1WDCC

Scallop myosin regulatory domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
152
Chain Sequence
LSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Muscle protein
molecule keywords SCALLOP MYOSIN
publication title Structure of the regulatory domain of scallop myosin at 2 A resolution: implications for regulation.
pubmed doi rcsb
total genus 50
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 1996-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wdcC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wdcC02
5I2QA 2ZNEA 3I5GC 2WC8A 3VRRA 3ZWHA 1UHJA 1IRJA 2LE9B 3DVEA 3EKJA 1B1GA 1UHHA 1J55A 1IKUA 2PRUA 1KSMA 1W7IB 2B1UA 1YVLA 1CFCA 1U5IB 2CBLA 2EC6C 4A4BA 4M2QA 1WRKA 1DVIA 1MHOA 4N1GA 5AXIA 1JBAA 3GOFA 4I5JA 1CDLA 1Y1AA 4ZCVA 3KF9A 3JTDB 2QPTA 2I94A 1MXLC 2M1UA 2I2RE 4GBAA 4OR9B 5CPVA 1NCYA 4DRWA 1WRLA 1KFUL 2M8UA 1BMOA 4BY5A 4CIDA 1UUSA 1A29A 3KEVA 2KSPA 1ALVA 1XFZO 2LVJA 1K95A 2KFFA 2MLEC 5CSNA 2JT0A 1NP8A 2BKHB 2MJWB 3BQ3A 4MLWA 4PE1A 1QS7A 2FCEA 2NLNA 5B8IB 2EC6B 3NSIA 4FQOA 1NPQA 1BOCA 1IG5A 1OMDA 1DJHA 2ZFDA 1Y1UA 1YX7A 1RK9A 2JU0A 1DTLA 4MZKA 1CTRA 1S5GY 3LLEA 1OMRA 3LK0A 1FF1A 1NX0A 1KK7Y 1OOJA 1QIWA 2M7NA 1KWOB 3RM1A 1NSHA 1H8BA 2M0RA 2JZIA 2F2OA 2KI4B 5CSJA 4C0JA 1SYMA 1WDCC 1ODBA 3LK1A 2LC5A 4XYNA 1JFJA 3OP0A 3RLZA 3VGOA 1JSAA 1N65A 1UP5A 3TZ1A 4HRHA 3SG7A 1SKTA 4NDBA 4NDDA 2OTGC 3E3RA 4PHMA 3ZNIA 2NXQA 1NWDA 2OS8C 1LKJA 3VRNA 1VRKA 2K7BA 4TNCA 4C0KA 2AMIA 3CR4X 2M49B 1K9PA 1SPYA 2JXLA 2KAYA 5J3XA 1SCMC 4GUKA 3FWCA 2WNDA 4JQ0D 5CSIA 2BCAA 1SR6C 2MBXA 4BY4A 1M46A 3PSRA 3M0WA 1WDCB 4CFQA 1BR4B 1YX8A 1ALWA 5DKQA 1K2HA 2LCPA 1TCFA 2K61A 1B7TY 1JF0A 2M3WA 3SG2A 2FOTA 2JULA 4QJ5B 1EG4A 1KQMB 1DJXA 4MZJA 1K9UA 2KQ6A 1EXRA 3CLNA 1RJVA 2BBMA 2H61C 5HKZA 4WQ2A 3BUMB 2H2KA 1TNWA 1DJGA 1HQVA 2LVKA 2PSRA 1PSBA 2G9BA 2LVVA 2PMYA 1SCMB 1SL9A 1AK8A 1C07A 1X02A 1L2OB 2GV5A 5DKNA 1DGUA 2AUCA 2EHBA 1SCVA 3LL8B 1ZFSA 1M31A 1CB1A 4PE0A 4D1EA 2R2IA 1B8RA 2E6WA 3OX6A 2HQWA 1FPWA 3EKHA 1LA3A 4OCIA 4U8DA 4WQ3A 1MXEA 1AP4A 4OV2A 2KI6C 3FS7A 1SY9A 1LINA 1XA5A 1BLQA 3QRXA 2JXCA 3CWGA 2D8NA 4OKHA 1CFFA 2TN4A 2ZRTA 2LMVA 1U5IA 4OVNF 1DT7B 1F71A 4MSPA 1CMFA 4NDCA 2M7LA 2OPOA 2A4JA 1J1DA 1A2XA 1DJZA 3KHEA 3MSEB 2BL0C 1QJTA 2LMUA 2KBMA 2G2BA 2WCBA 1XK4C 3D10A 5AEQA 4GGFC 5IBWA 3O2PA 1CLMA 2ZRSA 5D69A 2BKIB 1SRAA 3PALA 4I5LB 1FW4A 5FYXA 5HKYA 1YRTB 1WY9A 4MEWA 4CPVA 2Y5IA 3TS5C 1QLKA 1KFXL 1QVIZ 3F45A 3SIBA 3VRPA 2L0PA 2L50A 5JJGA 3JVTB 1FI6A 2JWWA 2JTTA 1UWOA 4GGNA 3PATA 2LNKA 2L2EA 1QX7A 2BL0B 1QASA 3NSOA 3HX4A 4YRUA 1NX2A 2Y4QA 2BBNA 1AVSA 1QX5B 3HCMA 1A4PA 2F2PA 1KFUS 2PVBA 1QX2A 3I5GB 1PK0D 2JC2A 2M9GA 2KQYA 3I5FC 1K93D 3TS5B 1BODA 2LHIA 3FWBA 2M97A 4R1EA 1JWDA 2DOQA 5D7FA 1B47A 2KYCA 2O5GA 4IL1A 1CNPA 4A4CA 1TNPA 2CXJA 4L9MA 2LVIA 4YGAA 1OZOA 2LAPA 1GJYA 1OQPA 3KPXA 2P6BB 1DJWA 5KU1A 1CDPA 2ZKMX 2HF5A 4MVFA 1A03A 3IQQA 1WLZA 1AUIB 1XYDA 3EVUA 1W7JB 4N5XA 5HYDA 2F33A 3I5FB 5F6TA 4CFRA 1B8LA 2ZN8A 1UHKA 3OB1B 1H4BA 3TDUA 1S6CA 1S3PA 3PLFB 2JNFA 4N1FA 4GAOA 1AJ4A 4ICBA 2GGMA 2LANA 3I5HC 1N0YA 1R6PA 4YI9A 1DF0B 1M39A 2HQ8A 4GFTA 2JTZA 1TIZA 2CT9A 3O78A 4PHKA 1YR5A 3ICBA 1K8UA 4WRIA 1IQ3A 1CDNA 4USLA 2LLUA 4XJKB 2I7AA 2NCOA 1XO5A 1CLBA 1RTP1 1TNXA 1SK6D 1JC2A 5AANA 2K2AA 1MQ1A 1ZUZA 1LVCD 2OTGB 3I5IC 3I5HB 2OS8B 2JT3A 3GK2A 1NYAA 3TDZA 2LUXA 2L51A 3PFVA 3A8RA 1EH2A 1Q80A 2KGRA 1DMOA 3CR5X 5K89A 3SG4A 4AOMA 1SR6B 2KI6D 1J7QA 4DCKA 1D1OA 2F3YA 3AKAA 1A75A 3SG5A 1BF5A 2BCXA 1GQMA 4MBEA 1TRFA 5PALA 3PN7C 2COLB 1B9AA 3I5IB 4HSZA 1PALA 2KAVA 2K7CA 1SL8A 1V1FA 2ZN9A 2KFHA 2KDHA 2QACA 2CTNA 1BT6A 5JOLA 1G4YR 1YTZC 2LLSA 2NZ0A 1V1GA 3CTNA 4I5NB 3WNXB 2K7DA 4P5OE 1LA0A 5HKWA 2ZNDA 1C7WA 3PM8A 1J7OA 1PSRA 1XFVO 1J7PA 3BYAA 4YI8A 2NCPA 1RWYA 4P2YB 4PE4A 3PN7B 4MRYA 3EK4A 4DUQA 2K2FA 2KOTA 2KNEA 2K0JA 3VROA 1JUOA 1NX1A 1XVJA 4JPZB 1NUBA 2Q91A 1HT9A 1YUSA 2JNXA 3IQOA 4C0LA 1QVIY 2L4HA 1CM1A 1R2UA 1SMGA 2JOJA 2MLFC 5HLOA 3EVVA 5G08A 4MRXA 1KFXS 4YGBB 1GGZA 3OX5A 2PASA 1MR8A 4GPLB 2FJUB 3AAJA 3K21A 1S6IA 1YVHA 1G8IA 2AAOA 2KBIA 4AQJA 1QLSA 4FTGA 2JPTA 5GQQC 1K94A 4QJ3B 2JQ6A 1YRUB 3WHTB 1PVAA 4ORBB 5HLVA 5AERA 1Y6WA 1WRZA 1E8AA 1DJYA 1DF0A 1G33A 2WCEA 3NXAA 1QATA 1TOPA 3H4SE 5AFPA 1YURA 5ER5A 2CNPA 2Y1NA 1MWNA 2JRFA 2MAZA 1IGVA 2VRGA 2BE4A 2GGZA 1J1EA 1F54A 3DD4A 2MHHA 1RROA 4YGDB 2L4IA 2E30A 3BUWB 4XJKA 1M45A 3GK4X 1S36A 2K7OA 1S26D 2LLTA 3DF0B 3D0YB 3BUOB 3CR2A 3CGAA 4I5KA 1KWOC 1GGWA 2KGBC 1KSOA 2KI4C 4ZCUA 4HREE 1B8CA 1ZACA 1JFKA 1NX3A 3C1VA 1OE9B 3OHMB 3BOWB 1A75B 1KCYA 3DVKA 1KQVA 1UURA 2L5XB 1PVBA 1CKKA 1FI5A 2BCBA 3IF7A 1M63B 1K96A 2KFGA 3TDIA 5TNCA 3VRQA 5ER4X 1QXPA 1UHIA 2KAXA 1IQ5A 4MZLA 4PCWA 4YGCB 1NCXA 2LP3A 2LV7A 1EL4A 5I2LA 3LCPC 3WHUB 1CLLA 3BUXB 4UPGA 1JF2A 3EK7A 5KTYA 1BG1A 3SG6A 3NSKA 1CMGA 1S5GZ 4PALA 2RGIA 4M2PA 1OSAA 2H61A 4GNKB 1KK7Z 1XFYO 2PALA 1SL7A 3GK1A 1TNQA 2K8MB 3TUYC 3NSLA 1YUTA 1CFPA 1TCOB 1KQMC 1NIWA 3SG3A 1C7VA 2I18A 1BJFA 1XFWO 1K9KA 2LUCA 4HRGA 4ORAB 3CS1A 4JWQA 1F4OA 1N2DA 1TN4A 3EK8A 3DVJA 2JT8A 2F8PA 2O60A 1SNLA 2M29A 2WOSA 1ZOTB 1J7RA 1TTXA 1ZMZA 1L2OC 1IWQA 2LHLA 4NQGA 1DGVA 1MF8B 1S6JA 2CCMA 1BU3A 1QTXA 3FIAA 1F70A 1RFJA 1FBVA 1Y0VH 3TUYB 2M1KB 1LXFC 3BUNB 2WCFA 1RECA 2ISDA 1PRWA 1SW8A 1CM4A 4PE7A 1YUUA 1UHNA 1NCZA 2LM5A 4PHNA 2HPSA 2FCDA 2HETA 4F0ZB 1B7TZ 1IJ5A 3O6BA 1AHRA 5I8NA 4ORCB 3SJSA 3BXKA 2KHNA 1QIVA 1QV1A 1Y1XA 2SCPA 1K90D 2L98A 2IS9A 2Q4UA 1KK8C 1XK4A 3EVRA 1XFUO 3OB2B 3CZTX 3AKBA 4GGFA 4PDZA 4YBHB 4QJ4B 4E68A 1AJ5A 1F55A 3DVMA 2MRDA 4YGEB 4M2OA 2WORA 4PHJA 1F4QA 4ETOA 1OMVA 3AAKA 1BR1B 1F8HA 1MUXA 2F3ZA 3SIAA 4DS7A 1L7ZA 2MA2A 2V53A 5I2OA 2Y1MA 4AQIA 4Q04A 1PULA 1XFXO 1EG3A 1QV0A 1KK8B 1S1EA 2SASA 4MN0A 3JVTC 3A4UB 1EJ3A 1CDMA 1IJ6A 3DF0A 2EGDA 3D0YA 5DKRA 2KYFA 5KSZA 3KO0A 1OZSA 3JTDC 3O4YA 4DIRA 1CFDA 1SBJA 4CLNA 2LMTA 1IH0A 2BECA 1WLMA 5CSFA 3WXAA 5BPJA 1B4CA 1DJIA 3BOWA 2BE6A 2LP2A
chains in the Genus database with same CATH superfamily
5I2QA 2ZNEA 3I5GC 2WC8A 3BFAA 1TUJA 1UHJA 2QEOA 3VRRA 1IRJA 3ZWHA 2LE9B 3DVEA 2JPOA 3EKJA 3L4AA 1B1GA 1UHHA 1J55A 1IKUA 2PRUA 1KSMA 3PM2A 1W7IB 2B1UA 1YVLA 1CFCA 3SS3A 1U5IB 3BFBA 3O4XA 2CBLA 2EC6C 4A4BA 4M2QA 1WRKA 1DVIA 1MHOA 4N1GA 5AXIA 1JBAA 3GOFA 2P70A 1CDLA 1Y1AA 4I5JA 3KF9A 3JTDB 4ZCVA 2QPTA 2I94A 1MXLC 2M1UA 3DYEA 2I2RE 4GBAA 4OR9B 5CPVA 1NCYA 1GM0A 4DRWA 1WRLA 1KFUL 2M8UA 1BMOA 4BY5A 4CIDA 1UUSA 1A29A 3KEVA 1P28A 2KSPA 3BJHA 1ALVA 1XFZO 2LVJA 1K95A 2KFFA 2MLEC 5CSNA 4OZDA 2JT0A 1NP8A 2BKHB 2WCHA 2MJWB 5FI6A 3BQ3A 4MLWA 4PE1A 1QS7A 2FCEA 2NLNA 5B8IB 1OOGA 2EC6B 3NSIA 4FQOA 1NPQA 3OBVA 1BOCA 1IG5A 5I94A 1OMDA 1DJHA 2ZFDA 1Y1UA 1YX7A 1RK9A 2JU0A 1DTLA 3CYZA 4MZKA 1CTRA 1S5GY 3LLEA 1OMRA 3LK0A 1FF1A 1NX0A 1KK7Y 1OOJA 1QIWA 2M7NA 4IJ7A 1KWOB 3RM1A 1NSHA 3S0EA 1H8BA 2M0RA 2JZIA 3DY9A 2F2OA 2KI4B 5CSJA 1T14A 4C0JA 1SYMA 3S0AA 1WDCC 1ODBA 2L5YA 3LK1A 2LC5A 4XYNA 1JFJA 3OP0A 3RLZA 3VGOA 1JSAA 1N65A 1UP5A 3TZ1A 4HRHA 3SG7A 1SKTA 4NDBA 4NDDA 1C07A 2OTGC 2P71A 3E3RA 4PHMA 3ZNIA 2NXQA 1NWDA 2OS8C 1LKJA 3VRNA 1VRKA 2K7BA 4TNCA 4C0KA 2AMIA 3CR4X 2M49B 1C3ZA 1K9PA 1SPYA 2JXLA 2KAYA 5J3XA 1SCMC 4GUKA 3FWCA 2WNDA 4JQ0D 5CSIA 2BCAA 1SR6C 2MBXA 4BY4A 1DC1A 1M46A 3PSRA 3M0WA 1WDCB 4CFQA 1BR4B 1YX8A 3S0DA 1ALWA 5DKQA 1K2HA 1W9ZA 2LCPA 1TCFA 2K61A 1B7TY 1JF0A 2M3WA 3SG2A 2FOTA 2JULA 3D76A 4QJ5B 1EG4A 1KQMB 1DJXA 1DEKA 1K9UA 2KQ6A 4MZJA 1EXRA 3CLNA 1RJVA 3SS4A 2QEVA 2BBMA 2H61C 3D78A 4WQ2A 5HKZA 2K60A 3BUMB 2H2KA 1TNWA 1DJGA 3DZTA 1HQVA 2LVKA 2PSRA 1PSBA 2G9BA 2LVVA 2PMYA 1SCMB 1SL9A 3L47A 4PT1A 1AK8A 1X02A 1L2OB 2GV5A 5DKNA 1DGUA 2AUCA 2EHBA 1SCVA 2QEHA 1ZFSA 3LL8B 3Q8IA 1M31A 1CB1A 1OOFA 4PE0A 2WCKA 4D1EA 2R2IA 1B8RA 2E6WA 3OX6A 2HQWA 1FPWA 3CZ1A 3EKHA 1LA3A 4OCIA 4U8DA 4WQ3A 1MXEA 1AP4A 4OV2A 2KI6C 3FS7A 1SY9A 1LINA 1XA5A 1OOHA 1BLQA 3QRXA 2JXCA 3CWGA 2D8NA 4OKHA 1CFFA 2TN4A 2ZRTA 2LMVA 1U5IA 4OVNF 1DT7B 2QEBA 1F71A 4MSPA 1CMFA 4NDCA 2M7LA 2OPOA 2A4JA 1J1DA 1A2XA 1DJZA 3KHEA 3MSEB 2BL0C 1QJTA 1XFRA 2LMUA 3S0FA 2KBMA 2G2BA 2WCBA 1XK4C 3D10A 5AEQA 4INWA 4GGFC 5IBWA 3O2PA 1CLMA 2ZRSA 5D69A 2BKIB 1SRAA 3PALA 4I5LB 1FW4A 5FYXA 5HKYA 1YRTB 1WY9A 4MEWA 4CPVA 2Y5IA 3TS5C 1QLKA 1KFXL 1QVIZ 3F45A 3SIBA 3VRPA 2L0PA 2L50A 5JJGA 3JVTB 1FI6A 2JWWA 2JTTA 1UWOA 4GGNA 3PATA 2LNKA 2L2EA 1QX7A 2YGUA 2BL0B 1QASA 3NSOA 3HX4A 4YRUA 1NX2A 3N7HA 2Y4QA 2BBNA 2BE6A 1AVSA 1QX5B 3HCMA 1A4PA 2F2PA 1KFUS 2PVBA 1QX2A 3I5GB 1PK0D 2JC2A 2M9GA 3NHTA 2KQYA 3I5FC 1K93D 3B6XA 3TS5B 2LHIA 3FWBA 2M97A 4R1EA 1BODA 2DOQA 5D7FA 1B47A 2KYCA 2O5GA 4IL1A 1CNPA 4A4CA 1TNPA 2CXJA 4L9MA 2LVIA 2ERBA 4YGAA 1OZOA 2LAPA 1GJYA 1OQPA 3KPXA 2P6BB 3D73A 1DJWA 5KU1A 1CDPA 2ZKMX 2HF5A 4MVFA 1A03A 3FE9A 1QWVA 3IQQA 1WLZA 1AUIB 3PJIA 1XYDA 3EVUA 4INXA 1W7JB 4N5XA 5HYDA 2F33A 3I5FB 5F6TA 4CFRA 1B8LA 2ZN8A 3QMEA 1UHKA 3OB1B 1H4BA 3TDUA 1S6CA 1S3PA 3PLFB 2JNFA 4N1FA 4GAOA 1AJ4A 4ICBA 4JKTA 1ORGA 2GGMA 1BG1A 2LANA 3I5HC 3B7AA 1N0YA 3V2LA 1Z4HA 1R6PA 4YI9A 1DF0B 1M39A 2HQ8A 4GFTA 2JTZA 2WC6A 1TIZA 1DQEA 1TWOA 2CT9A 5EL2A 3O78A 4PHKA 1YR5A 1IIOA 3ICBA 1K8UA 3D74A 1LS8A 4WRIA 1IQ3A 1CDNA 4USLA 2LLUA 4XJKB 2I7AA 2NCOA 3B87A 1XO5A 1CLBA 1RTP1 1TNXA 1SK6D 1JC2A 5AANA 2K2AA 1MQ1A 1ZUZA 1LVCD 2OTGB 3I5IC 3I5HB 2OS8B 2JT3A 3GK2A 1NYAA 3TDZA 2LUXA 2L51A 2BNXA 3PFVA 3A8RA 3S0GA 1EH2A 1Q80A 2KGRA 1DMOA 3CR5X 5K89A 3SG4A 4AOMA 1SR6B 5FI7A 3VB1A 3RZSA 2KI6D 1J7QA 4DCKA 1D1OA 2F3YA 3AKAA 3SG5A 1BF5A 2BCXA 1GQMA 4MBEA 1TRFA 1Z2CB 5PALA 3PN7C 2COLB 1B9AA 3I5IB 3D77A 4HSZA 4FQTA 1PALA 2KAVA 2K7CA 1SL8A 1V1FA 2ZN9A 2KFHA 2KDHA 2QACA 2CTNA 1BT6A 5JOLA 1G4YR 3IVTA 1YTZC 2LLSA 2NZ0A 1V1GA 3CTNA 4I5NB 3WNXB 2K7DA 4P5OE 1SSEB 3K1EA 1LA0A 5HKWA 2ZNDA 1C7WA 5FI2A 3PM8A 1J7OA 1PSRA 1XFVO 1J7PA 3BYAA 3NGVA 4YI8A 2NCPA 1RWYA 4P2YB 4PE4A 3PN7B 4MRYA 3EK4A 4DUQA 2K2FA 2KOTA 2KNEA 2K0JA 3VROA 1JUOA 1NX1A 1XVJA 4JPZB 1NUBA 2Q91A 1HT9A 1YUSA 2JNXA 2L2CA 3IQOA 4F7FA 4C0LA 1QVIY 2L4HA 1CM1A 1R2UA 1SMGA 2KPHA 2JOJA 2MLFC 5HLOA 3EVVA 5G08A 4MRXA 3R1PA 2PYQA 1KFXS 4YGBB 1GGZA 3OX5A 2PASA 1MR8A 4GPLB 2FJUB 3AAJA 4KYNA 3K21A 1S6IA 2KLEA 1YVHA 1G8IA 2AAOA 3B88A 2KBIA 4AQJA 1QLSA 4FTGA 2JPTA 5GQQC 3SS5A 1K94A 4QJ3B 2JQ6A 1YRUB 3WHTB 1PVAA 4ORBB 5HLVA 3UO9A 5AERA 1Y6WA 1WRZA 1E8AA 1DJYA 1DF0A 1G33A 2WCEA 3NXAA 1QATA 1TOPA 3H4SE 5AFPA 1YURA 5ER5A 2CNPA 2Y1NA 1MWNA 2JRFA 2MAZA 1IGVA 2VRGA 2BE4A 2GGZA 1J1EA 1F54A 3DD4A 2MHHA 1RROA 2WC5A 4YGDB 2L4IA 2E30A 3BUWB 4XJKA 1M45A 3GK4X 1S36A 2K7OA 1S26D 2LLTA 3DF0B 3D0YB 3BUOB 3CR2A 3CGAA 4I5KA 1KWOC 1GGWA 2KGBC 1KSOA 1C3YA 2KI4C 3B86A 2PQLA 4HREE 4ZCUA 1B8CA 1ZACA 1JFKA 1NX3A 3C1VA 1OE9B 3OHMB 1OOIX 3BOWB 1A75B 1KCYA 1TUZA 3DVKA 1KQVA 1UURA 2L5XB 1PVBA 1CKKA 1FI5A 2BCBA 3IF7A 1M63B 1K96A 2KFGA 3TDIA 5TNCA 2H8VA 3R1VA 3UNWA 3VRQA 5ER4X 1QXPA 1UHIA 2KAXA 1IQ5A 4MZLA 4PCWA 4YGCB 1NCXA 2LP3A 2LV7A 1EL4A 5I2LA 3LCPC 3WHUB 1CLLA 3BUXB 4UPGA 1JF2A 3EK7A 3DXLA 5KTYA 3SG6A 3NSKA 1CMGA 1S5GZ 4PALA 2RGIA 3R1OA 2WCMA 4M2PA 1OSAA 3R72A 2H61A 4GNKB 1KK7Z 1XFYO 2PALA 3OGNA 4JD9A 1SL7A 3GK1A 1TNQA 2K8MB 3TUYC 3NSLA 1YUTA 1CFPA 1TCOB 1KQMC 1NIWA 3SG3A 1C7VA 5D3OA 2I18A 1BJFA 1XFWO 1K9KA 2LUCA 3CZ0A 4HRGA 2WCLA 4ORAB 3CS1A 4JWQA 1F4OA 1N2DA 1TN4A 3EK8A 3DVJA 2JT8A 2F8PA 2O60A 1SNLA 2M29A 2WOSA 1ZOTB 1J7RA 1TTXA 1ZMZA 1L2OC 1IWQA 2LHLA 4NQGA 1DGVA 1MF8B 1S6JA 2CCMA 1BU3A 1QTXA 3FIAA 1F70A 1RFJA 1FBVA 1Y0VH 3TUYB 2M1KB 1LXFC 3BUNB 2WCFA 1RECA 2ISDA 1PRWA 1SW8A 1CM4A 4PE7A 1DELA 1UHNA 1NCZA 1YUUA 2LM5A 4PHNA 2HPSA 3S0BA 2FCDA 2HETA 4F0ZB 1B7TZ 3FE6A 2KLDA 3L4LA 1IJ5A 3O6BA 1AHRA 5I8NA 4ORCB 3SJSA 1OW4A 5HL1A 3BXKA 2QDIA 2KHNA 1QIVA 1QV1A 1Y1XA 2SCPA 1K90D 2L98A 2IS9A 2Q4UA 3NHIA 1KK8C 1XK4A 3D75A 3EVRA 1XFUO 3OB2B 3CZTX 3AKBA 4GGFA 4PDZA 4YBHB 4QJ4B 4E68A 1AJ5A 1F55A 1JWDA 3DVMA 2MRDA 3BFHA 4YGEB 2BAPA 4M2OA 3CZ2A 2WORA 3FE8A 1F4QA 4PHJA 3CABA 1OMVA 3AAKA 1BR1B 4ETOA 1F8HA 1MUXA 2F3ZA 3SIAA 4DS7A 2WCJA 5DICA 1L7ZA 2MA2A 2V53A 5I2OA 2Y1MA 4AQIA 4Q04A 1PULA 1XFXO 1EG3A 1QV0A 1KK8B 1S1EA 2SASA 3CDNA 4MN0A 2GTEA 3JVTC 3A4UB 3EG5B 1EJ3A 1CDMA 1IJ6A 3DF0A 2EGDA 3D0YA 5DKRA 2KYFA 5KSZA 3KO0A 1OZSA 3JTDC 3O4YA 4DIRA 1CFDA 1SBJA 4CLNA 2LMTA 1IH0A 2BECA 1WLMA 5CSFA 3WXAA 5BPJA 2FJYA 1B4CA 1DJIA 3BOWA 1A75A 2LP2A
chains in the Genus database with same CATH topology
5I2QA 2ZNEA 3I5GC 2WC8A 3VRRA 3ZWHA 1UHJA 1IRJA 2LE9B 3DVEA 3EKJA 1B1GA 1UHHA 1J55A 1IKUA 2PRUA 1KSMA 1W7IB 2B1UA 1YVLA 1CFCA 1U5IB 2CBLA 2EC6C 4A4BA 4M2QA 1WRKA 1DVIA 1MHOA 4N1GA 5AXIA 1JBAA 3GOFA 4I5JA 1CDLA 1Y1AA 4ZCVA 3KF9A 3JTDB 2QPTA 2I94A 1MXLC 2M1UA 2I2RE 4GBAA 4OR9B 5CPVA 1NCYA 4DRWA 1WRLA 1KFUL 2M8UA 1BMOA 4BY5A 4CIDA 1UUSA 1A29A 3KEVA 2KSPA 1ALVA 1XFZO 2LVJA 1K95A 2KFFA 2MLEC 5CSNA 2JT0A 1NP8A 2BKHB 2MJWB 3BQ3A 4MLWA 4PE1A 1QS7A 2FCEA 2NLNA 5B8IB 2EC6B 3NSIA 4FQOA 1NPQA 1BOCA 1IG5A 1OMDA 1DJHA 2ZFDA 1Y1UA 1YX7A 1RK9A 2JU0A 1DTLA 4MZKA 1CTRA 1S5GY 3LLEA 1OMRA 3LK0A 1FF1A 1NX0A 1KK7Y 1OOJA 1QIWA 2M7NA 1KWOB 3RM1A 1NSHA 1H8BA 2M0RA 2JZIA 2F2OA 2KI4B 5CSJA 4C0JA 1SYMA 1WDCC 1ODBA 3LK1A 2LC5A 4XYNA 1JFJA 3OP0A 3RLZA 3VGOA 1JSAA 1N65A 1UP5A 3TZ1A 4HRHA 3SG7A 1SKTA 4NDBA 4NDDA 2OTGC 3E3RA 4PHMA 3ZNIA 2NXQA 1NWDA 2OS8C 1LKJA 3VRNA 1VRKA 2K7BA 4TNCA 4C0KA 2AMIA 3CR4X 2M49B 1K9PA 1SPYA 2JXLA 2KAYA 5J3XA 1SCMC 4GUKA 3FWCA 2WNDA 4JQ0D 5CSIA 2BCAA 1SR6C 2MBXA 4BY4A 1M46A 3PSRA 3M0WA 1WDCB 4CFQA 1BR4B 1YX8A 1ALWA 5DKQA 1K2HA 2LCPA 1TCFA 2K61A 1B7TY 1JF0A 2M3WA 3SG2A 2FOTA 2JULA 4QJ5B 1EG4A 1KQMB 1DJXA 4MZJA 1K9UA 2KQ6A 1EXRA 3CLNA 1RJVA 2BBMA 2H61C 5HKZA 4WQ2A 3BUMB 2H2KA 1TNWA 1DJGA 1HQVA 2LVKA 2PSRA 1PSBA 2G9BA 2LVVA 2PMYA 1SCMB 1SL9A 1AK8A 1C07A 1X02A 1L2OB 2GV5A 5DKNA 1DGUA 2AUCA 2EHBA 1SCVA 3LL8B 1ZFSA 1M31A 1CB1A 4PE0A 4D1EA 2R2IA 1B8RA 2E6WA 3OX6A 2HQWA 1FPWA 3EKHA 1LA3A 4OCIA 4U8DA 4WQ3A 1MXEA 1AP4A 4OV2A 2KI6C 3FS7A 1SY9A 1LINA 1XA5A 1BLQA 3QRXA 2JXCA 3CWGA 2D8NA 4OKHA 1CFFA 2TN4A 2ZRTA 2LMVA 1U5IA 4OVNF 1DT7B 1F71A 4MSPA 1CMFA 4NDCA 2M7LA 2OPOA 2A4JA 1J1DA 1A2XA 1DJZA 3KHEA 3MSEB 2BL0C 1QJTA 2LMUA 2KBMA 2G2BA 2WCBA 1XK4C 3D10A 5AEQA 4GGFC 5IBWA 3O2PA 1CLMA 2ZRSA 5D69A 2BKIB 1SRAA 3PALA 4I5LB 1FW4A 5FYXA 5HKYA 1YRTB 1WY9A 4MEWA 4CPVA 2Y5IA 3TS5C 1QLKA 1KFXL 1QVIZ 3F45A 3SIBA 3VRPA 2L0PA 2L50A 5JJGA 3JVTB 1FI6A 2JWWA 2JTTA 1UWOA 4GGNA 3PATA 2LNKA 2L2EA 1QX7A 2BL0B 1QASA 3NSOA 3HX4A 4YRUA 1NX2A 2Y4QA 2BBNA 1AVSA 1QX5B 3HCMA 1A4PA 2F2PA 1KFUS 2PVBA 1QX2A 3I5GB 1PK0D 2JC2A 2M9GA 2KQYA 3I5FC 1K93D 3TS5B 1BODA 2LHIA 3FWBA 2M97A 4R1EA 1JWDA 2DOQA 5D7FA 1B47A 2KYCA 2O5GA 4IL1A 1CNPA 4A4CA 1TNPA 2CXJA 4L9MA 2LVIA 4YGAA 1OZOA 2LAPA 1GJYA 1OQPA 3KPXA 2P6BB 1DJWA 5KU1A 1CDPA 2ZKMX 2HF5A 4MVFA 1A03A 3IQQA 1WLZA 1AUIB 1XYDA 3EVUA 1W7JB 4N5XA 5HYDA 2F33A 3I5FB 5F6TA 4CFRA 1B8LA 2ZN8A 1UHKA 3OB1B 1H4BA 3TDUA 1S6CA 1S3PA 3PLFB 2JNFA 4N1FA 4GAOA 1AJ4A 4ICBA 2GGMA 2LANA 3I5HC 1N0YA 1R6PA 4YI9A 1DF0B 1M39A 2HQ8A 4GFTA 2JTZA 1TIZA 2CT9A 3O78A 4PHKA 1YR5A 3ICBA 1K8UA 4WRIA 1IQ3A 1CDNA 4USLA 2LLUA 4XJKB 2I7AA 2NCOA 1XO5A 1CLBA 1RTP1 1TNXA 1SK6D 1JC2A 5AANA 2K2AA 1MQ1A 1ZUZA 1LVCD 2OTGB 3I5IC 3I5HB 2OS8B 2JT3A 3GK2A 1NYAA 3TDZA 2LUXA 2L51A 3PFVA 3A8RA 1EH2A 1Q80A 2KGRA 1DMOA 3CR5X 5K89A 3SG4A 4AOMA 1SR6B 2KI6D 1J7QA 4DCKA 1D1OA 2F3YA 3AKAA 1A75A 3SG5A 1BF5A 2BCXA 1GQMA 4MBEA 1TRFA 5PALA 3PN7C 2COLB 1B9AA 3I5IB 4HSZA 1PALA 2KAVA 2K7CA 1SL8A 1V1FA 2ZN9A 2KFHA 2KDHA 2QACA 2CTNA 1BT6A 5JOLA 1G4YR 1YTZC 2LLSA 2NZ0A 1V1GA 3CTNA 4I5NB 3WNXB 2K7DA 4P5OE 1LA0A 5HKWA 2ZNDA 1C7WA 3PM8A 1J7OA 1PSRA 1XFVO 1J7PA 3BYAA 4YI8A 2NCPA 1RWYA 4P2YB 4PE4A 3PN7B 4MRYA 3EK4A 4DUQA 2K2FA 2KOTA 2KNEA 2K0JA 3VROA 1JUOA 1NX1A 1XVJA 4JPZB 1NUBA 2Q91A 1HT9A 1YUSA 2JNXA 3IQOA 4C0LA 1QVIY 2L4HA 1CM1A 1R2UA 1SMGA 2JOJA 2MLFC 5HLOA 3EVVA 5G08A 4MRXA 1KFXS 4YGBB 1GGZA 3OX5A 2PASA 1MR8A 4GPLB 2FJUB 3AAJA 3K21A 1S6IA 1YVHA 1G8IA 2AAOA 2KBIA 4AQJA 1QLSA 4FTGA 2JPTA 5GQQC 1K94A 4QJ3B 2JQ6A 1YRUB 3WHTB 1PVAA 4ORBB 5HLVA 5AERA 1Y6WA 1WRZA 1E8AA 1DJYA 1DF0A 1G33A 2WCEA 3NXAA 1QATA 1TOPA 3H4SE 5AFPA 1YURA 5ER5A 2CNPA 2Y1NA 1MWNA 2JRFA 2MAZA 1IGVA 2VRGA 2BE4A 2GGZA 1J1EA 1F54A 3DD4A 2MHHA 1RROA 4YGDB 2L4IA 2E30A 3BUWB 4XJKA 1M45A 3GK4X 1S36A 2K7OA 1S26D 2LLTA 3DF0B 3D0YB 3BUOB 3CR2A 3CGAA 4I5KA 1KWOC 1GGWA 2KGBC 1KSOA 2KI4C 4ZCUA 4HREE 1B8CA 1ZACA 1JFKA 1NX3A 3C1VA 1OE9B 3OHMB 3BOWB 1A75B 1KCYA 3DVKA 1KQVA 1UURA 2L5XB 1PVBA 1CKKA 1FI5A 2BCBA 3IF7A 1M63B 1K96A 2KFGA 3TDIA 5TNCA 3VRQA 5ER4X 1QXPA 1UHIA 2KAXA 1IQ5A 4MZLA 4PCWA 4YGCB 1NCXA 2LP3A 2LV7A 1EL4A 5I2LA 3LCPC 3WHUB 1CLLA 3BUXB 4UPGA 1JF2A 3EK7A 5KTYA 1BG1A 3SG6A 3NSKA 1CMGA 1S5GZ 4PALA 2RGIA 4M2PA 1OSAA 2H61A 4GNKB 1KK7Z 1XFYO 2PALA 1SL7A 3GK1A 1TNQA 2K8MB 3TUYC 3NSLA 1YUTA 1CFPA 1TCOB 1KQMC 1NIWA 3SG3A 1C7VA 2I18A 1BJFA 1XFWO 1K9KA 2LUCA 4HRGA 4ORAB 3CS1A 4JWQA 1F4OA 1N2DA 1TN4A 3EK8A 3DVJA 2JT8A 2F8PA 2O60A 1SNLA 2M29A 2WOSA 1ZOTB 1J7RA 1TTXA 1ZMZA 1L2OC 1IWQA 2LHLA 4NQGA 1DGVA 1MF8B 1S6JA 2CCMA 1BU3A 1QTXA 3FIAA 1F70A 1RFJA 1FBVA 1Y0VH 3TUYB 2M1KB 1LXFC 3BUNB 2WCFA 1RECA 2ISDA 1PRWA 1SW8A 1CM4A 4PE7A 1YUUA 1UHNA 1NCZA 2LM5A 4PHNA 2HPSA 2FCDA 2HETA 4F0ZB 1B7TZ 1IJ5A 3O6BA 1AHRA 5I8NA 4ORCB 3SJSA 3BXKA 2KHNA 1QIVA 1QV1A 1Y1XA 2SCPA 1K90D 2L98A 2IS9A 2Q4UA 1KK8C 1XK4A 3EVRA 1XFUO 3OB2B 3CZTX 3AKBA 4GGFA 4PDZA 4YBHB 4QJ4B 4E68A 1AJ5A 1F55A 3DVMA 2MRDA 4YGEB 4M2OA 2WORA 4PHJA 1F4QA 4ETOA 1OMVA 3AAKA 1BR1B 1F8HA 1MUXA 2F3ZA 3SIAA 4DS7A 1L7ZA 2MA2A 2V53A 5I2OA 2Y1MA 4AQIA 4Q04A 1PULA 1XFXO 1EG3A 1QV0A 1KK8B 1S1EA 2SASA 4MN0A 3JVTC 3A4UB 1EJ3A 1CDMA 1IJ6A 3DF0A 2EGDA 3D0YA 5DKRA 2KYFA 5KSZA 3KO0A 1OZSA 3JTDC 3O4YA 4DIRA 1CFDA 1SBJA 4CLNA 2LMTA 1IH0A 2BECA 1WLMA 5CSFA 3WXAA 5BPJA 1B4CA 1DJIA 3BOWA 2BE6A 2LP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2Q A;  2ZNE A;  3I5G C;  2WC8 A;  3VRR A;  3ZWH A;  1UHJ A;  1IRJ A;  2LE9 B;  3DVE A;  3EKJ A;  1B1G A;  1UHH A;  1J55 A;  1IKU A;  2PRU A;  1KSM A;  1W7I B;  2B1U A;  1YVL A;  1CFC A;  1U5I B;  2CBL A;  2EC6 C;  4A4B A;  4M2Q A;  1WRK A;  1DVI A;  1MHO A;  4N1G A;  5AXI A;  1JBA A;  3GOF A;  4I5J A;  1CDL A;  1Y1A A;  4ZCV A;  3KF9 A;  3JTD B;  2QPT A;  2I94 A;  1MXL C;  2M1U A;  2I2R E;  4GBA A;  4OR9 B;  5CPV A;  1NCY A;  4DRW A;  1WRL A;  1KFU L;  2M8U A;  1BMO A;  4BY5 A;  4CID A;  1UUS A;  1A29 A;  3KEV A;  2KSP A;  1ALV A;  1XFZ O;  2LVJ A;  1K95 A;  2KFF A;  2MLE C;  5CSN A;  2JT0 A;  1NP8 A;  2BKH B;  2MJW B;  3BQ3 A;  4MLW A;  4PE1 A;  1QS7 A;  2FCE A;  2NLN A;  5B8I B;  2EC6 B;  3NSI A;  4FQO A;  1NPQ A;  1BOC A;  1IG5 A;  1OMD A;  1DJH A;  2ZFD A;  1Y1U A;  1YX7 A;  1RK9 A;  2JU0 A;  1DTL A;  4MZK A;  1CTR A;  1S5G Y;  3LLE A;  1OMR A;  3LK0 A;  1FF1 A;  1NX0 A;  1KK7 Y;  1OOJ A;  1QIW A;  2M7N A;  1KWO B;  3RM1 A;  1NSH A;  1H8B A;  2M0R A;  2JZI A;  2F2O A;  2KI4 B;  5CSJ A;  4C0J A;  1SYM A;  1WDC C;  1ODB A;  3LK1 A;  2LC5 A;  4XYN A;  1JFJ A;  3OP0 A;  3RLZ A;  3VGO A;  1JSA A;  1N65 A;  1UP5 A;  3TZ1 A;  4HRH A;  3SG7 A;  1SKT A;  4NDB A;  4NDD A;  2OTG C;  3E3R A;  4PHM A;  3ZNI A;  2NXQ A;  1NWD A;  2OS8 C;  1LKJ A;  3VRN A;  1VRK A;  2K7B A;  4TNC A;  4C0K A;  2AMI A;  3CR4 X;  2M49 B;  1K9P A;  1SPY A;  2JXL A;  2KAY A;  5J3X A;  1SCM C;  4GUK A;  3FWC A;  2WND A;  4JQ0 D;  5CSI A;  2BCA A;  1SR6 C;  2MBX A;  4BY4 A;  1M46 A;  3PSR A;  3M0W A;  1WDC B;  4CFQ A;  1BR4 B;  1YX8 A;  1ALW A;  5DKQ A;  1K2H A;  2LCP A;  1TCF A;  2K61 A;  1B7T Y;  1JF0 A;  2M3W A;  3SG2 A;  2FOT A;  2JUL A;  4QJ5 B;  1EG4 A;  1KQM B;  1DJX A;  4MZJ A;  1K9U A;  2KQ6 A;  1EXR A;  3CLN A;  1RJV A;  2BBM A;  2H61 C;  5HKZ A;  4WQ2 A;  3BUM B;  2H2K A;  1TNW A;  1DJG A;  1HQV A;  2LVK A;  2PSR A;  1PSB A;  2G9B A;  2LVV A;  2PMY A;  1SCM B;  1SL9 A;  1AK8 A;  1C07 A;  1X02 A;  1L2O B;  2GV5 A;  5DKN A;  1DGU A;  2AUC A;  2EHB A;  1SCV A;  3LL8 B;  1ZFS A;  1M31 A;  1CB1 A;  4PE0 A;  4D1E A;  2R2I A;  1B8R A;  2E6W A;  3OX6 A;  2HQW A;  1FPW A;  3EKH A;  1LA3 A;  4OCI A;  4U8D A;  4WQ3 A;  1MXE A;  1AP4 A;  4OV2 A;  2KI6 C;  3FS7 A;  1SY9 A;  1LIN A;  1XA5 A;  1BLQ A;  3QRX A;  2JXC A;  3CWG A;  2D8N A;  4OKH A;  1CFF A;  2TN4 A;  2ZRT A;  2LMV A;  1U5I A;  4OVN F;  1DT7 B;  1F71 A;  4MSP A;  1CMF A;  4NDC A;  2M7L A;  2OPO A;  2A4J A;  1J1D A;  1A2X A;  1DJZ A;  3KHE A;  3MSE B;  2BL0 C;  1QJT A;  2LMU A;  2KBM A;  2G2B A;  2WCB A;  1XK4 C;  3D10 A;  5AEQ A;  4GGF C;  5IBW A;  3O2P A;  1CLM A;  2ZRS A;  5D69 A;  2BKI B;  1SRA A;  3PAL A;  4I5L B;  1FW4 A;  5FYX A;  5HKY A;  1YRT B;  1WY9 A;  4MEW A;  4CPV A;  2Y5I A;  3TS5 C;  1QLK A;  1KFX L;  1QVI Z;  3F45 A;  3SIB A;  3VRP A;  2L0P A;  2L50 A;  5JJG A;  3JVT B;  1FI6 A;  2JWW A;  2JTT A;  1UWO A;  4GGN A;  3PAT A;  2LNK A;  2L2E A;  1QX7 A;  2BL0 B;  1QAS A;  3NSO A;  3HX4 A;  4YRU A;  1NX2 A;  2Y4Q A;  2BBN A;  1AVS A;  1QX5 B;  3HCM A;  1A4P A;  2F2P A;  1KFU S;  2PVB A;  1QX2 A;  3I5G B;  1PK0 D;  2JC2 A;  2M9G A;  2KQY A;  3I5F C;  1K93 D;  3TS5 B;  1BOD A;  2LHI A;  3FWB A;  2M97 A;  4R1E A;  1JWD A;  2DOQ A;  5D7F A;  1B47 A;  2KYC A;  2O5G A;  4IL1 A;  1CNP A;  4A4C A;  1TNP A;  2CXJ A;  4L9M A;  2LVI A;  4YGA A;  1OZO A;  2LAP A;  1GJY A;  1OQP A;  3KPX A;  2P6B B;  1DJW A;  5KU1 A;  1CDP A;  2ZKM X;  2HF5 A;  4MVF A;  1A03 A;  3IQQ A;  1WLZ A;  1AUI B;  1XYD A;  3EVU A;  1W7J B;  4N5X A;  5HYD A;  2F33 A;  3I5F B;  5F6T A;  4CFR A;  1B8L A;  2ZN8 A;  1UHK A;  3OB1 B;  1H4B A;  3TDU A;  1S6C A;  1S3P A;  3PLF B;  2JNF A;  4N1F A;  4GAO A;  1AJ4 A;  4ICB A;  2GGM A;  2LAN A;  3I5H C;  1N0Y A;  1R6P A;  4YI9 A;  1DF0 B;  1M39 A;  2HQ8 A;  4GFT A;  2JTZ A;  1TIZ A;  2CT9 A;  3O78 A;  4PHK A;  1YR5 A;  3ICB A;  1K8U A;  4WRI A;  1IQ3 A;  1CDN A;  4USL A;  2LLU A;  4XJK B;  2I7A A;  2NCO A;  1XO5 A;  1CLB A;  1RTP 1;  1TNX A;  1SK6 D;  1JC2 A;  5AAN A;  2K2A A;  1MQ1 A;  1ZUZ A;  1LVC D;  2OTG B;  3I5I C;  3I5H B;  2OS8 B;  2JT3 A;  3GK2 A;  1NYA A;  3TDZ A;  2LUX A;  2L51 A;  3PFV A;  3A8R A;  1EH2 A;  1Q80 A;  2KGR A;  1DMO A;  3CR5 X;  5K89 A;  3SG4 A;  4AOM A;  1SR6 B;  2KI6 D;  1J7Q A;  4DCK A;  1D1O A;  2F3Y A;  3AKA A;  1A75 A;  3SG5 A;  1BF5 A;  2BCX A;  1GQM A;  4MBE A;  1TRF A;  5PAL A;  3PN7 C;  2COL B;  1B9A A;  3I5I B;  4HSZ A;  1PAL A;  2KAV A;  2K7C A;  1SL8 A;  1V1F A;  2ZN9 A;  2KFH A;  2KDH A;  2QAC A;  2CTN A;  1BT6 A;  5JOL A;  1G4Y R;  1YTZ C;  2LLS A;  2NZ0 A;  1V1G A;  3CTN A;  4I5N B;  3WNX B;  2K7D A;  4P5O E;  1LA0 A;  5HKW A;  2ZND A;  1C7W A;  3PM8 A;  1J7O A;  1PSR A;  1XFV O;  1J7P A;  3BYA A;  4YI8 A;  2NCP A;  1RWY A;  4P2Y B;  4PE4 A;  3PN7 B;  4MRY A;  3EK4 A;  4DUQ A;  2K2F A;  2KOT A;  2KNE A;  2K0J A;  3VRO A;  1JUO A;  1NX1 A;  1XVJ A;  4JPZ B;  1NUB A;  2Q91 A;  1HT9 A;  1YUS A;  2JNX A;  3IQO A;  4C0L A;  1QVI Y;  2L4H A;  1CM1 A;  1R2U A;  1SMG A;  2JOJ A;  2MLF C;  5HLO A;  3EVV A;  5G08 A;  4MRX A;  1KFX S;  4YGB B;  1GGZ A;  3OX5 A;  2PAS A;  1MR8 A;  4GPL B;  2FJU B;  3AAJ A;  3K21 A;  1S6I A;  1YVH A;  1G8I A;  2AAO A;  2KBI A;  4AQJ A;  1QLS A;  4FTG A;  2JPT A;  5GQQ C;  1K94 A;  4QJ3 B;  2JQ6 A;  1YRU B;  3WHT B;  1PVA A;  4ORB B;  5HLV A;  5AER A;  1Y6W A;  1WRZ A;  1E8A A;  1DJY A;  1DF0 A;  1G33 A;  2WCE A;  3NXA A;  1QAT A;  1TOP A;  3H4S E;  5AFP A;  1YUR A;  5ER5 A;  2CNP A;  2Y1N A;  1MWN A;  2JRF A;  2MAZ A;  1IGV A;  2VRG A;  2BE4 A;  2GGZ A;  1J1E A;  1F54 A;  3DD4 A;  2MHH A;  1RRO A;  4YGD B;  2L4I A;  2E30 A;  3BUW B;  4XJK A;  1M45 A;  3GK4 X;  1S36 A;  2K7O A;  1S26 D;  2LLT A;  3DF0 B;  3D0Y B;  3BUO B;  3CR2 A;  3CGA A;  4I5K A;  1KWO C;  1GGW A;  2KGB C;  1KSO A;  2KI4 C;  4ZCU A;  4HRE E;  1B8C A;  1ZAC A;  1JFK A;  1NX3 A;  3C1V A;  1OE9 B;  3OHM B;  3BOW B;  1A75 B;  1KCY A;  3DVK A;  1KQV A;  1UUR A;  2L5X B;  1PVB A;  1CKK A;  1FI5 A;  2BCB A;  3IF7 A;  1M63 B;  1K96 A;  2KFG A;  3TDI A;  5TNC A;  3VRQ A;  5ER4 X;  1QXP A;  1UHI A;  2KAX A;  1IQ5 A;  4MZL A;  4PCW A;  4YGC B;  1NCX A;  2LP3 A;  2LV7 A;  1EL4 A;  5I2L A;  3LCP C;  3WHU B;  1CLL A;  3BUX B;  4UPG A;  1JF2 A;  3EK7 A;  5KTY A;  1BG1 A;  3SG6 A;  3NSK A;  1CMG A;  1S5G Z;  4PAL A;  2RGI A;  4M2P A;  1OSA A;  2H61 A;  4GNK B;  1KK7 Z;  1XFY O;  2PAL A;  1SL7 A;  3GK1 A;  1TNQ A;  2K8M B;  3TUY C;  3NSL A;  1YUT A;  1CFP A;  1TCO B;  1KQM C;  1NIW A;  3SG3 A;  1C7V A;  2I18 A;  1BJF A;  1XFW O;  1K9K A;  2LUC A;  4HRG A;  4ORA B;  3CS1 A;  4JWQ A;  1F4O A;  1N2D A;  1TN4 A;  3EK8 A;  3DVJ A;  2JT8 A;  2F8P A;  2O60 A;  1SNL A;  2M29 A;  2WOS A;  1ZOT B;  1J7R A;  1TTX A;  1ZMZ A;  1L2O C;  1IWQ A;  2LHL A;  4NQG A;  1DGV A;  1MF8 B;  1S6J A;  2CCM A;  1BU3 A;  1QTX A;  3FIA A;  1F70 A;  1RFJ A;  1FBV A;  1Y0V H;  3TUY B;  2M1K B;  1LXF C;  3BUN B;  2WCF A;  1REC A;  2ISD A;  1PRW A;  1SW8 A;  1CM4 A;  4PE7 A;  1YUU A;  1UHN A;  1NCZ A;  2LM5 A;  4PHN A;  2HPS A;  2FCD A;  2HET A;  4F0Z B;  1B7T Z;  1IJ5 A;  3O6B A;  1AHR A;  5I8N A;  4ORC B;  3SJS A;  3BXK A;  2KHN A;  1QIV A;  1QV1 A;  1Y1X A;  2SCP A;  1K90 D;  2L98 A;  2IS9 A;  2Q4U A;  1KK8 C;  1XK4 A;  3EVR A;  1XFU O;  3OB2 B;  3CZT X;  3AKB A;  4GGF A;  4PDZ A;  4YBH B;  4QJ4 B;  4E68 A;  1AJ5 A;  1F55 A;  3DVM A;  2MRD A;  4YGE B;  4M2O A;  2WOR A;  4PHJ A;  1F4Q A;  4ETO A;  1OMV A;  3AAK A;  1BR1 B;  1F8H A;  1MUX A;  2F3Z A;  3SIA A;  4DS7 A;  1L7Z A;  2MA2 A;  2V53 A;  5I2O A;  2Y1M A;  4AQI A;  4Q04 A;  1PUL A;  1XFX O;  1EG3 A;  1QV0 A;  1KK8 B;  1S1E A;  2SAS A;  4MN0 A;  3JVT C;  3A4U B;  1EJ3 A;  1CDM A;  1IJ6 A;  3DF0 A;  2EGD A;  3D0Y A;  5DKR A;  2KYF A;  5KSZ A;  3KO0 A;  1OZS A;  3JTD C;  3O4Y A;  4DIR A;  1CFD A;  1SBJ A;  4CLN A;  2LMT A;  1IH0 A;  2BEC A;  1WLM A;  5CSF A;  3WXA A;  5BPJ A;  1B4C A;  1DJI A;  3BOW A;  2BE6 A;  2LP2 A; 
#chains in the Genus database with same CATH topology
 5I2Q A;  2ZNE A;  3I5G C;  2WC8 A;  3BFA A;  1TUJ A;  1UHJ A;  2QEO A;  3VRR A;  1IRJ A;  3ZWH A;  2LE9 B;  3DVE A;  2JPO A;  3EKJ A;  3L4A A;  1B1G A;  1UHH A;  1J55 A;  1IKU A;  2PRU A;  1KSM A;  3PM2 A;  1W7I B;  2B1U A;  1YVL A;  1CFC A;  3SS3 A;  1U5I B;  3BFB A;  3O4X A;  2CBL A;  2EC6 C;  4A4B A;  4M2Q A;  1WRK A;  1DVI A;  1MHO A;  4N1G A;  5AXI A;  1JBA A;  3GOF A;  2P70 A;  1CDL A;  1Y1A A;  4I5J A;  3KF9 A;  3JTD B;  4ZCV A;  2QPT A;  2I94 A;  1MXL C;  2M1U A;  3DYE A;  2I2R E;  4GBA A;  4OR9 B;  5CPV A;  1NCY A;  1GM0 A;  4DRW A;  1WRL A;  1KFU L;  2M8U A;  1BMO A;  4BY5 A;  4CID A;  1UUS A;  1A29 A;  3KEV A;  1P28 A;  2KSP A;  3BJH A;  1ALV A;  1XFZ O;  2LVJ A;  1K95 A;  2KFF A;  2MLE C;  5CSN A;  4OZD A;  2JT0 A;  1NP8 A;  2BKH B;  2WCH A;  2MJW B;  5FI6 A;  3BQ3 A;  4MLW A;  4PE1 A;  1QS7 A;  2FCE A;  2NLN A;  5B8I B;  1OOG A;  2EC6 B;  3NSI A;  4FQO A;  1NPQ A;  3OBV A;  1BOC A;  1IG5 A;  5I94 A;  1OMD A;  1DJH A;  2ZFD A;  1Y1U A;  1YX7 A;  1RK9 A;  2JU0 A;  1DTL A;  3CYZ A;  4MZK A;  1CTR A;  1S5G Y;  3LLE A;  1OMR A;  3LK0 A;  1FF1 A;  1NX0 A;  1KK7 Y;  1OOJ A;  1QIW A;  2M7N A;  4IJ7 A;  1KWO B;  3RM1 A;  1NSH A;  3S0E A;  1H8B A;  2M0R A;  2JZI A;  3DY9 A;  2F2O A;  2KI4 B;  5CSJ A;  1T14 A;  4C0J A;  1SYM A;  3S0A A;  1WDC C;  1ODB A;  2L5Y A;  3LK1 A;  2LC5 A;  4XYN A;  1JFJ A;  3OP0 A;  3RLZ A;  3VGO A;  1JSA A;  1N65 A;  1UP5 A;  3TZ1 A;  4HRH A;  3SG7 A;  1SKT A;  4NDB A;  4NDD A;  1C07 A;  2OTG C;  2P71 A;  3E3R A;  4PHM A;  3ZNI A;  2NXQ A;  1NWD A;  2OS8 C;  1LKJ A;  3VRN A;  1VRK A;  2K7B A;  4TNC A;  4C0K A;  2AMI A;  3CR4 X;  2M49 B;  1C3Z A;  1K9P A;  1SPY A;  2JXL A;  2KAY A;  5J3X A;  1SCM C;  4GUK A;  3FWC A;  2WND A;  4JQ0 D;  5CSI A;  2BCA A;  1SR6 C;  2MBX A;  4BY4 A;  1DC1 A;  1M46 A;  3PSR A;  3M0W A;  1WDC B;  4CFQ A;  1BR4 B;  1YX8 A;  3S0D A;  1ALW A;  5DKQ A;  1K2H A;  1W9Z A;  2LCP A;  1TCF A;  2K61 A;  1B7T Y;  1JF0 A;  2M3W A;  3SG2 A;  2FOT A;  2JUL A;  3D76 A;  4QJ5 B;  1EG4 A;  1KQM B;  1DJX A;  1DEK A;  1K9U A;  2KQ6 A;  4MZJ A;  1EXR A;  3CLN A;  1RJV A;  3SS4 A;  2QEV A;  2BBM A;  2H61 C;  3D78 A;  4WQ2 A;  5HKZ A;  2K60 A;  3BUM B;  2H2K A;  1TNW A;  1DJG A;  3DZT A;  1HQV A;  2LVK A;  2PSR A;  1PSB A;  2G9B A;  2LVV A;  2PMY A;  1SCM B;  1SL9 A;  3L47 A;  4PT1 A;  1AK8 A;  1X02 A;  1L2O B;  2GV5 A;  5DKN A;  1DGU A;  2AUC A;  2EHB A;  1SCV A;  2QEH A;  1ZFS A;  3LL8 B;  3Q8I A;  1M31 A;  1CB1 A;  1OOF A;  4PE0 A;  2WCK A;  4D1E A;  2R2I A;  1B8R A;  2E6W A;  3OX6 A;  2HQW A;  1FPW A;  3CZ1 A;  3EKH A;  1LA3 A;  4OCI A;  4U8D A;  4WQ3 A;  1MXE A;  1AP4 A;  4OV2 A;  2KI6 C;  3FS7 A;  1SY9 A;  1LIN A;  1XA5 A;  1OOH A;  1BLQ A;  3QRX A;  2JXC A;  3CWG A;  2D8N A;  4OKH A;  1CFF A;  2TN4 A;  2ZRT A;  2LMV A;  1U5I A;  4OVN F;  1DT7 B;  2QEB A;  1F71 A;  4MSP A;  1CMF A;  4NDC A;  2M7L A;  2OPO A;  2A4J A;  1J1D A;  1A2X A;  1DJZ A;  3KHE A;  3MSE B;  2BL0 C;  1QJT A;  1XFR A;  2LMU A;  3S0F A;  2KBM A;  2G2B A;  2WCB A;  1XK4 C;  3D10 A;  5AEQ A;  4INW A;  4GGF C;  5IBW A;  3O2P A;  1CLM A;  2ZRS A;  5D69 A;  2BKI B;  1SRA A;  3PAL A;  4I5L B;  1FW4 A;  5FYX A;  5HKY A;  1YRT B;  1WY9 A;  4MEW A;  4CPV A;  2Y5I A;  3TS5 C;  1QLK A;  1KFX L;  1QVI Z;  3F45 A;  3SIB A;  3VRP A;  2L0P A;  2L50 A;  5JJG A;  3JVT B;  1FI6 A;  2JWW A;  2JTT A;  1UWO A;  4GGN A;  3PAT A;  2LNK A;  2L2E A;  1QX7 A;  2YGU A;  2BL0 B;  1QAS A;  3NSO A;  3HX4 A;  4YRU A;  1NX2 A;  3N7H A;  2Y4Q A;  2BBN A;  2BE6 A;  1AVS A;  1QX5 B;  3HCM A;  1A4P A;  2F2P A;  1KFU S;  2PVB A;  1QX2 A;  3I5G B;  1PK0 D;  2JC2 A;  2M9G A;  3NHT A;  2KQY A;  3I5F C;  1K93 D;  3B6X A;  3TS5 B;  2LHI A;  3FWB A;  2M97 A;  4R1E A;  1BOD A;  2DOQ A;  5D7F A;  1B47 A;  2KYC A;  2O5G A;  4IL1 A;  1CNP A;  4A4C A;  1TNP A;  2CXJ A;  4L9M A;  2LVI A;  2ERB A;  4YGA A;  1OZO A;  2LAP A;  1GJY A;  1OQP A;  3KPX A;  2P6B B;  3D73 A;  1DJW A;  5KU1 A;  1CDP A;  2ZKM X;  2HF5 A;  4MVF A;  1A03 A;  3FE9 A;  1QWV A;  3IQQ A;  1WLZ A;  1AUI B;  3PJI A;  1XYD A;  3EVU A;  4INX A;  1W7J B;  4N5X A;  5HYD A;  2F33 A;  3I5F B;  5F6T A;  4CFR A;  1B8L A;  2ZN8 A;  3QME A;  1UHK A;  3OB1 B;  1H4B A;  3TDU A;  1S6C A;  1S3P A;  3PLF B;  2JNF A;  4N1F A;  4GAO A;  1AJ4 A;  4ICB A;  4JKT A;  1ORG A;  2GGM A;  1BG1 A;  2LAN A;  3I5H C;  3B7A A;  1N0Y A;  3V2L A;  1Z4H A;  1R6P A;  4YI9 A;  1DF0 B;  1M39 A;  2HQ8 A;  4GFT A;  2JTZ A;  2WC6 A;  1TIZ A;  1DQE A;  1TWO A;  2CT9 A;  5EL2 A;  3O78 A;  4PHK A;  1YR5 A;  1IIO A;  3ICB A;  1K8U A;  3D74 A;  1LS8 A;  4WRI A;  1IQ3 A;  1CDN A;  4USL A;  2LLU A;  4XJK B;  2I7A A;  2NCO A;  3B87 A;  1XO5 A;  1CLB A;  1RTP 1;  1TNX A;  1SK6 D;  1JC2 A;  5AAN A;  2K2A A;  1MQ1 A;  1ZUZ A;  1LVC D;  2OTG B;  3I5I C;  3I5H B;  2OS8 B;  2JT3 A;  3GK2 A;  1NYA A;  3TDZ A;  2LUX A;  2L51 A;  2BNX A;  3PFV A;  3A8R A;  3S0G A;  1EH2 A;  1Q80 A;  2KGR A;  1DMO A;  3CR5 X;  5K89 A;  3SG4 A;  4AOM A;  1SR6 B;  5FI7 A;  3VB1 A;  3RZS A;  2KI6 D;  1J7Q A;  4DCK A;  1D1O A;  2F3Y A;  3AKA A;  3SG5 A;  1BF5 A;  2BCX A;  1GQM A;  4MBE A;  1TRF A;  1Z2C B;  5PAL A;  3PN7 C;  2COL B;  1B9A A;  3I5I B;  3D77 A;  4HSZ A;  4FQT A;  1PAL A;  2KAV A;  2K7C A;  1SL8 A;  1V1F A;  2ZN9 A;  2KFH A;  2KDH A;  2QAC A;  2CTN A;  1BT6 A;  5JOL A;  1G4Y R;  3IVT A;  1YTZ C;  2LLS A;  2NZ0 A;  1V1G A;  3CTN A;  4I5N B;  3WNX B;  2K7D A;  4P5O E;  1SSE B;  3K1E A;  1LA0 A;  5HKW A;  2ZND A;  1C7W A;  5FI2 A;  3PM8 A;  1J7O A;  1PSR A;  1XFV O;  1J7P A;  3BYA A;  3NGV A;  4YI8 A;  2NCP A;  1RWY A;  4P2Y B;  4PE4 A;  3PN7 B;  4MRY A;  3EK4 A;  4DUQ A;  2K2F A;  2KOT A;  2KNE A;  2K0J A;  3VRO A;  1JUO A;  1NX1 A;  1XVJ A;  4JPZ B;  1NUB A;  2Q91 A;  1HT9 A;  1YUS A;  2JNX A;  2L2C A;  3IQO A;  4F7F A;  4C0L A;  1QVI Y;  2L4H A;  1CM1 A;  1R2U A;  1SMG A;  2KPH A;  2JOJ A;  2MLF C;  5HLO A;  3EVV A;  5G08 A;  4MRX A;  3R1P A;  2PYQ A;  1KFX S;  4YGB B;  1GGZ A;  3OX5 A;  2PAS A;  1MR8 A;  4GPL B;  2FJU B;  3AAJ A;  4KYN A;  3K21 A;  1S6I A;  2KLE A;  1YVH A;  1G8I A;  2AAO A;  3B88 A;  2KBI A;  4AQJ A;  1QLS A;  4FTG A;  2JPT A;  5GQQ C;  3SS5 A;  1K94 A;  4QJ3 B;  2JQ6 A;  1YRU B;  3WHT B;  1PVA A;  4ORB B;  5HLV A;  3UO9 A;  5AER A;  1Y6W A;  1WRZ A;  1E8A A;  1DJY A;  1DF0 A;  1G33 A;  2WCE A;  3NXA A;  1QAT A;  1TOP A;  3H4S E;  5AFP A;  1YUR A;  5ER5 A;  2CNP A;  2Y1N A;  1MWN A;  2JRF A;  2MAZ A;  1IGV A;  2VRG A;  2BE4 A;  2GGZ A;  1J1E A;  1F54 A;  3DD4 A;  2MHH A;  1RRO A;  2WC5 A;  4YGD B;  2L4I A;  2E30 A;  3BUW B;  4XJK A;  1M45 A;  3GK4 X;  1S36 A;  2K7O A;  1S26 D;  2LLT A;  3DF0 B;  3D0Y B;  3BUO B;  3CR2 A;  3CGA A;  4I5K A;  1KWO C;  1GGW A;  2KGB C;  1KSO A;  1C3Y A;  2KI4 C;  3B86 A;  2PQL A;  4HRE E;  4ZCU A;  1B8C A;  1ZAC A;  1JFK A;  1NX3 A;  3C1V A;  1OE9 B;  3OHM B;  1OOI X;  3BOW B;  1A75 B;  1KCY A;  1TUZ A;  3DVK A;  1KQV A;  1UUR A;  2L5X B;  1PVB A;  1CKK A;  1FI5 A;  2BCB A;  3IF7 A;  1M63 B;  1K96 A;  2KFG A;  3TDI A;  5TNC A;  2H8V A;  3R1V A;  3UNW A;  3VRQ A;  5ER4 X;  1QXP A;  1UHI A;  2KAX A;  1IQ5 A;  4MZL A;  4PCW A;  4YGC B;  1NCX A;  2LP3 A;  2LV7 A;  1EL4 A;  5I2L A;  3LCP C;  3WHU B;  1CLL A;  3BUX B;  4UPG A;  1JF2 A;  3EK7 A;  3DXL A;  5KTY A;  3SG6 A;  3NSK A;  1CMG A;  1S5G Z;  4PAL A;  2RGI A;  3R1O A;  2WCM A;  4M2P A;  1OSA A;  3R72 A;  2H61 A;  4GNK B;  1KK7 Z;  1XFY O;  2PAL A;  3OGN A;  4JD9 A;  1SL7 A;  3GK1 A;  1TNQ A;  2K8M B;  3TUY C;  3NSL A;  1YUT A;  1CFP A;  1TCO B;  1KQM C;  1NIW A;  3SG3 A;  1C7V A;  5D3O A;  2I18 A;  1BJF A;  1XFW O;  1K9K A;  2LUC A;  3CZ0 A;  4HRG A;  2WCL A;  4ORA B;  3CS1 A;  4JWQ A;  1F4O A;  1N2D A;  1TN4 A;  3EK8 A;  3DVJ A;  2JT8 A;  2F8P A;  2O60 A;  1SNL A;  2M29 A;  2WOS A;  1ZOT B;  1J7R A;  1TTX A;  1ZMZ A;  1L2O C;  1IWQ A;  2LHL A;  4NQG A;  1DGV A;  1MF8 B;  1S6J A;  2CCM A;  1BU3 A;  1QTX A;  3FIA A;  1F70 A;  1RFJ A;  1FBV A;  1Y0V H;  3TUY B;  2M1K B;  1LXF C;  3BUN B;  2WCF A;  1REC A;  2ISD A;  1PRW A;  1SW8 A;  1CM4 A;  4PE7 A;  1DEL A;  1UHN A;  1NCZ A;  1YUU A;  2LM5 A;  4PHN A;  2HPS A;  3S0B A;  2FCD A;  2HET A;  4F0Z B;  1B7T Z;  3FE6 A;  2KLD A;  3L4L A;  1IJ5 A;  3O6B A;  1AHR A;  5I8N A;  4ORC B;  3SJS A;  1OW4 A;  5HL1 A;  3BXK A;  2QDI A;  2KHN A;  1QIV A;  1QV1 A;  1Y1X A;  2SCP A;  1K90 D;  2L98 A;  2IS9 A;  2Q4U A;  3NHI A;  1KK8 C;  1XK4 A;  3D75 A;  3EVR A;  1XFU O;  3OB2 B;  3CZT X;  3AKB A;  4GGF A;  4PDZ A;  4YBH B;  4QJ4 B;  4E68 A;  1AJ5 A;  1F55 A;  1JWD A;  3DVM A;  2MRD A;  3BFH A;  4YGE B;  2BAP A;  4M2O A;  3CZ2 A;  2WOR A;  3FE8 A;  1F4Q A;  4PHJ A;  3CAB A;  1OMV A;  3AAK A;  1BR1 B;  4ETO A;  1F8H A;  1MUX A;  2F3Z A;  3SIA A;  4DS7 A;  2WCJ A;  5DIC A;  1L7Z A;  2MA2 A;  2V53 A;  5I2O A;  2Y1M A;  4AQI A;  4Q04 A;  1PUL A;  1XFX O;  1EG3 A;  1QV0 A;  1KK8 B;  1S1E A;  2SAS A;  3CDN A;  4MN0 A;  2GTE A;  3JVT C;  3A4U B;  3EG5 B;  1EJ3 A;  1CDM A;  1IJ6 A;  3DF0 A;  2EGD A;  3D0Y A;  5DKR A;  2KYF A;  5KSZ A;  3KO0 A;  1OZS A;  3JTD C;  3O4Y A;  4DIR A;  1CFD A;  1SBJ A;  4CLN A;  2LMT A;  1IH0 A;  2BEC A;  1WLM A;  5CSF A;  3WXA A;  5BPJ A;  2FJY A;  1B4C A;  1DJI A;  3BOW A;  1A75 A;  2LP2 A; 
#chains in the Genus database with same CATH homology
 5I2Q A;  2ZNE A;  3I5G C;  2WC8 A;  3VRR A;  3ZWH A;  1UHJ A;  1IRJ A;  2LE9 B;  3DVE A;  3EKJ A;  1B1G A;  1UHH A;  1J55 A;  1IKU A;  2PRU A;  1KSM A;  1W7I B;  2B1U A;  1YVL A;  1CFC A;  1U5I B;  2CBL A;  2EC6 C;  4A4B A;  4M2Q A;  1WRK A;  1DVI A;  1MHO A;  4N1G A;  5AXI A;  1JBA A;  3GOF A;  4I5J A;  1CDL A;  1Y1A A;  4ZCV A;  3KF9 A;  3JTD B;  2QPT A;  2I94 A;  1MXL C;  2M1U A;  2I2R E;  4GBA A;  4OR9 B;  5CPV A;  1NCY A;  4DRW A;  1WRL A;  1KFU L;  2M8U A;  1BMO A;  4BY5 A;  4CID A;  1UUS A;  1A29 A;  3KEV A;  2KSP A;  1ALV A;  1XFZ O;  2LVJ A;  1K95 A;  2KFF A;  2MLE C;  5CSN A;  2JT0 A;  1NP8 A;  2BKH B;  2MJW B;  3BQ3 A;  4MLW A;  4PE1 A;  1QS7 A;  2FCE A;  2NLN A;  5B8I B;  2EC6 B;  3NSI A;  4FQO A;  1NPQ A;  1BOC A;  1IG5 A;  1OMD A;  1DJH A;  2ZFD A;  1Y1U A;  1YX7 A;  1RK9 A;  2JU0 A;  1DTL A;  4MZK A;  1CTR A;  1S5G Y;  3LLE A;  1OMR A;  3LK0 A;  1FF1 A;  1NX0 A;  1KK7 Y;  1OOJ A;  1QIW A;  2M7N A;  1KWO B;  3RM1 A;  1NSH A;  1H8B A;  2M0R A;  2JZI A;  2F2O A;  2KI4 B;  5CSJ A;  4C0J A;  1SYM A;  1WDC C;  1ODB A;  3LK1 A;  2LC5 A;  4XYN A;  1JFJ A;  3OP0 A;  3RLZ A;  3VGO A;  1JSA A;  1N65 A;  1UP5 A;  3TZ1 A;  4HRH A;  3SG7 A;  1SKT A;  4NDB A;  4NDD A;  2OTG C;  3E3R A;  4PHM A;  3ZNI A;  2NXQ A;  1NWD A;  2OS8 C;  1LKJ A;  3VRN A;  1VRK A;  2K7B A;  4TNC A;  4C0K A;  2AMI A;  3CR4 X;  2M49 B;  1K9P A;  1SPY A;  2JXL A;  2KAY A;  5J3X A;  1SCM C;  4GUK A;  3FWC A;  2WND A;  4JQ0 D;  5CSI A;  2BCA A;  1SR6 C;  2MBX A;  4BY4 A;  1M46 A;  3PSR A;  3M0W A;  1WDC B;  4CFQ A;  1BR4 B;  1YX8 A;  1ALW A;  5DKQ A;  1K2H A;  2LCP A;  1TCF A;  2K61 A;  1B7T Y;  1JF0 A;  2M3W A;  3SG2 A;  2FOT A;  2JUL A;  4QJ5 B;  1EG4 A;  1KQM B;  1DJX A;  4MZJ A;  1K9U A;  2KQ6 A;  1EXR A;  3CLN A;  1RJV A;  2BBM A;  2H61 C;  5HKZ A;  4WQ2 A;  3BUM B;  2H2K A;  1TNW A;  1DJG A;  1HQV A;  2LVK A;  2PSR A;  1PSB A;  2G9B A;  2LVV A;  2PMY A;  1SCM B;  1SL9 A;  1AK8 A;  1C07 A;  1X02 A;  1L2O B;  2GV5 A;  5DKN A;  1DGU A;  2AUC A;  2EHB A;  1SCV A;  3LL8 B;  1ZFS A;  1M31 A;  1CB1 A;  4PE0 A;  4D1E A;  2R2I A;  1B8R A;  2E6W A;  3OX6 A;  2HQW A;  1FPW A;  3EKH A;  1LA3 A;  4OCI A;  4U8D A;  4WQ3 A;  1MXE A;  1AP4 A;  4OV2 A;  2KI6 C;  3FS7 A;  1SY9 A;  1LIN A;  1XA5 A;  1BLQ A;  3QRX A;  2JXC A;  3CWG A;  2D8N A;  4OKH A;  1CFF A;  2TN4 A;  2ZRT A;  2LMV A;  1U5I A;  4OVN F;  1DT7 B;  1F71 A;  4MSP A;  1CMF A;  4NDC A;  2M7L A;  2OPO A;  2A4J A;  1J1D A;  1A2X A;  1DJZ A;  3KHE A;  3MSE B;  2BL0 C;  1QJT A;  2LMU A;  2KBM A;  2G2B A;  2WCB A;  1XK4 C;  3D10 A;  5AEQ A;  4GGF C;  5IBW A;  3O2P A;  1CLM A;  2ZRS A;  5D69 A;  2BKI B;  1SRA A;  3PAL A;  4I5L B;  1FW4 A;  5FYX A;  5HKY A;  1YRT B;  1WY9 A;  4MEW A;  4CPV A;  2Y5I A;  3TS5 C;  1QLK A;  1KFX L;  1QVI Z;  3F45 A;  3SIB A;  3VRP A;  2L0P A;  2L50 A;  5JJG A;  3JVT B;  1FI6 A;  2JWW A;  2JTT A;  1UWO A;  4GGN A;  3PAT A;  2LNK A;  2L2E A;  1QX7 A;  2BL0 B;  1QAS A;  3NSO A;  3HX4 A;  4YRU A;  1NX2 A;  2Y4Q A;  2BBN A;  1AVS A;  1QX5 B;  3HCM A;  1A4P A;  2F2P A;  1KFU S;  2PVB A;  1QX2 A;  3I5G B;  1PK0 D;  2JC2 A;  2M9G A;  2KQY A;  3I5F C;  1K93 D;  3TS5 B;  1BOD A;  2LHI A;  3FWB A;  2M97 A;  4R1E A;  1JWD A;  2DOQ A;  5D7F A;  1B47 A;  2KYC A;  2O5G A;  4IL1 A;  1CNP A;  4A4C A;  1TNP A;  2CXJ A;  4L9M A;  2LVI A;  4YGA A;  1OZO A;  2LAP A;  1GJY A;  1OQP A;  3KPX A;  2P6B B;  1DJW A;  5KU1 A;  1CDP A;  2ZKM X;  2HF5 A;  4MVF A;  1A03 A;  3IQQ A;  1WLZ A;  1AUI B;  1XYD A;  3EVU A;  1W7J B;  4N5X A;  5HYD A;  2F33 A;  3I5F B;  5F6T A;  4CFR A;  1B8L A;  2ZN8 A;  1UHK A;  3OB1 B;  1H4B A;  3TDU A;  1S6C A;  1S3P A;  3PLF B;  2JNF A;  4N1F A;  4GAO A;  1AJ4 A;  4ICB A;  2GGM A;  2LAN A;  3I5H C;  1N0Y A;  1R6P A;  4YI9 A;  1DF0 B;  1M39 A;  2HQ8 A;  4GFT A;  2JTZ A;  1TIZ A;  2CT9 A;  3O78 A;  4PHK A;  1YR5 A;  3ICB A;  1K8U A;  4WRI A;  1IQ3 A;  1CDN A;  4USL A;  2LLU A;  4XJK B;  2I7A A;  2NCO A;  1XO5 A;  1CLB A;  1RTP 1;  1TNX A;  1SK6 D;  1JC2 A;  5AAN A;  2K2A A;  1MQ1 A;  1ZUZ A;  1LVC D;  2OTG B;  3I5I C;  3I5H B;  2OS8 B;  2JT3 A;  3GK2 A;  1NYA A;  3TDZ A;  2LUX A;  2L51 A;  3PFV A;  3A8R A;  1EH2 A;  1Q80 A;  2KGR A;  1DMO A;  3CR5 X;  5K89 A;  3SG4 A;  4AOM A;  1SR6 B;  2KI6 D;  1J7Q A;  4DCK A;  1D1O A;  2F3Y A;  3AKA A;  1A75 A;  3SG5 A;  1BF5 A;  2BCX A;  1GQM A;  4MBE A;  1TRF A;  5PAL A;  3PN7 C;  2COL B;  1B9A A;  3I5I B;  4HSZ A;  1PAL A;  2KAV A;  2K7C A;  1SL8 A;  1V1F A;  2ZN9 A;  2KFH A;  2KDH A;  2QAC A;  2CTN A;  1BT6 A;  5JOL A;  1G4Y R;  1YTZ C;  2LLS A;  2NZ0 A;  1V1G A;  3CTN A;  4I5N B;  3WNX B;  2K7D A;  4P5O E;  1LA0 A;  5HKW A;  2ZND A;  1C7W A;  3PM8 A;  1J7O A;  1PSR A;  1XFV O;  1J7P A;  3BYA A;  4YI8 A;  2NCP A;  1RWY A;  4P2Y B;  4PE4 A;  3PN7 B;  4MRY A;  3EK4 A;  4DUQ A;  2K2F A;  2KOT A;  2KNE A;  2K0J A;  3VRO A;  1JUO A;  1NX1 A;  1XVJ A;  4JPZ B;  1NUB A;  2Q91 A;  1HT9 A;  1YUS A;  2JNX A;  3IQO A;  4C0L A;  1QVI Y;  2L4H A;  1CM1 A;  1R2U A;  1SMG A;  2JOJ A;  2MLF C;  5HLO A;  3EVV A;  5G08 A;  4MRX A;  1KFX S;  4YGB B;  1GGZ A;  3OX5 A;  2PAS A;  1MR8 A;  4GPL B;  2FJU B;  3AAJ A;  3K21 A;  1S6I A;  1YVH A;  1G8I A;  2AAO A;  2KBI A;  4AQJ A;  1QLS A;  4FTG A;  2JPT A;  5GQQ C;  1K94 A;  4QJ3 B;  2JQ6 A;  1YRU B;  3WHT B;  1PVA A;  4ORB B;  5HLV A;  5AER A;  1Y6W A;  1WRZ A;  1E8A A;  1DJY A;  1DF0 A;  1G33 A;  2WCE A;  3NXA A;  1QAT A;  1TOP A;  3H4S E;  5AFP A;  1YUR A;  5ER5 A;  2CNP A;  2Y1N A;  1MWN A;  2JRF A;  2MAZ A;  1IGV A;  2VRG A;  2BE4 A;  2GGZ A;  1J1E A;  1F54 A;  3DD4 A;  2MHH A;  1RRO A;  4YGD B;  2L4I A;  2E30 A;  3BUW B;  4XJK A;  1M45 A;  3GK4 X;  1S36 A;  2K7O A;  1S26 D;  2LLT A;  3DF0 B;  3D0Y B;  3BUO B;  3CR2 A;  3CGA A;  4I5K A;  1KWO C;  1GGW A;  2KGB C;  1KSO A;  2KI4 C;  4ZCU A;  4HRE E;  1B8C A;  1ZAC A;  1JFK A;  1NX3 A;  3C1V A;  1OE9 B;  3OHM B;  3BOW B;  1A75 B;  1KCY A;  3DVK A;  1KQV A;  1UUR A;  2L5X B;  1PVB A;  1CKK A;  1FI5 A;  2BCB A;  3IF7 A;  1M63 B;  1K96 A;  2KFG A;  3TDI A;  5TNC A;  3VRQ A;  5ER4 X;  1QXP A;  1UHI A;  2KAX A;  1IQ5 A;  4MZL A;  4PCW A;  4YGC B;  1NCX A;  2LP3 A;  2LV7 A;  1EL4 A;  5I2L A;  3LCP C;  3WHU B;  1CLL A;  3BUX B;  4UPG A;  1JF2 A;  3EK7 A;  5KTY A;  1BG1 A;  3SG6 A;  3NSK A;  1CMG A;  1S5G Z;  4PAL A;  2RGI A;  4M2P A;  1OSA A;  2H61 A;  4GNK B;  1KK7 Z;  1XFY O;  2PAL A;  1SL7 A;  3GK1 A;  1TNQ A;  2K8M B;  3TUY C;  3NSL A;  1YUT A;  1CFP A;  1TCO B;  1KQM C;  1NIW A;  3SG3 A;  1C7V A;  2I18 A;  1BJF A;  1XFW O;  1K9K A;  2LUC A;  4HRG A;  4ORA B;  3CS1 A;  4JWQ A;  1F4O A;  1N2D A;  1TN4 A;  3EK8 A;  3DVJ A;  2JT8 A;  2F8P A;  2O60 A;  1SNL A;  2M29 A;  2WOS A;  1ZOT B;  1J7R A;  1TTX A;  1ZMZ A;  1L2O C;  1IWQ A;  2LHL A;  4NQG A;  1DGV A;  1MF8 B;  1S6J A;  2CCM A;  1BU3 A;  1QTX A;  3FIA A;  1F70 A;  1RFJ A;  1FBV A;  1Y0V H;  3TUY B;  2M1K B;  1LXF C;  3BUN B;  2WCF A;  1REC A;  2ISD A;  1PRW A;  1SW8 A;  1CM4 A;  4PE7 A;  1YUU A;  1UHN A;  1NCZ A;  2LM5 A;  4PHN A;  2HPS A;  2FCD A;  2HET A;  4F0Z B;  1B7T Z;  1IJ5 A;  3O6B A;  1AHR A;  5I8N A;  4ORC B;  3SJS A;  3BXK A;  2KHN A;  1QIV A;  1QV1 A;  1Y1X A;  2SCP A;  1K90 D;  2L98 A;  2IS9 A;  2Q4U A;  1KK8 C;  1XK4 A;  3EVR A;  1XFU O;  3OB2 B;  3CZT X;  3AKB A;  4GGF A;  4PDZ A;  4YBH B;  4QJ4 B;  4E68 A;  1AJ5 A;  1F55 A;  3DVM A;  2MRD A;  4YGE B;  4M2O A;  2WOR A;  4PHJ A;  1F4Q A;  4ETO A;  1OMV A;  3AAK A;  1BR1 B;  1F8H A;  1MUX A;  2F3Z A;  3SIA A;  4DS7 A;  1L7Z A;  2MA2 A;  2V53 A;  5I2O A;  2Y1M A;  4AQI A;  4Q04 A;  1PUL A;  1XFX O;  1EG3 A;  1QV0 A;  1KK8 B;  1S1E A;  2SAS A;  4MN0 A;  3JVT C;  3A4U B;  1EJ3 A;  1CDM A;  1IJ6 A;  3DF0 A;  2EGD A;  3D0Y A;  5DKR A;  2KYF A;  5KSZ A;  3KO0 A;  1OZS A;  3JTD C;  3O4Y A;  4DIR A;  1CFD A;  1SBJ A;  4CLN A;  2LMT A;  1IH0 A;  2BEC A;  1WLM A;  5CSF A;  3WXA A;  5BPJ A;  1B4C A;  1DJI A;  3BOW A;  2BE6 A;  2LP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...