR4B 3BJHA 2L5YA 2L51A 3OB1B 1YURA 2AMIA 2KAVA 1LKJA 2KNEA 3FE9A 2MBXA 2LLTA 1QX7A 3B86A 2Y1NA 3RM1A 2EHBA 3PN7C 2DOQA 2PMYA 2MLFC 1DGVA 2K8MB 2ZN9A 1DTLA 3FWBA 3AKAA 1OSAA 3KHEA 3UO9A 1F71A 2KI4B 1MHOA 1V1FA 1K9PA 2B1UA 2K7DA 2QACA 4PT1A 3TDZA 3L47A 4OVNF 3BFBA 1JFKA 3SG6A 2JXLA 3KF9A 4ETOA 2WC6A 3JVTC 2CT9A 1XA5A 3I5IB 1AJ5A 3BOWA 3O2PA 1BF5A 2F3YA 3O78A 1GGZA 2LP2A 1DJIA 4E68A 1NWDA 1PSBA 2CXJA 1DVIA 4ORBB 3SG5A 2KGBC 3BOWB 1C7WA 4I5JA 4C0JA 1CDNA 2NCPA 1SK6D 3BXKA 2F2PA 4N1FA 4DIRA 2KYFA 1P28A 3K21A 3EK7A 3PALA 3S0FA 1F55A 1DJWA 1CLBA 1QS7A 1L2OB 2R2IA 2KI6D 4HSZA 3D74A 4YI8A 4YRUA 1Y1AA 4A4BA 1JF0A 2JOJA 2G2BA 3QMEA 2AAOA 1K94A 1OOFA 3L4AA 1K95A 4U8DA 1RROA 4USLA 5CSFA 5FI2A 3S0EA 1B1GA 4GPLB 2K7CA 3PN7B 5CSNA 5D69A 1TNQA 4OR9B 2JPOA 1H4BA 1XFYO 3WHUB 1SYMA 4INXA 1DQEA 1KWOC 1CM1A 2FJYA 2L4HA 2P70A 4GBAA 3SIBA 3KEVA 3NHTA 3EK8A 2IS9A 2I18A 2WCFA 3DYEA 5I2OA 3JVTB 2I7AA 1IH0A 4F0ZB 2BKHB 3B7AA 4GGFC 1QV0A 2BCXA 4JQ0D 3CZ1A 4HRGA 4JKTA 3RZSA 3IQOA 3BUNB 3EVUA 3CGAA 1BG1A 1PSRA 4C0KA 2MLEC 4L9MA 1EG4A 2M97A 5DKRA 3SS4A 3EVRA 4DUQA 3OP0A 4IL1A 3HCMA 1U5IA 4PHKA 2FJUB 4ICBA 1XFZO 4XJKA 1EJ3A 1YUUA 1Z2CB 2LAPA 4YBHB 1QJTA 1J7RA 2HPSA 3DVJA 1A75A 1DF0A 1S6IA 1U5IB 1QLSA 1KFUL 2BKIB 2K61A 4GUKA 5CPVA 3ZWHA 1DJYA 5TNCA 2Q91A 1X02A 1NX3A 1QVIY 3L4LA 1TCFA 1DF0B 1YX8A 1JWDA 5J3XA 2KLEA 4MEWA 1OMDA 2F8PA 3ICBA 2H8VA 1CFPA 1KWOB 4GGFA 2L50A 4MRYA 1CLLA 2BE4A 3BUMB 3ZNIA 5HKYA 1JC2A 2KLDA 2KHNA 2JTTA 1K8UA 3SIAA 3OGNA 2JPTA 2LUCA 3PLFB 1AVSA 3LK1A 4M2PA 2KFFA 3JTDC 4HRHA 5I8NA 2KBMA 1ALVA 1T14A 4JPZB 1DJZA 1LXFC 4DCKA 2ISDA 3FWCA 1MUXA 1KK7Y 2PALA 3NSIA 5AEQA 2JNFA 2LCPA 2M7NA 2D8NA 2LMVA 4MRXA 2K7BA 3S0AA 1CMFA 2ZRSA 3Q8IA 1S26D 1FPWA 3SJSA 2H2KA 3PM2A 2L0PA 3CZ2A 1OOIX 1D1OA 3F45A 1CLMA 2CTNA 3DVMA 1YR5A 1R6PA 1ZFSA 2GTEA 4OCIA 3PM8A 2HQ8A 3NXAA 5HKZA 2BNXA 4DRWA 4AOMA 2CCMA 3A4UB 4CFRA 4QJ5B 1C7VA 1CKKA 2QDIA 2BBMA 1KQVA 1JUOA 2A4JA 4YGDB 1WRZA 3IQQA 1L2OC 1XVJA 2PSRA 5HYDA 1SL7A 1KCYA 3DZTA 2LMUA 1LS8A 4YGAA 4I5KA 1Y0VH 1S6CA 4P5OE 1YVLA 2LP3A 1YVHA 2BCBA 2COLB 4FQOA 3DD4A 1OE9B 1K2HA 5D7FA 5G08A 2LNKA 4MZKA 2ZNDA 1CTRA 3CABA 3DVKA 2K2AA 4A4CA 1BR1B 2FCEA 3VRRA 1RWYA 3JTDB 1YX7A 2LMTA 1SKTA 1C3YA 1IJ5A 3CDNA 1V1GA 2EGDA 3K1EA 3VRNA 1R2UA 4YGCB 2KFGA 3PSRA 1SL8A 1SCMC 1HQVA 1BT6A 3CWGA 1B7TY 4KYNA 1NYAA 3WNXB 1K9UA 3DY9A 1Z4HA 1B8CA 1GGWA 3GK4X 3EKJA 1JBAA 2OPOA 1BOCA 2GGZA 2JULA 3MSEB 3IF7A 5AXIA 4FTGA 1IRJA 1QATA 3S0BA 2KFHA 1AK8A 3UNWA 1F8HA 3FE6A 2JWWA 4WRIA 1JFJA 1UHJA 1FBVA 1CNPA 2KAXA 2WCLA 1QV1A 4CIDA 3B87A 2Q4UA 5B8IB 3D10A 1AHRA 1NP8A 1DC1A 3AAKA 1CFFA 3BUWB 1PVBA 4YI9A 1KQMC 1Q80A 2H61C 1IGVA 1Y1UA 2ZRTA 2OTGC 3O6BA 4PE7A 5AERA 4PE4A 1W9ZA 2G9BA 3LLEA 1RK9A 3D76A 3SG3A 3DF0A 3EVVA 2OS8C 3BFHA 1SW8A 2NCOA 2JT0A 1ZOTB 4IJ7A 4WQ3A 2E6WA 2JNXA 2VRGA 2PYQA 4N1GA 4PCWA 2WCEA 2LE9B 3DXLA 4MBEA 3DF0B 4PDZA 1SCMB 1B47A 3VGOA 1NUBA 2KBIA 3CR2A 1A29A 3OB2B 4GAOA 4PHJA 3QRXA 1DEKA 1XFUO 5FI7A 5CSIA 1MXEA 5IBWA 1QXPA 2P71A 1ORGA 2WCKA 1KK8B 3I5FB 1F54A 1TNXA 2LV7A 5HL1A 3N7HA 3O4XA 1SCVA 5FI6A 5I2LA 3D75A 5DKQA 2BAPA 3EKHA 1EL4A 1Y1XA 2QEHA 1PULA 1ZUZA 3R72A 5GQQC 1NCZA 1IG5A 2SCPA 1XK4C 4AQJA 1SRAA 1CFDA 2JT8A 1TRFA 1KQMB 4I5LB 5ER5A 4AQIA 3OX6A 4ORCB 2OTGB 1BJFA 2JT3A 1QVIZ 3CLNA 5AANA 2NZ0A 2QPTA 1IQ3A 2OS8B 2PVBA 1NCXA 1EH2A 1Y6WA 3CR4X 3D77A 2M8UA 1AP4A 1OZSA 2WCBA 3VRQA 1RJVA 4PALA 2ZFDA 2JQ6A 3S0GA 1DJXA 5K89A 5HLVA 3TZ1A 4MSPA 3BUOB 1TUJA 1MWNA 3VB1A 1MQ1A 1RTP1 2WNDA 4I5NB 1CDLA 2QEOA 1FW4A 2JU0A 3AKBA 5KSZA 1FI6A 5KTYA 1KK7Z 1XK4A 2KQ6A 1QIWA 1W7JB 1N65A 5I2QA 1AJ4A 2I94A 1JSAA 2KAYA 2KYCA 1NX2A 1OW4A 3CYZA 2BCAA 1MR8A 1KFXL 1TNPA 1TTXA 4UPGA 2F33A 1NCYA 4PHNA 1OZOA 4NDBA 4INWA 1QIVA 3EK4A 2LUXA 1J1EA 3TDIA 1MXLC 1YTZC 2PQLA 4Q04A 1W7IB 1ODBA 2CBLA 1JF2A 1KSMA 3NHIA 3E3RA 1EG3A 4NDCA 4OZDA 3SS3A 4F7FA 2QEVA 4CFQA 1OMRA 4HREE 2O60A 2WCMA 3I5GC 1DMOA 1B8RA 2HF5A 5I94A 4QJ3B 2M9GA 1K90D 3R1OA 4MVFA 3BYAA 4C0LA 1QTXA 2HQWA 1WRLA 2MRDA 3NGVA 5HLOA 3I5HC 1CMGA 2JTZA 1K96A 1CM4A 3CR5X 3BUXB 1EXRA 3CZ0A 1LA3A 3PFVA 2AUCA 2WORA 4WQ2A
chains in the Genus database with same CATH topology
1B7TZ 3RLZA 3VROA 1BMOA 3H4SE 2KOTA 1CFCA 3TS5C 2M3WA 1KK8C 3D0YB 3FS7A 3I5FC 3NSKA 4YGEB 1FF1A 3OX5A 1TIZA 3BQ3A 2K7OA 4MZJA 1LA0A 4ZCUA 3KPXA 1G33A 2LVKA 2ZNEA 3VRPA 4R1EA 3I5GB 1OMVA 3NSOA 4CPVA 2EC6C 1YUSA 1J7OA 2E30A 4MLWA 3PATA 2KQYA 1M46A 2LVVA 3LL8B 4ZCVA 2BBNA 1SR6C 2P6BB 1J1DA 3KO0A 1ZACA 2M49B 3I5HB 2MJWB 3A8RA 1S5GY 3DVEA 2M0RA 1F70A 2JC2A 1DJGA 1S5GZ 4BY5A 2LC5A 2BL0C 1IWQA 3LK0A 4PE1A 2NXQA 5BPJA 1XFVO 3OHMB 2MHHA 1TNWA 1UP5A 5JOLA 2LANA 2MA2A 1K93D 1QASA 2BECA 1M63B 1CB1A 2FCDA 2LM5A 3GK2A 3TS5B 1J7QA 1E8AA 3LCPC 1A4PA 3SG2A 2KDHA 2O5GA 1B9AA 2M7LA 2JZIA 2LVIA 1TN4A 3O4YA 1KFUS 1WY9A 2H61A 1PVAA 2K2FA 2CNPA 1YRTB 1AUIB 2GGMA 1IKUA 1PRWA 1VRKA 1L7ZA 4GFTA 1BODA 2HETA 5HKWA 2EC6B 3WXAA 4MN0A 1WDCC 2LVJA 4DS7A 2F3ZA 5AFPA 2LHIA 1SR6B 1UHNA 1OQPA 1XYDA 1GJYA 1WRKA 2Y5IA 1QX2A 2BE6A 1RFJA 1IQ5A 1HT9A 1MF8B 5PALA 4D1EA 2Y1MA 2KSPA 1NPQA 2BL0B 1ALWA 1GQMA 1K9KA 1RECA 3AAJA 3GK1A 3FIAA 1QX5B 2M29A 4GNKB 1XO5A 1SY9A 1ZMZA 1LVCD 5FYXA 3CTNA 1SBJA 2JXCA 1S6JA 1F4OA 1A2XA 1WLZA 1TCOB 4XJKB 2ZKMX 5CSJA 5ER4X 2PRUA 3M0WA 1CDPA 1NIWA 1YUTA 1J55A 2NLNA 1WLMA 1OOJA 3CS1A 4NDDA 1KSOA 1M45A 2KI6C 1A75B 4M2QA 4PHMA 1YRUB 1J7PA 1FI5A 4M2OA 2I2RE 1A03A 1S36A 3CZTX 1BU3A 1KFXS 2Y4QA 3TUYC 1SNLA 4GGNA 1DJHA 2L4IA 2LLSA 4JWQA 1B4CA 1NX0A 2LHLA 1N0YA 4OV2A 2KGRA 1SL9A 5DKNA 5F6TA 1XFWO 2M1KB 1H8BA 2MAZA 1XFXO 3NSLA 1UURA 1UWOA 1WDCB 1TOPA 1DGUA 2F2OA 2GV5A 1NX1A 2L98A 1B8LA 1PK0D 2M1UA 2KI4C 4OKHA 1S1EA 2L2EA 2WC8A 3C1VA 2RGIA 1C07A 4BY4A 1CDMA 1UHHA 2SASA 2L5XB 3I5IC 1QLKA 1M39A 1G4YR 4PE0A 1UHKA 3WHTB 4MZLA 1IJ6A 1NSHA 1UHIA 5JJGA 4TNCA 1UUSA 1M31A 3TDUA 1PALA 4CLNA 3GOFA 1S3PA 2ZN8A 2K0JA 3HX4A 2FOTA 4XYNA 2WOSA 4P2YB 3SG7A 5KU1A 1LINA 2V53A 1DT7B 2TN4A 4NQGA 3D0YA 1N2DA 2JRFA 2PASA 3SG4A 1F4QA 4ORAB 3TUYB 1BLQA 1SMGA 4N5XA 4YGBB 1SPYA 2LLUA 1G8IA 1BR4B 2L51A 3OB1B 1YURA 2AMIA 2KAVA 1LKJA 2KNEA 2MBXA 2LLTA 1QX7A 2Y1NA 3RM1A 2EHBA 3PN7C 2DOQA 2PMYA 2MLFC 1DGVA 2K8MB 2ZN9A 1DTLA 3FWBA 3AKAA 1OSAA 3KHEA 1F71A 2KI4B 1MHOA 1V1FA 1K9PA 2B1UA 2K7DA 2QACA 3TDZA 4OVNF 1JFKA 3SG6A 2JXLA 3KF9A 4ETOA 3JVTC 2CT9A 1XA5A 3I5IB 1AJ5A 3BOWA 3O2PA 1BF5A 2F3YA 3O78A 1GGZA 2LP2A 1DJIA 4E68A 1NWDA 1PSBA 2CXJA 1DVIA 4ORBB 2KGBC 3BOWB 1C7WA 4I5JA 4C0JA 1CDNA 2NCPA 1SK6D 3BXKA 2F2PA 4N1FA 4DIRA 2KYFA 3K21A 3EK7A 3PALA 1F55A 1DJWA 1CLBA 1QS7A 1L2OB 2R2IA 2KI6D 4HSZA 4YI8A 4YRUA 1Y1AA 4A4BA 1JF0A 2JOJA 2G2BA 5CSFA 2AAOA 1K94A 4USLA 3SG5A 1K95A 4U8DA 1RROA 4QJ4B 1B1GA 4GPLB 2K7CA 3PN7B 5CSNA 5D69A 1TNQA 4OR9B 1H4BA 1XFYO 3WHUB 1SYMA 1KWOC 1CM1A 4GBAA 2L4HA 3SIBA 3KEVA 3EK8A 2IS9A 2I18A 2WCFA 5I2OA 3JVTB 2I7AA 1IH0A 4F0ZB 2BKHB 4GGFC 1QV0A 2BCXA 4JQ0D 4HRGA 3IQOA 3BUNB 3EVUA 3CGAA 1BG1A 1PSRA 4C0KA 2MLEC 4L9MA 1EG4A 2M97A 5DKRA 3EVRA 4DUQA 3OP0A 4IL1A 3HCMA 1U5IA 4PHKA 2FJUB 4ICBA 1XFZO 4XJKA 1EJ3A 1YUUA 2LAPA 4YBHB 1QJTA 1J7RA 2HPSA 3DVJA 1A75A 1DF0A 1S6IA 1U5IB 1QLSA 1KFUL 2BKIB 2K61A 4GUKA 5CPVA 3ZWHA 1DJYA 5TNCA 2Q91A 1X02A 1NX3A 1QVIY 1TCFA 1DF0B 1YX8A 1JWDA 5J3XA 4MEWA 1OMDA 2F8PA 3ICBA 1CFPA 1KWOB 4GGFA 2L50A 4MRYA 1CLLA 2BE4A 3BUMB 3ZNIA 5HKYA 1JC2A 2KHNA 2JTTA 1K8UA 3SIAA 2JPTA 2LUCA 3PLFB 1AVSA 3LK1A 4M2PA 2KFFA 3JTDC 4HRHA 5I8NA 2KBMA 1ALVA 4JPZB 1DJZA 1LXFC 4DCKA 2ISDA 3FWCA 1MUXA 1KK7Y 2PALA 3NSIA 5AEQA 2JNFA 2LCPA 2M7NA 2D8NA 2LMVA 4MRXA 2K7BA 1CMFA 1FPWA 2ZRSA 1S26D 3SJSA 2H2KA 2L0PA 1D1OA 3F45A 1CLMA 2CTNA 3DVMA 1YR5A 1R6PA 1ZFSA 4OCIA 3PM8A 2HQ8A 3NXAA 5HKZA 4DRWA 4AOMA 2CCMA 3A4UB 4CFRA 4QJ5B 1C7VA 1CKKA 2BBMA 1KQVA 1JUOA 2A4JA 4YGDB 1WRZA 3IQQA 1L2OC 1XVJA 2PSRA 5HYDA 1SL7A 1KCYA 2LMUA 4YGAA 4I5KA 1Y0VH 1S6CA 4P5OE 1YVLA 2LP3A 1YVHA 2BCBA 2COLB 4FQOA 3DD4A 1OE9B 1K2HA 5D7FA 5G08A 2LNKA 4MZKA 2ZNDA 1CTRA 3DVKA 2K2AA 4A4CA 1BR1B 2FCEA 3VRRA 1RWYA 3JTDB 1YX7A 2LMTA 1SKTA 1IJ5A 1V1GA 2EGDA 3VRNA 1R2UA 4YGCB 2KFGA 3PSRA 1SL8A 1SCMC 1HQVA 1BT6A 3CWGA 1B7TY 1NYAA 3WNXB 1K9UA 1B8CA 1GGWA 3GK4X 3EKJA 1JBAA 2OPOA 1BOCA 2GGZA 2JULA 3MSEB 3IF7A 5AXIA 4FTGA 1IRJA 1QATA 1AK8A 2KFHA 1F8HA 2JWWA 4WRIA 1JFJA 1UHJA 1FBVA 1CNPA 2KAXA 1QV1A 4CIDA 2Q4UA 5B8IB 3D10A 1AHRA 1NP8A 3AAKA 1CFFA 3BUWB 1PVBA 4YI9A 1KQMC 1Q80A 2H61C 1IGVA 1Y1UA 2ZRTA 2OTGC 3O6BA 4PE7A 5AERA 4PE4A 2G9BA 3LLEA 1RK9A 3SG3A 3DF0A 3EVVA 2OS8C 1SW8A 2NCOA 2JT0A 1ZOTB 4WQ3A 2E6WA 2JNXA 2VRGA 4N1GA 4PCWA 2WCEA 2LE9B 4MBEA 3DF0B 4PDZA 1SCMB 1B47A 3VGOA 1NUBA 2KBIA 3CR2A 1A29A 3OB2B 4GAOA 4PHJA 3QRXA 1XFUO 5CSIA 1MXEA 5IBWA 1QXPA 1F54A 1KK8B 3I5FB 1TNXA 2LV7A 1SCVA 5I2LA 5DKQA 3EKHA 1EL4A 1Y1XA 1PULA 1ZUZA 5GQQC 1NCZA 1IG5A 2SCPA 1XK4C 4AQJA 1SRAA 1CFDA 2JT8A 1TRFA 1KQMB 4I5LB 5ER5A 4AQIA 3OX6A 4ORCB 2OTGB 1BJFA 2JT3A 1QVIZ 3CLNA 5AANA 2NZ0A 2QPTA 1IQ3A 2OS8B 2PVBA 1NCXA 1EH2A 1Y6WA 3CR4X 2M8UA 1AP4A 1OZSA 2WCBA 3VRQA 1RJVA 4PALA 2ZFDA 2JQ6A 1DJXA 5K89A 5HLVA 3TZ1A 4MSPA 3BUOB 1MWNA 1MQ1A 1RTP1 2WNDA 4I5NB 1CDLA 1FI6A 1FW4A 2JU0A 3AKBA 5KSZA 5KTYA 1KK7Z 1XK4A 2KQ6A 1QIWA 1W7JB 1N65A 5I2QA 1AJ4A 2I94A 1JSAA 2KAYA 2KYCA 1NX2A 2BCAA 1MR8A 1KFXL 1TNPA 1TTXA 4UPGA 2F33A 1NCYA 4PHNA 1OZOA 4NDBA 1QIVA 3EK4A 2LUXA 1J1EA 3TDIA 1MXLC 1YTZC 4Q04A 1W7IB 1ODBA 2CBLA 1JF2A 1KSMA 4NDCA 3E3RA 1EG3A 4CFQA 1OMRA 4HREE 2O60A 3I5GC 1DMOA 1B8RA 2HF5A 4QJ3B 2M9GA 1K90D 4MVFA 3BYAA 4C0LA 1QTXA 2HQWA 1WRLA 2MRDA 5HLOA 1CMGA 3I5HC 2JTZA 1K96A 1CM4A 3CR5X 3BUXB 1EXRA 1LA3A 3PFVA 2AUCA 2WORA 4WQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7T Z;  3RLZ A;  3VRO A;  1BMO A;  3H4S E;  2KOT A;  1CFC A;  3TS5 C;  2M3W A;  1KK8 C;  3D0Y B;  3FS7 A;  3I5F C;  3NSK A;  4YGE B;  1FF1 A;  3OX5 A;  1TIZ A;  3BQ3 A;  2K7O A;  4MZJ A;  1LA0 A;  4ZCU A;  3KPX A;  1G33 A;  2LVK A;  2ZNE A;  3VRP A;  4R1E A;  3I5G B;  1OMV A;  3NSO A;  4CPV A;  2EC6 C;  1YUS A;  1J7O A;  2E30 A;  4MLW A;  3PAT A;  2KQY A;  1M46 A;  2LVV A;  3LL8 B;  4ZCV A;  2BBN A;  1SR6 C;  2P6B B;  1J1D A;  3KO0 A;  1ZAC A;  2M49 B;  3I5H B;  2MJW B;  3A8R A;  1S5G Y;  3DVE A;  2M0R A;  1F70 A;  2JC2 A;  1DJG A;  1S5G Z;  4BY5 A;  2LC5 A;  2BL0 C;  1IWQ A;  3LK0 A;  4PE1 A;  2NXQ A;  5BPJ A;  1XFV O;  3OHM B;  2MHH A;  1TNW A;  1UP5 A;  5JOL A;  2LAN A;  2MA2 A;  1K93 D;  1QAS A;  2BEC A;  1M63 B;  1CB1 A;  2FCD A;  2LM5 A;  3GK2 A;  3TS5 B;  1J7Q A;  1E8A A;  3LCP C;  1A4P A;  3SG2 A;  2KDH A;  2O5G A;  1B9A A;  2M7L A;  2JZI A;  2LVI A;  1TN4 A;  3O4Y A;  1KFU S;  1WY9 A;  2H61 A;  1PVA A;  2K2F A;  2CNP A;  1YRT B;  1AUI B;  2GGM A;  1IKU A;  1PRW A;  1VRK A;  1L7Z A;  4GFT A;  1BOD A;  2HET A;  5HKW A;  2EC6 B;  3WXA A;  4MN0 A;  1WDC C;  2LVJ A;  4DS7 A;  2F3Z A;  5AFP A;  2LHI A;  1SR6 B;  1UHN A;  1OQP A;  1XYD A;  1GJY A;  1WRK A;  2Y5I A;  1QX2 A;  2BE6 A;  1RFJ A;  1IQ5 A;  1HT9 A;  1MF8 B;  5PAL A;  4D1E A;  2Y1M A;  2KSP A;  1NPQ A;  2BL0 B;  1ALW A;  1GQM A;  1K9K A;  1REC A;  3AAJ A;  3GK1 A;  3FIA A;  1QX5 B;  2M29 A;  4GNK B;  1XO5 A;  1SY9 A;  1ZMZ A;  1LVC D;  5FYX A;  3CTN A;  1SBJ A;  2JXC A;  1S6J A;  1F4O A;  1A2X A;  1WLZ A;  1TCO B;  4XJK B;  2ZKM X;  5CSJ A;  5ER4 X;  2PRU A;  3M0W A;  1CDP A;  1NIW A;  1YUT A;  1J55 A;  2NLN A;  1WLM A;  1OOJ A;  3CS1 A;  4NDD A;  1KSO A;  1M45 A;  2KI6 C;  1A75 B;  4M2Q A;  4PHM A;  1YRU B;  1J7P A;  1FI5 A;  4M2O A;  2I2R E;  1A03 A;  1S36 A;  3CZT X;  1BU3 A;  1KFX S;  2Y4Q A;  3TUY C;  1SNL A;  4GGN A;  1DJH A;  2L4I A;  2LLS A;  4JWQ A;  1B4C A;  1NX0 A;  2LHL A;  1N0Y A;  4OV2 A;  2KGR A;  1SL9 A;  5DKN A;  5F6T A;  1XFW O;  2M1K B;  1H8B A;  2MAZ A;  1XFX O;  3NSL A;  1UUR A;  1UWO A;  1WDC B;  1TOP A;  1DGU A;  2F2O A;  2GV5 A;  1NX1 A;  2L98 A;  1B8L A;  1PK0 D;  2M1U A;  2KI4 C;  4OKH A;  1S1E A;  2L2E A;  2WC8 A;  3C1V A;  2RGI A;  1C07 A;  4BY4 A;  1CDM A;  1UHH A;  2SAS A;  2L5X B;  3I5I C;  1QLK A;  1M39 A;  1G4Y R;  4PE0 A;  1UHK A;  3WHT B;  4MZL A;  1IJ6 A;  1NSH A;  1UHI A;  5JJG A;  4TNC A;  1UUS A;  1M31 A;  3TDU A;  1PAL A;  4CLN A;  3GOF A;  1S3P A;  2ZN8 A;  2K0J A;  3HX4 A;  2FOT A;  4XYN A;  2WOS A;  4P2Y B;  3SG7 A;  5KU1 A;  1LIN A;  2V53 A;  1DT7 B;  2TN4 A;  4NQG A;  3D0Y A;  1N2D A;  2JRF A;  2PAS A;  3SG4 A;  1F4Q A;  4ORA B;  3TUY B;  1BLQ A;  1SMG A;  4N5X A;  4YGB B;  1SPY A;  2LLU A;  1G8I A;  1BR4 B;  2L51 A;  3OB1 B;  1YUR A;  2AMI A;  2KAV A;  1LKJ A;  2KNE A;  2MBX A;  2LLT A;  1QX7 A;  2Y1N A;  3RM1 A;  2EHB A;  3PN7 C;  2DOQ A;  2PMY A;  2MLF C;  1DGV A;  2K8M B;  2ZN9 A;  1DTL A;  3FWB A;  3AKA A;  1OSA A;  3KHE A;  1F71 A;  2KI4 B;  1MHO A;  1V1F A;  1K9P A;  2B1U A;  2K7D A;  2QAC A;  3TDZ A;  4OVN F;  1JFK A;  3SG6 A;  2JXL A;  3KF9 A;  4ETO A;  3JVT C;  2CT9 A;  1XA5 A;  3I5I B;  1AJ5 A;  3BOW A;  3O2P A;  1BF5 A;  2F3Y A;  3O78 A;  1GGZ A;  2LP2 A;  1DJI A;  4E68 A;  1NWD A;  1PSB A;  2CXJ A;  1DVI A;  4ORB B;  2KGB C;  3BOW B;  1C7W A;  4I5J A;  4C0J A;  1CDN A;  2NCP A;  1SK6 D;  3BXK A;  2F2P A;  4N1F A;  4DIR A;  2KYF A;  3K21 A;  3EK7 A;  3PAL A;  1F55 A;  1DJW A;  1CLB A;  1QS7 A;  1L2O B;  2R2I A;  2KI6 D;  4HSZ A;  4YI8 A;  4YRU A;  1Y1A A;  4A4B A;  1JF0 A;  2JOJ A;  2G2B A;  5CSF A;  2AAO A;  1K94 A;  4USL A;  3SG5 A;  1K95 A;  4U8D A;  1RRO A;  4QJ4 B;  1B1G A;  4GPL B;  2K7C A;  3PN7 B;  5CSN A;  5D69 A;  1TNQ A;  4OR9 B;  1H4B A;  1XFY O;  3WHU B;  1SYM A;  1KWO C;  1CM1 A;  4GBA A;  2L4H A;  3SIB A;  3KEV A;  3EK8 A;  2IS9 A;  2I18 A;  2WCF A;  5I2O A;  3JVT B;  2I7A A;  1IH0 A;  4F0Z B;  2BKH B;  4GGF C;  1QV0 A;  2BCX A;  4JQ0 D;  4HRG A;  3IQO A;  3BUN B;  3EVU A;  3CGA A;  1BG1 A;  1PSR A;  4C0K A;  2MLE C;  4L9M A;  1EG4 A;  2M97 A;  5DKR A;  3EVR A;  4DUQ A;  3OP0 A;  4IL1 A;  3HCM A;  1U5I A;  4PHK A;  2FJU B;  4ICB A;  1XFZ O;  4XJK A;  1EJ3 A;  1YUU A;  2LAP A;  4YBH B;  1QJT A;  1J7R A;  2HPS A;  3DVJ A;  1A75 A;  1DF0 A;  1S6I A;  1U5I B;  1QLS A;  1KFU L;  2BKI B;  2K61 A;  4GUK A;  5CPV A;  3ZWH A;  1DJY A;  5TNC A;  2Q91 A;  1X02 A;  1NX3 A;  1QVI Y;  1TCF A;  1DF0 B;  1YX8 A;  1JWD A;  5J3X A;  4MEW A;  1OMD A;  2F8P A;  3ICB A;  1CFP A;  1KWO B;  4GGF A;  2L50 A;  4MRY A;  1CLL A;  2BE4 A;  3BUM B;  3ZNI A;  5HKY A;  1JC2 A;  2KHN A;  2JTT A;  1K8U A;  3SIA A;  2JPT A;  2LUC A;  3PLF B;  1AVS A;  3LK1 A;  4M2P A;  2KFF A;  3JTD C;  4HRH A;  5I8N A;  2KBM A;  1ALV A;  4JPZ B;  1DJZ A;  1LXF C;  4DCK A;  2ISD A;  3FWC A;  1MUX A;  1KK7 Y;  2PAL A;  3NSI A;  5AEQ A;  2JNF A;  2LCP A;  2M7N A;  2D8N A;  2LMV A;  4MRX A;  2K7B A;  1CMF A;  1FPW A;  2ZRS A;  1S26 D;  3SJS A;  2H2K A;  2L0P A;  1D1O A;  3F45 A;  1CLM A;  2CTN A;  3DVM A;  1YR5 A;  1R6P A;  1ZFS A;  4OCI A;  3PM8 A;  2HQ8 A;  3NXA A;  5HKZ A;  4DRW A;  4AOM A;  2CCM A;  3A4U B;  4CFR A;  4QJ5 B;  1C7V A;  1CKK A;  2BBM A;  1KQV A;  1JUO A;  2A4J A;  4YGD B;  1WRZ A;  3IQQ A;  1L2O C;  1XVJ A;  2PSR A;  5HYD A;  1SL7 A;  1KCY A;  2LMU A;  4YGA A;  4I5K A;  1Y0V H;  1S6C A;  4P5O E;  1YVL A;  2LP3 A;  1YVH A;  2BCB A;  2COL B;  4FQO A;  3DD4 A;  1OE9 B;  1K2H A;  5D7F A;  5G08 A;  2LNK A;  4MZK A;  2ZND A;  1CTR A;  3DVK A;  2K2A A;  4A4C A;  1BR1 B;  2FCE A;  3VRR A;  1RWY A;  3JTD B;  1YX7 A;  2LMT A;  1SKT A;  1IJ5 A;  1V1G A;  2EGD A;  3VRN A;  1R2U A;  4YGC B;  2KFG A;  3PSR A;  1SL8 A;  1SCM C;  1HQV A;  1BT6 A;  3CWG A;  1B7T Y;  1NYA A;  3WNX B;  1K9U A;  1B8C A;  1GGW A;  3GK4 X;  3EKJ A;  1JBA A;  2OPO A;  1BOC A;  2GGZ A;  2JUL A;  3MSE B;  3IF7 A;  5AXI A;  4FTG A;  1IRJ A;  1QAT A;  1AK8 A;  2KFH A;  1F8H A;  2JWW A;  4WRI A;  1JFJ A;  1UHJ A;  1FBV A;  1CNP A;  2KAX A;  1QV1 A;  4CID A;  2Q4U A;  5B8I B;  3D10 A;  1AHR A;  1NP8 A;  3AAK A;  1CFF A;  3BUW B;  1PVB A;  4YI9 A;  1KQM C;  1Q80 A;  2H61 C;  1IGV A;  1Y1U A;  2ZRT A;  2OTG C;  3O6B A;  4PE7 A;  5AER A;  4PE4 A;  2G9B A;  3LLE A;  1RK9 A;  3SG3 A;  3DF0 A;  3EVV A;  2OS8 C;  1SW8 A;  2NCO A;  2JT0 A;  1ZOT B;  4WQ3 A;  2E6W A;  2JNX A;  2VRG A;  4N1G A;  4PCW A;  2WCE A;  2LE9 B;  4MBE A;  3DF0 B;  4PDZ A;  1SCM B;  1B47 A;  3VGO A;  1NUB A;  2KBI A;  3CR2 A;  1A29 A;  3OB2 B;  4GAO A;  4PHJ A;  3QRX A;  1XFU O;  5CSI A;  1MXE A;  5IBW A;  1QXP A;  1F54 A;  1KK8 B;  3I5F B;  1TNX A;  2LV7 A;  1SCV A;  5I2L A;  5DKQ A;  3EKH A;  1EL4 A;  1Y1X A;  1PUL A;  1ZUZ A;  5GQQ C;  1NCZ A;  1IG5 A;  2SCP A;  1XK4 C;  4AQJ A;  1SRA A;  1CFD A;  2JT8 A;  1TRF A;  1KQM B;  4I5L B;  5ER5 A;  4AQI A;  3OX6 A;  4ORC B;  2OTG B;  1BJF A;  2JT3 A;  1QVI Z;  3CLN A;  5AAN A;  2NZ0 A;  2QPT A;  1IQ3 A;  2OS8 B;  2PVB A;  1NCX A;  1EH2 A;  1Y6W A;  3CR4 X;  2M8U A;  1AP4 A;  1OZS A;  2WCB A;  3VRQ A;  1RJV A;  4PAL A;  2ZFD A;  2JQ6 A;  1DJX A;  5K89 A;  5HLV A;  3TZ1 A;  4MSP A;  3BUO B;  1MWN A;  1MQ1 A;  1RTP 1;  2WND A;  4I5N B;  1CDL A;  1FI6 A;  1FW4 A;  2JU0 A;  3AKB A;  5KSZ A;  5KTY A;  1KK7 Z;  1XK4 A;  2KQ6 A;  1QIW A;  1W7J B;  1N65 A;  5I2Q A;  1AJ4 A;  2I94 A;  1JSA A;  2KAY A;  2KYC A;  1NX2 A;  2BCA A;  1MR8 A;  1KFX L;  1TNP A;  1TTX A;  4UPG A;  2F33 A;  1NCY A;  4PHN A;  1OZO A;  4NDB A;  1QIV A;  3EK4 A;  2LUX A;  1J1E A;  3TDI A;  1MXL C;  1YTZ C;  4Q04 A;  1W7I B;  1ODB A;  2CBL A;  1JF2 A;  1KSM A;  4NDC A;  3E3R A;  1EG3 A;  4CFQ A;  1OMR A;  4HRE E;  2O60 A;  3I5G C;  1DMO A;  1B8R A;  2HF5 A;  4QJ3 B;  2M9G A;  1K90 D;  4MVF A;  3BYA A;  4C0L A;  1QTX A;  2HQW A;  1WRL A;  2MRD A;  5HLO A;  1CMG A;  3I5H C;  2JTZ A;  1K96 A;  1CM4 A;  3CR5 X;  3BUX B;  1EXR A;  1LA3 A;  3PFV A;  2AUC A;  2WOR A;  4WQ2 A; 
#chains in the Genus database with same CATH topology
 1B7T Z;  3RLZ A;  3VRO A;  1BMO A;  3H4S E;  2KOT A;  1CFC A;  3TS5 C;  2M3W A;  1KK8 C;  3D0Y B;  3FS7 A;  3I5F C;  3NSK A;  4YGE B;  1FF1 A;  3OX5 A;  1TIZ A;  2L2C A;  3BQ3 A;  2K7O A;  4MZJ A;  1LA0 A;  4ZCU A;  2K60 A;  3KPX A;  1G33 A;  2LVK A;  2QEB A;  2ZNE A;  3VRP A;  4R1E A;  3I5G B;  1OMV A;  3NSO A;  4CPV A;  2EC6 C;  1YUS A;  3S0D A;  1J7O A;  2E30 A;  4MLW A;  3PAT A;  2KQY A;  1M46 A;  2LVV A;  3LL8 B;  4ZCV A;  2WC5 A;  2BBN A;  1SR6 C;  2P6B B;  1J1D A;  3KO0 A;  1ZAC A;  2M49 B;  3I5H B;  4FQT A;  2MJW B;  3A8R A;  1S5G Y;  3DVE A;  2M0R A;  3PJI A;  1F70 A;  2JC2 A;  1DJG A;  1S5G Z;  4BY5 A;  2ERB A;  3BFA A;  2LC5 A;  2BL0 C;  1IWQ A;  3LK0 A;  4PE1 A;  2NXQ A;  5BPJ A;  1XFV O;  3OHM B;  2MHH A;  1TNW A;  1UP5 A;  5JOL A;  2LAN A;  2MA2 A;  3EG5 B;  4JD9 A;  1K93 D;  1QAS A;  2BEC A;  1M63 B;  1CB1 A;  1IIO A;  2FCD A;  2LM5 A;  3GK2 A;  3TS5 B;  1J7Q A;  1E8A A;  3FE8 A;  3LCP C;  1A4P A;  3SG2 A;  2KDH A;  2O5G A;  1B9A A;  2M7L A;  2JZI A;  3R1P A;  2LVI A;  1TN4 A;  3O4Y A;  1KFU S;  1WY9 A;  2H61 A;  1OOH A;  1PVA A;  2CNP A;  2K2F A;  1YRT B;  1AUI B;  5EL2 A;  2GGM A;  1IKU A;  1PRW A;  1VRK A;  1L7Z A;  3B6X A;  4GFT A;  1BOD A;  2HET A;  3SS5 A;  5HKW A;  2EC6 B;  3WXA A;  4MN0 A;  1WDC C;  2LVJ A;  4DS7 A;  2F3Z A;  5AFP A;  2LHI A;  1GM0 A;  1SR6 B;  1UHN A;  1OQP A;  1XYD A;  1GJY A;  1WRK A;  2Y5I A;  1QX2 A;  2BE6 A;  1RFJ A;  1IQ5 A;  1HT9 A;  1MF8 B;  5PAL A;  3V2L A;  4D1E A;  2Y1M A;  2KSP A;  1NPQ A;  2BL0 B;  1ALW A;  1GQM A;  1K9K A;  1REC A;  3AAJ A;  3GK1 A;  3FIA A;  1QX5 B;  2M29 A;  4GNK B;  1XO5 A;  1SY9 A;  1ZMZ A;  1LVC D;  5FYX A;  3R1V A;  3CTN A;  1SBJ A;  5DIC A;  2JXC A;  1S6J A;  1F4O A;  1A2X A;  1WLZ A;  1TCO B;  4XJK B;  2ZKM X;  5CSJ A;  5ER4 X;  2PRU A;  3M0W A;  1CDP A;  1NIW A;  1YUT A;  2KPH A;  1J55 A;  2NLN A;  1WLM A;  1OOJ A;  3CS1 A;  1XFR A;  3IVT A;  4NDD A;  1KSO A;  1M45 A;  2KI6 C;  1A75 B;  4M2Q A;  4PHM A;  1YRU B;  1J7P A;  1FI5 A;  4M2O A;  2I2R E;  1A03 A;  1S36 A;  3CZT X;  1BU3 A;  1KFX S;  2Y4Q A;  3TUY C;  1SNL A;  4GGN A;  1DJH A;  2L4I A;  2LLS A;  4JWQ A;  1B4C A;  1NX0 A;  1QWV A;  2LHL A;  1N0Y A;  4OV2 A;  2KGR A;  1SL9 A;  5DKN A;  5F6T A;  1XFW O;  2M1K B;  4QJ4 B;  1H8B A;  2MAZ A;  3D73 A;  1XFX O;  3NSL A;  1UUR A;  3D78 A;  1UWO A;  1SSE B;  2WCJ A;  1WDC B;  1TOP A;  1DGU A;  2F2O A;  2GV5 A;  1NX1 A;  2L98 A;  1B8L A;  3OBV A;  1PK0 D;  1OOG A;  2M1U A;  2KI4 C;  4OKH A;  1S1E A;  2L2E A;  2WC8 A;  3C1V A;  2RGI A;  1C07 A;  4BY4 A;  1CDM A;  1UHH A;  2YGU A;  2SAS A;  2L5X B;  1TUZ A;  3I5I C;  1QLK A;  1M39 A;  1G4Y R;  4PE0 A;  1UHK A;  3WHT B;  4MZL A;  1IJ6 A;  1NSH A;  1UHI A;  5JJG A;  5D3O A;  4TNC A;  1TWO A;  1UUS A;  1M31 A;  3TDU A;  1PAL A;  4CLN A;  1DEL A;  3GOF A;  1S3P A;  2ZN8 A;  2K0J A;  2WCH A;  3HX4 A;  2FOT A;  4XYN A;  2WOS A;  4P2Y B;  3SG7 A;  5KU1 A;  1LIN A;  2V53 A;  1DT7 B;  2TN4 A;  4NQG A;  3D0Y A;  1N2D A;  2JRF A;  2PAS A;  3B88 A;  3SG4 A;  1F4Q A;  4ORA B;  1C3Z A;  3TUY B;  1BLQ A;  1SMG A;  4N5X A;  4YGB B;  1SPY A;  2LLU A;  1G8I A;  1BR4 B;  3BJH A;  2L5Y A;  2L51 A;  3OB1 B;  1YUR A;  2AMI A;  2KAV A;  1LKJ A;  2KNE A;  3FE9 A;  2MBX A;  2LLT A;  1QX7 A;  3B86 A;  2Y1N A;  3RM1 A;  2EHB A;  3PN7 C;  2DOQ A;  2PMY A;  2MLF C;  1DGV A;  2K8M B;  2ZN9 A;  1DTL A;  3FWB A;  3AKA A;  1OSA A;  3KHE A;  3UO9 A;  1F71 A;  2KI4 B;  1MHO A;  1V1F A;  1K9P A;  2B1U A;  2K7D A;  2QAC A;  4PT1 A;  3TDZ A;  3L47 A;  4OVN F;  3BFB A;  1JFK A;  3SG6 A;  2JXL A;  3KF9 A;  4ETO A;  2WC6 A;  3JVT C;  2CT9 A;  1XA5 A;  3I5I B;  1AJ5 A;  3BOW A;  3O2P A;  1BF5 A;  2F3Y A;  3O78 A;  1GGZ A;  2LP2 A;  1DJI A;  4E68 A;  1NWD A;  1PSB A;  2CXJ A;  1DVI A;  4ORB B;  3SG5 A;  2KGB C;  3BOW B;  1C7W A;  4I5J A;  4C0J A;  1CDN A;  2NCP A;  1SK6 D;  3BXK A;  2F2P A;  4N1F A;  4DIR A;  2KYF A;  1P28 A;  3K21 A;  3EK7 A;  3PAL A;  3S0F A;  1F55 A;  1DJW A;  1CLB A;  1QS7 A;  1L2O B;  2R2I A;  2KI6 D;  4HSZ A;  3D74 A;  4YI8 A;  4YRU A;  1Y1A A;  4A4B A;  1JF0 A;  2JOJ A;  2G2B A;  3QME A;  2AAO A;  1K94 A;  1OOF A;  3L4A A;  1K95 A;  4U8D A;  1RRO A;  4USL A;  5CSF A;  5FI2 A;  3S0E A;  1B1G A;  4GPL B;  2K7C A;  3PN7 B;  5CSN A;  5D69 A;  1TNQ A;  4OR9 B;  2JPO A;  1H4B A;  1XFY O;  3WHU B;  1SYM A;  4INX A;  1DQE A;  1KWO C;  1CM1 A;  2FJY A;  2L4H A;  2P70 A;  4GBA A;  3SIB A;  3KEV A;  3NHT A;  3EK8 A;  2IS9 A;  2I18 A;  2WCF A;  3DYE A;  5I2O A;  3JVT B;  2I7A A;  1IH0 A;  4F0Z B;  2BKH B;  3B7A A;  4GGF C;  1QV0 A;  2BCX A;  4JQ0 D;  3CZ1 A;  4HRG A;  4JKT A;  3RZS A;  3IQO A;  3BUN B;  3EVU A;  3CGA A;  1BG1 A;  1PSR A;  4C0K A;  2MLE C;  4L9M A;  1EG4 A;  2M97 A;  5DKR A;  3SS4 A;  3EVR A;  4DUQ A;  3OP0 A;  4IL1 A;  3HCM A;  1U5I A;  4PHK A;  2FJU B;  4ICB A;  1XFZ O;  4XJK A;  1EJ3 A;  1YUU A;  1Z2C B;  2LAP A;  4YBH B;  1QJT A;  1J7R A;  2HPS A;  3DVJ A;  1A75 A;  1DF0 A;  1S6I A;  1U5I B;  1QLS A;  1KFU L;  2BKI B;  2K61 A;  4GUK A;  5CPV A;  3ZWH A;  1DJY A;  5TNC A;  2Q91 A;  1X02 A;  1NX3 A;  1QVI Y;  3L4L A;  1TCF A;  1DF0 B;  1YX8 A;  1JWD A;  5J3X A;  2KLE A;  4MEW A;  1OMD A;  2F8P A;  3ICB A;  2H8V A;  1CFP A;  1KWO B;  4GGF A;  2L50 A;  4MRY A;  1CLL A;  2BE4 A;  3BUM B;  3ZNI A;  5HKY A;  1JC2 A;  2KLD A;  2KHN A;  2JTT A;  1K8U A;  3SIA A;  3OGN A;  2JPT A;  2LUC A;  3PLF B;  1AVS A;  3LK1 A;  4M2P A;  2KFF A;  3JTD C;  4HRH A;  5I8N A;  2KBM A;  1ALV A;  1T14 A;  4JPZ B;  1DJZ A;  1LXF C;  4DCK A;  2ISD A;  3FWC A;  1MUX A;  1KK7 Y;  2PAL A;  3NSI A;  5AEQ A;  2JNF A;  2LCP A;  2M7N A;  2D8N A;  2LMV A;  4MRX A;  2K7B A;  3S0A A;  1CMF A;  2ZRS A;  3Q8I A;  1S26 D;  1FPW A;  3SJS A;  2H2K A;  3PM2 A;  2L0P A;  3CZ2 A;  1OOI X;  1D1O A;  3F45 A;  1CLM A;  2CTN A;  3DVM A;  1YR5 A;  1R6P A;  1ZFS A;  2GTE A;  4OCI A;  3PM8 A;  2HQ8 A;  3NXA A;  5HKZ A;  2BNX A;  4DRW A;  4AOM A;  2CCM A;  3A4U B;  4CFR A;  4QJ5 B;  1C7V A;  1CKK A;  2QDI A;  2BBM A;  1KQV A;  1JUO A;  2A4J A;  4YGD B;  1WRZ A;  3IQQ A;  1L2O C;  1XVJ A;  2PSR A;  5HYD A;  1SL7 A;  1KCY A;  3DZT A;  2LMU A;  1LS8 A;  4YGA A;  4I5K A;  1Y0V H;  1S6C A;  4P5O E;  1YVL A;  2LP3 A;  1YVH A;  2BCB A;  2COL B;  4FQO A;  3DD4 A;  1OE9 B;  1K2H A;  5D7F A;  5G08 A;  2LNK A;  4MZK A;  2ZND A;  1CTR A;  3CAB A;  3DVK A;  2K2A A;  4A4C A;  1BR1 B;  2FCE A;  3VRR A;  1RWY A;  3JTD B;  1YX7 A;  2LMT A;  1SKT A;  1C3Y A;  1IJ5 A;  3CDN A;  1V1G A;  2EGD A;  3K1E A;  3VRN A;  1R2U A;  4YGC B;  2KFG A;  3PSR A;  1SL8 A;  1SCM C;  1HQV A;  1BT6 A;  3CWG A;  1B7T Y;  4KYN A;  1NYA A;  3WNX B;  1K9U A;  3DY9 A;  1Z4H A;  1B8C A;  1GGW A;  3GK4 X;  3EKJ A;  1JBA A;  2OPO A;  1BOC A;  2GGZ A;  2JUL A;  3MSE B;  3IF7 A;  5AXI A;  4FTG A;  1IRJ A;  1QAT A;  3S0B A;  2KFH A;  1AK8 A;  3UNW A;  1F8H A;  3FE6 A;  2JWW A;  4WRI A;  1JFJ A;  1UHJ A;  1FBV A;  1CNP A;  2KAX A;  2WCL A;  1QV1 A;  4CID A;  3B87 A;  2Q4U A;  5B8I B;  3D10 A;  1AHR A;  1NP8 A;  1DC1 A;  3AAK A;  1CFF A;  3BUW B;  1PVB A;  4YI9 A;  1KQM C;  1Q80 A;  2H61 C;  1IGV A;  1Y1U A;  2ZRT A;  2OTG C;  3O6B A;  4PE7 A;  5AER A;  4PE4 A;  1W9Z A;  2G9B A;  3LLE A;  1RK9 A;  3D76 A;  3SG3 A;  3DF0 A;  3EVV A;  2OS8 C;  3BFH A;  1SW8 A;  2NCO A;  2JT0 A;  1ZOT B;  4IJ7 A;  4WQ3 A;  2E6W A;  2JNX A;  2VRG A;  2PYQ A;  4N1G A;  4PCW A;  2WCE A;  2LE9 B;  3DXL A;  4MBE A;  3DF0 B;  4PDZ A;  1SCM B;  1B47 A;  3VGO A;  1NUB A;  2KBI A;  3CR2 A;  1A29 A;  3OB2 B;  4GAO A;  4PHJ A;  3QRX A;  1DEK A;  1XFU O;  5FI7 A;  5CSI A;  1MXE A;  5IBW A;  1QXP A;  2P71 A;  1ORG A;  2WCK A;  1KK8 B;  3I5F B;  1F54 A;  1TNX A;  2LV7 A;  5HL1 A;  3N7H A;  3O4X A;  1SCV A;  5FI6 A;  5I2L A;  3D75 A;  5DKQ A;  2BAP A;  3EKH A;  1EL4 A;  1Y1X A;  2QEH A;  1PUL A;  1ZUZ A;  3R72 A;  5GQQ C;  1NCZ A;  1IG5 A;  2SCP A;  1XK4 C;  4AQJ A;  1SRA A;  1CFD A;  2JT8 A;  1TRF A;  1KQM B;  4I5L B;  5ER5 A;  4AQI A;  3OX6 A;  4ORC B;  2OTG B;  1BJF A;  2JT3 A;  1QVI Z;  3CLN A;  5AAN A;  2NZ0 A;  2QPT A;  1IQ3 A;  2OS8 B;  2PVB A;  1NCX A;  1EH2 A;  1Y6W A;  3CR4 X;  3D77 A;  2M8U A;  1AP4 A;  1OZS A;  2WCB A;  3VRQ A;  1RJV A;  4PAL A;  2ZFD A;  2JQ6 A;  3S0G A;  1DJX A;  5K89 A;  5HLV A;  3TZ1 A;  4MSP A;  3BUO B;  1TUJ A;  1MWN A;  3VB1 A;  1MQ1 A;  1RTP 1;  2WND A;  4I5N B;  1CDL A;  2QEO A;  1FW4 A;  2JU0 A;  3AKB A;  5KSZ A;  1FI6 A;  5KTY A;  1KK7 Z;  1XK4 A;  2KQ6 A;  1QIW A;  1W7J B;  1N65 A;  5I2Q A;  1AJ4 A;  2I94 A;  1JSA A;  2KAY A;  2KYC A;  1NX2 A;  1OW4 A;  3CYZ A;  2BCA A;  1MR8 A;  1KFX L;  1TNP A;  1TTX A;  4UPG A;  2F33 A;  1NCY A;  4PHN A;  1OZO A;  4NDB A;  4INW A;  1QIV A;  3EK4 A;  2LUX A;  1J1E A;  3TDI A;  1MXL C;  1YTZ C;  2PQL A;  4Q04 A;  1W7I B;  1ODB A;  2CBL A;  1JF2 A;  1KSM A;  3NHI A;  3E3R A;  1EG3 A;  4NDC A;  4OZD A;  3SS3 A;  4F7F A;  2QEV A;  4CFQ A;  1OMR A;  4HRE E;  2O60 A;  2WCM A;  3I5G C;  1DMO A;  1B8R A;  2HF5 A;  5I94 A;  4QJ3 B;  2M9G A;  1K90 D;  3R1O A;  4MVF A;  3BYA A;  4C0L A;  1QTX A;  2HQW A;  1WRL A;  2MRD A;  3NGV A;  5HLO A;  3I5H C;  1CMG A;  2JTZ A;  1K96 A;  1CM4 A;  3CR5 X;  3BUX B;  1EXR A;  3CZ0 A;  1LA3 A;  3PFV A;  2AUC A;  2WOR A;  4WQ2 A; 
#chains in the Genus database with same CATH homology
 1B7T Z;  3RLZ A;  3VRO A;  1BMO A;  3H4S E;  2KOT A;  1CFC A;  3TS5 C;  2M3W A;  1KK8 C;  3D0Y B;  3FS7 A;  3I5F C;  3NSK A;  4YGE B;  1FF1 A;  3OX5 A;  1TIZ A;  3BQ3 A;  2K7O A;  4MZJ A;  1LA0 A;  4ZCU A;  3KPX A;  1G33 A;  2LVK A;  2ZNE A;  3VRP A;  4R1E A;  3I5G B;  1OMV A;  3NSO A;  4CPV A;  2EC6 C;  1YUS A;  1J7O A;  2E30 A;  4MLW A;  3PAT A;  2KQY A;  1M46 A;  2LVV A;  3LL8 B;  4ZCV A;  2BBN A;  1SR6 C;  2P6B B;  1J1D A;  3KO0 A;  1ZAC A;  2M49 B;  3I5H B;  2MJW B;  3A8R A;  1S5G Y;  3DVE A;  2M0R A;  1F70 A;  2JC2 A;  1DJG A;  1S5G Z;  4BY5 A;  2LC5 A;  2BL0 C;  1IWQ A;  3LK0 A;  4PE1 A;  2NXQ A;  5BPJ A;  1XFV O;  3OHM B;  2MHH A;  1TNW A;  1UP5 A;  5JOL A;  2LAN A;  2MA2 A;  1K93 D;  1QAS A;  2BEC A;  1M63 B;  1CB1 A;  2FCD A;  2LM5 A;  3GK2 A;  3TS5 B;  1J7Q A;  1E8A A;  3LCP C;  1A4P A;  3SG2 A;  2KDH A;  2O5G A;  1B9A A;  2M7L A;  2JZI A;  2LVI A;  1TN4 A;  3O4Y A;  1KFU S;  1WY9 A;  2H61 A;  1PVA A;  2K2F A;  2CNP A;  1YRT B;  1AUI B;  2GGM A;  1IKU A;  1PRW A;  1VRK A;  1L7Z A;  4GFT A;  1BOD A;  2HET A;  5HKW A;  2EC6 B;  3WXA A;  4MN0 A;  1WDC C;  2LVJ A;  4DS7 A;  2F3Z A;  5AFP A;  2LHI A;  1SR6 B;  1UHN A;  1OQP A;  1XYD A;  1GJY A;  1WRK A;  2Y5I A;  1QX2 A;  2BE6 A;  1RFJ A;  1IQ5 A;  1HT9 A;  1MF8 B;  5PAL A;  4D1E A;  2Y1M A;  2KSP A;  1NPQ A;  2BL0 B;  1ALW A;  1GQM A;  1K9K A;  1REC A;  3AAJ A;  3GK1 A;  3FIA A;  1QX5 B;  2M29 A;  4GNK B;  1XO5 A;  1SY9 A;  1ZMZ A;  1LVC D;  5FYX A;  3CTN A;  1SBJ A;  2JXC A;  1S6J A;  1F4O A;  1A2X A;  1WLZ A;  1TCO B;  4XJK B;  2ZKM X;  5CSJ A;  5ER4 X;  2PRU A;  3M0W A;  1CDP A;  1NIW A;  1YUT A;  1J55 A;  2NLN A;  1WLM A;  1OOJ A;  3CS1 A;  4NDD A;  1KSO A;  1M45 A;  2KI6 C;  1A75 B;  4M2Q A;  4PHM A;  1YRU B;  1J7P A;  1FI5 A;  4M2O A;  2I2R E;  1A03 A;  1S36 A;  3CZT X;  1BU3 A;  1KFX S;  2Y4Q A;  3TUY C;  1SNL A;  4GGN A;  1DJH A;  2L4I A;  2LLS A;  4JWQ A;  1B4C A;  1NX0 A;  2LHL A;  1N0Y A;  4OV2 A;  2KGR A;  1SL9 A;  5DKN A;  5F6T A;  1XFW O;  2M1K B;  1H8B A;  2MAZ A;  1XFX O;  3NSL A;  1UUR A;  1UWO A;  1WDC B;  1TOP A;  1DGU A;  2F2O A;  2GV5 A;  1NX1 A;  2L98 A;  1B8L A;  1PK0 D;  2M1U A;  2KI4 C;  4OKH A;  1S1E A;  2L2E A;  2WC8 A;  3C1V A;  2RGI A;  1C07 A;  4BY4 A;  1CDM A;  1UHH A;  2SAS A;  2L5X B;  3I5I C;  1QLK A;  1M39 A;  1G4Y R;  4PE0 A;  1UHK A;  3WHT B;  4MZL A;  1IJ6 A;  1NSH A;  1UHI A;  5JJG A;  4TNC A;  1UUS A;  1M31 A;  3TDU A;  1PAL A;  4CLN A;  3GOF A;  1S3P A;  2ZN8 A;  2K0J A;  3HX4 A;  2FOT A;  4XYN A;  2WOS A;  4P2Y B;  3SG7 A;  5KU1 A;  1LIN A;  2V53 A;  1DT7 B;  2TN4 A;  4NQG A;  3D0Y A;  1N2D A;  2JRF A;  2PAS A;  3SG4 A;  1F4Q A;  4ORA B;  3TUY B;  1BLQ A;  1SMG A;  4N5X A;  4YGB B;  1SPY A;  2LLU A;  1G8I A;  1BR4 B;  2L51 A;  3OB1 B;  1YUR A;  2AMI A;  2KAV A;  1LKJ A;  2KNE A;  2MBX A;  2LLT A;  1QX7 A;  2Y1N A;  3RM1 A;  2EHB A;  3PN7 C;  2DOQ A;  2PMY A;  2MLF C;  1DGV A;  2K8M B;  2ZN9 A;  1DTL A;  3FWB A;  3AKA A;  1OSA A;  3KHE A;  1F71 A;  2KI4 B;  1MHO A;  1V1F A;  1K9P A;  2B1U A;  2K7D A;  2QAC A;  3TDZ A;  4OVN F;  1JFK A;  3SG6 A;  2JXL A;  3KF9 A;  4ETO A;  3JVT C;  2CT9 A;  1XA5 A;  3I5I B;  1AJ5 A;  3BOW A;  3O2P A;  1BF5 A;  2F3Y A;  3O78 A;  1GGZ A;  2LP2 A;  1DJI A;  4E68 A;  1NWD A;  1PSB A;  2CXJ A;  1DVI A;  4ORB B;  2KGB C;  3BOW B;  1C7W A;  4I5J A;  4C0J A;  1CDN A;  2NCP A;  1SK6 D;  3BXK A;  2F2P A;  4N1F A;  4DIR A;  2KYF A;  3K21 A;  3EK7 A;  3PAL A;  1F55 A;  1DJW A;  1CLB A;  1QS7 A;  1L2O B;  2R2I A;  2KI6 D;  4HSZ A;  4YI8 A;  4YRU A;  1Y1A A;  4A4B A;  1JF0 A;  2JOJ A;  2G2B A;  5CSF A;  2AAO A;  1K94 A;  4USL A;  3SG5 A;  1K95 A;  4U8D A;  1RRO A;  4QJ4 B;  1B1G A;  4GPL B;  2K7C A;  3PN7 B;  5CSN A;  5D69 A;  1TNQ A;  4OR9 B;  1H4B A;  1XFY O;  3WHU B;  1SYM A;  1KWO C;  1CM1 A;  4GBA A;  2L4H A;  3SIB A;  3KEV A;  3EK8 A;  2IS9 A;  2I18 A;  2WCF A;  5I2O A;  3JVT B;  2I7A A;  1IH0 A;  4F0Z B;  2BKH B;  4GGF C;  1QV0 A;  2BCX A;  4JQ0 D;  4HRG A;  3IQO A;  3BUN B;  3EVU A;  3CGA A;  1BG1 A;  1PSR A;  4C0K A;  2MLE C;  4L9M A;  1EG4 A;  2M97 A;  5DKR A;  3EVR A;  4DUQ A;  3OP0 A;  4IL1 A;  3HCM A;  1U5I A;  4PHK A;  2FJU B;  4ICB A;  1XFZ O;  4XJK A;  1EJ3 A;  1YUU A;  2LAP A;  4YBH B;  1QJT A;  1J7R A;  2HPS A;  3DVJ A;  1A75 A;  1DF0 A;  1S6I A;  1U5I B;  1QLS A;  1KFU L;  2BKI B;  2K61 A;  4GUK A;  5CPV A;  3ZWH A;  1DJY A;  5TNC A;  2Q91 A;  1X02 A;  1NX3 A;  1QVI Y;  1TCF A;  1DF0 B;  1YX8 A;  1JWD A;  5J3X A;  4MEW A;  1OMD A;  2F8P A;  3ICB A;  1CFP A;  1KWO B;  4GGF A;  2L50 A;  4MRY A;  1CLL A;  2BE4 A;  3BUM B;  3ZNI A;  5HKY A;  1JC2 A;  2KHN A;  2JTT A;  1K8U A;  3SIA A;  2JPT A;  2LUC A;  3PLF B;  1AVS A;  3LK1 A;  4M2P A;  2KFF A;  3JTD C;  4HRH A;  5I8N A;  2KBM A;  1ALV A;  4JPZ B;  1DJZ A;  1LXF C;  4DCK A;  2ISD A;  3FWC A;  1MUX A;  1KK7 Y;  2PAL A;  3NSI A;  5AEQ A;  2JNF A;  2LCP A;  2M7N A;  2D8N A;  2LMV A;  4MRX A;  2K7B A;  1CMF A;  1FPW A;  2ZRS A;  1S26 D;  3SJS A;  2H2K A;  2L0P A;  1D1O A;  3F45 A;  1CLM A;  2CTN A;  3DVM A;  1YR5 A;  1R6P A;  1ZFS A;  4OCI A;  3PM8 A;  2HQ8 A;  3NXA A;  5HKZ A;  4DRW A;  4AOM A;  2CCM A;  3A4U B;  4CFR A;  4QJ5 B;  1C7V A;  1CKK A;  2BBM A;  1KQV A;  1JUO A;  2A4J A;  4YGD B;  1WRZ A;  3IQQ A;  1L2O C;  1XVJ A;  2PSR A;  5HYD A;  1SL7 A;  1KCY A;  2LMU A;  4YGA A;  4I5K A;  1Y0V H;  1S6C A;  4P5O E;  1YVL A;  2LP3 A;  1YVH A;  2BCB A;  2COL B;  4FQO A;  3DD4 A;  1OE9 B;  1K2H A;  5D7F A;  5G08 A;  2LNK A;  4MZK A;  2ZND A;  1CTR A;  3DVK A;  2K2A A;  4A4C A;  1BR1 B;  2FCE A;  3VRR A;  1RWY A;  3JTD B;  1YX7 A;  2LMT A;  1SKT A;  1IJ5 A;  1V1G A;  2EGD A;  3VRN A;  1R2U A;  4YGC B;  2KFG A;  3PSR A;  1SL8 A;  1SCM C;  1HQV A;  1BT6 A;  3CWG A;  1B7T Y;  1NYA A;  3WNX B;  1K9U A;  1B8C A;  1GGW A;  3GK4 X;  3EKJ A;  1JBA A;  2OPO A;  1BOC A;  2GGZ A;  2JUL A;  3MSE B;  3IF7 A;  5AXI A;  4FTG A;  1IRJ A;  1QAT A;  1AK8 A;  2KFH A;  1F8H A;  2JWW A;  4WRI A;  1JFJ A;  1UHJ A;  1FBV A;  1CNP A;  2KAX A;  1QV1 A;  4CID A;  2Q4U A;  5B8I B;  3D10 A;  1AHR A;  1NP8 A;  3AAK A;  1CFF A;  3BUW B;  1PVB A;  4YI9 A;  1KQM C;  1Q80 A;  2H61 C;  1IGV A;  1Y1U A;  2ZRT A;  2OTG C;  3O6B A;  4PE7 A;  5AER A;  4PE4 A;  2G9B A;  3LLE A;  1RK9 A;  3SG3 A;  3DF0 A;  3EVV A;  2OS8 C;  1SW8 A;  2NCO A;  2JT0 A;  1ZOT B;  4WQ3 A;  2E6W A;  2JNX A;  2VRG A;  4N1G A;  4PCW A;  2WCE A;  2LE9 B;  4MBE A;  3DF0 B;  4PDZ A;  1SCM B;  1B47 A;  3VGO A;  1NUB A;  2KBI A;  3CR2 A;  1A29 A;  3OB2 B;  4GAO A;  4PHJ A;  3QRX A;  1XFU O;  5CSI A;  1MXE A;  5IBW A;  1QXP A;  1F54 A;  1KK8 B;  3I5F B;  1TNX A;  2LV7 A;  1SCV A;  5I2L A;  5DKQ A;  3EKH A;  1EL4 A;  1Y1X A;  1PUL A;  1ZUZ A;  5GQQ C;  1NCZ A;  1IG5 A;  2SCP A;  1XK4 C;  4AQJ A;  1SRA A;  1CFD A;  2JT8 A;  1TRF A;  1KQM B;  4I5L B;  5ER5 A;  4AQI A;  3OX6 A;  4ORC B;  2OTG B;  1BJF A;  2JT3 A;  1QVI Z;  3CLN A;  5AAN A;  2NZ0 A;  2QPT A;  1IQ3 A;  2OS8 B;  2PVB A;  1NCX A;  1EH2 A;  1Y6W A;  3CR4 X;  2M8U A;  1AP4 A;  1OZS A;  2WCB A;  3VRQ A;  1RJV A;  4PAL A;  2ZFD A;  2JQ6 A;  1DJX A;  5K89 A;  5HLV A;  3TZ1 A;  4MSP A;  3BUO B;  1MWN A;  1MQ1 A;  1RTP 1;  2WND A;  4I5N B;  1CDL A;  1FI6 A;  1FW4 A;  2JU0 A;  3AKB A;  5KSZ A;  5KTY A;  1KK7 Z;  1XK4 A;  2KQ6 A;  1QIW A;  1W7J B;  1N65 A;  5I2Q A;  1AJ4 A;  2I94 A;  1JSA A;  2KAY A;  2KYC A;  1NX2 A;  2BCA A;  1MR8 A;  1KFX L;  1TNP A;  1TTX A;  4UPG A;  2F33 A;  1NCY A;  4PHN A;  1OZO A;  4NDB A;  1QIV A;  3EK4 A;  2LUX A;  1J1E A;  3TDI A;  1MXL C;  1YTZ C;  4Q04 A;  1W7I B;  1ODB A;  2CBL A;  1JF2 A;  1KSM A;  4NDC A;  3E3R A;  1EG3 A;  4CFQ A;  1OMR A;  4HRE E;  2O60 A;  3I5G C;  1DMO A;  1B8R A;  2HF5 A;  4QJ3 B;  2M9G A;  1K90 D;  4MVF A;  3BYA A;  4C0L A;  1QTX A;  2HQW A;  1WRL A;  2MRD A;  5HLO A;  1CMG A;  3I5H C;  2JTZ A;  1K96 A;  1CM4 A;  3CR5 X;  3BUX B;  1EXR A;  1LA3 A;  3PFV A;  2AUC A;  2WOR A;  4WQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...