1CMFA

Nmr solution structure of apo calmodulin carboxy-terminal domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
MKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALMODULIN (VERTEBRATE)
publication title Calcium-induced structural changes and domain autonomy in calmodulin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1995-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cmfA00
1UP5A 1MWNA 1TN4A 1NCZA 2CNPA 5HLOA 2PSRA 1BR1B 2BE4A 3FS7A 4HSZA 5JOLA 2WOSA 1PVAA 1SCVA 3OB2B 2ZKMX 4ICBA 3CS1A 3LK1A 1YR5A 1S6JA 4PDZA 1EG4A 5HLVA 1CLMA 4WRIA 1CB1A 1H4BA 2BL0C 3SG6A 1YUSA 2KAVA 1G4YR 3C1VA 1IWQA 4ORCB 1S5GZ 3LLEA 1SK6D 3QRXA 2JPTA 2LVVA 1TTXA 1J7PA 2BKHB 3O4YA 2KGBC 3VRQA 3DD4A 5J3XA 1KK8B 2HQ8A 1CDPA 2OTGC 3GK4X 2MBXA 1IG5A 1K90D 1OZSA 3BUOB 1IQ5A 2JULA 3D0YA 1HQVA 3BOWA 1SCMC 3I5HB 5PALA 3WXAA 1QIVA 2NZ0A 3EVUA 1DVIA 2LUCA 2KHNA 3ICBA 3ZWHA 1AP4A 1A2XA 1KFXS 1B7TZ 1A75B 5D69A 2TN4A 2AUCA 4BY4A 2Y5IA 2K0JA 1CDLA 2K7OA 4FTGA 3EKJA 2LLTA 2K7CA 3NXAA 2KI4C 2P6BB 2LV7A 1WDCB 5I2LA 1SPYA 3I5IC 1EL4A 1Y6WA 3TZ1A 2MA2A 3LCPC 1A03A 2LVKA 2L5XB 2V53A 1FPWA 4U8DA 1DJYA 1N2DA 2LVJA 1YX8A 4ZCUA 1FI6A 2GGZA 2WCFA 3I5FC 1LA3A 1SRAA 3SIAA 3DF0B 2K61A 3BYAA 1KCYA 1XYDA 1QJTA 2F33A 4M2PA 4I5LB 5AERA 4YI9A 1BF5A 1C07A 2VRGA 4I5KA 4HRGA 1KQMC 2JU0A 1ZMZA 3F45A 2EC6B 5B8IB 5CSFA 5JJGA 1YVLA 1M39A 5ER4X 1MQ1A 2HF5A 3GOFA 1CFPA 3DVJA 1J1EA 4PHKA 1DJWA 1MXLC 1DT7B 4ORAB 2I7AA 5AFPA 1NYAA 4PHMA 3KHEA 3PN7B 1S3PA 1WRKA 4P5OE 1BMOA 1NX0A 1Y1UA 2M49B 1J7OA 1K94A 1X02A 3BUXB 1YVHA 1IGVA 4MN0A 1OMVA 2KQYA 1MR8A 1IKUA 2BCAA 4MRYA 1ZACA 4PHNA 1PALA 2M9GA 3CWGA 4JQ0D 1OQPA 2O60A 3TDIA 1FI5A 2M1UA 1UHNA 2CT9A 2JQ6A 4N5XA 1QS7A 3JVTB 1SL8A 1UUSA 1GJYA 2G2BA 4I5NB 1SY9A 3NSLA 1IRJA 1G8IA 2SASA 1RROA 3CR4X 4C0JA 1KK7Y 2LMTA 1CNPA 1Y1AA 1QLSA 3DVKA 5KTYA 3BXKA 1HT9A 4YBHB 1WY9A 1ZUZA 1YUUA 1M31A 2NCPA 3NSKA 1FW4A 4JWQA 1CM4A 1S6IA 2F3ZA 3LK0A 3PALA 1AVSA 1M63B 1JBAA 4PE7A 2M97A 1DJZA 3TDZA 3O2PA 4UPGA 2JT0A 2ZN8A 1B7TY 4PE1A 2M29A 1XVJA 2F8PA 1IH0A 1A4PA 1WRZA 3K21A 2M3WA 1YUTA 2ZRSA 2F2PA 1UWOA 3PATA 3VGOA 1R2UA 1K96A 1TNPA 3SG5A 1IJ6A 2SCPA 3AKAA 1DJIA 1L2OC 5AANA 1DGVA 2JXCA 1JUOA 4GNKB 1YRTB 1B8CA 2K8MB 2WC8A 3DVEA 1NP8A 3I5GB 4M2OA 5F6TA 4A4CA 2AMIA 3TS5B 1NSHA 3OX6A 1JF2A 1XFYO 3PM8A 1J1DA 4N1GA 2OPOA 1IJ5A 2K7BA 1KFUS 2LM5A 2AAOA 5BPJA 2MJWB 2JNXA 3NSIA 2KFFA 1M45A 2MLEC 3HCMA 2O5GA 3TUYC 2E30A 1K2HA 1DTLA 1SR6C 5DKNA 1RFJA 4CFQA 2JT8A 1KK7Z 1MF8B 4BY5A 2LVIA 1CDMA 1UHIA 4DS7A 1ODBA 2LCPA 5HKWA 4M2QA 1SMGA 4GGFC 2M7NA 4YGBB 1DF0A 2E6WA 1OMDA 2WCBA 2BKIB 3VRPA 2KGRA 1H8BA 5IBWA 3MSEB 4YGEB 3BUWB 2K2AA 5I2QA 1TNXA 2L4IA 3CR5X 3CZTX 4CLNA 1J55A 1YX7A 2GV5A 2NCOA 2H2KA 2JTTA 1XK4C 3VRNA 1B8RA 1CLBA 1OSAA 3DF0A 1KSMA 2PMYA 5AEQA 1K9PA 1A29A 1V1GA 1EXRA 2GGMA 3FWBA 3JTDB 4MEWA 2JZIA 4MZLA 2KOTA 4MRXA 5GQQC 3PFVA 3TS5C 1PSRA 1S26D 4XJKA 1LKJA 4NDCA 4NQGA 4XYNA 1SL7A 1LINA 2Q91A 1CFFA 1ZFSA 2L50A 2KYCA 1TNQA 1QV1A 2PASA 2EHBA 4USLA 2B1UA 1FBVA 1R6PA 1KK8C 1S6CA 1U5IB 1RJVA 3D0YB 3WNXB 3OX5A 2Y4QA 1NWDA 1RK9A 1NCXA 5FYXA 2L51A 4OR9B 3VROA 1WLMA 5I8NA 3DVMA 1W7IB 1RWYA 2WORA 1UHHA 5AXIA 1PULA 1K9KA 1SNLA 1JFJA 1LA0A 4QJ3B 2KNEA 3I5HC 5G08A 4E68A 1NX3A 3OB1B 2PRUA 2IS9A 3EK8A 3OHMB 4N1FA 2CCMA 1AHRA 2M7LA 3SG4A 4OKHA 2ZFDA 1E8AA 3IQOA 1GGZA 1DJGA 1MHOA 5DKRA 2KFGA 3AAJA 1CTRA 1OE9B 1BLQA 4YGDB 4FQOA 1F4QA 2FCDA 2JT3A 1DGUA 2FOTA 2NXQA 3LL8B 1BJFA 1LVCD 1QASA 1RECA 1WDCC 3JTDC 1L7ZA 1QTXA 2M8UA 4YI8A 3EVVA 4F0ZB 1WLZA 2R2IA 4GGFA 4GBAA 1EJ3A 2I2RE 1M46A 1QX2A 2LHLA 1BG1A 2ZRTA 1TRFA 2F2OA 3A4UB 4GAOA 2K7DA 3FIAA 1QX7A 1KWOB 2PVBA 1AJ5A 4PCWA 1EH2A 1LXFC 4C0LA 1QXPA 1GGWA 5K89A 3SIBA 3TDUA 2QACA 1QX5B 4QJ5B 1YTZC 3KEVA 4ETOA 1XK4A 1UHJA 2BBMA 2BL0B 1IQ3A 2I94A 2ZNEA 1RTP1 2LLUA 5I2OA 3RM1A 4NDBA 3OP0A 2NLNA 3CR2A 4ORBB 2COLB 2EC6C 1S1EA 2DOQA 1JFKA 4GPLB 2H61C 2KAYA 1MXEA 1SKTA 2JNFA 2L4HA 5ER5A 2A4JA 2KBMA 2MLFC 2I18A 3SJSA 3FWCA 2L98A 5TNCA 3O6BA 4WQ2A 3PN7C 1TIZA 4DRWA 1PVBA 1B8LA 1CMFA 1ALVA 1FF1A 1JC2A 1SCMB 2BE6A 4GUKA 1DJXA 2CTNA 3EVRA 1DMOA 4CIDA 2QPTA 2WCEA 2HETA 1QVIY 4JPZB 2Y1MA 3WHTB 1QLKA 4DIRA 2LAPA 1XFXO 1UURA 4YGAA 3IQQA 4R1EA 2JTZA 3CLNA 3JVTC 4QJ4B 3E3RA 1A75A 1KWOC 1XA5A 1EG3A 4HREE 3RLZA 2KYFA 2L2EA 2BBNA 1DJHA 2JC2A 2F3YA 3BUNB 1F4OA 2LP3A 4I5JA 1F55A 2KI4B 2LLSA 1S36A 1OOJA 5HYDA 1D1OA 3ZNIA 3I5IB 1NUBA 4TNCA 3SG7A 2LC5A 2LUXA 5CSIA 1AK8A 1K95A 4OV2A 1TCOB 1J7QA 3CTNA 3BUMB 5HKYA 1ZOTB 1NX1A 3I5FB 3IF7A 1N0YA 1AJ4A 2KI6C 3EK4A 3HX4A 2LE9B 2LANA 4AOMA 1B1GA 1U5IA 4C0KA 1SW8A 2ISDA 3CGAA 1TCFA 3AKBA 4AQJA 2WNDA 1KQMB 2CXJA 4HRHA 2JOJA 3A8RA 3I5GC 4MZJA 1N65A 1WRLA 2LP2A 1QV0A 2Q4UA 4MVFA 1QVIZ 3KO0A 1B47A 1B9AA 2H61A 3PSRA 4DUQA 2L0PA 1NIWA 2JWWA 1CM1A 1CFCA 1BT6A 3PLFB 1Y1XA 3BOWB 2LHIA 1SBJA 1XO5A 1G33A 1CDNA 2KQ6A 4PE0A 1J7RA 4MZKA 4PE4A 1F71A 1DF0B 4OVNF 1PSBA 4MLWA 1BU3A 1VRKA 2OS8B 1C7WA 1Q80A 4MBEA 3VRRA 4D1EA 4YRUA 1KFUL 3WHUB 2Y1NA 1K8UA 1QATA 2MHHA 3GK1A 1W7JB 4MSPA 1XFZO 2KFHA 1JSAA 1CKKA 4WQ3A 1BOCA 1QIWA 4IL1A 4OCIA 2BECA 2HPSA 1CFDA 3SG2A 2BCXA 5CPVA 5CSNA 2D8NA 2FCEA 4GGNA 5KSZA 2KDHA 2KAXA 1KQVA 4XJKB 2JRFA 1JWDA 1BODA 2KBIA 2K2FA 3GK2A 2M0RA 4PALA 4AQIA 1XFWO 1TOPA 5KU1A 1F8HA 4DCKA 1KFXL 2LMUA 3NSOA 3EK7A 2FJUB 4GFTA 4PHJA 1SL9A 1YRUB 1CLLA 1L2OB 3AAKA 1K9UA 2KSPA 4Q04A 3D10A 1XFUO 4NDDA 1NPQA 1MUXA 2LNKA 1S5GY 4YGCB 4CPVA 4L9MA 1C7VA 1GQMA 1AUIB 3KF9A 1UHKA 3SG3A 2CBLA 2LMVA 1ALWA 4ZCVA 1K93D 2RGIA 3BQ3A 4P2YB 1V1FA 2OS8C 1YURA 1CMGA 3M0WA 1F54A 5HKZA 4A4BA 1XFVO 2EGDA 2MAZA 2KI6D 1TNWA 1Y0VH 2OTGB 3KPXA 3TUYB 1NX2A 3H4SE 1PK0D 2BCBA 1JF0A 1SR6B 1SYMA 1OMRA 5D7FA 1PRWA 1BR4B 1OZOA 1B4CA 3EKHA 2MRDA 2G9BA 2ZNDA 2ZN9A 1F70A 3O78A 2PALA 4CFRA 2HQWA 2M1KB 5CSJA 5DKQA 2JXLA 1NCYA 1KSOA
chains in the Genus database with same CATH superfamily
1UP5A 1MWNA 1TN4A 1NCZA 2CNPA 2ERBA 2PSRA 5HLOA 1BR1B 2BE4A 3FS7A 1TUZA 4HSZA 5JOLA 2WOSA 1PVAA 1SCVA 3OB2B 2ZKMX 4KYNA 4ICBA 3CS1A 3D76A 3LK1A 1YR5A 1C3YA 1S6JA 4PDZA 1EG4A 5HLVA 2PQLA 1CLMA 4WRIA 1CB1A 1H4BA 5HL1A 2BL0C 3SG6A 1YUSA 2KAVA 1G4YR 3C1VA 1IWQA 4ORCB 1S5GZ 3LLEA 1SK6D 3OBVA 3QRXA 2JPTA 2LVVA 1TTXA 1J7PA 2BKHB 3O4YA 2KGBC 3VRQA 3DD4A 3S0AA 5J3XA 1KK8B 2HQ8A 1CDPA 2OTGC 3GK4X 2MBXA 1IG5A 1K90D 1OZSA 2WC6A 1IQ5A 3BUOB 2JULA 3D0YA 1HQVA 3BOWA 1SCMC 3I5HB 5PALA 3BFHA 3WXAA 1QIVA 2NZ0A 3EVUA 1DVIA 2LUCA 2KHNA 3CDNA 3ICBA 3ZWHA 3OGNA 1AP4A 1A2XA 2WCKA 1KFXS 1B7TZ 1A75B 5D69A 2TN4A 2AUCA 4BY4A 2Y5IA 3B7AA 3B86A 2K0JA 1CDLA 3N7HA 2K7OA 4FTGA 3EKJA 3NGVA 2LLTA 2K7CA 3B6XA 3NXAA 2KI4C 2P6BB 2LV7A 1WDCB 5I2LA 1SPYA 3I5IC 1EL4A 1Y6WA 3BFBA 5D3OA 3TZ1A 2MA2A 3LCPC 1A03A 2LVKA 2L5XB 2V53A 4PT1A 1FPWA 2GTEA 4U8DA 1DJYA 2KLEA 1N2DA 2LVJA 1YX8A 4ZCUA 3SS4A 2GGZA 1FI6A 2WCFA 2L5YA 3K1EA 3I5FC 1LA3A 1SRAA 3SIAA 3DF0B 3CYZA 2K61A 3BYAA 1KCYA 1XYDA 1QJTA 2F33A 4M2PA 4I5LB 5AERA 1DQEA 2FJYA 4YI9A 1BF5A 1C07A 2VRGA 3L47A 4I5KA 1SSEB 4HRGA 1KQMC 2JU0A 1ZMZA 3F45A 2EC6B 3IVTA 3EG5B 5B8IB 5CSFA 5JJGA 1YVLA 1M39A 5ER4X 1MQ1A 2HF5A 3D77A 3GOFA 1CFPA 3DVJA 1J1EA 4PHKA 1DJWA 1MXLC 1DT7B 4ORAB 2I7AA 5AFPA 1NYAA 4PHMA 3KHEA 2BNXA 1S3PA 3PN7B 1WRKA 4P5OE 1BMOA 1NX0A 1Y1UA 2M49B 1J7OA 1K94A 1X02A 3BUXB 1YVHA 1IGVA 3CZ2A 4MN0A 1OMVA 4CFQA 2KQYA 1MR8A 3DXLA 1IKUA 2BCAA 4MRYA 1ZACA 4PHNA 1PALA 2M9GA 3CWGA 4JQ0D 1OQPA 2O60A 3R1OA 3TDIA 1FI5A 2M1UA 1UHNA 2CT9A 2JQ6A 4N5XA 1QS7A 3JVTB 1SL8A 1UUSA 1GJYA 2G2BA 4I5NB 1SY9A 3NSLA 1G8IA 1IRJA 2SASA 1RROA 3CR4X 4C0JA 1KK7Y 2LMTA 3V2LA 1CNPA 1Y1AA 3UNWA 1QLSA 3DVKA 5KTYA 3B88A 3BXKA 1HT9A 4YBHB 1WY9A 1ZUZA 1YUUA 1M31A 2NCPA 3NSKA 1FW4A 4JWQA 1CM4A 1S6IA 5EL2A 2F3ZA 3LK0A 3PALA 1AVSA 1M63B 1JBAA 4PE7A 5FI2A 2M97A 1DJZA 3TDZA 3O2PA 4UPGA 2JT0A 2ZN8A 1B7TY 4PE1A 2M29A 1XVJA 2F8PA 4F7FA 1IH0A 1A4PA 1WRZA 3K21A 2M3WA 1YUTA 2ZRSA 2F2PA 4FQTA 1UWOA 3PATA 5FI7A 3VGOA 1R2UA 1K96A 1TNPA 2H8VA 3SG5A 1IJ6A 2SCPA 3AKAA 1DJIA 1L2OC 5AANA 1DGVA 2JXCA 1JUOA 3CABA 4GNKB 3S0GA 1YRTB 1B8CA 2K8MB 2WC8A 3DVEA 1NP8A 3I5GB 4M2OA 5F6TA 3FE6A 4A4CA 2AMIA 2KLDA 3TS5B 1NSHA 3OX6A 1JF2A 1XFYO 3PM8A 3CZ0A 1J1DA 4N1GA 2OPOA 3R1VA 1IJ5A 2K7BA 1KFUS 2LM5A 3R72A 2PYQA 2AAOA 5BPJA 2MJWB 2JNXA 3NSIA 2KFFA 1M45A 1DEKA 2MLEC 2O5GA 3HCMA 2E30A 3TUYC 1K2HA 2WCMA 1DTLA 1SR6C 2KPHA 1RFJA 3PM2A 2JT8A 5DKNA 1KK7Z 1MF8B 3FE9A 4BY5A 2LVIA 1C3ZA 1CDMA 1UHIA 4DS7A 1Z2CB 1ODBA 2LCPA 1DELA 5HKWA 4M2QA 1SMGA 1W9ZA 4GGFC 2M7NA 4YGBB 2YGUA 1DF0A 2E6WA 1OMDA 2WCBA 2BKIB 3VRPA 2KGRA 4INWA 5IBWA 3MSEB 1H8BA 4YGEB 3BUWB 2WCLA 2K2AA 5I2QA 1TNXA 2L4IA 5I94A 3CR5X 3CZTX 4CLNA 1J55A 3RZSA 1YX7A 2GV5A 2NCOA 4IJ7A 2H2KA 2JTTA 1XK4C 3VRNA 1B8RA 1CLBA 1OSAA 3DF0A 1KSMA 2PMYA 5AEQA 1K9PA 1A29A 1V1GA 1EXRA 2GGMA 3FWBA 3JTDB 2JPOA 2JZIA 4MEWA 4MZLA 3SS3A 2KOTA 4MRXA 5GQQC 3PFVA 3TS5C 1PSRA 1S26D 4XJKA 1ORGA 1LKJA 4NDCA 4NQGA 4XYNA 3DZTA 1SL7A 1LINA 2Q91A 1CFFA 1ZFSA 2L50A 3DYEA 2KYCA 1TNQA 1QV1A 2PASA 2EHBA 4USLA 2B1UA 1FBVA 1R6PA 1KK8C 1S6CA 1U5IB 1RJVA 3D0YB 3WNXB 3OX5A 2Y4QA 1NWDA 1RK9A 1NCXA 5FYXA 2L51A 4OR9B 3VROA 1WLMA 5I8NA 3DVMA 1W7IB 1RWYA 2WORA 1UHHA 5AXIA 1PULA 1K9KA 1SNLA 1JFJA 1LA0A 4QJ3B 2KNEA 3I5HC 3L4AA 5G08A 1NX3A 4E68A 3OB1B 2PRUA 2IS9A 2WCHA 3EK8A 3OHMB 4N1FA 3PJIA 2CCMA 1AHRA 2M7LA 3SG4A 4OKHA 2ZFDA 1E8AA 3IQOA 1GGZA 1DJGA 1MHOA 5DKRA 2KFGA 3AAJA 2P71A 1CTRA 1OE9B 1BLQA 4YGDB 4FQOA 1F4QA 2FCDA 2JT3A 3R1PA 1DGUA 2FOTA 2P70A 2NXQA 3LL8B 1BJFA 1LVCD 1QASA 1RECA 1WDCC 3JTDC 1L7ZA 1QTXA 2M8UA 4YI8A 3EVVA 4F0ZB 1WLZA 2R2IA 4GGFA 4GBAA 2QEVA 1EJ3A 2I2RE 1M46A 1QX2A 2LHLA 1BG1A 2ZRTA 1TRFA 2F2OA 3A4UB 4GAOA 2K7DA 3FIAA 5DICA 1QX7A 1KWOB 2PVBA 1AJ5A 3BJHA 4PCWA 1EH2A 1LXFC 4C0LA 1XFRA 3Q8IA 1QXPA 1GGWA 5K89A 3SIBA 3DY9A 3TDUA 2QACA 1QX5B 4QJ5B 1YTZC 3KEVA 4ETOA 1XK4A 1UHJA 2BBMA 2BL0B 1IQ3A 2I94A 2ZNEA 1RTP1 2LLUA 3B87A 3RM1A 5I2OA 4NDBA 3OP0A 2NLNA 3CR2A 3QMEA 4ORBB 2COLB 2EC6C 1S1EA 2DOQA 1JFKA 4GPLB 2H61C 2WCJA 2KAYA 1MXEA 1SKTA 2JNFA 2L4HA 5ER5A 2A4JA 3S0BA 2KBMA 2MLFC 2I18A 3SJSA 3FWCA 2L98A 5TNCA 3O6BA 4WQ2A 3PN7C 1TIZA 4DRWA 1PVBA 1B8LA 1CMFA 1ALVA 1FF1A 1JC2A 1SCMB 2BE6A 4GUKA 1DJXA 2CTNA 3EVRA 1DMOA 4CIDA 2QPTA 2WCEA 2HETA 1QVIY 1TUJA 4JPZB 2Y1MA 2WC5A 1GM0A 3WHTB 1QLKA 4DIRA 4QJ4B 2LAPA 1XFXO 1T14A 1UURA 4YGAA 3IQQA 4R1EA 2JTZA 3CLNA 3JVTC 1QWVA 3E3RA 1A75A 3VB1A 1KWOC 1OOFA 1XA5A 1EG3A 4HREE 3RLZA 1OW4A 2KYFA 2L2EA 2BBNA 1DJHA 2JC2A 2F3YA 3BUNB 1F4OA 2LP3A 4I5JA 1F55A 2KI4B 2LLSA 1S36A 1OOJA 2QEOA 5HYDA 1D1OA 3ZNIA 3I5IB 3D78A 1NUBA 4TNCA 3S0EA 3SG7A 2LC5A 2LUXA 2QEHA 5CSIA 1AK8A 1K95A 4OV2A 1TCOB 1J7QA 3CTNA 3BUMB 5HKYA 1ZOTB 1NX1A 2L2CA 3I5FB 3IF7A 1N0YA 1AJ4A 2KI6C 3EK4A 3HX4A 2LE9B 2LANA 4AOMA 4INXA 1B1GA 1U5IA 4C0KA 1SW8A 2ISDA 3D75A 3CGAA 1TCFA 3AKBA 4AQJA 2WNDA 1KQMB 2CXJA 4HRHA 3NHTA 2JOJA 3A8RA 3I5GC 4MZJA 1N65A 1DC1A 1WRLA 2LP2A 1QV0A 2Q4UA 4MVFA 3UO9A 1QVIZ 4JD9A 3KO0A 3D74A 1B47A 1B9AA 1OOGA 2H61A 3PSRA 2BAPA 4DUQA 2L0PA 3L4LA 1NIWA 2JWWA 1CM1A 1CFCA 1BT6A 3PLFB 1Y1XA 3SS5A 3BOWB 2LHIA 1SBJA 1XO5A 3FE8A 1G33A 1CDNA 2KQ6A 4PE0A 1J7RA 1P28A 4MZKA 4PE4A 1F71A 1DF0B 4OVNF 1PSBA 4MLWA 1BU3A 2QDIA 1VRKA 2OS8B 1C7WA 1Q80A 3BFAA 4MBEA 3VRRA 1Z4HA 4D1EA 4YRUA 3S0FA 1KFUL 3WHUB 2Y1NA 1K8UA 1QATA 2MHHA 3CZ1A 1W7JB 3GK1A 1LS8A 4MSPA 1XFZO 2KFHA 1JSAA 1CKKA 4WQ3A 1BOCA 1QIWA 4IL1A 4OCIA 2BECA 2HPSA 1CFDA 3SG2A 2BCXA 5CPVA 5CSNA 2D8NA 2FCEA 4GGNA 5KSZA 2KDHA 2KAXA 4JKTA 1OOHA 2JRFA 4XJKB 1JWDA 1KQVA 1BODA 2KBIA 2K2FA 1TWOA 2M0RA 3GK2A 4PALA 4AQIA 3O4XA 1XFWO 1TOPA 5KU1A 1F8HA 4DCKA 1KFXL 2LMUA 3NSOA 3EK7A 3D73A 2FJUB 4GFTA 4PHJA 1SL9A 1YRUB 1CLLA 1L2OB 3AAKA 1K9UA 2KSPA 4OZDA 4Q04A 3D10A 1XFUO 4NDDA 1NPQA 1MUXA 2LNKA 1S5GY 4YGCB 4CPVA 4L9MA 1C7VA 1GQMA 1AUIB 3KF9A 1UHKA 3SG3A 2CBLA 2LMVA 1ALWA 4ZCVA 1K93D 1OOIX 2RGIA 5FI6A 3BQ3A 4P2YB 1V1FA 2OS8C 1YURA 1CMGA 3M0WA 1F54A 5HKZA 4A4BA 1XFVO 3NHIA 2EGDA 2MAZA 2KI6D 1TNWA 1Y0VH 2OTGB 3KPXA 3TUYB 1NX2A 3H4SE 1PK0D 1JF0A 1SR6B 2BCBA 1SYMA 1OMRA 5D7FA 1IIOA 1PRWA 1BR4B 1OZOA 1B4CA 3EKHA 2MRDA 2G9BA 2QEBA 2ZNDA 2ZN9A 3O78A 1F70A 2PALA 4CFRA 2HQWA 2M1KB 5CSJA 5DKQA 2JXLA 2K60A 1NCYA 3S0DA 1KSOA
chains in the Genus database with same CATH topology
1UP5A 1MWNA 1TN4A 1NCZA 2CNPA 5HLOA 2PSRA 1BR1B 2BE4A 3FS7A 4HSZA 5JOLA 2WOSA 1PVAA 1SCVA 3OB2B 2ZKMX 4ICBA 3CS1A 3LK1A 1YR5A 1S6JA 4PDZA 1EG4A 5HLVA 1CLMA 4WRIA 1CB1A 1H4BA 2BL0C 3SG6A 1YUSA 2KAVA 1G4YR 3C1VA 1IWQA 4ORCB 1S5GZ 3LLEA 1SK6D 3QRXA 2JPTA 2LVVA 1TTXA 1J7PA 2BKHB 3O4YA 2KGBC 3VRQA 3DD4A 5J3XA 1KK8B 2HQ8A 1CDPA 2OTGC 3GK4X 2MBXA 1IG5A 1K90D 1OZSA 3BUOB 1IQ5A 2JULA 3D0YA 1HQVA 3BOWA 1SCMC 3I5HB 5PALA 3WXAA 1QIVA 2NZ0A 3EVUA 1DVIA 2LUCA 2KHNA 3ICBA 3ZWHA 1AP4A 1A2XA 1KFXS 1B7TZ 1A75B 5D69A 2TN4A 2AUCA 4BY4A 2Y5IA 2K0JA 1CDLA 2K7OA 4FTGA 3EKJA 2LLTA 2K7CA 3NXAA 2KI4C 2P6BB 2LV7A 1WDCB 5I2LA 1SPYA 3I5IC 1EL4A 1Y6WA 3TZ1A 2MA2A 3LCPC 1A03A 2LVKA 2L5XB 2V53A 1FPWA 4U8DA 1DJYA 1N2DA 2LVJA 1YX8A 4ZCUA 1FI6A 2GGZA 2WCFA 3I5FC 1LA3A 1SRAA 3SIAA 3DF0B 2K61A 3BYAA 1KCYA 1XYDA 1QJTA 2F33A 4M2PA 4I5LB 5AERA 4YI9A 1BF5A 1C07A 2VRGA 4I5KA 4HRGA 1KQMC 2JU0A 1ZMZA 3F45A 2EC6B 5B8IB 5CSFA 5JJGA 1YVLA 1M39A 5ER4X 1MQ1A 2HF5A 3GOFA 1CFPA 3DVJA 1J1EA 4PHKA 1DJWA 1MXLC 1DT7B 4ORAB 2I7AA 5AFPA 1NYAA 4PHMA 3KHEA 3PN7B 1S3PA 1WRKA 4P5OE 1BMOA 1NX0A 1Y1UA 2M49B 1J7OA 1K94A 1X02A 3BUXB 1YVHA 1IGVA 4MN0A 1OMVA 2KQYA 1MR8A 1IKUA 2BCAA 4MRYA 1ZACA 4PHNA 1PALA 2M9GA 3CWGA 4JQ0D 1OQPA 2O60A 3TDIA 1FI5A 2M1UA 1UHNA 2CT9A 2JQ6A 4N5XA 1QS7A 3JVTB 1SL8A 1UUSA 1GJYA 2G2BA 4I5NB 1SY9A 3NSLA 1IRJA 1G8IA 2SASA 1RROA 3CR4X 4C0JA 1KK7Y 2LMTA 1CNPA 1Y1AA 1QLSA 3DVKA 5KTYA 3BXKA 1HT9A 4YBHB 1WY9A 1ZUZA 1YUUA 1M31A 2NCPA 3NSKA 1FW4A 4JWQA 1CM4A 1S6IA 2F3ZA 3LK0A 3PALA 1AVSA 1M63B 1JBAA 4PE7A 2M97A 1DJZA 3TDZA 3O2PA 4UPGA 2JT0A 2ZN8A 1B7TY 4PE1A 2M29A 1XVJA 2F8PA 1IH0A 1A4PA 1WRZA 3K21A 2M3WA 1YUTA 2ZRSA 2F2PA 1UWOA 3PATA 3VGOA 1R2UA 1K96A 1TNPA 3SG5A 1IJ6A 2SCPA 3AKAA 1DJIA 1L2OC 5AANA 1DGVA 2JXCA 1JUOA 4GNKB 1YRTB 1B8CA 2K8MB 2WC8A 3DVEA 1NP8A 3I5GB 4M2OA 5F6TA 4A4CA 2AMIA 3TS5B 1NSHA 3OX6A 1JF2A 1XFYO 3PM8A 1J1DA 4N1GA 2OPOA 1IJ5A 2K7BA 1KFUS 2LM5A 2AAOA 5BPJA 2MJWB 2JNXA 3NSIA 2KFFA 1M45A 2MLEC 3HCMA 2O5GA 3TUYC 2E30A 1K2HA 1DTLA 1SR6C 5DKNA 1RFJA 4CFQA 2JT8A 1KK7Z 1MF8B 4BY5A 2LVIA 1CDMA 1UHIA 4DS7A 1ODBA 2LCPA 5HKWA 4M2QA 1SMGA 4GGFC 2M7NA 4YGBB 1DF0A 2E6WA 1OMDA 2WCBA 2BKIB 3VRPA 2KGRA 1H8BA 5IBWA 3MSEB 4YGEB 3BUWB 2K2AA 5I2QA 1TNXA 2L4IA 3CR5X 3CZTX 4CLNA 1J55A 1YX7A 2GV5A 2NCOA 2H2KA 2JTTA 1XK4C 3VRNA 1B8RA 1CLBA 1OSAA 3DF0A 1KSMA 2PMYA 5AEQA 1K9PA 1A29A 1V1GA 1EXRA 2GGMA 3FWBA 3JTDB 4MEWA 2JZIA 4MZLA 2KOTA 4MRXA 5GQQC 3PFVA 3TS5C 1PSRA 1S26D 4XJKA 1LKJA 4NDCA 4NQGA 4XYNA 1SL7A 1LINA 2Q91A 1CFFA 1ZFSA 2L50A 2KYCA 1TNQA 1QV1A 2PASA 2EHBA 4USLA 2B1UA 1FBVA 1R6PA 1KK8C 1S6CA 1U5IB 1RJVA 3D0YB 3WNXB 3OX5A 2Y4QA 1NWDA 1RK9A 1NCXA 5FYXA 2L51A 4OR9B 3VROA 1WLMA 5I8NA 3DVMA 1W7IB 1RWYA 2WORA 1UHHA 5AXIA 1PULA 1K9KA 1SNLA 1JFJA 1LA0A 4QJ3B 2KNEA 3I5HC 5G08A 4E68A 1NX3A 3OB1B 2PRUA 2IS9A 3EK8A 3OHMB 4N1FA 2CCMA 1AHRA 2M7LA 3SG4A 4OKHA 2ZFDA 1E8AA 3IQOA 1GGZA 1DJGA 1MHOA 5DKRA 2KFGA 3AAJA 1CTRA 1OE9B 1BLQA 4YGDB 4FQOA 1F4QA 2FCDA 2JT3A 1DGUA 2FOTA 2NXQA 3LL8B 1BJFA 1LVCD 1QASA 1RECA 1WDCC 3JTDC 1L7ZA 1QTXA 2M8UA 4YI8A 3EVVA 4F0ZB 1WLZA 2R2IA 4GGFA 4GBAA 1EJ3A 2I2RE 1M46A 1QX2A 2LHLA 1BG1A 2ZRTA 1TRFA 2F2OA 3A4UB 4GAOA 2K7DA 3FIAA 1QX7A 1KWOB 2PVBA 1AJ5A 4PCWA 1EH2A 1LXFC 4C0LA 1QXPA 1GGWA 5K89A 3SIBA 3TDUA 2QACA 1QX5B 4QJ5B 1YTZC 3KEVA 4ETOA 1XK4A 1UHJA 2BBMA 2BL0B 1IQ3A 2I94A 2ZNEA 1RTP1 2LLUA 5I2OA 3RM1A 4NDBA 3OP0A 2NLNA 3CR2A 4ORBB 2COLB 2EC6C 1S1EA 2DOQA 1JFKA 4GPLB 2H61C 2KAYA 1MXEA 1SKTA 2JNFA 2L4HA 5ER5A 2A4JA 2KBMA 2MLFC 2I18A 3SJSA 3FWCA 2L98A 5TNCA 3O6BA 4WQ2A 3PN7C 1TIZA 4DRWA 1PVBA 1B8LA 1CMFA 1ALVA 1FF1A 1JC2A 1SCMB 2BE6A 4GUKA 1DJXA 2CTNA 3EVRA 1DMOA 4CIDA 2QPTA 2WCEA 2HETA 1QVIY 4JPZB 2Y1MA 3WHTB 1QLKA 4DIRA 2LAPA 1XFXO 1UURA 4YGAA 3IQQA 4R1EA 2JTZA 3CLNA 3JVTC 4QJ4B 3E3RA 1A75A 1KWOC 1XA5A 1EG3A 4HREE 3RLZA 2KYFA 2L2EA 2BBNA 1DJHA 2JC2A 2F3YA 3BUNB 1F4OA 2LP3A 4I5JA 1F55A 2KI4B 2LLSA 1S36A 1OOJA 5HYDA 1D1OA 3ZNIA 3I5IB 1NUBA 4TNCA 3SG7A 2LC5A 2LUXA 5CSIA 1AK8A 1K95A 4OV2A 1TCOB 1J7QA 3CTNA 3BUMB 5HKYA 1ZOTB 1NX1A 3I5FB 3IF7A 1N0YA 1AJ4A 2KI6C 3EK4A 3HX4A 2LE9B 2LANA 4AOMA 1B1GA 1U5IA 4C0KA 1SW8A 2ISDA 3CGAA 1TCFA 3AKBA 4AQJA 2WNDA 1KQMB 2CXJA 4HRHA 2JOJA 3A8RA 3I5GC 4MZJA 1N65A 1WRLA 2LP2A 1QV0A 2Q4UA 4MVFA 1QVIZ 3KO0A 1B47A 1B9AA 2H61A 3PSRA 4DUQA 2L0PA 1NIWA 2JWWA 1CM1A 1CFCA 1BT6A 3PLFB 1Y1XA 3BOWB 2LHIA 1SBJA 1XO5A 1G33A 1CDNA 2KQ6A 4PE0A 1J7RA 4MZKA 4PE4A 1F71A 1DF0B 4OVNF 1PSBA 4MLWA 1BU3A 1VRKA 2OS8B 1C7WA 1Q80A 4MBEA 3VRRA 4D1EA 4YRUA 1KFUL 3WHUB 2Y1NA 1K8UA 1QATA 2MHHA 3GK1A 1W7JB 4MSPA 1XFZO 2KFHA 1JSAA 1CKKA 4WQ3A 1BOCA 1QIWA 4IL1A 4OCIA 2BECA 2HPSA 1CFDA 3SG2A 2BCXA 5CPVA 5CSNA 2D8NA 2FCEA 4GGNA 5KSZA 2KDHA 2KAXA 1KQVA 4XJKB 2JRFA 1JWDA 1BODA 2KBIA 2K2FA 3GK2A 2M0RA 4PALA 4AQIA 1XFWO 1TOPA 5KU1A 1F8HA 4DCKA 1KFXL 2LMUA 3NSOA 3EK7A 2FJUB 4GFTA 4PHJA 1SL9A 1YRUB 1CLLA 1L2OB 3AAKA 1K9UA 2KSPA 4Q04A 3D10A 1XFUO 4NDDA 1NPQA 1MUXA 2LNKA 1S5GY 4YGCB 4CPVA 4L9MA 1C7VA 1GQMA 1AUIB 3KF9A 1UHKA 3SG3A 2CBLA 2LMVA 1ALWA 4ZCVA 1K93D 2RGIA 3BQ3A 4P2YB 1V1FA 2OS8C 1YURA 1CMGA 3M0WA 1F54A 5HKZA 4A4BA 1XFVO 2EGDA 2MAZA 2KI6D 1TNWA 1Y0VH 2OTGB 3KPXA 3TUYB 1NX2A 3H4SE 1PK0D 2BCBA 1JF0A 1SR6B 1SYMA 1OMRA 5D7FA 1PRWA 1BR4B 1OZOA 1B4CA 3EKHA 2MRDA 2G9BA 2ZNDA 2ZN9A 1F70A 3O78A 2PALA 4CFRA 2HQWA 2M1KB 5CSJA 5DKQA 2JXLA 1NCYA 1KSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UP5 A;  1MWN A;  1TN4 A;  1NCZ A;  2CNP A;  5HLO A;  2PSR A;  1BR1 B;  2BE4 A;  3FS7 A;  4HSZ A;  5JOL A;  2WOS A;  1PVA A;  1SCV A;  3OB2 B;  2ZKM X;  4ICB A;  3CS1 A;  3LK1 A;  1YR5 A;  1S6J A;  4PDZ A;  1EG4 A;  5HLV A;  1CLM A;  4WRI A;  1CB1 A;  1H4B A;  2BL0 C;  3SG6 A;  1YUS A;  2KAV A;  1G4Y R;  3C1V A;  1IWQ A;  4ORC B;  1S5G Z;  3LLE A;  1SK6 D;  3QRX A;  2JPT A;  2LVV A;  1TTX A;  1J7P A;  2BKH B;  3O4Y A;  2KGB C;  3VRQ A;  3DD4 A;  5J3X A;  1KK8 B;  2HQ8 A;  1CDP A;  2OTG C;  3GK4 X;  2MBX A;  1IG5 A;  1K90 D;  1OZS A;  3BUO B;  1IQ5 A;  2JUL A;  3D0Y A;  1HQV A;  3BOW A;  1SCM C;  3I5H B;  5PAL A;  3WXA A;  1QIV A;  2NZ0 A;  3EVU A;  1DVI A;  2LUC A;  2KHN A;  3ICB A;  3ZWH A;  1AP4 A;  1A2X A;  1KFX S;  1B7T Z;  1A75 B;  5D69 A;  2TN4 A;  2AUC A;  4BY4 A;  2Y5I A;  2K0J A;  1CDL A;  2K7O A;  4FTG A;  3EKJ A;  2LLT A;  2K7C A;  3NXA A;  2KI4 C;  2P6B B;  2LV7 A;  1WDC B;  5I2L A;  1SPY A;  3I5I C;  1EL4 A;  1Y6W A;  3TZ1 A;  2MA2 A;  3LCP C;  1A03 A;  2LVK A;  2L5X B;  2V53 A;  1FPW A;  4U8D A;  1DJY A;  1N2D A;  2LVJ A;  1YX8 A;  4ZCU A;  1FI6 A;  2GGZ A;  2WCF A;  3I5F C;  1LA3 A;  1SRA A;  3SIA A;  3DF0 B;  2K61 A;  3BYA A;  1KCY A;  1XYD A;  1QJT A;  2F33 A;  4M2P A;  4I5L B;  5AER A;  4YI9 A;  1BF5 A;  1C07 A;  2VRG A;  4I5K A;  4HRG A;  1KQM C;  2JU0 A;  1ZMZ A;  3F45 A;  2EC6 B;  5B8I B;  5CSF A;  5JJG A;  1YVL A;  1M39 A;  5ER4 X;  1MQ1 A;  2HF5 A;  3GOF A;  1CFP A;  3DVJ A;  1J1E A;  4PHK A;  1DJW A;  1MXL C;  1DT7 B;  4ORA B;  2I7A A;  5AFP A;  1NYA A;  4PHM A;  3KHE A;  3PN7 B;  1S3P A;  1WRK A;  4P5O E;  1BMO A;  1NX0 A;  1Y1U A;  2M49 B;  1J7O A;  1K94 A;  1X02 A;  3BUX B;  1YVH A;  1IGV A;  4MN0 A;  1OMV A;  2KQY A;  1MR8 A;  1IKU A;  2BCA A;  4MRY A;  1ZAC A;  4PHN A;  1PAL A;  2M9G A;  3CWG A;  4JQ0 D;  1OQP A;  2O60 A;  3TDI A;  1FI5 A;  2M1U A;  1UHN A;  2CT9 A;  2JQ6 A;  4N5X A;  1QS7 A;  3JVT B;  1SL8 A;  1UUS A;  1GJY A;  2G2B A;  4I5N B;  1SY9 A;  3NSL A;  1IRJ A;  1G8I A;  2SAS A;  1RRO A;  3CR4 X;  4C0J A;  1KK7 Y;  2LMT A;  1CNP A;  1Y1A A;  1QLS A;  3DVK A;  5KTY A;  3BXK A;  1HT9 A;  4YBH B;  1WY9 A;  1ZUZ A;  1YUU A;  1M31 A;  2NCP A;  3NSK A;  1FW4 A;  4JWQ A;  1CM4 A;  1S6I A;  2F3Z A;  3LK0 A;  3PAL A;  1AVS A;  1M63 B;  1JBA A;  4PE7 A;  2M97 A;  1DJZ A;  3TDZ A;  3O2P A;  4UPG A;  2JT0 A;  2ZN8 A;  1B7T Y;  4PE1 A;  2M29 A;  1XVJ A;  2F8P A;  1IH0 A;  1A4P A;  1WRZ A;  3K21 A;  2M3W A;  1YUT A;  2ZRS A;  2F2P A;  1UWO A;  3PAT A;  3VGO A;  1R2U A;  1K96 A;  1TNP A;  3SG5 A;  1IJ6 A;  2SCP A;  3AKA A;  1DJI A;  1L2O C;  5AAN A;  1DGV A;  2JXC A;  1JUO A;  4GNK B;  1YRT B;  1B8C A;  2K8M B;  2WC8 A;  3DVE A;  1NP8 A;  3I5G B;  4M2O A;  5F6T A;  4A4C A;  2AMI A;  3TS5 B;  1NSH A;  3OX6 A;  1JF2 A;  1XFY O;  3PM8 A;  1J1D A;  4N1G A;  2OPO A;  1IJ5 A;  2K7B A;  1KFU S;  2LM5 A;  2AAO A;  5BPJ A;  2MJW B;  2JNX A;  3NSI A;  2KFF A;  1M45 A;  2MLE C;  3HCM A;  2O5G A;  3TUY C;  2E30 A;  1K2H A;  1DTL A;  1SR6 C;  5DKN A;  1RFJ A;  4CFQ A;  2JT8 A;  1KK7 Z;  1MF8 B;  4BY5 A;  2LVI A;  1CDM A;  1UHI A;  4DS7 A;  1ODB A;  2LCP A;  5HKW A;  4M2Q A;  1SMG A;  4GGF C;  2M7N A;  4YGB B;  1DF0 A;  2E6W A;  1OMD A;  2WCB A;  2BKI B;  3VRP A;  2KGR A;  1H8B A;  5IBW A;  3MSE B;  4YGE B;  3BUW B;  2K2A A;  5I2Q A;  1TNX A;  2L4I A;  3CR5 X;  3CZT X;  4CLN A;  1J55 A;  1YX7 A;  2GV5 A;  2NCO A;  2H2K A;  2JTT A;  1XK4 C;  3VRN A;  1B8R A;  1CLB A;  1OSA A;  3DF0 A;  1KSM A;  2PMY A;  5AEQ A;  1K9P A;  1A29 A;  1V1G A;  1EXR A;  2GGM A;  3FWB A;  3JTD B;  4MEW A;  2JZI A;  4MZL A;  2KOT A;  4MRX A;  5GQQ C;  3PFV A;  3TS5 C;  1PSR A;  1S26 D;  4XJK A;  1LKJ A;  4NDC A;  4NQG A;  4XYN A;  1SL7 A;  1LIN A;  2Q91 A;  1CFF A;  1ZFS A;  2L50 A;  2KYC A;  1TNQ A;  1QV1 A;  2PAS A;  2EHB A;  4USL A;  2B1U A;  1FBV A;  1R6P A;  1KK8 C;  1S6C A;  1U5I B;  1RJV A;  3D0Y B;  3WNX B;  3OX5 A;  2Y4Q A;  1NWD A;  1RK9 A;  1NCX A;  5FYX A;  2L51 A;  4OR9 B;  3VRO A;  1WLM A;  5I8N A;  3DVM A;  1W7I B;  1RWY A;  2WOR A;  1UHH A;  5AXI A;  1PUL A;  1K9K A;  1SNL A;  1JFJ A;  1LA0 A;  4QJ3 B;  2KNE A;  3I5H C;  5G08 A;  4E68 A;  1NX3 A;  3OB1 B;  2PRU A;  2IS9 A;  3EK8 A;  3OHM B;  4N1F A;  2CCM A;  1AHR A;  2M7L A;  3SG4 A;  4OKH A;  2ZFD A;  1E8A A;  3IQO A;  1GGZ A;  1DJG A;  1MHO A;  5DKR A;  2KFG A;  3AAJ A;  1CTR A;  1OE9 B;  1BLQ A;  4YGD B;  4FQO A;  1F4Q A;  2FCD A;  2JT3 A;  1DGU A;  2FOT A;  2NXQ A;  3LL8 B;  1BJF A;  1LVC D;  1QAS A;  1REC A;  1WDC C;  3JTD C;  1L7Z A;  1QTX A;  2M8U A;  4YI8 A;  3EVV A;  4F0Z B;  1WLZ A;  2R2I A;  4GGF A;  4GBA A;  1EJ3 A;  2I2R E;  1M46 A;  1QX2 A;  2LHL A;  1BG1 A;  2ZRT A;  1TRF A;  2F2O A;  3A4U B;  4GAO A;  2K7D A;  3FIA A;  1QX7 A;  1KWO B;  2PVB A;  1AJ5 A;  4PCW A;  1EH2 A;  1LXF C;  4C0L A;  1QXP A;  1GGW A;  5K89 A;  3SIB A;  3TDU A;  2QAC A;  1QX5 B;  4QJ5 B;  1YTZ C;  3KEV A;  4ETO A;  1XK4 A;  1UHJ A;  2BBM A;  2BL0 B;  1IQ3 A;  2I94 A;  2ZNE A;  1RTP 1;  2LLU A;  5I2O A;  3RM1 A;  4NDB A;  3OP0 A;  2NLN A;  3CR2 A;  4ORB B;  2COL B;  2EC6 C;  1S1E A;  2DOQ A;  1JFK A;  4GPL B;  2H61 C;  2KAY A;  1MXE A;  1SKT A;  2JNF A;  2L4H A;  5ER5 A;  2A4J A;  2KBM A;  2MLF C;  2I18 A;  3SJS A;  3FWC A;  2L98 A;  5TNC A;  3O6B A;  4WQ2 A;  3PN7 C;  1TIZ A;  4DRW A;  1PVB A;  1B8L A;  1CMF A;  1ALV A;  1FF1 A;  1JC2 A;  1SCM B;  2BE6 A;  4GUK A;  1DJX A;  2CTN A;  3EVR A;  1DMO A;  4CID A;  2QPT A;  2WCE A;  2HET A;  1QVI Y;  4JPZ B;  2Y1M A;  3WHT B;  1QLK A;  4DIR A;  2LAP A;  1XFX O;  1UUR A;  4YGA A;  3IQQ A;  4R1E A;  2JTZ A;  3CLN A;  3JVT C;  4QJ4 B;  3E3R A;  1A75 A;  1KWO C;  1XA5 A;  1EG3 A;  4HRE E;  3RLZ A;  2KYF A;  2L2E A;  2BBN A;  1DJH A;  2JC2 A;  2F3Y A;  3BUN B;  1F4O A;  2LP3 A;  4I5J A;  1F55 A;  2KI4 B;  2LLS A;  1S36 A;  1OOJ A;  5HYD A;  1D1O A;  3ZNI A;  3I5I B;  1NUB A;  4TNC A;  3SG7 A;  2LC5 A;  2LUX A;  5CSI A;  1AK8 A;  1K95 A;  4OV2 A;  1TCO B;  1J7Q A;  3CTN A;  3BUM B;  5HKY A;  1ZOT B;  1NX1 A;  3I5F B;  3IF7 A;  1N0Y A;  1AJ4 A;  2KI6 C;  3EK4 A;  3HX4 A;  2LE9 B;  2LAN A;  4AOM A;  1B1G A;  1U5I A;  4C0K A;  1SW8 A;  2ISD A;  3CGA A;  1TCF A;  3AKB A;  4AQJ A;  2WND A;  1KQM B;  2CXJ A;  4HRH A;  2JOJ A;  3A8R A;  3I5G C;  4MZJ A;  1N65 A;  1WRL A;  2LP2 A;  1QV0 A;  2Q4U A;  4MVF A;  1QVI Z;  3KO0 A;  1B47 A;  1B9A A;  2H61 A;  3PSR A;  4DUQ A;  2L0P A;  1NIW A;  2JWW A;  1CM1 A;  1CFC A;  1BT6 A;  3PLF B;  1Y1X A;  3BOW B;  2LHI A;  1SBJ A;  1XO5 A;  1G33 A;  1CDN A;  2KQ6 A;  4PE0 A;  1J7R A;  4MZK A;  4PE4 A;  1F71 A;  1DF0 B;  4OVN F;  1PSB A;  4MLW A;  1BU3 A;  1VRK A;  2OS8 B;  1C7W A;  1Q80 A;  4MBE A;  3VRR A;  4D1E A;  4YRU A;  1KFU L;  3WHU B;  2Y1N A;  1K8U A;  1QAT A;  2MHH A;  3GK1 A;  1W7J B;  4MSP A;  1XFZ O;  2KFH A;  1JSA A;  1CKK A;  4WQ3 A;  1BOC A;  1QIW A;  4IL1 A;  4OCI A;  2BEC A;  2HPS A;  1CFD A;  3SG2 A;  2BCX A;  5CPV A;  5CSN A;  2D8N A;  2FCE A;  4GGN A;  5KSZ A;  2KDH A;  2KAX A;  1KQV A;  4XJK B;  2JRF A;  1JWD A;  1BOD A;  2KBI A;  2K2F A;  3GK2 A;  2M0R A;  4PAL A;  4AQI A;  1XFW O;  1TOP A;  5KU1 A;  1F8H A;  4DCK A;  1KFX L;  2LMU A;  3NSO A;  3EK7 A;  2FJU B;  4GFT A;  4PHJ A;  1SL9 A;  1YRU B;  1CLL A;  1L2O B;  3AAK A;  1K9U A;  2KSP A;  4Q04 A;  3D10 A;  1XFU O;  4NDD A;  1NPQ A;  1MUX A;  2LNK A;  1S5G Y;  4YGC B;  4CPV A;  4L9M A;  1C7V A;  1GQM A;  1AUI B;  3KF9 A;  1UHK A;  3SG3 A;  2CBL A;  2LMV A;  1ALW A;  4ZCV A;  1K93 D;  2RGI A;  3BQ3 A;  4P2Y B;  1V1F A;  2OS8 C;  1YUR A;  1CMG A;  3M0W A;  1F54 A;  5HKZ A;  4A4B A;  1XFV O;  2EGD A;  2MAZ A;  2KI6 D;  1TNW A;  1Y0V H;  2OTG B;  3KPX A;  3TUY B;  1NX2 A;  3H4S E;  1PK0 D;  2BCB A;  1JF0 A;  1SR6 B;  1SYM A;  1OMR A;  5D7F A;  1PRW A;  1BR4 B;  1OZO A;  1B4C A;  3EKH A;  2MRD A;  2G9B A;  2ZND A;  2ZN9 A;  1F70 A;  3O78 A;  2PAL A;  4CFR A;  2HQW A;  2M1K B;  5CSJ A;  5DKQ A;  2JXL A;  1NCY A;  1KSO A; 
#chains in the Genus database with same CATH topology
 1UP5 A;  1MWN A;  1TN4 A;  1NCZ A;  2CNP A;  2ERB A;  2PSR A;  5HLO A;  1BR1 B;  2BE4 A;  3FS7 A;  1TUZ A;  4HSZ A;  5JOL A;  2WOS A;  1PVA A;  1SCV A;  3OB2 B;  2ZKM X;  4KYN A;  4ICB A;  3CS1 A;  3D76 A;  3LK1 A;  1YR5 A;  1C3Y A;  1S6J A;  4PDZ A;  1EG4 A;  5HLV A;  2PQL A;  1CLM A;  4WRI A;  1CB1 A;  1H4B A;  5HL1 A;  2BL0 C;  3SG6 A;  1YUS A;  2KAV A;  1G4Y R;  3C1V A;  1IWQ A;  4ORC B;  1S5G Z;  3LLE A;  1SK6 D;  3OBV A;  3QRX A;  2JPT A;  2LVV A;  1TTX A;  1J7P A;  2BKH B;  3O4Y A;  2KGB C;  3VRQ A;  3DD4 A;  3S0A A;  5J3X A;  1KK8 B;  2HQ8 A;  1CDP A;  2OTG C;  3GK4 X;  2MBX A;  1IG5 A;  1K90 D;  1OZS A;  2WC6 A;  1IQ5 A;  3BUO B;  2JUL A;  3D0Y A;  1HQV A;  3BOW A;  1SCM C;  3I5H B;  5PAL A;  3BFH A;  3WXA A;  1QIV A;  2NZ0 A;  3EVU A;  1DVI A;  2LUC A;  2KHN A;  3CDN A;  3ICB A;  3ZWH A;  3OGN A;  1AP4 A;  1A2X A;  2WCK A;  1KFX S;  1B7T Z;  1A75 B;  5D69 A;  2TN4 A;  2AUC A;  4BY4 A;  2Y5I A;  3B7A A;  3B86 A;  2K0J A;  1CDL A;  3N7H A;  2K7O A;  4FTG A;  3EKJ A;  3NGV A;  2LLT A;  2K7C A;  3B6X A;  3NXA A;  2KI4 C;  2P6B B;  2LV7 A;  1WDC B;  5I2L A;  1SPY A;  3I5I C;  1EL4 A;  1Y6W A;  3BFB A;  5D3O A;  3TZ1 A;  2MA2 A;  3LCP C;  1A03 A;  2LVK A;  2L5X B;  2V53 A;  4PT1 A;  1FPW A;  2GTE A;  4U8D A;  1DJY A;  2KLE A;  1N2D A;  2LVJ A;  1YX8 A;  4ZCU A;  3SS4 A;  2GGZ A;  1FI6 A;  2WCF A;  2L5Y A;  3K1E A;  3I5F C;  1LA3 A;  1SRA A;  3SIA A;  3DF0 B;  3CYZ A;  2K61 A;  3BYA A;  1KCY A;  1XYD A;  1QJT A;  2F33 A;  4M2P A;  4I5L B;  5AER A;  1DQE A;  2FJY A;  4YI9 A;  1BF5 A;  1C07 A;  2VRG A;  3L47 A;  4I5K A;  1SSE B;  4HRG A;  1KQM C;  2JU0 A;  1ZMZ A;  3F45 A;  2EC6 B;  3IVT A;  3EG5 B;  5B8I B;  5CSF A;  5JJG A;  1YVL A;  1M39 A;  5ER4 X;  1MQ1 A;  2HF5 A;  3D77 A;  3GOF A;  1CFP A;  3DVJ A;  1J1E A;  4PHK A;  1DJW A;  1MXL C;  1DT7 B;  4ORA B;  2I7A A;  5AFP A;  1NYA A;  4PHM A;  3KHE A;  2BNX A;  1S3P A;  3PN7 B;  1WRK A;  4P5O E;  1BMO A;  1NX0 A;  1Y1U A;  2M49 B;  1J7O A;  1K94 A;  1X02 A;  3BUX B;  1YVH A;  1IGV A;  3CZ2 A;  4MN0 A;  1OMV A;  4CFQ A;  2KQY A;  1MR8 A;  3DXL A;  1IKU A;  2BCA A;  4MRY A;  1ZAC A;  4PHN A;  1PAL A;  2M9G A;  3CWG A;  4JQ0 D;  1OQP A;  2O60 A;  3R1O A;  3TDI A;  1FI5 A;  2M1U A;  1UHN A;  2CT9 A;  2JQ6 A;  4N5X A;  1QS7 A;  3JVT B;  1SL8 A;  1UUS A;  1GJY A;  2G2B A;  4I5N B;  1SY9 A;  3NSL A;  1G8I A;  1IRJ A;  2SAS A;  1RRO A;  3CR4 X;  4C0J A;  1KK7 Y;  2LMT A;  3V2L A;  1CNP A;  1Y1A A;  3UNW A;  1QLS A;  3DVK A;  5KTY A;  3B88 A;  3BXK A;  1HT9 A;  4YBH B;  1WY9 A;  1ZUZ A;  1YUU A;  1M31 A;  2NCP A;  3NSK A;  1FW4 A;  4JWQ A;  1CM4 A;  1S6I A;  5EL2 A;  2F3Z A;  3LK0 A;  3PAL A;  1AVS A;  1M63 B;  1JBA A;  4PE7 A;  5FI2 A;  2M97 A;  1DJZ A;  3TDZ A;  3O2P A;  4UPG A;  2JT0 A;  2ZN8 A;  1B7T Y;  4PE1 A;  2M29 A;  1XVJ A;  2F8P A;  4F7F A;  1IH0 A;  1A4P A;  1WRZ A;  3K21 A;  2M3W A;  1YUT A;  2ZRS A;  2F2P A;  4FQT A;  1UWO A;  3PAT A;  5FI7 A;  3VGO A;  1R2U A;  1K96 A;  1TNP A;  2H8V A;  3SG5 A;  1IJ6 A;  2SCP A;  3AKA A;  1DJI A;  1L2O C;  5AAN A;  1DGV A;  2JXC A;  1JUO A;  3CAB A;  4GNK B;  3S0G A;  1YRT B;  1B8C A;  2K8M B;  2WC8 A;  3DVE A;  1NP8 A;  3I5G B;  4M2O A;  5F6T A;  3FE6 A;  4A4C A;  2AMI A;  2KLD A;  3TS5 B;  1NSH A;  3OX6 A;  1JF2 A;  1XFY O;  3PM8 A;  3CZ0 A;  1J1D A;  4N1G A;  2OPO A;  3R1V A;  1IJ5 A;  2K7B A;  1KFU S;  2LM5 A;  3R72 A;  2PYQ A;  2AAO A;  5BPJ A;  2MJW B;  2JNX A;  3NSI A;  2KFF A;  1M45 A;  1DEK A;  2MLE C;  2O5G A;  3HCM A;  2E30 A;  3TUY C;  1K2H A;  2WCM A;  1DTL A;  1SR6 C;  2KPH A;  1RFJ A;  3PM2 A;  2JT8 A;  5DKN A;  1KK7 Z;  1MF8 B;  3FE9 A;  4BY5 A;  2LVI A;  1C3Z A;  1CDM A;  1UHI A;  4DS7 A;  1Z2C B;  1ODB A;  2LCP A;  1DEL A;  5HKW A;  4M2Q A;  1SMG A;  1W9Z A;  4GGF C;  2M7N A;  4YGB B;  2YGU A;  1DF0 A;  2E6W A;  1OMD A;  2WCB A;  2BKI B;  3VRP A;  2KGR A;  4INW A;  5IBW A;  3MSE B;  1H8B A;  4YGE B;  3BUW B;  2WCL A;  2K2A A;  5I2Q A;  1TNX A;  2L4I A;  5I94 A;  3CR5 X;  3CZT X;  4CLN A;  1J55 A;  3RZS A;  1YX7 A;  2GV5 A;  2NCO A;  4IJ7 A;  2H2K A;  2JTT A;  1XK4 C;  3VRN A;  1B8R A;  1CLB A;  1OSA A;  3DF0 A;  1KSM A;  2PMY A;  5AEQ A;  1K9P A;  1A29 A;  1V1G A;  1EXR A;  2GGM A;  3FWB A;  3JTD B;  2JPO A;  2JZI A;  4MEW A;  4MZL A;  3SS3 A;  2KOT A;  4MRX A;  5GQQ C;  3PFV A;  3TS5 C;  1PSR A;  1S26 D;  4XJK A;  1ORG A;  1LKJ A;  4NDC A;  4NQG A;  4XYN A;  3DZT A;  1SL7 A;  1LIN A;  2Q91 A;  1CFF A;  1ZFS A;  2L50 A;  3DYE A;  2KYC A;  1TNQ A;  1QV1 A;  2PAS A;  2EHB A;  4USL A;  2B1U A;  1FBV A;  1R6P A;  1KK8 C;  1S6C A;  1U5I B;  1RJV A;  3D0Y B;  3WNX B;  3OX5 A;  2Y4Q A;  1NWD A;  1RK9 A;  1NCX A;  5FYX A;  2L51 A;  4OR9 B;  3VRO A;  1WLM A;  5I8N A;  3DVM A;  1W7I B;  1RWY A;  2WOR A;  1UHH A;  5AXI A;  1PUL A;  1K9K A;  1SNL A;  1JFJ A;  1LA0 A;  4QJ3 B;  2KNE A;  3I5H C;  3L4A A;  5G08 A;  1NX3 A;  4E68 A;  3OB1 B;  2PRU A;  2IS9 A;  2WCH A;  3EK8 A;  3OHM B;  4N1F A;  3PJI A;  2CCM A;  1AHR A;  2M7L A;  3SG4 A;  4OKH A;  2ZFD A;  1E8A A;  3IQO A;  1GGZ A;  1DJG A;  1MHO A;  5DKR A;  2KFG A;  3AAJ A;  2P71 A;  1CTR A;  1OE9 B;  1BLQ A;  4YGD B;  4FQO A;  1F4Q A;  2FCD A;  2JT3 A;  3R1P A;  1DGU A;  2FOT A;  2P70 A;  2NXQ A;  3LL8 B;  1BJF A;  1LVC D;  1QAS A;  1REC A;  1WDC C;  3JTD C;  1L7Z A;  1QTX A;  2M8U A;  4YI8 A;  3EVV A;  4F0Z B;  1WLZ A;  2R2I A;  4GGF A;  4GBA A;  2QEV A;  1EJ3 A;  2I2R E;  1M46 A;  1QX2 A;  2LHL A;  1BG1 A;  2ZRT A;  1TRF A;  2F2O A;  3A4U B;  4GAO A;  2K7D A;  3FIA A;  5DIC A;  1QX7 A;  1KWO B;  2PVB A;  1AJ5 A;  3BJH A;  4PCW A;  1EH2 A;  1LXF C;  4C0L A;  1XFR A;  3Q8I A;  1QXP A;  1GGW A;  5K89 A;  3SIB A;  3DY9 A;  3TDU A;  2QAC A;  1QX5 B;  4QJ5 B;  1YTZ C;  3KEV A;  4ETO A;  1XK4 A;  1UHJ A;  2BBM A;  2BL0 B;  1IQ3 A;  2I94 A;  2ZNE A;  1RTP 1;  2LLU A;  3B87 A;  3RM1 A;  5I2O A;  4NDB A;  3OP0 A;  2NLN A;  3CR2 A;  3QME A;  4ORB B;  2COL B;  2EC6 C;  1S1E A;  2DOQ A;  1JFK A;  4GPL B;  2H61 C;  2WCJ A;  2KAY A;  1MXE A;  1SKT A;  2JNF A;  2L4H A;  5ER5 A;  2A4J A;  3S0B A;  2KBM A;  2MLF C;  2I18 A;  3SJS A;  3FWC A;  2L98 A;  5TNC A;  3O6B A;  4WQ2 A;  3PN7 C;  1TIZ A;  4DRW A;  1PVB A;  1B8L A;  1CMF A;  1ALV A;  1FF1 A;  1JC2 A;  1SCM B;  2BE6 A;  4GUK A;  1DJX A;  2CTN A;  3EVR A;  1DMO A;  4CID A;  2QPT A;  2WCE A;  2HET A;  1QVI Y;  1TUJ A;  4JPZ B;  2Y1M A;  2WC5 A;  1GM0 A;  3WHT B;  1QLK A;  4DIR A;  4QJ4 B;  2LAP A;  1XFX O;  1T14 A;  1UUR A;  4YGA A;  3IQQ A;  4R1E A;  2JTZ A;  3CLN A;  3JVT C;  1QWV A;  3E3R A;  1A75 A;  3VB1 A;  1KWO C;  1OOF A;  1XA5 A;  1EG3 A;  4HRE E;  3RLZ A;  1OW4 A;  2KYF A;  2L2E A;  2BBN A;  1DJH A;  2JC2 A;  2F3Y A;  3BUN B;  1F4O A;  2LP3 A;  4I5J A;  1F55 A;  2KI4 B;  2LLS A;  1S36 A;  1OOJ A;  2QEO A;  5HYD A;  1D1O A;  3ZNI A;  3I5I B;  3D78 A;  1NUB A;  4TNC A;  3S0E A;  3SG7 A;  2LC5 A;  2LUX A;  2QEH A;  5CSI A;  1AK8 A;  1K95 A;  4OV2 A;  1TCO B;  1J7Q A;  3CTN A;  3BUM B;  5HKY A;  1ZOT B;  1NX1 A;  2L2C A;  3I5F B;  3IF7 A;  1N0Y A;  1AJ4 A;  2KI6 C;  3EK4 A;  3HX4 A;  2LE9 B;  2LAN A;  4AOM A;  4INX A;  1B1G A;  1U5I A;  4C0K A;  1SW8 A;  2ISD A;  3D75 A;  3CGA A;  1TCF A;  3AKB A;  4AQJ A;  2WND A;  1KQM B;  2CXJ A;  4HRH A;  3NHT A;  2JOJ A;  3A8R A;  3I5G C;  4MZJ A;  1N65 A;  1DC1 A;  1WRL A;  2LP2 A;  1QV0 A;  2Q4U A;  4MVF A;  3UO9 A;  1QVI Z;  4JD9 A;  3KO0 A;  3D74 A;  1B47 A;  1B9A A;  1OOG A;  2H61 A;  3PSR A;  2BAP A;  4DUQ A;  2L0P A;  3L4L A;  1NIW A;  2JWW A;  1CM1 A;  1CFC A;  1BT6 A;  3PLF B;  1Y1X A;  3SS5 A;  3BOW B;  2LHI A;  1SBJ A;  1XO5 A;  3FE8 A;  1G33 A;  1CDN A;  2KQ6 A;  4PE0 A;  1J7R A;  1P28 A;  4MZK A;  4PE4 A;  1F71 A;  1DF0 B;  4OVN F;  1PSB A;  4MLW A;  1BU3 A;  2QDI A;  1VRK A;  2OS8 B;  1C7W A;  1Q80 A;  3BFA A;  4MBE A;  3VRR A;  1Z4H A;  4D1E A;  4YRU A;  3S0F A;  1KFU L;  3WHU B;  2Y1N A;  1K8U A;  1QAT A;  2MHH A;  3CZ1 A;  1W7J B;  3GK1 A;  1LS8 A;  4MSP A;  1XFZ O;  2KFH A;  1JSA A;  1CKK A;  4WQ3 A;  1BOC A;  1QIW A;  4IL1 A;  4OCI A;  2BEC A;  2HPS A;  1CFD A;  3SG2 A;  2BCX A;  5CPV A;  5CSN A;  2D8N A;  2FCE A;  4GGN A;  5KSZ A;  2KDH A;  2KAX A;  4JKT A;  1OOH A;  2JRF A;  4XJK B;  1JWD A;  1KQV A;  1BOD A;  2KBI A;  2K2F A;  1TWO A;  2M0R A;  3GK2 A;  4PAL A;  4AQI A;  3O4X A;  1XFW O;  1TOP A;  5KU1 A;  1F8H A;  4DCK A;  1KFX L;  2LMU A;  3NSO A;  3EK7 A;  3D73 A;  2FJU B;  4GFT A;  4PHJ A;  1SL9 A;  1YRU B;  1CLL A;  1L2O B;  3AAK A;  1K9U A;  2KSP A;  4OZD A;  4Q04 A;  3D10 A;  1XFU O;  4NDD A;  1NPQ A;  1MUX A;  2LNK A;  1S5G Y;  4YGC B;  4CPV A;  4L9M A;  1C7V A;  1GQM A;  1AUI B;  3KF9 A;  1UHK A;  3SG3 A;  2CBL A;  2LMV A;  1ALW A;  4ZCV A;  1K93 D;  1OOI X;  2RGI A;  5FI6 A;  3BQ3 A;  4P2Y B;  1V1F A;  2OS8 C;  1YUR A;  1CMG A;  3M0W A;  1F54 A;  5HKZ A;  4A4B A;  1XFV O;  3NHI A;  2EGD A;  2MAZ A;  2KI6 D;  1TNW A;  1Y0V H;  2OTG B;  3KPX A;  3TUY B;  1NX2 A;  3H4S E;  1PK0 D;  1JF0 A;  1SR6 B;  2BCB A;  1SYM A;  1OMR A;  5D7F A;  1IIO A;  1PRW A;  1BR4 B;  1OZO A;  1B4C A;  3EKH A;  2MRD A;  2G9B A;  2QEB A;  2ZND A;  2ZN9 A;  3O78 A;  1F70 A;  2PAL A;  4CFR A;  2HQW A;  2M1K B;  5CSJ A;  5DKQ A;  2JXL A;  2K60 A;  1NCY A;  3S0D A;  1KSO A; 
#chains in the Genus database with same CATH homology
 1UP5 A;  1MWN A;  1TN4 A;  1NCZ A;  2CNP A;  5HLO A;  2PSR A;  1BR1 B;  2BE4 A;  3FS7 A;  4HSZ A;  5JOL A;  2WOS A;  1PVA A;  1SCV A;  3OB2 B;  2ZKM X;  4ICB A;  3CS1 A;  3LK1 A;  1YR5 A;  1S6J A;  4PDZ A;  1EG4 A;  5HLV A;  1CLM A;  4WRI A;  1CB1 A;  1H4B A;  2BL0 C;  3SG6 A;  1YUS A;  2KAV A;  1G4Y R;  3C1V A;  1IWQ A;  4ORC B;  1S5G Z;  3LLE A;  1SK6 D;  3QRX A;  2JPT A;  2LVV A;  1TTX A;  1J7P A;  2BKH B;  3O4Y A;  2KGB C;  3VRQ A;  3DD4 A;  5J3X A;  1KK8 B;  2HQ8 A;  1CDP A;  2OTG C;  3GK4 X;  2MBX A;  1IG5 A;  1K90 D;  1OZS A;  3BUO B;  1IQ5 A;  2JUL A;  3D0Y A;  1HQV A;  3BOW A;  1SCM C;  3I5H B;  5PAL A;  3WXA A;  1QIV A;  2NZ0 A;  3EVU A;  1DVI A;  2LUC A;  2KHN A;  3ICB A;  3ZWH A;  1AP4 A;  1A2X A;  1KFX S;  1B7T Z;  1A75 B;  5D69 A;  2TN4 A;  2AUC A;  4BY4 A;  2Y5I A;  2K0J A;  1CDL A;  2K7O A;  4FTG A;  3EKJ A;  2LLT A;  2K7C A;  3NXA A;  2KI4 C;  2P6B B;  2LV7 A;  1WDC B;  5I2L A;  1SPY A;  3I5I C;  1EL4 A;  1Y6W A;  3TZ1 A;  2MA2 A;  3LCP C;  1A03 A;  2LVK A;  2L5X B;  2V53 A;  1FPW A;  4U8D A;  1DJY A;  1N2D A;  2LVJ A;  1YX8 A;  4ZCU A;  1FI6 A;  2GGZ A;  2WCF A;  3I5F C;  1LA3 A;  1SRA A;  3SIA A;  3DF0 B;  2K61 A;  3BYA A;  1KCY A;  1XYD A;  1QJT A;  2F33 A;  4M2P A;  4I5L B;  5AER A;  4YI9 A;  1BF5 A;  1C07 A;  2VRG A;  4I5K A;  4HRG A;  1KQM C;  2JU0 A;  1ZMZ A;  3F45 A;  2EC6 B;  5B8I B;  5CSF A;  5JJG A;  1YVL A;  1M39 A;  5ER4 X;  1MQ1 A;  2HF5 A;  3GOF A;  1CFP A;  3DVJ A;  1J1E A;  4PHK A;  1DJW A;  1MXL C;  1DT7 B;  4ORA B;  2I7A A;  5AFP A;  1NYA A;  4PHM A;  3KHE A;  3PN7 B;  1S3P A;  1WRK A;  4P5O E;  1BMO A;  1NX0 A;  1Y1U A;  2M49 B;  1J7O A;  1K94 A;  1X02 A;  3BUX B;  1YVH A;  1IGV A;  4MN0 A;  1OMV A;  2KQY A;  1MR8 A;  1IKU A;  2BCA A;  4MRY A;  1ZAC A;  4PHN A;  1PAL A;  2M9G A;  3CWG A;  4JQ0 D;  1OQP A;  2O60 A;  3TDI A;  1FI5 A;  2M1U A;  1UHN A;  2CT9 A;  2JQ6 A;  4N5X A;  1QS7 A;  3JVT B;  1SL8 A;  1UUS A;  1GJY A;  2G2B A;  4I5N B;  1SY9 A;  3NSL A;  1IRJ A;  1G8I A;  2SAS A;  1RRO A;  3CR4 X;  4C0J A;  1KK7 Y;  2LMT A;  1CNP A;  1Y1A A;  1QLS A;  3DVK A;  5KTY A;  3BXK A;  1HT9 A;  4YBH B;  1WY9 A;  1ZUZ A;  1YUU A;  1M31 A;  2NCP A;  3NSK A;  1FW4 A;  4JWQ A;  1CM4 A;  1S6I A;  2F3Z A;  3LK0 A;  3PAL A;  1AVS A;  1M63 B;  1JBA A;  4PE7 A;  2M97 A;  1DJZ A;  3TDZ A;  3O2P A;  4UPG A;  2JT0 A;  2ZN8 A;  1B7T Y;  4PE1 A;  2M29 A;  1XVJ A;  2F8P A;  1IH0 A;  1A4P A;  1WRZ A;  3K21 A;  2M3W A;  1YUT A;  2ZRS A;  2F2P A;  1UWO A;  3PAT A;  3VGO A;  1R2U A;  1K96 A;  1TNP A;  3SG5 A;  1IJ6 A;  2SCP A;  3AKA A;  1DJI A;  1L2O C;  5AAN A;  1DGV A;  2JXC A;  1JUO A;  4GNK B;  1YRT B;  1B8C A;  2K8M B;  2WC8 A;  3DVE A;  1NP8 A;  3I5G B;  4M2O A;  5F6T A;  4A4C A;  2AMI A;  3TS5 B;  1NSH A;  3OX6 A;  1JF2 A;  1XFY O;  3PM8 A;  1J1D A;  4N1G A;  2OPO A;  1IJ5 A;  2K7B A;  1KFU S;  2LM5 A;  2AAO A;  5BPJ A;  2MJW B;  2JNX A;  3NSI A;  2KFF A;  1M45 A;  2MLE C;  3HCM A;  2O5G A;  3TUY C;  2E30 A;  1K2H A;  1DTL A;  1SR6 C;  5DKN A;  1RFJ A;  4CFQ A;  2JT8 A;  1KK7 Z;  1MF8 B;  4BY5 A;  2LVI A;  1CDM A;  1UHI A;  4DS7 A;  1ODB A;  2LCP A;  5HKW A;  4M2Q A;  1SMG A;  4GGF C;  2M7N A;  4YGB B;  1DF0 A;  2E6W A;  1OMD A;  2WCB A;  2BKI B;  3VRP A;  2KGR A;  1H8B A;  5IBW A;  3MSE B;  4YGE B;  3BUW B;  2K2A A;  5I2Q A;  1TNX A;  2L4I A;  3CR5 X;  3CZT X;  4CLN A;  1J55 A;  1YX7 A;  2GV5 A;  2NCO A;  2H2K A;  2JTT A;  1XK4 C;  3VRN A;  1B8R A;  1CLB A;  1OSA A;  3DF0 A;  1KSM A;  2PMY A;  5AEQ A;  1K9P A;  1A29 A;  1V1G A;  1EXR A;  2GGM A;  3FWB A;  3JTD B;  4MEW A;  2JZI A;  4MZL A;  2KOT A;  4MRX A;  5GQQ C;  3PFV A;  3TS5 C;  1PSR A;  1S26 D;  4XJK A;  1LKJ A;  4NDC A;  4NQG A;  4XYN A;  1SL7 A;  1LIN A;  2Q91 A;  1CFF A;  1ZFS A;  2L50 A;  2KYC A;  1TNQ A;  1QV1 A;  2PAS A;  2EHB A;  4USL A;  2B1U A;  1FBV A;  1R6P A;  1KK8 C;  1S6C A;  1U5I B;  1RJV A;  3D0Y B;  3WNX B;  3OX5 A;  2Y4Q A;  1NWD A;  1RK9 A;  1NCX A;  5FYX A;  2L51 A;  4OR9 B;  3VRO A;  1WLM A;  5I8N A;  3DVM A;  1W7I B;  1RWY A;  2WOR A;  1UHH A;  5AXI A;  1PUL A;  1K9K A;  1SNL A;  1JFJ A;  1LA0 A;  4QJ3 B;  2KNE A;  3I5H C;  5G08 A;  4E68 A;  1NX3 A;  3OB1 B;  2PRU A;  2IS9 A;  3EK8 A;  3OHM B;  4N1F A;  2CCM A;  1AHR A;  2M7L A;  3SG4 A;  4OKH A;  2ZFD A;  1E8A A;  3IQO A;  1GGZ A;  1DJG A;  1MHO A;  5DKR A;  2KFG A;  3AAJ A;  1CTR A;  1OE9 B;  1BLQ A;  4YGD B;  4FQO A;  1F4Q A;  2FCD A;  2JT3 A;  1DGU A;  2FOT A;  2NXQ A;  3LL8 B;  1BJF A;  1LVC D;  1QAS A;  1REC A;  1WDC C;  3JTD C;  1L7Z A;  1QTX A;  2M8U A;  4YI8 A;  3EVV A;  4F0Z B;  1WLZ A;  2R2I A;  4GGF A;  4GBA A;  1EJ3 A;  2I2R E;  1M46 A;  1QX2 A;  2LHL A;  1BG1 A;  2ZRT A;  1TRF A;  2F2O A;  3A4U B;  4GAO A;  2K7D A;  3FIA A;  1QX7 A;  1KWO B;  2PVB A;  1AJ5 A;  4PCW A;  1EH2 A;  1LXF C;  4C0L A;  1QXP A;  1GGW A;  5K89 A;  3SIB A;  3TDU A;  2QAC A;  1QX5 B;  4QJ5 B;  1YTZ C;  3KEV A;  4ETO A;  1XK4 A;  1UHJ A;  2BBM A;  2BL0 B;  1IQ3 A;  2I94 A;  2ZNE A;  1RTP 1;  2LLU A;  5I2O A;  3RM1 A;  4NDB A;  3OP0 A;  2NLN A;  3CR2 A;  4ORB B;  2COL B;  2EC6 C;  1S1E A;  2DOQ A;  1JFK A;  4GPL B;  2H61 C;  2KAY A;  1MXE A;  1SKT A;  2JNF A;  2L4H A;  5ER5 A;  2A4J A;  2KBM A;  2MLF C;  2I18 A;  3SJS A;  3FWC A;  2L98 A;  5TNC A;  3O6B A;  4WQ2 A;  3PN7 C;  1TIZ A;  4DRW A;  1PVB A;  1B8L A;  1CMF A;  1ALV A;  1FF1 A;  1JC2 A;  1SCM B;  2BE6 A;  4GUK A;  1DJX A;  2CTN A;  3EVR A;  1DMO A;  4CID A;  2QPT A;  2WCE A;  2HET A;  1QVI Y;  4JPZ B;  2Y1M A;  3WHT B;  1QLK A;  4DIR A;  2LAP A;  1XFX O;  1UUR A;  4YGA A;  3IQQ A;  4R1E A;  2JTZ A;  3CLN A;  3JVT C;  4QJ4 B;  3E3R A;  1A75 A;  1KWO C;  1XA5 A;  1EG3 A;  4HRE E;  3RLZ A;  2KYF A;  2L2E A;  2BBN A;  1DJH A;  2JC2 A;  2F3Y A;  3BUN B;  1F4O A;  2LP3 A;  4I5J A;  1F55 A;  2KI4 B;  2LLS A;  1S36 A;  1OOJ A;  5HYD A;  1D1O A;  3ZNI A;  3I5I B;  1NUB A;  4TNC A;  3SG7 A;  2LC5 A;  2LUX A;  5CSI A;  1AK8 A;  1K95 A;  4OV2 A;  1TCO B;  1J7Q A;  3CTN A;  3BUM B;  5HKY A;  1ZOT B;  1NX1 A;  3I5F B;  3IF7 A;  1N0Y A;  1AJ4 A;  2KI6 C;  3EK4 A;  3HX4 A;  2LE9 B;  2LAN A;  4AOM A;  1B1G A;  1U5I A;  4C0K A;  1SW8 A;  2ISD A;  3CGA A;  1TCF A;  3AKB A;  4AQJ A;  2WND A;  1KQM B;  2CXJ A;  4HRH A;  2JOJ A;  3A8R A;  3I5G C;  4MZJ A;  1N65 A;  1WRL A;  2LP2 A;  1QV0 A;  2Q4U A;  4MVF A;  1QVI Z;  3KO0 A;  1B47 A;  1B9A A;  2H61 A;  3PSR A;  4DUQ A;  2L0P A;  1NIW A;  2JWW A;  1CM1 A;  1CFC A;  1BT6 A;  3PLF B;  1Y1X A;  3BOW B;  2LHI A;  1SBJ A;  1XO5 A;  1G33 A;  1CDN A;  2KQ6 A;  4PE0 A;  1J7R A;  4MZK A;  4PE4 A;  1F71 A;  1DF0 B;  4OVN F;  1PSB A;  4MLW A;  1BU3 A;  1VRK A;  2OS8 B;  1C7W A;  1Q80 A;  4MBE A;  3VRR A;  4D1E A;  4YRU A;  1KFU L;  3WHU B;  2Y1N A;  1K8U A;  1QAT A;  2MHH A;  3GK1 A;  1W7J B;  4MSP A;  1XFZ O;  2KFH A;  1JSA A;  1CKK A;  4WQ3 A;  1BOC A;  1QIW A;  4IL1 A;  4OCI A;  2BEC A;  2HPS A;  1CFD A;  3SG2 A;  2BCX A;  5CPV A;  5CSN A;  2D8N A;  2FCE A;  4GGN A;  5KSZ A;  2KDH A;  2KAX A;  1KQV A;  4XJK B;  2JRF A;  1JWD A;  1BOD A;  2KBI A;  2K2F A;  3GK2 A;  2M0R A;  4PAL A;  4AQI A;  1XFW O;  1TOP A;  5KU1 A;  1F8H A;  4DCK A;  1KFX L;  2LMU A;  3NSO A;  3EK7 A;  2FJU B;  4GFT A;  4PHJ A;  1SL9 A;  1YRU B;  1CLL A;  1L2O B;  3AAK A;  1K9U A;  2KSP A;  4Q04 A;  3D10 A;  1XFU O;  4NDD A;  1NPQ A;  1MUX A;  2LNK A;  1S5G Y;  4YGC B;  4CPV A;  4L9M A;  1C7V A;  1GQM A;  1AUI B;  3KF9 A;  1UHK A;  3SG3 A;  2CBL A;  2LMV A;  1ALW A;  4ZCV A;  1K93 D;  2RGI A;  3BQ3 A;  4P2Y B;  1V1F A;  2OS8 C;  1YUR A;  1CMG A;  3M0W A;  1F54 A;  5HKZ A;  4A4B A;  1XFV O;  2EGD A;  2MAZ A;  2KI6 D;  1TNW A;  1Y0V H;  2OTG B;  3KPX A;  3TUY B;  1NX2 A;  3H4S E;  1PK0 D;  2BCB A;  1JF0 A;  1SR6 B;  1SYM A;  1OMR A;  5D7F A;  1PRW A;  1BR4 B;  1OZO A;  1B4C A;  3EKH A;  2MRD A;  2G9B A;  2ZND A;  2ZN9 A;  1F70 A;  3O78 A;  2PAL A;  4CFR A;  2HQW A;  2M1K B;  5CSJ A;  5DKQ A;  2JXL A;  1NCY A;  1KSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...