1WDCC

Scallop myosin regulatory domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
152
Chain Sequence
LSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCALLOP MYOSIN
publication title Structure of the regulatory domain of scallop myosin at 2 A resolution: implications for regulation.
pubmed doi rcsb
molecule tags Muscle protein
total genus 50
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 1996-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wdcC01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wdcC02
3VRRA 1QVIZ 3WHUB 3O2PA 2O60A 3A8RA 2I18A 3GK1A 3LK0A 1ALWA 3D0YA 2LVJA 3IQQA 1C07A 4GFTA 1DJWA 1L7ZA 1NX3A 3BUNB 2PALA 5K89A 1CM1A 4MEWA 2BL0B 1IQ5A 1FW4A 2WCBA 3JTDB 4GPLB 5AANA 2BBNA 1F70A 3DVKA 1PSRA 2ZNEA 4ORCB 1B8RA 1CMFA 1NPQA 2I2RE 1CDLA 4MN0A 1C7VA 5HKZA 2LC5A 2LP3A 2SCPA 2KBMA 4YGBB 1NCYA 4QJ4B 1JBAA 2FOTA 1R6PA 4XYNA 5JOLA 2H2KA 1YURA 1G8IA 4WQ2A 4F0ZB 2LVVA 3D0YB 1FI6A 2TN4A 2MRDA 1J7PA 1QXPA 2D8NA 3OHMB 1ZOTB 2GV5A 1ALVA 3O4YA 5F6TA 2A4JA 3MSEB 2OS8C 1UHKA 2F3YA 4ZCVA 1GQMA 1KCYA 1RJVA 2CXJA 2HQ8A 2JC2A 2LLTA 3A4UB 1JC2A 1WDCC 3WNXB 1B7TY 1DJYA 1K9PA 1AJ5A 1N2DA 1OZOA 3KHEA 1F54A 2KGBC 4MZJA 3WXAA 2KI4B 1A4PA 1QX2A 3CGAA 4CFRA 3EVUA 5GQQC 1K2HA 1EL4A 2KI6D 2L4IA 2WCEA 2K7CA 3DVJA 2M49B 1MXLC 1DTLA 2DOQA 4M2OA 2NCOA 1WDCB 1WRLA 4YGCB 4YGAA 1BU3A 2KNEA 1IGVA 1Q80A 2JU0A 1B7TZ 2Y5IA 4AQIA 3TS5C 4OV2A 3AAJA 1CFFA 1FF1A 1KFUL 2ZN9A 2L5XB 4D1EA 1K95A 5D7FA 1MXEA 1OZSA 2BECA 5I2LA 2R2IA 4M2QA 2LVKA 2PVBA 4E68A 4PE4A 1JUOA 1SY9A 2LAPA 1CB1A 2BBMA 4C0KA 2LMUA 2OTGC 1F4QA 1OOJA 1JWDA 3TS5B 1LVCD 3D10A 1S36A 2CNPA 1JFKA 4MRXA 1A75A 1KSOA 1HT9A 3SJSA 2LHIA 1XFUO 2M1UA 2WORA 2L98A 1KQMC 1N0YA 2G2BA 3ICBA 1L2OC 4I5NB 4JQ0D 1CDMA 5I2QA 3SG7A 4JPZB 5JJGA 1EH2A 3VRQA 2JT8A 2OTGB 1G4YR 4PHNA 3EVVA 1TNXA 1K90D 3SIAA 1CTRA 1MF8B 2F2PA 3I5FC 1DVIA 2ZFDA 5I8NA 1CKKA 2P6BB 1KK7Y 1WY9A 3LCPC 3CR2A 1F55A 2NXQA 1UHHA 3OB1B 3CZTX 1DJGA 1TNQA 2JRFA 1HQVA 1B8CA 2KGRA 1NSHA 1A75B 1MUXA 1DJXA 1ZFSA 4R1EA 4USLA 1XFYO 1KK7Z 4YI8A 4YGDB 4AQJA 5HLVA 3PFVA 2JT3A 5CSJA 1QVIY 1ZACA 2JTZA 5KTYA 2B1UA 5CSIA 3F45A 1JSAA 1SRAA 1M45A 1PSBA 2K7OA 1Y6WA 1B1GA 3EKHA 4DCKA 3CS1A 1AVSA 2CTNA 1B47A 3GOFA 1J7OA 1TTXA 1DF0A 3CTNA 2GGZA 2JQ6A 1NCXA 5G08A 4YI9A 1NX2A 2HPSA 2Y4QA 1CDNA 3BUWB 1LKJA 5AEQA 1IH0A 2E6WA 4OVNF 2BCBA 1S1EA 1SCVA 1BT6A 1W7JB 2ZKMX 4OR9B 1BLQA 2K0JA 1NIWA 1LA0A 1WLZA 4A4CA 1DGVA 4N1GA 2WC8A 2BKIB 1IJ5A 2KQ6A 2HETA 2ZRSA 2HF5A 2GGMA 1DMOA 4MVFA 3TDUA 3SIBA 1K94A 2EHBA 1JFJA 3CWGA 1YUTA 4GGNA 2MA2A 2F33A 2L0PA 3BUOB 1UHIA 2AMIA 4U8DA 2K61A 3QRXA 3KEVA 1DF0B 3BXKA 1KSMA 3FS7A 1CLBA 5KSZA 2KQYA 5BPJA 4I5LB 3FWBA 3OX5A 1QIWA 2F2OA 4FQOA 2KAXA 1AUIB 3NXAA 3KF9A 4MZKA 4PE1A 1SBJA 2L50A 1J7QA 2KI4C 3OB2B 5HKWA 4BY5A 5AERA 3ZNIA 1BG1A 1BJFA 4NDBA 2RGIA 1IQ3A 1CMGA 4GUKA 1KFUS 4GNKB 2MAZA 1BMOA 3OX6A 3IQOA 3O78A 1IRJA 4GGFC 1CFCA 1PRWA 2LV7A 4A4BA 1A29A 1NX1A 2ZRTA 2BCAA 1YRUB 1BOCA 2IS9A 1DJZA 2KBIA 2M1KB 2MLFC 3BQ3A 3I5IC 1GJYA 1PVBA 1D1OA 3SG5A 2KFFA 2BKHB 4M2PA 4OCIA 1W7IB 5DKRA 4GBAA 3LL8B 3RM1A 1DGUA 1QX5B 2M97A 1B4CA 4GAOA 1BR4B 3M0WA 1QV0A 1A03A 1NCZA 1SNLA 1GGWA 3RLZA 1CNPA 1XVJA 3KO0A 3PN7C 1TRFA 3JVTC 2Q91A 1QASA 3I5IB 1B8LA 1XA5A 1DJIA 1QX7A 1IJ6A 5ER4X 4AOMA 1AHRA 2K7BA 1UHJA 1YRTB 3C1VA 1TCFA 2JXLA 1E8AA 1YX7A 3WHTB 1JF0A 2MJWB 1ZMZA 1LXFC 3PN7B 3JVTB 1S6CA 1QLSA 3PLFB 1Y1AA 1QS7A 2KDHA 3TDIA 4HSZA 1PULA 1RFJA 1SL9A 2I94A 1SYMA 2JXCA 1QIVA 2EGDA 3EK4A 4MBEA 1KK8C 3AAKA 2KFGA 3GK4X 2JTTA 2KYCA 3HCMA 2AAOA 1OE9B 2PSRA 1KQVA 4ICBA 1AK8A 1F8HA 1QLKA 3EKJA 1YVLA 1CLMA 1QTXA 2K2FA 2M7NA 2NCPA 2SASA 1CLLA 2Y1NA 4P2YB 4PCWA 2LLUA 1PK0D 3I5HC 4TNCA 2MBXA 2BE4A 3AKAA 1DT7B 1KK8B 2KHNA 5J3XA 4FTGA 1MR8A 3NSLA 1SCMC 3OP0A 1JF2A 2BE6A 4CLNA 4PE7A 1EXRA 1TNWA 4PDZA 1IG5A 1XYDA 3EK7A 1TOPA 2LE9B 1R2UA 2LMVA 4WRIA 3I5HB 5AFPA 2MHHA 2WOSA 1J55A 1XFVO 1YR5A 3DVMA 4MLWA 2WCFA 1KWOB 4PE0A 1BODA 1SCMB 1NP8A 3BUMB 2K2AA 5CPVA 1CFDA 2OPOA 1CDPA 5DKNA 1MQ1A 2M0RA 1UWOA 1NX0A 1XFWO 3PATA 2M3WA 2KAVA 5ER5A 3PSRA 4NDDA 2HQWA 2WNDA 1RECA 4IL1A 1QATA 1M63B 5I2OA 4I5JA 1A2XA 3I5GB 2M7LA 1K93D 1AJ4A 1MWNA 2LMTA 2LUXA 1X02A 1PVAA 1H4BA 1LA3A 3SG2A 2KAYA 2E30A 1PALA 1RTP1 3EVRA 3DF0A 1GGZA 2LVIA 1MHOA 4P5OE 4CIDA 1V1GA 1QV1A 4HREE 2CBLA 1S5GY 2Q4UA 3NSIA 3HX4A 2JNXA 3SG3A 3IF7A 1XK4A 2LUCA 3PM8A 1WRKA 4BY4A 4L9MA 1UUSA 4GGFA 1VRKA 1ODBA 3DD4A 5CSFA 1EJ3A 1S6JA 1ZUZA 5CSNA 4XJKA 1RROA 3SG6A 1BF5A 1AP4A 1S5GZ 1DJHA 1N65A 1XK4C 2LNKA 1J1DA 3CLNA 5PALA 3DF0B 4ETOA 1Y0VH 3TUYC 1K96A 4YGEB 3VGOA 5AXIA 4JWQA 1EG4A 1OQPA 5IBWA 1M46A 2K8MB 3CR5X 4ORAB 2ISDA 1U5IA 2KI6C 4PALA 1OSAA 1TN4A 3DVEA 3TDZA 4I5KA 2JWWA 4DIRA 1TNPA 1J1EA 2LHLA 2QPTA 3AKBA 2AUCA 3FWCA 3TUYB 1FI5A 1Y1XA 1YTZC 2L2EA 2PMYA 1NWDA 1RWYA 4XJKB 1V1FA 3NSOA 1SK6D 4C0LA 1YUUA 4DS7A 4MZLA 1IKUA 2JT0A 1UHNA 1LINA 5B8IB 2COLB 3GK2A 3NSKA 1IWQA 4PHJA 4C0JA 1FBVA 1M31A 2OS8B 3BUXB 4YRUA 2K7DA 5FYXA 1U5IB 2JPTA 3E3RA 2KFHA 3TZ1A 1FPWA 2Y1MA 1CM4A 3SG4A 3K21A 1BR1B 4UPGA 2FCDA 1WLMA 1SL7A 2NZ0A 2M9GA 1WRZA 4MRYA 1UP5A 2ZNDA 1Y1UA 1C7WA 1YX8A 2ZN8A 1NUBA 1K9UA 1OMDA 5KU1A 2H61A 1B9AA 3BYAA 3BOWA 1TIZA 2PRUA 2QACA 3KPXA 1OMRA 4MSPA 1XFZO 1SW8A 2KSPA 4DRWA 5D69A 5HKYA 3VRPA 1S6IA 4QJ3B 1F4OA 2LM5A 2O5GA 2H61C 3VRNA 1M39A 2JOJA 2M8UA 3ZWHA 4ZCUA 4HRGA 2CCMA 2JZIA 1XO5A 2VRGA 4Q04A 1KWOC 1SPYA 4QJ5B 1KFXS 2L51A 4ORBB 1YUSA 4CFQA 3H4SE 3O6BA 2JNFA 2PASA 2F8PA 5HLOA 1CFPA 2NLNA 2I7AA 2JULA 4N1FA 3BOWB 1RK9A 2LP2A 3VROA 2FJUB 2LCPA 2G9BA 1KQMB 1L2OB 1K9KA 1OMVA 2FCEA 1S26D 1F71A 2BCXA 4NQGA 2MLEC 3I5FB 3I5GC 1H8BA 2KOTA 4DUQA 2F3ZA 2V53A 4YBHB 1G33A 1NYAA 3CR4X 4OKHA 4NDCA 4HRHA 5DKQA 1SR6C 4WQ3A 2LLSA 4CPVA 1KFXL 2EC6C 1TCOB 5TNCA 1SL8A 3LK1A 4N5XA 3FIAA 4PHMA 4PHKA 1J7RA 1EG3A 3LLEA 1SKTA 1YVHA 1S3PA 1K8UA 1XFXO 3EK8A 2BL0C 1QJTA 2KYFA 2LANA 3PALA 2CT9A 1SR6B 2M29A 3JTDC 2L4HA 5HYDA 2EC6B 1SMGA 1UURA
chains in the Genus database with same CATH superfamily
3VRRA 1QVIZ 3WHUB 3O2PA 2O60A 3A8RA 2I18A 3BJHA 3GK1A 3CZ2A 3LK0A 1ALWA 3D0YA 2LVJA 3IQQA 1C07A 4GFTA 1DJWA 1L7ZA 1NX3A 3BUNB 2PALA 5K89A 1CM1A 2KLDA 2BL0B 4MEWA 1IQ5A 1FW4A 2WCBA 3JTDB 4GPLB 5AANA 3PM2A 2BBNA 1ORGA 3DVKA 1PSRA 2ZNEA 4FQTA 1B8RA 4ORCB 1NPQA 1CMFA 1F70A 2I2RE 1CDLA 4MN0A 1C7VA 5HKZA 2LC5A 2LP3A 2SCPA 2KBMA 4YGBB 1NCYA 4QJ4B 1JBAA 2FOTA 1R6PA 4XYNA 5JOLA 2H2KA 1YURA 1G8IA 4WQ2A 4F0ZB 2LVVA 3D0YB 1FI6A 2TN4A 2MRDA 1J7PA 1QXPA 2D8NA 3OHMB 1ZOTB 2GV5A 1ALVA 3O4YA 5F6TA 2A4JA 1OOHA 3MSEB 1QWVA 3D73A 2OS8C 1UHKA 2F3YA 4ZCVA 1GQMA 2L2CA 1RJVA 2CXJA 1KCYA 2HQ8A 2JC2A 2LLTA 3A4UB 2WCJA 1JC2A 1WDCC 3WNXB 1B7TY 1DJYA 1K9PA 2BNXA 1AJ5A 1N2DA 1OZOA 3KHEA 1F54A 2KGBC 4MZJA 3WXAA 2KI4B 3CYZA 1A4PA 1QX2A 3CGAA 4CFRA 2WCMA 3EVUA 5GQQC 1K2HA 1EL4A 2KI6D 2L4IA 2QEHA 2K7CA 2WCEA 3DVJA 2M49B 1MXLC 1DTLA 2DOQA 4M2OA 2NCOA 1WDCB 1WRLA 4YGCB 4YGAA 1BU3A 2WCKA 2KNEA 1IGVA 1Q80A 2JU0A 1B7TZ 2Y5IA 5FI7A 4AQIA 3TS5C 4OV2A 3AAJA 1CFFA 1FF1A 1KFUL 2ZN9A 2L5XB 4D1EA 1K95A 5D7FA 1MXEA 1OZSA 2BECA 1OOFA 2R2IA 5I2LA 4M2QA 2LVKA 2PVBA 4E68A 4PE4A 1JUOA 1SY9A 2LAPA 1CB1A 2BBMA 3NHIA 4C0KA 2LMUA 2OTGC 1F4QA 1OOJA 1JWDA 3TS5B 1LVCD 2JPOA 3D10A 1S36A 3D74A 3DXLA 2CNPA 1JFKA 1OOIX 4MRXA 1A75A 1KSOA 1HT9A 3SJSA 2LHIA 1XFUO 2M1UA 2WORA 2L98A 1KQMC 1N0YA 2G2BA 3ICBA 1L2OC 4I5NB 4JQ0D 1CDMA 5I2QA 3SG7A 4JPZB 5JJGA 1EH2A 3VRQA 2JT8A 2L5YA 2OTGB 1G4YR 2KLEA 3EVVA 4PHNA 1TNXA 1K90D 3SIAA 1CTRA 1MF8B 2F2PA 3I5FC 1DVIA 2P70A 2ZFDA 5I8NA 2P6BB 1CKKA 1KK7Y 1WY9A 3LCPC 3CR2A 1F55A 2QEBA 2NXQA 3IVTA 1UHHA 3OB1B 3CZTX 1DJGA 1TNQA 2JRFA 1HQVA 3CZ1A 3BFHA 1B8CA 2KGRA 1NSHA 1A75B 1MUXA 1DJXA 1ZFSA 4R1EA 4USLA 1XFYO 1KK7Z 4YI8A 3SS3A 4YGDB 4AQJA 5HLVA 3PFVA 2JT3A 5CSJA 1QVIY 1ZACA 4INXA 2JTZA 3FE6A 2B1UA 1Z2CB 5CSIA 3F45A 5KTYA 1GM0A 1JSAA 1SRAA 1M45A 1PSBA 3L47A 2K7OA 1Y6WA 1B1GA 3EKHA 3O4XA 4DCKA 2WCHA 3CS1A 2QEOA 1AVSA 2CTNA 1B47A 1C3ZA 2WC5A 3GOFA 1J7OA 3VB1A 4PT1A 1TTXA 1DF0A 3CTNA 2GGZA 2JQ6A 3K1EA 1NCXA 5G08A 4YI9A 1NX2A 2HPSA 2Y4QA 1CDNA 3BUWB 1LKJA 5AEQA 1IH0A 2E6WA 4OVNF 2BCBA 1S1EA 1SCVA 1BT6A 1W7JB 2ZKMX 4OR9B 1BLQA 2K0JA 1NIWA 1LA0A 1WLZA 4A4CA 1DGVA 4N1GA 2WC8A 2BKIB 1IJ5A 2KQ6A 2HETA 2ZRSA 3B86A 2GTEA 2HF5A 2GGMA 2QEVA 3BFBA 4MVFA 3TDUA 1DMOA 3SIBA 1K94A 2EHBA 1JFJA 3CWGA 1YUTA 4GGNA 2MA2A 2F33A 2L0PA 3BUOB 1UHIA 2AMIA 3B87A 4U8DA 2K61A 3QRXA 3KEVA 1DF0B 1IIOA 3BXKA 1KSMA 3FS7A 1CLBA 5KSZA 2KQYA 5BPJA 4I5LB 3FWBA 3OX5A 5HL1A 1QIWA 2F2OA 4FQOA 2KAXA 3OBVA 1AUIB 3NXAA 3KF9A 4MZKA 4PE1A 1SBJA 1DQEA 2L50A 2ISDA 1J7QA 2KI4C 3OB2B 5HKWA 4BY5A 5AERA 3ZNIA 1BG1A 1BJFA 4NDBA 2RGIA 1IQ3A 1CMGA 4GUKA 1KFUS 4GNKB 2MAZA 1BMOA 3OX6A 3IQOA 3O78A 1IRJA 4GGFC 1CFCA 1PRWA 2LV7A 3NGVA 4A4BA 1A29A 1NX1A 2ZRTA 2BCAA 1YRUB 1BOCA 2IS9A 3CABA 1DJZA 1TWOA 3S0EA 2KBIA 2M1KB 2MLFC 3BQ3A 3I5IC 4INWA 1GJYA 1PVBA 1D1OA 3SG5A 2KFFA 2BKHB 4M2PA 4OCIA 1W7IB 5DKRA 4GBAA 3LL8B 3RM1A 1DGUA 1QX5B 2M97A 2PYQA 1B4CA 4GAOA 1BR4B 3M0WA 1QV0A 1A03A 1NCZA 1SNLA 1GGWA 3RLZA 1CNPA 1XVJA 3KO0A 3S0AA 3PN7C 1TRFA 3JVTC 2Q91A 1QASA 3I5IB 1B8LA 1XA5A 1DJIA 1QX7A 1IJ6A 5ER4X 4AOMA 1AHRA 1T14A 2K7BA 1UHJA 1YRTB 3C1VA 1P28A 1Z4HA 1TCFA 2JXLA 1E8AA 1YX7A 3WHTB 1JF0A 2MJWB 1ZMZA 1LXFC 3PN7B 3JVTB 1S6CA 1QLSA 3DY9A 2YGUA 3PLFB 1Y1AA 1QS7A 2KDHA 3TDIA 4HSZA 1PULA 1RFJA 1SL9A 2I94A 1SYMA 2JXCA 1QIVA 2EGDA 3EK4A 5DICA 4MBEA 3PJIA 4JKTA 3L4AA 1KK8C 3AAKA 2KFGA 3GK4X 2WCLA 2JTTA 2KYCA 3HCMA 2AAOA 1OE9B 2PSRA 1KQVA 4ICBA 1AK8A 1F8HA 1QLKA 3EKJA 1YVLA 1CLMA 1QTXA 2K2FA 2M7NA 2NCPA 2SASA 1CLLA 2Y1NA 4P2YB 4PCWA 3B6XA 2LLUA 3FE8A 3S0FA 1PK0D 3I5HC 4TNCA 2MBXA 2BE4A 3AKAA 1DT7B 1KK8B 3S0BA 2KHNA 3D76A 4FTGA 5J3XA 1MR8A 3NSLA 1SCMC 3OP0A 1JF2A 2BE6A 4CLNA 4PE7A 1EXRA 1TNWA 4PDZA 1IG5A 1XYDA 3D77A 3EK7A 1TOPA 2LE9B 1R2UA 2LMVA 4WRIA 3I5HB 5AFPA 2MHHA 2WOSA 1J55A 1XFVO 1YR5A 3DVMA 4MLWA 2WCFA 1KWOB 4PE0A 1BODA 1SCMB 1NP8A 2H8VA 2FJYA 3BUMB 5FI2A 2K2AA 5CPVA 1CFDA 2OPOA 1CDPA 5DKNA 1MQ1A 2M0RA 2P71A 1UWOA 1NX0A 1XFWO 3PATA 2M3WA 2KAVA 1OW4A 5ER5A 3PSRA 4NDDA 2HQWA 3V2LA 2WNDA 1OOGA 1RECA 3NHTA 1QATA 1M63B 4IL1A 5I2OA 4I5JA 1A2XA 3I5GB 2M7LA 1K93D 1AJ4A 1MWNA 2LMTA 2LUXA 1X02A 1PVAA 1H4BA 1LA3A 3SG2A 2KAYA 2E30A 1PALA 1RTP1 3EVRA 3DF0A 1GGZA 2PQLA 2LVIA 1MHOA 4P5OE 4CIDA 3EG5B 1V1GA 1QV1A 4HREE 2CBLA 1S5GY 2Q4UA 3NSIA 3HX4A 2JNXA 2BAPA 3SG3A 3R1OA 3IF7A 1XK4A 3UO9A 2LUCA 3PM8A 1WRKA 4BY4A 4L9MA 3R1VA 1UUSA 4GGFA 1VRKA 1ODBA 3DD4A 5CSFA 1EJ3A 1S6JA 1ZUZA 5CSNA 4XJKA 1RROA 3SG6A 1BF5A 1AP4A 1S5GZ 1DJHA 1N65A 1XK4C 2LNKA 1J1DA 3CLNA 5PALA 3DF0B 4ETOA 1Y0VH 3TUYC 1K96A 1TUZA 4YGEB 3S0GA 1LS8A 5AXIA 3SS4A 3VGOA 4JWQA 2QDIA 1EG4A 1OQPA 1DELA 3BFAA 3CZ0A 5IBWA 1M46A 2K8MB 3CR5X 2WC6A 4ORAB 1U5IA 2KI6C 3OGNA 1OSAA 1TN4A 3QMEA 4PALA 3DVEA 5D3OA 3N7HA 3TDZA 4I5KA 2JWWA 4DIRA 1TNPA 1J1EA 2LHLA 2QPTA 3AKBA 2AUCA 3FWCA 3TUYB 1FI5A 1Y1XA 1YTZC 2L2EA 2PMYA 1NWDA 1RWYA 4XJKB 1V1FA 3NSOA 1SK6D 4C0LA 3SS5A 1YUUA 4DS7A 4MZLA 1IKUA 2JT0A 1UHNA 3S0DA 1LINA 4F7FA 5B8IB 2COLB 3GK2A 5FI6A 3NSKA 1IWQA 4PHJA 4C0JA 1FBVA 1M31A 2OS8B 3BUXB 4YRUA 2K7DA 5EL2A 5FYXA 1U5IB 2JPTA 3E3RA 2KFHA 3TZ1A 1FPWA 2Y1MA 1CM4A 3SG4A 3B88A 3K21A 1BR1B 2ERBA 4UPGA 5I94A 2FCDA 1WLMA 1SL7A 2KPHA 2NZ0A 2M9GA 4JD9A 1WRZA 4MRYA 1UP5A 2ZNDA 1Y1UA 1C7WA 1YX8A 2ZN8A 1NUBA 1K9UA 1OMDA 3D78A 5KU1A 2H61A 1B9AA 3BYAA 3BOWA 1TIZA 2PRUA 2QACA 3KPXA 1OMRA 4MSPA 1XFZO 3Q8IA 3RZSA 1SW8A 2KSPA 4DRWA 5D69A 5HKYA 3VRPA 3DYEA 1S6IA 4QJ3B 1F4OA 2LM5A 2O5GA 2H61C 3VRNA 1M39A 1C3YA 3L4LA 2JOJA 2M8UA 3ZWHA 1DEKA 4HRGA 2CCMA 4ZCUA 2JZIA 1XO5A 2VRGA 4Q04A 1KWOC 1SPYA 4QJ5B 1KFXS 2L51A 4ORBB 3D75A 3R1PA 1YUSA 4CFQA 3H4SE 3FE9A 1TUJA 3O6BA 1DC1A 2JNFA 2PASA 2F8PA 5HLOA 1CFPA 2NLNA 2I7AA 2JULA 4N1FA 3BOWB 1RK9A 2LP2A 3VROA 2FJUB 2LCPA 2G9BA 1KQMB 1L2OB 3UNWA 1K9KA 1OMVA 2FCEA 1S26D 1F71A 2BCXA 4NQGA 2MLEC 3B7AA 3I5FB 3I5GC 1H8BA 2KOTA 4DUQA 2F3ZA 2V53A 4YBHB 1G33A 1NYAA 3CR4X 4OKHA 4KYNA 4NDCA 1XFRA 4HRHA 5DKQA 2K60A 1SR6C 4WQ3A 2LLSA 4CPVA 1KFXL 2EC6C 1TCOB 5TNCA 1SL8A 3LK1A 4N5XA 3R72A 3FIAA 4PHMA 3DZTA 4PHKA 1J7RA 1EG3A 3LLEA 3CDNA 1SKTA 1YVHA 4OZDA 1S3PA 1K8UA 1XFXO 3EK8A 1W9ZA 2BL0C 1QJTA 2KYFA 2LANA 3PALA 2CT9A 1SR6B 2M29A 3JTDC 2L4HA 5HYDA 1SSEB 2EC6B 4IJ7A 1SMGA 1UURA
chains in the Genus database with same CATH topology
3VRRA 1QVIZ 3WHUB 3O2PA 2O60A 3A8RA 2I18A 3GK1A 3LK0A 1ALWA 3D0YA 2LVJA 3IQQA 1C07A 4GFTA 1DJWA 1L7ZA 1NX3A 3BUNB 2PALA 5K89A 1CM1A 4MEWA 2BL0B 1IQ5A 1FW4A 2WCBA 3JTDB 4GPLB 5AANA 2BBNA 1F70A 3DVKA 1PSRA 2ZNEA 4ORCB 1B8RA 1CMFA 1NPQA 2I2RE 1CDLA 4MN0A 1C7VA 5HKZA 2LC5A 2LP3A 2SCPA 2KBMA 4YGBB 1NCYA 4QJ4B 1JBAA 2FOTA 1R6PA 4XYNA 5JOLA 2H2KA 1YURA 1G8IA 4WQ2A 4F0ZB 2LVVA 3D0YB 1FI6A 2TN4A 2MRDA 1J7PA 1QXPA 2D8NA 3OHMB 1ZOTB 2GV5A 1ALVA 3O4YA 5F6TA 2A4JA 3MSEB 2OS8C 1UHKA 2F3YA 4ZCVA 1GQMA 1KCYA 1RJVA 2CXJA 2HQ8A 2JC2A 2LLTA 3A4UB 1JC2A 1WDCC 3WNXB 1B7TY 1DJYA 1K9PA 1AJ5A 1N2DA 1OZOA 3KHEA 1F54A 2KGBC 4MZJA 3WXAA 2KI4B 1A4PA 1QX2A 3CGAA 4CFRA 3EVUA 5GQQC 1K2HA 1EL4A 2KI6D 2L4IA 2WCEA 2K7CA 3DVJA 2M49B 1MXLC 1DTLA 2DOQA 4M2OA 2NCOA 1WDCB 1WRLA 4YGCB 4YGAA 1BU3A 2KNEA 1IGVA 1Q80A 2JU0A 1B7TZ 2Y5IA 4AQIA 3TS5C 4OV2A 3AAJA 1CFFA 1FF1A 1KFUL 2ZN9A 2L5XB 4D1EA 1K95A 5D7FA 1MXEA 1OZSA 2BECA 5I2LA 2R2IA 4M2QA 2LVKA 2PVBA 4E68A 4PE4A 1JUOA 1SY9A 2LAPA 1CB1A 2BBMA 4C0KA 2LMUA 2OTGC 1F4QA 1OOJA 1JWDA 3TS5B 1LVCD 3D10A 1S36A 2CNPA 1JFKA 4MRXA 1A75A 1KSOA 1HT9A 3SJSA 2LHIA 1XFUO 2M1UA 2WORA 2L98A 1KQMC 1N0YA 2G2BA 3ICBA 1L2OC 4I5NB 4JQ0D 1CDMA 5I2QA 3SG7A 4JPZB 5JJGA 1EH2A 3VRQA 2JT8A 2OTGB 1G4YR 4PHNA 3EVVA 1TNXA 1K90D 3SIAA 1CTRA 1MF8B 2F2PA 3I5FC 1DVIA 2ZFDA 5I8NA 1CKKA 2P6BB 1KK7Y 1WY9A 3LCPC 3CR2A 1F55A 2NXQA 1UHHA 3OB1B 3CZTX 1DJGA 1TNQA 2JRFA 1HQVA 1B8CA 2KGRA 1NSHA 1A75B 1MUXA 1DJXA 1ZFSA 4R1EA 4USLA 1XFYO 1KK7Z 4YI8A 4YGDB 4AQJA 5HLVA 3PFVA 2JT3A 5CSJA 1QVIY 1ZACA 2JTZA 5KTYA 2B1UA 5CSIA 3F45A 1JSAA 1SRAA 1M45A 1PSBA 2K7OA 1Y6WA 1B1GA 3EKHA 4DCKA 3CS1A 1AVSA 2CTNA 1B47A 3GOFA 1J7OA 1TTXA 1DF0A 3CTNA 2GGZA 2JQ6A 1NCXA 5G08A 4YI9A 1NX2A 2HPSA 2Y4QA 1CDNA 3BUWB 1LKJA 5AEQA 1IH0A 2E6WA 4OVNF 2BCBA 1S1EA 1SCVA 1BT6A 1W7JB 2ZKMX 4OR9B 1BLQA 2K0JA 1NIWA 1LA0A 1WLZA 4A4CA 1DGVA 4N1GA 2WC8A 2BKIB 1IJ5A 2KQ6A 2HETA 2ZRSA 2HF5A 2GGMA 1DMOA 4MVFA 3TDUA 3SIBA 1K94A 2EHBA 1JFJA 3CWGA 1YUTA 4GGNA 2MA2A 2F33A 2L0PA 3BUOB 1UHIA 2AMIA 4U8DA 2K61A 3QRXA 3KEVA 1DF0B 3BXKA 1KSMA 3FS7A 1CLBA 5KSZA 2KQYA 5BPJA 4I5LB 3FWBA 3OX5A 1QIWA 2F2OA 4FQOA 2KAXA 1AUIB 3NXAA 3KF9A 4MZKA 4PE1A 1SBJA 2L50A 1J7QA 2KI4C 3OB2B 5HKWA 4BY5A 5AERA 3ZNIA 1BG1A 1BJFA 4NDBA 2RGIA 1IQ3A 1CMGA 4GUKA 1KFUS 4GNKB 2MAZA 1BMOA 3OX6A 3IQOA 3O78A 1IRJA 4GGFC 1CFCA 1PRWA 2LV7A 4A4BA 1A29A 1NX1A 2ZRTA 2BCAA 1YRUB 1BOCA 2IS9A 1DJZA 2KBIA 2M1KB 2MLFC 3BQ3A 3I5IC 1GJYA 1PVBA 1D1OA 3SG5A 2KFFA 2BKHB 4M2PA 4OCIA 1W7IB 5DKRA 4GBAA 3LL8B 3RM1A 1DGUA 1QX5B 2M97A 1B4CA 4GAOA 1BR4B 3M0WA 1QV0A 1A03A 1NCZA 1SNLA 1GGWA 3RLZA 1CNPA 1XVJA 3KO0A 3PN7C 1TRFA 3JVTC 2Q91A 1QASA 3I5IB 1B8LA 1XA5A 1DJIA 1QX7A 1IJ6A 5ER4X 4AOMA 1AHRA 2K7BA 1UHJA 1YRTB 3C1VA 1TCFA 2JXLA 1E8AA 1YX7A 3WHTB 1JF0A 2MJWB 1ZMZA 1LXFC 3PN7B 3JVTB 1S6CA 1QLSA 3PLFB 1Y1AA 1QS7A 2KDHA 3TDIA 4HSZA 1PULA 1RFJA 1SL9A 2I94A 1SYMA 2JXCA 1QIVA 2EGDA 3EK4A 4MBEA 1KK8C 3AAKA 2KFGA 3GK4X 2JTTA 2KYCA 3HCMA 2AAOA 1OE9B 2PSRA 1KQVA 4ICBA 1AK8A 1F8HA 1QLKA 3EKJA 1YVLA 1CLMA 1QTXA 2K2FA 2M7NA 2NCPA 2SASA 1CLLA 2Y1NA 4P2YB 4PCWA 2LLUA 1PK0D 3I5HC 4TNCA 2MBXA 2BE4A 3AKAA 1DT7B 1KK8B 2KHNA 5J3XA 4FTGA 1MR8A 3NSLA 1SCMC 3OP0A 1JF2A 2BE6A 4CLNA 4PE7A 1EXRA 1TNWA 4PDZA 1IG5A 1XYDA 3EK7A 1TOPA 2LE9B 1R2UA 2LMVA 4WRIA 3I5HB 5AFPA 2MHHA 2WOSA 1J55A 1XFVO 1YR5A 3DVMA 4MLWA 2WCFA 1KWOB 4PE0A 1BODA 1SCMB 1NP8A 3BUMB 2K2AA 5CPVA 1CFDA 2OPOA 1CDPA 5DKNA 1MQ1A 2M0RA 1UWOA 1NX0A 1XFWO 3PATA 2M3WA 2KAVA 5ER5A 3PSRA 4NDDA 2HQWA 2WNDA 1RECA 4IL1A 1QATA 1M63B 5I2OA 4I5JA 1A2XA 3I5GB 2M7LA 1K93D 1AJ4A 1MWNA 2LMTA 2LUXA 1X02A 1PVAA 1H4BA 1LA3A 3SG2A 2KAYA 2E30A 1PALA 1RTP1 3EVRA 3DF0A 1GGZA 2LVIA 1MHOA 4P5OE 4CIDA 1V1GA 1QV1A 4HREE 2CBLA 1S5GY 2Q4UA 3NSIA 3HX4A 2JNXA 3SG3A 3IF7A 1XK4A 2LUCA 3PM8A 1WRKA 4BY4A 4L9MA 1UUSA 4GGFA 1VRKA 1ODBA 3DD4A 5CSFA 1EJ3A 1S6JA 1ZUZA 5CSNA 4XJKA 1RROA 3SG6A 1BF5A 1AP4A 1S5GZ 1DJHA 1N65A 1XK4C 2LNKA 1J1DA 3CLNA 5PALA 3DF0B 4ETOA 1Y0VH 3TUYC 1K96A 4YGEB 3VGOA 5AXIA 4JWQA 1EG4A 1OQPA 5IBWA 1M46A 2K8MB 3CR5X 4ORAB 2ISDA 1U5IA 2KI6C 4PALA 1OSAA 1TN4A 3DVEA 3TDZA 4I5KA 2JWWA 4DIRA 1TNPA 1J1EA 2LHLA 2QPTA 3AKBA 2AUCA 3FWCA 3TUYB 1FI5A 1Y1XA 1YTZC 2L2EA 2PMYA 1NWDA 1RWYA 4XJKB 1V1FA 3NSOA 1SK6D 4C0LA 1YUUA 4DS7A 4MZLA 1IKUA 2JT0A 1UHNA 1LINA 5B8IB 2COLB 3GK2A 3NSKA 1IWQA 4PHJA 4C0JA 1FBVA 1M31A 2OS8B 3BUXB 4YRUA 2K7DA 5FYXA 1U5IB 2JPTA 3E3RA 2KFHA 3TZ1A 1FPWA 2Y1MA 1CM4A 3SG4A 3K21A 1BR1B 4UPGA 2FCDA 1WLMA 1SL7A 2NZ0A 2M9GA 1WRZA 4MRYA 1UP5A 2ZNDA 1Y1UA 1C7WA 1YX8A 2ZN8A 1NUBA 1K9UA 1OMDA 5KU1A 2H61A 1B9AA 3BYAA 3BOWA 1TIZA 2PRUA 2QACA 3KPXA 1OMRA 4MSPA 1XFZO 1SW8A 2KSPA 4DRWA 5D69A 5HKYA 3VRPA 1S6IA 4QJ3B 1F4OA 2LM5A 2O5GA 2H61C 3VRNA 1M39A 2JOJA 2M8UA 3ZWHA 4ZCUA 4HRGA 2CCMA 2JZIA 1XO5A 2VRGA 4Q04A 1KWOC 1SPYA 4QJ5B 1KFXS 2L51A 4ORBB 1YUSA 4CFQA 3H4SE 3O6BA 2JNFA 2PASA 2F8PA 5HLOA 1CFPA 2NLNA 2I7AA 2JULA 4N1FA 3BOWB 1RK9A 2LP2A 3VROA 2FJUB 2LCPA 2G9BA 1KQMB 1L2OB 1K9KA 1OMVA 2FCEA 1S26D 1F71A 2BCXA 4NQGA 2MLEC 3I5FB 3I5GC 1H8BA 2KOTA 4DUQA 2F3ZA 2V53A 4YBHB 1G33A 1NYAA 3CR4X 4OKHA 4NDCA 4HRHA 5DKQA 1SR6C 4WQ3A 2LLSA 4CPVA 1KFXL 2EC6C 1TCOB 5TNCA 1SL8A 3LK1A 4N5XA 3FIAA 4PHMA 4PHKA 1J7RA 1EG3A 3LLEA 1SKTA 1YVHA 1S3PA 1K8UA 1XFXO 3EK8A 2BL0C 1QJTA 2KYFA 2LANA 3PALA 2CT9A 1SR6B 2M29A 3JTDC 2L4HA 5HYDA 2EC6B 1SMGA 1UURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRR A;  1QVI Z;  3WHU B;  3O2P A;  2O60 A;  3A8R A;  2I18 A;  3GK1 A;  3LK0 A;  1ALW A;  3D0Y A;  2LVJ A;  3IQQ A;  1C07 A;  4GFT A;  1DJW A;  1L7Z A;  1NX3 A;  3BUN B;  2PAL A;  5K89 A;  1CM1 A;  4MEW A;  2BL0 B;  1IQ5 A;  1FW4 A;  2WCB A;  3JTD B;  4GPL B;  5AAN A;  2BBN A;  1F70 A;  3DVK A;  1PSR A;  2ZNE A;  4ORC B;  1B8R A;  1CMF A;  1NPQ A;  2I2R E;  1CDL A;  4MN0 A;  1C7V A;  5HKZ A;  2LC5 A;  2LP3 A;  2SCP A;  2KBM A;  4YGB B;  1NCY A;  4QJ4 B;  1JBA A;  2FOT A;  1R6P A;  4XYN A;  5JOL A;  2H2K A;  1YUR A;  1G8I A;  4WQ2 A;  4F0Z B;  2LVV A;  3D0Y B;  1FI6 A;  2TN4 A;  2MRD A;  1J7P A;  1QXP A;  2D8N A;  3OHM B;  1ZOT B;  2GV5 A;  1ALV A;  3O4Y A;  5F6T A;  2A4J A;  3MSE B;  2OS8 C;  1UHK A;  2F3Y A;  4ZCV A;  1GQM A;  1KCY A;  1RJV A;  2CXJ A;  2HQ8 A;  2JC2 A;  2LLT A;  3A4U B;  1JC2 A;  1WDC C;  3WNX B;  1B7T Y;  1DJY A;  1K9P A;  1AJ5 A;  1N2D A;  1OZO A;  3KHE A;  1F54 A;  2KGB C;  4MZJ A;  3WXA A;  2KI4 B;  1A4P A;  1QX2 A;  3CGA A;  4CFR A;  3EVU A;  5GQQ C;  1K2H A;  1EL4 A;  2KI6 D;  2L4I A;  2WCE A;  2K7C A;  3DVJ A;  2M49 B;  1MXL C;  1DTL A;  2DOQ A;  4M2O A;  2NCO A;  1WDC B;  1WRL A;  4YGC B;  4YGA A;  1BU3 A;  2KNE A;  1IGV A;  1Q80 A;  2JU0 A;  1B7T Z;  2Y5I A;  4AQI A;  3TS5 C;  4OV2 A;  3AAJ A;  1CFF A;  1FF1 A;  1KFU L;  2ZN9 A;  2L5X B;  4D1E A;  1K95 A;  5D7F A;  1MXE A;  1OZS A;  2BEC A;  5I2L A;  2R2I A;  4M2Q A;  2LVK A;  2PVB A;  4E68 A;  4PE4 A;  1JUO A;  1SY9 A;  2LAP A;  1CB1 A;  2BBM A;  4C0K A;  2LMU A;  2OTG C;  1F4Q A;  1OOJ A;  1JWD A;  3TS5 B;  1LVC D;  3D10 A;  1S36 A;  2CNP A;  1JFK A;  4MRX A;  1A75 A;  1KSO A;  1HT9 A;  3SJS A;  2LHI A;  1XFU O;  2M1U A;  2WOR A;  2L98 A;  1KQM C;  1N0Y A;  2G2B A;  3ICB A;  1L2O C;  4I5N B;  4JQ0 D;  1CDM A;  5I2Q A;  3SG7 A;  4JPZ B;  5JJG A;  1EH2 A;  3VRQ A;  2JT8 A;  2OTG B;  1G4Y R;  4PHN A;  3EVV A;  1TNX A;  1K90 D;  3SIA A;  1CTR A;  1MF8 B;  2F2P A;  3I5F C;  1DVI A;  2ZFD A;  5I8N A;  1CKK A;  2P6B B;  1KK7 Y;  1WY9 A;  3LCP C;  3CR2 A;  1F55 A;  2NXQ A;  1UHH A;  3OB1 B;  3CZT X;  1DJG A;  1TNQ A;  2JRF A;  1HQV A;  1B8C A;  2KGR A;  1NSH A;  1A75 B;  1MUX A;  1DJX A;  1ZFS A;  4R1E A;  4USL A;  1XFY O;  1KK7 Z;  4YI8 A;  4YGD B;  4AQJ A;  5HLV A;  3PFV A;  2JT3 A;  5CSJ A;  1QVI Y;  1ZAC A;  2JTZ A;  5KTY A;  2B1U A;  5CSI A;  3F45 A;  1JSA A;  1SRA A;  1M45 A;  1PSB A;  2K7O A;  1Y6W A;  1B1G A;  3EKH A;  4DCK A;  3CS1 A;  1AVS A;  2CTN A;  1B47 A;  3GOF A;  1J7O A;  1TTX A;  1DF0 A;  3CTN A;  2GGZ A;  2JQ6 A;  1NCX A;  5G08 A;  4YI9 A;  1NX2 A;  2HPS A;  2Y4Q A;  1CDN A;  3BUW B;  1LKJ A;  5AEQ A;  1IH0 A;  2E6W A;  4OVN F;  2BCB A;  1S1E A;  1SCV A;  1BT6 A;  1W7J B;  2ZKM X;  4OR9 B;  1BLQ A;  2K0J A;  1NIW A;  1LA0 A;  1WLZ A;  4A4C A;  1DGV A;  4N1G A;  2WC8 A;  2BKI B;  1IJ5 A;  2KQ6 A;  2HET A;  2ZRS A;  2HF5 A;  2GGM A;  1DMO A;  4MVF A;  3TDU A;  3SIB A;  1K94 A;  2EHB A;  1JFJ A;  3CWG A;  1YUT A;  4GGN A;  2MA2 A;  2F33 A;  2L0P A;  3BUO B;  1UHI A;  2AMI A;  4U8D A;  2K61 A;  3QRX A;  3KEV A;  1DF0 B;  3BXK A;  1KSM A;  3FS7 A;  1CLB A;  5KSZ A;  2KQY A;  5BPJ A;  4I5L B;  3FWB A;  3OX5 A;  1QIW A;  2F2O A;  4FQO A;  2KAX A;  1AUI B;  3NXA A;  3KF9 A;  4MZK A;  4PE1 A;  1SBJ A;  2L50 A;  1J7Q A;  2KI4 C;  3OB2 B;  5HKW A;  4BY5 A;  5AER A;  3ZNI A;  1BG1 A;  1BJF A;  4NDB A;  2RGI A;  1IQ3 A;  1CMG A;  4GUK A;  1KFU S;  4GNK B;  2MAZ A;  1BMO A;  3OX6 A;  3IQO A;  3O78 A;  1IRJ A;  4GGF C;  1CFC A;  1PRW A;  2LV7 A;  4A4B A;  1A29 A;  1NX1 A;  2ZRT A;  2BCA A;  1YRU B;  1BOC A;  2IS9 A;  1DJZ A;  2KBI A;  2M1K B;  2MLF C;  3BQ3 A;  3I5I C;  1GJY A;  1PVB A;  1D1O A;  3SG5 A;  2KFF A;  2BKH B;  4M2P A;  4OCI A;  1W7I B;  5DKR A;  4GBA A;  3LL8 B;  3RM1 A;  1DGU A;  1QX5 B;  2M97 A;  1B4C A;  4GAO A;  1BR4 B;  3M0W A;  1QV0 A;  1A03 A;  1NCZ A;  1SNL A;  1GGW A;  3RLZ A;  1CNP A;  1XVJ A;  3KO0 A;  3PN7 C;  1TRF A;  3JVT C;  2Q91 A;  1QAS A;  3I5I B;  1B8L A;  1XA5 A;  1DJI A;  1QX7 A;  1IJ6 A;  5ER4 X;  4AOM A;  1AHR A;  2K7B A;  1UHJ A;  1YRT B;  3C1V A;  1TCF A;  2JXL A;  1E8A A;  1YX7 A;  3WHT B;  1JF0 A;  2MJW B;  1ZMZ A;  1LXF C;  3PN7 B;  3JVT B;  1S6C A;  1QLS A;  3PLF B;  1Y1A A;  1QS7 A;  2KDH A;  3TDI A;  4HSZ A;  1PUL A;  1RFJ A;  1SL9 A;  2I94 A;  1SYM A;  2JXC A;  1QIV A;  2EGD A;  3EK4 A;  4MBE A;  1KK8 C;  3AAK A;  2KFG A;  3GK4 X;  2JTT A;  2KYC A;  3HCM A;  2AAO A;  1OE9 B;  2PSR A;  1KQV A;  4ICB A;  1AK8 A;  1F8H A;  1QLK A;  3EKJ A;  1YVL A;  1CLM A;  1QTX A;  2K2F A;  2M7N A;  2NCP A;  2SAS A;  1CLL A;  2Y1N A;  4P2Y B;  4PCW A;  2LLU A;  1PK0 D;  3I5H C;  4TNC A;  2MBX A;  2BE4 A;  3AKA A;  1DT7 B;  1KK8 B;  2KHN A;  5J3X A;  4FTG A;  1MR8 A;  3NSL A;  1SCM C;  3OP0 A;  1JF2 A;  2BE6 A;  4CLN A;  4PE7 A;  1EXR A;  1TNW A;  4PDZ A;  1IG5 A;  1XYD A;  3EK7 A;  1TOP A;  2LE9 B;  1R2U A;  2LMV A;  4WRI A;  3I5H B;  5AFP A;  2MHH A;  2WOS A;  1J55 A;  1XFV O;  1YR5 A;  3DVM A;  4MLW A;  2WCF A;  1KWO B;  4PE0 A;  1BOD A;  1SCM B;  1NP8 A;  3BUM B;  2K2A A;  5CPV A;  1CFD A;  2OPO A;  1CDP A;  5DKN A;  1MQ1 A;  2M0R A;  1UWO A;  1NX0 A;  1XFW O;  3PAT A;  2M3W A;  2KAV A;  5ER5 A;  3PSR A;  4NDD A;  2HQW A;  2WND A;  1REC A;  4IL1 A;  1QAT A;  1M63 B;  5I2O A;  4I5J A;  1A2X A;  3I5G B;  2M7L A;  1K93 D;  1AJ4 A;  1MWN A;  2LMT A;  2LUX A;  1X02 A;  1PVA A;  1H4B A;  1LA3 A;  3SG2 A;  2KAY A;  2E30 A;  1PAL A;  1RTP 1;  3EVR A;  3DF0 A;  1GGZ A;  2LVI A;  1MHO A;  4P5O E;  4CID A;  1V1G A;  1QV1 A;  4HRE E;  2CBL A;  1S5G Y;  2Q4U A;  3NSI A;  3HX4 A;  2JNX A;  3SG3 A;  3IF7 A;  1XK4 A;  2LUC A;  3PM8 A;  1WRK A;  4BY4 A;  4L9M A;  1UUS A;  4GGF A;  1VRK A;  1ODB A;  3DD4 A;  5CSF A;  1EJ3 A;  1S6J A;  1ZUZ A;  5CSN A;  4XJK A;  1RRO A;  3SG6 A;  1BF5 A;  1AP4 A;  1S5G Z;  1DJH A;  1N65 A;  1XK4 C;  2LNK A;  1J1D A;  3CLN A;  5PAL A;  3DF0 B;  4ETO A;  1Y0V H;  3TUY C;  1K96 A;  4YGE B;  3VGO A;  5AXI A;  4JWQ A;  1EG4 A;  1OQP A;  5IBW A;  1M46 A;  2K8M B;  3CR5 X;  4ORA B;  2ISD A;  1U5I A;  2KI6 C;  4PAL A;  1OSA A;  1TN4 A;  3DVE A;  3TDZ A;  4I5K A;  2JWW A;  4DIR A;  1TNP A;  1J1E A;  2LHL A;  2QPT A;  3AKB A;  2AUC A;  3FWC A;  3TUY B;  1FI5 A;  1Y1X A;  1YTZ C;  2L2E A;  2PMY A;  1NWD A;  1RWY A;  4XJK B;  1V1F A;  3NSO A;  1SK6 D;  4C0L A;  1YUU A;  4DS7 A;  4MZL A;  1IKU A;  2JT0 A;  1UHN A;  1LIN A;  5B8I B;  2COL B;  3GK2 A;  3NSK A;  1IWQ A;  4PHJ A;  4C0J A;  1FBV A;  1M31 A;  2OS8 B;  3BUX B;  4YRU A;  2K7D A;  5FYX A;  1U5I B;  2JPT A;  3E3R A;  2KFH A;  3TZ1 A;  1FPW A;  2Y1M A;  1CM4 A;  3SG4 A;  3K21 A;  1BR1 B;  4UPG A;  2FCD A;  1WLM A;  1SL7 A;  2NZ0 A;  2M9G A;  1WRZ A;  4MRY A;  1UP5 A;  2ZND A;  1Y1U A;  1C7W A;  1YX8 A;  2ZN8 A;  1NUB A;  1K9U A;  1OMD A;  5KU1 A;  2H61 A;  1B9A A;  3BYA A;  3BOW A;  1TIZ A;  2PRU A;  2QAC A;  3KPX A;  1OMR A;  4MSP A;  1XFZ O;  1SW8 A;  2KSP A;  4DRW A;  5D69 A;  5HKY A;  3VRP A;  1S6I A;  4QJ3 B;  1F4O A;  2LM5 A;  2O5G A;  2H61 C;  3VRN A;  1M39 A;  2JOJ A;  2M8U A;  3ZWH A;  4ZCU A;  4HRG A;  2CCM A;  2JZI A;  1XO5 A;  2VRG A;  4Q04 A;  1KWO C;  1SPY A;  4QJ5 B;  1KFX S;  2L51 A;  4ORB B;  1YUS A;  4CFQ A;  3H4S E;  3O6B A;  2JNF A;  2PAS A;  2F8P A;  5HLO A;  1CFP A;  2NLN A;  2I7A A;  2JUL A;  4N1F A;  3BOW B;  1RK9 A;  2LP2 A;  3VRO A;  2FJU B;  2LCP A;  2G9B A;  1KQM B;  1L2O B;  1K9K A;  1OMV A;  2FCE A;  1S26 D;  1F71 A;  2BCX A;  4NQG A;  2MLE C;  3I5F B;  3I5G C;  1H8B A;  2KOT A;  4DUQ A;  2F3Z A;  2V53 A;  4YBH B;  1G33 A;  1NYA A;  3CR4 X;  4OKH A;  4NDC A;  4HRH A;  5DKQ A;  1SR6 C;  4WQ3 A;  2LLS A;  4CPV A;  1KFX L;  2EC6 C;  1TCO B;  5TNC A;  1SL8 A;  3LK1 A;  4N5X A;  3FIA A;  4PHM A;  4PHK A;  1J7R A;  1EG3 A;  3LLE A;  1SKT A;  1YVH A;  1S3P A;  1K8U A;  1XFX O;  3EK8 A;  2BL0 C;  1QJT A;  2KYF A;  2LAN A;  3PAL A;  2CT9 A;  1SR6 B;  2M29 A;  3JTD C;  2L4H A;  5HYD A;  2EC6 B;  1SMG A;  1UUR A; 
#chains in the Genus database with same CATH topology
 3VRR A;  1QVI Z;  3WHU B;  3O2P A;  2O60 A;  3A8R A;  2I18 A;  3BJH A;  3GK1 A;  3CZ2 A;  3LK0 A;  1ALW A;  3D0Y A;  2LVJ A;  3IQQ A;  1C07 A;  4GFT A;  1DJW A;  1L7Z A;  1NX3 A;  3BUN B;  2PAL A;  5K89 A;  1CM1 A;  2KLD A;  2BL0 B;  4MEW A;  1IQ5 A;  1FW4 A;  2WCB A;  3JTD B;  4GPL B;  5AAN A;  3PM2 A;  2BBN A;  1ORG A;  3DVK A;  1PSR A;  2ZNE A;  4FQT A;  1B8R A;  4ORC B;  1NPQ A;  1CMF A;  1F70 A;  2I2R E;  1CDL A;  4MN0 A;  1C7V A;  5HKZ A;  2LC5 A;  2LP3 A;  2SCP A;  2KBM A;  4YGB B;  1NCY A;  4QJ4 B;  1JBA A;  2FOT A;  1R6P A;  4XYN A;  5JOL A;  2H2K A;  1YUR A;  1G8I A;  4WQ2 A;  4F0Z B;  2LVV A;  3D0Y B;  1FI6 A;  2TN4 A;  2MRD A;  1J7P A;  1QXP A;  2D8N A;  3OHM B;  1ZOT B;  2GV5 A;  1ALV A;  3O4Y A;  5F6T A;  2A4J A;  1OOH A;  3MSE B;  1QWV A;  3D73 A;  2OS8 C;  1UHK A;  2F3Y A;  4ZCV A;  1GQM A;  2L2C A;  1RJV A;  2CXJ A;  1KCY A;  2HQ8 A;  2JC2 A;  2LLT A;  3A4U B;  2WCJ A;  1JC2 A;  1WDC C;  3WNX B;  1B7T Y;  1DJY A;  1K9P A;  2BNX A;  1AJ5 A;  1N2D A;  1OZO A;  3KHE A;  1F54 A;  2KGB C;  4MZJ A;  3WXA A;  2KI4 B;  3CYZ A;  1A4P A;  1QX2 A;  3CGA A;  4CFR A;  2WCM A;  3EVU A;  5GQQ C;  1K2H A;  1EL4 A;  2KI6 D;  2L4I A;  2QEH A;  2K7C A;  2WCE A;  3DVJ A;  2M49 B;  1MXL C;  1DTL A;  2DOQ A;  4M2O A;  2NCO A;  1WDC B;  1WRL A;  4YGC B;  4YGA A;  1BU3 A;  2WCK A;  2KNE A;  1IGV A;  1Q80 A;  2JU0 A;  1B7T Z;  2Y5I A;  5FI7 A;  4AQI A;  3TS5 C;  4OV2 A;  3AAJ A;  1CFF A;  1FF1 A;  1KFU L;  2ZN9 A;  2L5X B;  4D1E A;  1K95 A;  5D7F A;  1MXE A;  1OZS A;  2BEC A;  1OOF A;  2R2I A;  5I2L A;  4M2Q A;  2LVK A;  2PVB A;  4E68 A;  4PE4 A;  1JUO A;  1SY9 A;  2LAP A;  1CB1 A;  2BBM A;  3NHI A;  4C0K A;  2LMU A;  2OTG C;  1F4Q A;  1OOJ A;  1JWD A;  3TS5 B;  1LVC D;  2JPO A;  3D10 A;  1S36 A;  3D74 A;  3DXL A;  2CNP A;  1JFK A;  1OOI X;  4MRX A;  1A75 A;  1KSO A;  1HT9 A;  3SJS A;  2LHI A;  1XFU O;  2M1U A;  2WOR A;  2L98 A;  1KQM C;  1N0Y A;  2G2B A;  3ICB A;  1L2O C;  4I5N B;  4JQ0 D;  1CDM A;  5I2Q A;  3SG7 A;  4JPZ B;  5JJG A;  1EH2 A;  3VRQ A;  2JT8 A;  2L5Y A;  2OTG B;  1G4Y R;  2KLE A;  3EVV A;  4PHN A;  1TNX A;  1K90 D;  3SIA A;  1CTR A;  1MF8 B;  2F2P A;  3I5F C;  1DVI A;  2P70 A;  2ZFD A;  5I8N A;  2P6B B;  1CKK A;  1KK7 Y;  1WY9 A;  3LCP C;  3CR2 A;  1F55 A;  2QEB A;  2NXQ A;  3IVT A;  1UHH A;  3OB1 B;  3CZT X;  1DJG A;  1TNQ A;  2JRF A;  1HQV A;  3CZ1 A;  3BFH A;  1B8C A;  2KGR A;  1NSH A;  1A75 B;  1MUX A;  1DJX A;  1ZFS A;  4R1E A;  4USL A;  1XFY O;  1KK7 Z;  4YI8 A;  3SS3 A;  4YGD B;  4AQJ A;  5HLV A;  3PFV A;  2JT3 A;  5CSJ A;  1QVI Y;  1ZAC A;  4INX A;  2JTZ A;  3FE6 A;  2B1U A;  1Z2C B;  5CSI A;  3F45 A;  5KTY A;  1GM0 A;  1JSA A;  1SRA A;  1M45 A;  1PSB A;  3L47 A;  2K7O A;  1Y6W A;  1B1G A;  3EKH A;  3O4X A;  4DCK A;  2WCH A;  3CS1 A;  2QEO A;  1AVS A;  2CTN A;  1B47 A;  1C3Z A;  2WC5 A;  3GOF A;  1J7O A;  3VB1 A;  4PT1 A;  1TTX A;  1DF0 A;  3CTN A;  2GGZ A;  2JQ6 A;  3K1E A;  1NCX A;  5G08 A;  4YI9 A;  1NX2 A;  2HPS A;  2Y4Q A;  1CDN A;  3BUW B;  1LKJ A;  5AEQ A;  1IH0 A;  2E6W A;  4OVN F;  2BCB A;  1S1E A;  1SCV A;  1BT6 A;  1W7J B;  2ZKM X;  4OR9 B;  1BLQ A;  2K0J A;  1NIW A;  1LA0 A;  1WLZ A;  4A4C A;  1DGV A;  4N1G A;  2WC8 A;  2BKI B;  1IJ5 A;  2KQ6 A;  2HET A;  2ZRS A;  3B86 A;  2GTE A;  2HF5 A;  2GGM A;  2QEV A;  3BFB A;  4MVF A;  3TDU A;  1DMO A;  3SIB A;  1K94 A;  2EHB A;  1JFJ A;  3CWG A;  1YUT A;  4GGN A;  2MA2 A;  2F33 A;  2L0P A;  3BUO B;  1UHI A;  2AMI A;  3B87 A;  4U8D A;  2K61 A;  3QRX A;  3KEV A;  1DF0 B;  1IIO A;  3BXK A;  1KSM A;  3FS7 A;  1CLB A;  5KSZ A;  2KQY A;  5BPJ A;  4I5L B;  3FWB A;  3OX5 A;  5HL1 A;  1QIW A;  2F2O A;  4FQO A;  2KAX A;  3OBV A;  1AUI B;  3NXA A;  3KF9 A;  4MZK A;  4PE1 A;  1SBJ A;  1DQE A;  2L50 A;  2ISD A;  1J7Q A;  2KI4 C;  3OB2 B;  5HKW A;  4BY5 A;  5AER A;  3ZNI A;  1BG1 A;  1BJF A;  4NDB A;  2RGI A;  1IQ3 A;  1CMG A;  4GUK A;  1KFU S;  4GNK B;  2MAZ A;  1BMO A;  3OX6 A;  3IQO A;  3O78 A;  1IRJ A;  4GGF C;  1CFC A;  1PRW A;  2LV7 A;  3NGV A;  4A4B A;  1A29 A;  1NX1 A;  2ZRT A;  2BCA A;  1YRU B;  1BOC A;  2IS9 A;  3CAB A;  1DJZ A;  1TWO A;  3S0E A;  2KBI A;  2M1K B;  2MLF C;  3BQ3 A;  3I5I C;  4INW A;  1GJY A;  1PVB A;  1D1O A;  3SG5 A;  2KFF A;  2BKH B;  4M2P A;  4OCI A;  1W7I B;  5DKR A;  4GBA A;  3LL8 B;  3RM1 A;  1DGU A;  1QX5 B;  2M97 A;  2PYQ A;  1B4C A;  4GAO A;  1BR4 B;  3M0W A;  1QV0 A;  1A03 A;  1NCZ A;  1SNL A;  1GGW A;  3RLZ A;  1CNP A;  1XVJ A;  3KO0 A;  3S0A A;  3PN7 C;  1TRF A;  3JVT C;  2Q91 A;  1QAS A;  3I5I B;  1B8L A;  1XA5 A;  1DJI A;  1QX7 A;  1IJ6 A;  5ER4 X;  4AOM A;  1AHR A;  1T14 A;  2K7B A;  1UHJ A;  1YRT B;  3C1V A;  1P28 A;  1Z4H A;  1TCF A;  2JXL A;  1E8A A;  1YX7 A;  3WHT B;  1JF0 A;  2MJW B;  1ZMZ A;  1LXF C;  3PN7 B;  3JVT B;  1S6C A;  1QLS A;  3DY9 A;  2YGU A;  3PLF B;  1Y1A A;  1QS7 A;  2KDH A;  3TDI A;  4HSZ A;  1PUL A;  1RFJ A;  1SL9 A;  2I94 A;  1SYM A;  2JXC A;  1QIV A;  2EGD A;  3EK4 A;  5DIC A;  4MBE A;  3PJI A;  4JKT A;  3L4A A;  1KK8 C;  3AAK A;  2KFG A;  3GK4 X;  2WCL A;  2JTT A;  2KYC A;  3HCM A;  2AAO A;  1OE9 B;  2PSR A;  1KQV A;  4ICB A;  1AK8 A;  1F8H A;  1QLK A;  3EKJ A;  1YVL A;  1CLM A;  1QTX A;  2K2F A;  2M7N A;  2NCP A;  2SAS A;  1CLL A;  2Y1N A;  4P2Y B;  4PCW A;  3B6X A;  2LLU A;  3FE8 A;  3S0F A;  1PK0 D;  3I5H C;  4TNC A;  2MBX A;  2BE4 A;  3AKA A;  1DT7 B;  1KK8 B;  3S0B A;  2KHN A;  3D76 A;  4FTG A;  5J3X A;  1MR8 A;  3NSL A;  1SCM C;  3OP0 A;  1JF2 A;  2BE6 A;  4CLN A;  4PE7 A;  1EXR A;  1TNW A;  4PDZ A;  1IG5 A;  1XYD A;  3D77 A;  3EK7 A;  1TOP A;  2LE9 B;  1R2U A;  2LMV A;  4WRI A;  3I5H B;  5AFP A;  2MHH A;  2WOS A;  1J55 A;  1XFV O;  1YR5 A;  3DVM A;  4MLW A;  2WCF A;  1KWO B;  4PE0 A;  1BOD A;  1SCM B;  1NP8 A;  2H8V A;  2FJY A;  3BUM B;  5FI2 A;  2K2A A;  5CPV A;  1CFD A;  2OPO A;  1CDP A;  5DKN A;  1MQ1 A;  2M0R A;  2P71 A;  1UWO A;  1NX0 A;  1XFW O;  3PAT A;  2M3W A;  2KAV A;  1OW4 A;  5ER5 A;  3PSR A;  4NDD A;  2HQW A;  3V2L A;  2WND A;  1OOG A;  1REC A;  3NHT A;  1QAT A;  1M63 B;  4IL1 A;  5I2O A;  4I5J A;  1A2X A;  3I5G B;  2M7L A;  1K93 D;  1AJ4 A;  1MWN A;  2LMT A;  2LUX A;  1X02 A;  1PVA A;  1H4B A;  1LA3 A;  3SG2 A;  2KAY A;  2E30 A;  1PAL A;  1RTP 1;  3EVR A;  3DF0 A;  1GGZ A;  2PQL A;  2LVI A;  1MHO A;  4P5O E;  4CID A;  3EG5 B;  1V1G A;  1QV1 A;  4HRE E;  2CBL A;  1S5G Y;  2Q4U A;  3NSI A;  3HX4 A;  2JNX A;  2BAP A;  3SG3 A;  3R1O A;  3IF7 A;  1XK4 A;  3UO9 A;  2LUC A;  3PM8 A;  1WRK A;  4BY4 A;  4L9M A;  3R1V A;  1UUS A;  4GGF A;  1VRK A;  1ODB A;  3DD4 A;  5CSF A;  1EJ3 A;  1S6J A;  1ZUZ A;  5CSN A;  4XJK A;  1RRO A;  3SG6 A;  1BF5 A;  1AP4 A;  1S5G Z;  1DJH A;  1N65 A;  1XK4 C;  2LNK A;  1J1D A;  3CLN A;  5PAL A;  3DF0 B;  4ETO A;  1Y0V H;  3TUY C;  1K96 A;  1TUZ A;  4YGE B;  3S0G A;  1LS8 A;  5AXI A;  3SS4 A;  3VGO A;  4JWQ A;  2QDI A;  1EG4 A;  1OQP A;  1DEL A;  3BFA A;  3CZ0 A;  5IBW A;  1M46 A;  2K8M B;  3CR5 X;  2WC6 A;  4ORA B;  1U5I A;  2KI6 C;  3OGN A;  1OSA A;  1TN4 A;  3QME A;  4PAL A;  3DVE A;  5D3O A;  3N7H A;  3TDZ A;  4I5K A;  2JWW A;  4DIR A;  1TNP A;  1J1E A;  2LHL A;  2QPT A;  3AKB A;  2AUC A;  3FWC A;  3TUY B;  1FI5 A;  1Y1X A;  1YTZ C;  2L2E A;  2PMY A;  1NWD A;  1RWY A;  4XJK B;  1V1F A;  3NSO A;  1SK6 D;  4C0L A;  3SS5 A;  1YUU A;  4DS7 A;  4MZL A;  1IKU A;  2JT0 A;  1UHN A;  3S0D A;  1LIN A;  4F7F A;  5B8I B;  2COL B;  3GK2 A;  5FI6 A;  3NSK A;  1IWQ A;  4PHJ A;  4C0J A;  1FBV A;  1M31 A;  2OS8 B;  3BUX B;  4YRU A;  2K7D A;  5EL2 A;  5FYX A;  1U5I B;  2JPT A;  3E3R A;  2KFH A;  3TZ1 A;  1FPW A;  2Y1M A;  1CM4 A;  3SG4 A;  3B88 A;  3K21 A;  1BR1 B;  2ERB A;  4UPG A;  5I94 A;  2FCD A;  1WLM A;  1SL7 A;  2KPH A;  2NZ0 A;  2M9G A;  4JD9 A;  1WRZ A;  4MRY A;  1UP5 A;  2ZND A;  1Y1U A;  1C7W A;  1YX8 A;  2ZN8 A;  1NUB A;  1K9U A;  1OMD A;  3D78 A;  5KU1 A;  2H61 A;  1B9A A;  3BYA A;  3BOW A;  1TIZ A;  2PRU A;  2QAC A;  3KPX A;  1OMR A;  4MSP A;  1XFZ O;  3Q8I A;  3RZS A;  1SW8 A;  2KSP A;  4DRW A;  5D69 A;  5HKY A;  3VRP A;  3DYE A;  1S6I A;  4QJ3 B;  1F4O A;  2LM5 A;  2O5G A;  2H61 C;  3VRN A;  1M39 A;  1C3Y A;  3L4L A;  2JOJ A;  2M8U A;  3ZWH A;  1DEK A;  4HRG A;  2CCM A;  4ZCU A;  2JZI A;  1XO5 A;  2VRG A;  4Q04 A;  1KWO C;  1SPY A;  4QJ5 B;  1KFX S;  2L51 A;  4ORB B;  3D75 A;  3R1P A;  1YUS A;  4CFQ A;  3H4S E;  3FE9 A;  1TUJ A;  3O6B A;  1DC1 A;  2JNF A;  2PAS A;  2F8P A;  5HLO A;  1CFP A;  2NLN A;  2I7A A;  2JUL A;  4N1F A;  3BOW B;  1RK9 A;  2LP2 A;  3VRO A;  2FJU B;  2LCP A;  2G9B A;  1KQM B;  1L2O B;  3UNW A;  1K9K A;  1OMV A;  2FCE A;  1S26 D;  1F71 A;  2BCX A;  4NQG A;  2MLE C;  3B7A A;  3I5F B;  3I5G C;  1H8B A;  2KOT A;  4DUQ A;  2F3Z A;  2V53 A;  4YBH B;  1G33 A;  1NYA A;  3CR4 X;  4OKH A;  4KYN A;  4NDC A;  1XFR A;  4HRH A;  5DKQ A;  2K60 A;  1SR6 C;  4WQ3 A;  2LLS A;  4CPV A;  1KFX L;  2EC6 C;  1TCO B;  5TNC A;  1SL8 A;  3LK1 A;  4N5X A;  3R72 A;  3FIA A;  4PHM A;  3DZT A;  4PHK A;  1J7R A;  1EG3 A;  3LLE A;  3CDN A;  1SKT A;  1YVH A;  4OZD A;  1S3P A;  1K8U A;  1XFX O;  3EK8 A;  1W9Z A;  2BL0 C;  1QJT A;  2KYF A;  2LAN A;  3PAL A;  2CT9 A;  1SR6 B;  2M29 A;  3JTD C;  2L4H A;  5HYD A;  1SSE B;  2EC6 B;  4IJ7 A;  1SMG A;  1UUR A; 
#chains in the Genus database with same CATH homology
 3VRR A;  1QVI Z;  3WHU B;  3O2P A;  2O60 A;  3A8R A;  2I18 A;  3GK1 A;  3LK0 A;  1ALW A;  3D0Y A;  2LVJ A;  3IQQ A;  1C07 A;  4GFT A;  1DJW A;  1L7Z A;  1NX3 A;  3BUN B;  2PAL A;  5K89 A;  1CM1 A;  4MEW A;  2BL0 B;  1IQ5 A;  1FW4 A;  2WCB A;  3JTD B;  4GPL B;  5AAN A;  2BBN A;  1F70 A;  3DVK A;  1PSR A;  2ZNE A;  4ORC B;  1B8R A;  1CMF A;  1NPQ A;  2I2R E;  1CDL A;  4MN0 A;  1C7V A;  5HKZ A;  2LC5 A;  2LP3 A;  2SCP A;  2KBM A;  4YGB B;  1NCY A;  4QJ4 B;  1JBA A;  2FOT A;  1R6P A;  4XYN A;  5JOL A;  2H2K A;  1YUR A;  1G8I A;  4WQ2 A;  4F0Z B;  2LVV A;  3D0Y B;  1FI6 A;  2TN4 A;  2MRD A;  1J7P A;  1QXP A;  2D8N A;  3OHM B;  1ZOT B;  2GV5 A;  1ALV A;  3O4Y A;  5F6T A;  2A4J A;  3MSE B;  2OS8 C;  1UHK A;  2F3Y A;  4ZCV A;  1GQM A;  1KCY A;  1RJV A;  2CXJ A;  2HQ8 A;  2JC2 A;  2LLT A;  3A4U B;  1JC2 A;  1WDC C;  3WNX B;  1B7T Y;  1DJY A;  1K9P A;  1AJ5 A;  1N2D A;  1OZO A;  3KHE A;  1F54 A;  2KGB C;  4MZJ A;  3WXA A;  2KI4 B;  1A4P A;  1QX2 A;  3CGA A;  4CFR A;  3EVU A;  5GQQ C;  1K2H A;  1EL4 A;  2KI6 D;  2L4I A;  2WCE A;  2K7C A;  3DVJ A;  2M49 B;  1MXL C;  1DTL A;  2DOQ A;  4M2O A;  2NCO A;  1WDC B;  1WRL A;  4YGC B;  4YGA A;  1BU3 A;  2KNE A;  1IGV A;  1Q80 A;  2JU0 A;  1B7T Z;  2Y5I A;  4AQI A;  3TS5 C;  4OV2 A;  3AAJ A;  1CFF A;  1FF1 A;  1KFU L;  2ZN9 A;  2L5X B;  4D1E A;  1K95 A;  5D7F A;  1MXE A;  1OZS A;  2BEC A;  5I2L A;  2R2I A;  4M2Q A;  2LVK A;  2PVB A;  4E68 A;  4PE4 A;  1JUO A;  1SY9 A;  2LAP A;  1CB1 A;  2BBM A;  4C0K A;  2LMU A;  2OTG C;  1F4Q A;  1OOJ A;  1JWD A;  3TS5 B;  1LVC D;  3D10 A;  1S36 A;  2CNP A;  1JFK A;  4MRX A;  1A75 A;  1KSO A;  1HT9 A;  3SJS A;  2LHI A;  1XFU O;  2M1U A;  2WOR A;  2L98 A;  1KQM C;  1N0Y A;  2G2B A;  3ICB A;  1L2O C;  4I5N B;  4JQ0 D;  1CDM A;  5I2Q A;  3SG7 A;  4JPZ B;  5JJG A;  1EH2 A;  3VRQ A;  2JT8 A;  2OTG B;  1G4Y R;  4PHN A;  3EVV A;  1TNX A;  1K90 D;  3SIA A;  1CTR A;  1MF8 B;  2F2P A;  3I5F C;  1DVI A;  2ZFD A;  5I8N A;  1CKK A;  2P6B B;  1KK7 Y;  1WY9 A;  3LCP C;  3CR2 A;  1F55 A;  2NXQ A;  1UHH A;  3OB1 B;  3CZT X;  1DJG A;  1TNQ A;  2JRF A;  1HQV A;  1B8C A;  2KGR A;  1NSH A;  1A75 B;  1MUX A;  1DJX A;  1ZFS A;  4R1E A;  4USL A;  1XFY O;  1KK7 Z;  4YI8 A;  4YGD B;  4AQJ A;  5HLV A;  3PFV A;  2JT3 A;  5CSJ A;  1QVI Y;  1ZAC A;  2JTZ A;  5KTY A;  2B1U A;  5CSI A;  3F45 A;  1JSA A;  1SRA A;  1M45 A;  1PSB A;  2K7O A;  1Y6W A;  1B1G A;  3EKH A;  4DCK A;  3CS1 A;  1AVS A;  2CTN A;  1B47 A;  3GOF A;  1J7O A;  1TTX A;  1DF0 A;  3CTN A;  2GGZ A;  2JQ6 A;  1NCX A;  5G08 A;  4YI9 A;  1NX2 A;  2HPS A;  2Y4Q A;  1CDN A;  3BUW B;  1LKJ A;  5AEQ A;  1IH0 A;  2E6W A;  4OVN F;  2BCB A;  1S1E A;  1SCV A;  1BT6 A;  1W7J B;  2ZKM X;  4OR9 B;  1BLQ A;  2K0J A;  1NIW A;  1LA0 A;  1WLZ A;  4A4C A;  1DGV A;  4N1G A;  2WC8 A;  2BKI B;  1IJ5 A;  2KQ6 A;  2HET A;  2ZRS A;  2HF5 A;  2GGM A;  1DMO A;  4MVF A;  3TDU A;  3SIB A;  1K94 A;  2EHB A;  1JFJ A;  3CWG A;  1YUT A;  4GGN A;  2MA2 A;  2F33 A;  2L0P A;  3BUO B;  1UHI A;  2AMI A;  4U8D A;  2K61 A;  3QRX A;  3KEV A;  1DF0 B;  3BXK A;  1KSM A;  3FS7 A;  1CLB A;  5KSZ A;  2KQY A;  5BPJ A;  4I5L B;  3FWB A;  3OX5 A;  1QIW A;  2F2O A;  4FQO A;  2KAX A;  1AUI B;  3NXA A;  3KF9 A;  4MZK A;  4PE1 A;  1SBJ A;  2L50 A;  1J7Q A;  2KI4 C;  3OB2 B;  5HKW A;  4BY5 A;  5AER A;  3ZNI A;  1BG1 A;  1BJF A;  4NDB A;  2RGI A;  1IQ3 A;  1CMG A;  4GUK A;  1KFU S;  4GNK B;  2MAZ A;  1BMO A;  3OX6 A;  3IQO A;  3O78 A;  1IRJ A;  4GGF C;  1CFC A;  1PRW A;  2LV7 A;  4A4B A;  1A29 A;  1NX1 A;  2ZRT A;  2BCA A;  1YRU B;  1BOC A;  2IS9 A;  1DJZ A;  2KBI A;  2M1K B;  2MLF C;  3BQ3 A;  3I5I C;  1GJY A;  1PVB A;  1D1O A;  3SG5 A;  2KFF A;  2BKH B;  4M2P A;  4OCI A;  1W7I B;  5DKR A;  4GBA A;  3LL8 B;  3RM1 A;  1DGU A;  1QX5 B;  2M97 A;  1B4C A;  4GAO A;  1BR4 B;  3M0W A;  1QV0 A;  1A03 A;  1NCZ A;  1SNL A;  1GGW A;  3RLZ A;  1CNP A;  1XVJ A;  3KO0 A;  3PN7 C;  1TRF A;  3JVT C;  2Q91 A;  1QAS A;  3I5I B;  1B8L A;  1XA5 A;  1DJI A;  1QX7 A;  1IJ6 A;  5ER4 X;  4AOM A;  1AHR A;  2K7B A;  1UHJ A;  1YRT B;  3C1V A;  1TCF A;  2JXL A;  1E8A A;  1YX7 A;  3WHT B;  1JF0 A;  2MJW B;  1ZMZ A;  1LXF C;  3PN7 B;  3JVT B;  1S6C A;  1QLS A;  3PLF B;  1Y1A A;  1QS7 A;  2KDH A;  3TDI A;  4HSZ A;  1PUL A;  1RFJ A;  1SL9 A;  2I94 A;  1SYM A;  2JXC A;  1QIV A;  2EGD A;  3EK4 A;  4MBE A;  1KK8 C;  3AAK A;  2KFG A;  3GK4 X;  2JTT A;  2KYC A;  3HCM A;  2AAO A;  1OE9 B;  2PSR A;  1KQV A;  4ICB A;  1AK8 A;  1F8H A;  1QLK A;  3EKJ A;  1YVL A;  1CLM A;  1QTX A;  2K2F A;  2M7N A;  2NCP A;  2SAS A;  1CLL A;  2Y1N A;  4P2Y B;  4PCW A;  2LLU A;  1PK0 D;  3I5H C;  4TNC A;  2MBX A;  2BE4 A;  3AKA A;  1DT7 B;  1KK8 B;  2KHN A;  5J3X A;  4FTG A;  1MR8 A;  3NSL A;  1SCM C;  3OP0 A;  1JF2 A;  2BE6 A;  4CLN A;  4PE7 A;  1EXR A;  1TNW A;  4PDZ A;  1IG5 A;  1XYD A;  3EK7 A;  1TOP A;  2LE9 B;  1R2U A;  2LMV A;  4WRI A;  3I5H B;  5AFP A;  2MHH A;  2WOS A;  1J55 A;  1XFV O;  1YR5 A;  3DVM A;  4MLW A;  2WCF A;  1KWO B;  4PE0 A;  1BOD A;  1SCM B;  1NP8 A;  3BUM B;  2K2A A;  5CPV A;  1CFD A;  2OPO A;  1CDP A;  5DKN A;  1MQ1 A;  2M0R A;  1UWO A;  1NX0 A;  1XFW O;  3PAT A;  2M3W A;  2KAV A;  5ER5 A;  3PSR A;  4NDD A;  2HQW A;  2WND A;  1REC A;  4IL1 A;  1QAT A;  1M63 B;  5I2O A;  4I5J A;  1A2X A;  3I5G B;  2M7L A;  1K93 D;  1AJ4 A;  1MWN A;  2LMT A;  2LUX A;  1X02 A;  1PVA A;  1H4B A;  1LA3 A;  3SG2 A;  2KAY A;  2E30 A;  1PAL A;  1RTP 1;  3EVR A;  3DF0 A;  1GGZ A;  2LVI A;  1MHO A;  4P5O E;  4CID A;  1V1G A;  1QV1 A;  4HRE E;  2CBL A;  1S5G Y;  2Q4U A;  3NSI A;  3HX4 A;  2JNX A;  3SG3 A;  3IF7 A;  1XK4 A;  2LUC A;  3PM8 A;  1WRK A;  4BY4 A;  4L9M A;  1UUS A;  4GGF A;  1VRK A;  1ODB A;  3DD4 A;  5CSF A;  1EJ3 A;  1S6J A;  1ZUZ A;  5CSN A;  4XJK A;  1RRO A;  3SG6 A;  1BF5 A;  1AP4 A;  1S5G Z;  1DJH A;  1N65 A;  1XK4 C;  2LNK A;  1J1D A;  3CLN A;  5PAL A;  3DF0 B;  4ETO A;  1Y0V H;  3TUY C;  1K96 A;  4YGE B;  3VGO A;  5AXI A;  4JWQ A;  1EG4 A;  1OQP A;  5IBW A;  1M46 A;  2K8M B;  3CR5 X;  4ORA B;  2ISD A;  1U5I A;  2KI6 C;  4PAL A;  1OSA A;  1TN4 A;  3DVE A;  3TDZ A;  4I5K A;  2JWW A;  4DIR A;  1TNP A;  1J1E A;  2LHL A;  2QPT A;  3AKB A;  2AUC A;  3FWC A;  3TUY B;  1FI5 A;  1Y1X A;  1YTZ C;  2L2E A;  2PMY A;  1NWD A;  1RWY A;  4XJK B;  1V1F A;  3NSO A;  1SK6 D;  4C0L A;  1YUU A;  4DS7 A;  4MZL A;  1IKU A;  2JT0 A;  1UHN A;  1LIN A;  5B8I B;  2COL B;  3GK2 A;  3NSK A;  1IWQ A;  4PHJ A;  4C0J A;  1FBV A;  1M31 A;  2OS8 B;  3BUX B;  4YRU A;  2K7D A;  5FYX A;  1U5I B;  2JPT A;  3E3R A;  2KFH A;  3TZ1 A;  1FPW A;  2Y1M A;  1CM4 A;  3SG4 A;  3K21 A;  1BR1 B;  4UPG A;  2FCD A;  1WLM A;  1SL7 A;  2NZ0 A;  2M9G A;  1WRZ A;  4MRY A;  1UP5 A;  2ZND A;  1Y1U A;  1C7W A;  1YX8 A;  2ZN8 A;  1NUB A;  1K9U A;  1OMD A;  5KU1 A;  2H61 A;  1B9A A;  3BYA A;  3BOW A;  1TIZ A;  2PRU A;  2QAC A;  3KPX A;  1OMR A;  4MSP A;  1XFZ O;  1SW8 A;  2KSP A;  4DRW A;  5D69 A;  5HKY A;  3VRP A;  1S6I A;  4QJ3 B;  1F4O A;  2LM5 A;  2O5G A;  2H61 C;  3VRN A;  1M39 A;  2JOJ A;  2M8U A;  3ZWH A;  4ZCU A;  4HRG A;  2CCM A;  2JZI A;  1XO5 A;  2VRG A;  4Q04 A;  1KWO C;  1SPY A;  4QJ5 B;  1KFX S;  2L51 A;  4ORB B;  1YUS A;  4CFQ A;  3H4S E;  3O6B A;  2JNF A;  2PAS A;  2F8P A;  5HLO A;  1CFP A;  2NLN A;  2I7A A;  2JUL A;  4N1F A;  3BOW B;  1RK9 A;  2LP2 A;  3VRO A;  2FJU B;  2LCP A;  2G9B A;  1KQM B;  1L2O B;  1K9K A;  1OMV A;  2FCE A;  1S26 D;  1F71 A;  2BCX A;  4NQG A;  2MLE C;  3I5F B;  3I5G C;  1H8B A;  2KOT A;  4DUQ A;  2F3Z A;  2V53 A;  4YBH B;  1G33 A;  1NYA A;  3CR4 X;  4OKH A;  4NDC A;  4HRH A;  5DKQ A;  1SR6 C;  4WQ3 A;  2LLS A;  4CPV A;  1KFX L;  2EC6 C;  1TCO B;  5TNC A;  1SL8 A;  3LK1 A;  4N5X A;  3FIA A;  4PHM A;  4PHK A;  1J7R A;  1EG3 A;  3LLE A;  1SKT A;  1YVH A;  1S3P A;  1K8U A;  1XFX O;  3EK8 A;  2BL0 C;  1QJT A;  2KYF A;  2LAN A;  3PAL A;  2CT9 A;  1SR6 B;  2M29 A;  3JTD C;  2L4H A;  5HYD A;  2EC6 B;  1SMG A;  1UUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...