1CMFA

Nmr solution structure of apo calmodulin carboxy-terminal domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
b'MKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALMODULIN (VERTEBRATE)
molecule tags Calcium-binding protein
source organism Bos taurus
publication title Calcium-induced structural changes and domain autonomy in calmodulin.
pubmed doi rcsb
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1995-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cmfA00
1J7RA 2LM5A 3BQ3A 3PM8A 4AQJA 1EH2A 2CCMA 4I5NB 2LHIA 5HKZA 4GUKA 1XFZO 2LP3A 4M2PA 3SIBA 1JBAA 1CDPA 1M39A 4AQIA 1L2OC 1BG1A 1K9KA 4A4BA 3O6BA 2HPSA 1OE9B 3O78A 1GGWA 2LHLA 3LLEA 3VROA 1V1GA 1QATA 1PRWA 2JT0A 1WDCC 1IJ6A 4CFRA 1S3PA 2TN4A 2KI4C 2AUCA 3JTDB 3DVEA 2KFFA 2BECA 3BYAA 1SPYA 2COLB 2ZNEA 1SL9A 4OR9B 5TNCA 1DF0B 1M63B 2KYFA 1UHIA 1DJHA 4AOMA 2K7BA 4IL1A 4MEWA 1AJ4A 2KI6D 2L0PA 2CT9A 1J1DA 1W7JB 3IQOA 1R6PA 2L51A 3LK1A 1Y1XA 4YI8A 4PE4A 1IGVA 1D1OA 3BUXB 2PVBA 3RM1A 1TN4A 3TDZA 1FF1A 3D10A 1CB1A 2HQ8A 1QTXA 4MRYA 1FI5A 3DD4A 1OOJA 3EVVA 2KHNA 3BOWA 3JVTC 4NDDA 2JWWA 4NDBA 1S26D 2FJUB 2KAYA 3HCMA 1MHOA 1NYAA 4YGDB 2K7CA 4PHKA 3TDUA 1J1EA 4MSPA 2CXJA 2A4JA 3EKJA 3BUNB 1IKUA 2NLNA 4FTGA 1VRKA 4PHMA 1U5IA 3CGAA 4DCKA 5CSNA 1Y1AA 1SRAA 2KFGA 2L4HA 1OMDA 3VRPA 1MF8B 1KQVA 2BBMA 1KFXS 2Q4UA 2M0RA 3ZWHA 1PVAA 1W7IB 2KFHA 2LV7A 2PASA 1DGVA 1K9UA 2EGDA 3PLFB 1YUUA 1FPWA 2K8MB 1IH0A 3TDIA 1JSAA 3OB1B 4YI9A 1NP8A 1QX2A 4OKHA 1BODA 4C0JA 2M1KB 4MN0A 2JTZA 1KK7Y 1YR5A 3KHEA 1OZSA 1UHJA 5FYXA 1SL7A 2JQ6A 4GNKB 3C1VA 3I5FC 3GOFA 3KF9A 4PE1A 2OS8B 3BUMB 3KPXA 2EC6B 3BOWB 4BY5A 5BPJA 2I2RE 2L4IA 3EK4A 2M3WA 1RTP1 1OZOA 2LAPA 2RGIA 1DVIA 1QVIY 1YRTB 2KQ6A 2V53A 2I18A 1J55A 1WLZA 1J7OA 2Y1MA 2JC2A 5D69A 1LVCD 3I5GC 1K94A 1AK8A 2F33A 2BCXA 1H8BA 2CNPA 1S6CA 2G2BA 2BL0B 1A75A 1CKKA 5HYDA 2AAOA 2BE6A 3WHTB 1DTLA 1TCOB 3TS5B 1TNXA 1NCYA 2PALA 2KAVA 4GGFC 2K7DA 2JPTA 1NX3A 1OSAA 1NSHA 3I5FB 1RWYA 3VRQA 4DUQA 1QS7A 4CFQA 1NX2A 1UURA 2O60A 3SG6A 5KSZA 4ZCUA 1M31A 2KGRA 1CMFA 2M8UA 4ORCB 4OV2A 1SYMA 3CZTX 3ZNIA 1BOCA 4MRXA 5F6TA 1F54A 1A4PA 3I5GB 1CLLA 1ZACA 5DKRA 5IBWA 1TCFA 3PFVA 1J7PA 5JOLA 2B1UA 4HSZA 1PALA 2L5XB 1EG3A 1L7ZA 1G8IA 1WRKA 1CTRA 2BE4A 2NCOA 2LUCA 4P5OE 2F3YA 1RECA 2BKHB 3BXKA 3CLNA 3OP0A 1SL8A 5HLOA 2LP2A 4DS7A 4MVFA 1NWDA 5K89A 1SNLA 2K2FA 1B9AA 2E30A 2PMYA 4E68A 1KQMC 1PK0D 4PE7A 1F4OA 2OS8C 4C0KA 4R1EA 2Y4QA 1IRJA 1LA0A 1ZFSA 1UHHA 2LC5A 1BLQA 3EK7A 1WDCB 1C7VA 4JPZB 4PE0A 4MZKA 4WQ2A 1FW4A 2QACA 1CM1A 3O4YA 1WLMA 4L9MA 3SJSA 1BF5A 1FBVA 2M9GA 2NZ0A 1Q80A 1KCYA 1NX0A 3AAJA 1BT6A 2LLUA 4PCWA 3TZ1A 3SG2A 1S5GZ 1MXLC 4CLNA 2L2EA 1K93D 1F71A 1GQMA 1XFVO 1K9PA 2L50A 2M97A 1CDMA 1MXEA 5DKQA 1ALVA 1CM4A 2WCEA 3DVKA 4MZJA 1MR8A 2QPTA 1F55A 3RLZA 4PDZA 4OVNF 5I2QA 3LL8B 4BY4A 1TTXA 1DJXA 4A4CA 2JT8A 1DT7B 1QVIZ 1KK8C 2CTNA 4YGBB 3F45A 1JFJA 4CIDA 1PSRA 2KSPA 1LKJA 1IG5A 4GPLB 2JT3A 3DF0B 3I5IC 2JXLA 1DJIA 1S5GY 5AANA 3FWBA 3FWCA 1XK4A 1K96A 1XYDA 2LVKA 1DJYA 2M49B 1KSMA 1TRFA 3PSRA 3FIAA 2WCBA 4NDCA 2D8NA 2GGMA 2JXCA 1QXPA 3GK2A 4HRGA 1JFKA 3AKBA 1K95A 4YRUA 1SCMC 5PALA 2JNXA 3PN7C 1G33A 1XVJA 4XJKA 2H61A 1DJGA 1SY9A 2P6BB 3TUYB 1FI6A 5AEQA 5HKYA 1OMRA 5CSFA 2JTTA 3I5HB 1XA5A 2AMIA 1RJVA 1DJZA 2KI4B 3VRRA 3WHUB 3IQQA 1SR6C 3WNXB 2LCPA 3GK4X 1MUXA 1IQ5A 2LMUA 1NPQA 3ICBA 2I7AA 2KNEA 1ZUZA 1A29A 1B8LA 1JF2A 1WRLA 1AHRA 2Y5IA 4OCIA 1QX5B 4D1EA 1F70A 3GK1A 2WC8A 3NXAA 3CR5X 1YX8A 1X02A 4C0LA 3OX6A 5ER5A 1XK4C 1CNPA 2LLSA 1K8UA 1LXFC 3PN7B 2F3ZA 3DF0A 3TUYC 2NXQA 4YGEB 1BJFA 3OB2B 4MLWA 1QJTA 1YTZC 4NQGA 1KFXL 1H4BA 5B8IB 2ZN8A 2ZFDA 1BR4B 2Q91A 1NUBA 1CDLA 2GGZA 1AVSA 1Y0VH 1N2DA 1BR1B 1YUTA 1KSOA 1V1FA 1F4QA 3PALA 1SR6B 1HQVA 2H61C 3AAKA 5I8NA 5AERA 4N1FA 1GJYA 1S36A 4QJ4B 2M7LA 4N5XA 5I2OA 1AP4A 1B1GA 3D0YA 3M0WA 2MBXA 2MHHA 5CPVA 3K21A 1YURA 1XFUO 1XFYO 2KAXA 2LE9B 1JUOA 3EVUA 5CSJA 2HQWA 1YRUB 4CPVA 1C07A 1DGUA 1YX7A 2WCFA 1CFCA 2GV5A 1NCXA 2KDHA 3SG4A 1OMVA 2EC6C 4PHJA 4PHNA 3SG5A 1KK7Z 3BUWB 1HT9A 1TOPA 2BCAA 1KQMB 3NSLA 4GGFA 3CR4X 3DVMA 2E6WA 5J3XA 4ORBB 2OPOA 1PSBA 4QJ3B 2ISDA 1QIVA 3LCPC 1TNQA 2ZRSA 1XFWO 3PATA 2WORA 2I94A 4UPGA 1CDNA 1SKTA 2KBIA 2M1UA 4USLA 1SBJA 2KOTA 2LANA 4ICBA 1LA3A 3D0YB 4XYNA 1QV1A 3O2PA 1LINA 2KBMA 2SCPA 2ZN9A 1QIWA 1L2OB 1N65A 4GAOA 5AFPA 1F8HA 1PVBA 3A8RA 2JRFA 1K2HA 4U8DA 2HETA 4Q04A 1UHKA 3DVJA 1ZMZA 1NCZA 2MAZA 3IF7A 2MJWB 1QLKA 5AXIA 1MWNA 1C7WA 3CS1A 1AJ5A 1M46A 5G08A 1JC2A 1B8RA 2G9BA 2R2IA 1KWOC 1UP5A 2ZKMX 3QRXA 2WNDA 2LMTA 4MBEA 3SG7A 1CFPA 1DMOA 2HF5A 1TIZA 2EHBA 3JTDC 1A2XA 4DRWA 5D7FA 2K7OA 2MRDA 1QASA 1TNPA 5HKWA 1A75B 3SG3A 2JOJA 2F2PA 2JULA 1CFDA 2LMVA 5I2LA 3EK8A 5DKNA 1XO5A 3MSEB 1JF0A 1A03A 1WY9A 1SMGA 2F8PA 1ALWA 1NX1A 2BL0C 4GFTA 1B4CA 1OQPA 3VGOA 3H4SE 4I5LB 3OHMB 4ZCVA 2PSRA 1RFJA 1SCMB 2H2KA 1UHNA 4MZLA 2BBNA 2K0JA 2LVVA 2M7NA 2MA2A 4GBAA 2K61A 1KFUL 1RROA 5GQQC 5JJGA 1KWOB 2IS9A 2MLEC 1J7QA 2JZIA 4JWQA 1MQ1A 5KU1A 2SASA 3I5HC 4PALA 2K2AA 1CMGA 4XJKB 4HRHA 1RK9A 3EVRA 4YGCB 2LLTA 2ZNDA 2LNKA 3LK0A 1S6IA 2M29A 4FQOA 2O5GA 1UUSA 1R2UA 1E8AA 1SCVA 3CTNA 4ORAB 1ODBA 1SK6D 1DJWA 3OX5A 1G4YR 2FCEA 1AUIB 1K90D 5ER4X 4JQ0D 1B47A 1WRZA 3KEVA 3VRNA 3WXAA 4N1GA 2KQYA 3AKAA 5HLVA 1U5IB 4GGNA 5CSIA 4DIRA 2FCDA 1IWQA 1EXRA 4M2OA 1SW8A 1IQ3A 5KTYA 2KGBC 1KK8B 4YBHB 4F0ZB 1B8CA 4TNCA 2BKIB 2LVJA 1YVHA 1YUSA 1ZOTB 1IJ5A 4M2QA 1S1EA 1YVLA 1BMOA 3A4UB 1QX7A 2VRGA 1EL4A 2FOTA 1N0YA 1S6JA 2DOQA 2KI6C 3EKHA 2OTGC 3I5IB 1CLMA 3FS7A 2ZRTA 2JU0A 4WQ3A 4WRIA 1EJ3A 1M45A 3E3RA 2F2OA 4YGAA 1QLSA 1CFFA 1XFXO 1QV0A 4QJ5B 1EG4A 1Y1UA 4P2YB 1UWOA 2KYCA 3NSKA 1PULA 2LUXA 4HREE 3SIAA 1DF0A 1B7TZ 2WOSA 2NCPA 1Y6WA 1JWDA 2PRUA 1GGZA 1BU3A 3BUOB 3TS5C 3HX4A 3JVTB 2MLFC 3KO0A 1B7TY 2BCBA 1NIWA 3CR2A 3NSIA 2CBLA 1TNWA 2L98A 1CLBA 3NSOA 4ETOA 2JNFA 1KFUS 2LVIA 4I5JA 4I5KA 2OTGB 2Y1NA 3CWGA
chains in the Genus database with same CATH superfamily
1J7RA 2LM5A 2QEHA 3BQ3A 3QMEA 3PM8A 4AQJA 1EH2A 2CCMA 4I5NB 2LHIA 5HKZA 1C3ZA 4GUKA 3NHTA 1XFZO 2LP3A 4M2PA 3SIBA 1JBAA 1CDPA 1M39A 4AQIA 1L2OC 1BG1A 1K9KA 4A4BA 2QEVA 3O6BA 2HPSA 1OE9B 3B87A 3O78A 1GGWA 2LHLA 4INXA 1TUZA 3LLEA 3VROA 1QWVA 1V1GA 1QATA 1PRWA 3L47A 3S0AA 1P28A 2JT0A 1WDCC 1IJ6A 4CFRA 1S3PA 2TN4A 2KI4C 2AUCA 3DY9A 3JTDB 3DVEA 2KFFA 2BECA 3BYAA 1SPYA 2COLB 4IJ7A 2ZNEA 1SL9A 4OR9B 5TNCA 1DF0B 1M63B 2KYFA 1UHIA 1DJHA 4AOMA 2K7BA 4IL1A 4MEWA 1AJ4A 2KI6D 2L0PA 2CT9A 1J1DA 1W7JB 3IQOA 1R6PA 2L51A 3LK1A 1Y1XA 4YI8A 4PE4A 1IGVA 3R1VA 5D3OA 1D1OA 3BUXB 2PVBA 3RM1A 1TN4A 3TDZA 1FF1A 3D10A 3B86A 1CB1A 2HQ8A 1QTXA 4MRYA 1XFRA 1FI5A 3DD4A 1OOJA 3EVVA 2KHNA 3BOWA 3JVTC 4NDDA 2JWWA 4FQTA 4NDBA 1DQEA 1S26D 2FJUB 2KAYA 3HCMA 5DICA 1MHOA 1NYAA 2WC5A 2K7CA 4YGDB 4PHKA 3TDUA 2KLDA 1J1EA 4MSPA 2CXJA 2A4JA 3EKJA 3BUNB 1IKUA 2NLNA 4FTGA 1VRKA 4PHMA 1U5IA 3CGAA 4DCKA 5CSNA 1Y1AA 1SRAA 2KFGA 2L4HA 1OMDA 2KPHA 3VRPA 1MF8B 1KQVA 1ORGA 2BBMA 2GTEA 3EG5B 1KFXS 2Q4UA 2M0RA 3ZWHA 1PVAA 1W7IB 2KFHA 2LV7A 2PASA 1DGVA 1K9UA 2EGDA 3PLFB 1YUUA 1FPWA 3DYEA 2K8MB 1IH0A 3TDIA 1JSAA 3OB1B 4YI9A 1NP8A 1QX2A 3PM2A 4OKHA 1BODA 4C0JA 2M1KB 4MN0A 2JTZA 1KK7Y 1YR5A 3KHEA 1OZSA 1UHJA 5FYXA 1SL7A 2JQ6A 4GNKB 3C1VA 3B7AA 3GOFA 3I5FC 3KF9A 4PE1A 3D74A 1OOGA 2OS8B 3BUMB 3KPXA 2EC6B 3BOWB 4BY5A 5BPJA 2I2RE 2L4IA 3EK4A 2M3WA 1RTP1 1OZOA 2LAPA 2RGIA 1DVIA 1QVIY 1YRTB 2KQ6A 2V53A 2I18A 1J55A 1WLZA 1J7OA 2Y1MA 2JC2A 5D69A 1LVCD 3I5GC 1K94A 1AK8A 2F33A 2BCXA 4INWA 1H8BA 3S0FA 2CNPA 1S6CA 2G2BA 2BL0B 3R1PA 1A75A 1CKKA 3CZ1A 5HYDA 2AAOA 3Q8IA 2BE6A 3NGVA 2QDIA 3WHTB 1DTLA 1TCOB 3TS5B 1TNXA 1NCYA 2PALA 2KAVA 4GGFC 2K7DA 2JPTA 1NX3A 1OSAA 1NSHA 3I5FB 1RWYA 5FI2A 3VRQA 4DUQA 1QS7A 3CYZA 4CFQA 1NX2A 1UURA 2O60A 3SG6A 5KSZA 4ZCUA 1M31A 2KGRA 1CMFA 2M8UA 4ORCB 4OV2A 1SYMA 3CZTX 3ZNIA 1BOCA 3L4LA 4MRXA 5F6TA 3BFBA 1F54A 1A4PA 3I5GB 1CLLA 2WC6A 3CABA 1ZACA 3IVTA 5DKRA 5IBWA 1TCFA 3PFVA 5FI6A 5JOLA 1J7PA 2B1UA 4HSZA 1PALA 2L5XB 1EG3A 1L7ZA 5I94A 1G8IA 1WRKA 1CTRA 2BE4A 2NCOA 2LUCA 4P5OE 2F3YA 3NHIA 1RECA 2BKHB 3BXKA 3CLNA 3OP0A 1SL8A 5HLOA 2LP2A 4DS7A 4MVFA 1NWDA 5K89A 1SNLA 2K2FA 1B9AA 2E30A 2PMYA 4E68A 1KQMC 1PK0D 4OZDA 4PE7A 1F4OA 2OS8C 2PQLA 4C0KA 4R1EA 3K1EA 2Y4QA 1IRJA 1ZFSA 1LA0A 1UHHA 2LC5A 1BLQA 3EK7A 1WDCB 1C7VA 4JPZB 4PE0A 2WCMA 4MZKA 4WQ2A 1FW4A 2QACA 1CM1A 2K60A 1WLMA 3O4YA 4L9MA 3SJSA 3SS4A 1BF5A 1FBVA 2M9GA 2NZ0A 1Q80A 1KCYA 1NX0A 3BJHA 3AAJA 1BT6A 2LLUA 4PCWA 3TZ1A 3SG2A 1S5GZ 1MXLC 4CLNA 2L2EA 1K93D 1F71A 1GQMA 1XFVO 1K9PA 2L50A 2M97A 1CDMA 1MXEA 5DKQA 1ALVA 1CM4A 2WCEA 1OOHA 3DVKA 1MR8A 2QPTA 4MZJA 3S0DA 1F55A 3RLZA 4PDZA 4OVNF 5I2QA 3LL8B 4BY4A 1TTXA 1DJXA 4A4CA 2JT8A 1DT7B 1QVIZ 1KK8C 2CTNA 4YGBB 3F45A 1JFJA 3D75A 4CIDA 1PSRA 2KSPA 1LKJA 3FE9A 1IG5A 4GPLB 2JT3A 3DF0B 3I5IC 2JXLA 1DJIA 1S5GY 5AANA 3FWBA 3FWCA 1XK4A 1K96A 1XYDA 1OOIX 4KYNA 2LVKA 1DJYA 2M49B 1KSMA 1TRFA 3PSRA 3FIAA 2WCBA 4NDCA 2D8NA 2GGMA 2JXCA 1QXPA 3GK2A 4HRGA 1JFKA 3AKBA 1K95A 4YRUA 1SCMC 5PALA 3R1OA 2JNXA 3PN7C 1G33A 1XVJA 3UO9A 4XJKA 1Z2CB 1DJGA 1SY9A 2H61A 2P6BB 3D76A 3FE6A 3O4XA 3TUYB 1FI6A 5AEQA 5HKYA 1OMRA 3CZ0A 5CSFA 2JTTA 3I5HB 1XA5A 2AMIA 1RJVA 1DJZA 2KI4B 3VRRA 3WHUB 3IQQA 1SR6C 3WNXB 2LCPA 3GK4X 3PJIA 1MUXA 2KLEA 1IQ5A 2LMUA 1NPQA 3ICBA 2I7AA 2KNEA 1ZUZA 1A29A 1B8LA 1JF2A 1WRLA 3N7HA 3UNWA 1AHRA 2Y5IA 4OCIA 1QX5B 4D1EA 1F70A 2PYQA 3GK1A 2WC8A 3NXAA 3CR5X 1YX8A 1X02A 4C0LA 2YGUA 3OX6A 5ER5A 1XK4C 2BAPA 1CNPA 2LLSA 1K8UA 1LXFC 3PN7B 2F3ZA 3VB1A 3DF0A 3TUYC 2NXQA 4YGEB 1BJFA 3OB2B 1SSEB 4MLWA 1QJTA 1YTZC 1DELA 1KFXL 4NQGA 1H4BA 5B8IB 1TWOA 2ZN8A 2ZFDA 1BR4B 2Q91A 1NUBA 3DZTA 1CDLA 2GGZA 2FJYA 1AVSA 1Y0VH 1N2DA 4JKTA 1BR1B 1YUTA 1KSOA 1V1FA 1F4QA 3PALA 1C3YA 1SR6B 1HQVA 2H61C 3AAKA 5I8NA 5AERA 4N1FA 1GJYA 1S36A 4QJ4B 2M7LA 4N5XA 5I2OA 1AP4A 1B1GA 3D0YA 3D78A 3M0WA 2MBXA 2MHHA 5CPVA 3K21A 1YURA 1XFUO 1XFYO 2KAXA 2LE9B 1JUOA 3EVUA 5CSJA 1YRUB 2HQWA 4CPVA 1C07A 1DGUA 1YX7A 2WCFA 2L2CA 4F7FA 2GV5A 1NCXA 1CFCA 3S0EA 2KDHA 3SG4A 1OMVA 2EC6C 3SS3A 4PHJA 4PHNA 3SG5A 1KK7Z 3BUWB 1HT9A 1TOPA 2BCAA 1KQMB 3NSLA 4GGFA 3BFHA 3CR4X 3DVMA 2E6WA 5J3XA 4ORBB 2OPOA 1PSBA 4QJ3B 2ISDA 1QIVA 3LCPC 1TNQA 2ZRSA 1XFWO 3PATA 2WORA 2I94A 4UPGA 1CDNA 1SKTA 2H8VA 2KBIA 2M1UA 4USLA 1SBJA 2KOTA 2LANA 4ICBA 1LA3A 3D0YB 4XYNA 1QV1A 3O2PA 1LINA 2KBMA 2SCPA 2ZN9A 1QIWA 1L2OB 1N65A 4GAOA 5AFPA 1F8HA 1PVBA 3A8RA 2JRFA 1K2HA 4U8DA 1Z4HA 2HETA 4Q04A 1UHKA 3DVJA 1ZMZA 1NCZA 2MAZA 3IF7A 2MJWB 1QLKA 3OBVA 5AXIA 1MWNA 3L4AA 1C7WA 3CS1A 1AJ5A 1M46A 5G08A 1JC2A 1B8RA 2G9BA 2R2IA 1KWOC 1UP5A 2ZKMX 3QRXA 2WNDA 2LMTA 4MBEA 3SG7A 1CFPA 1DMOA 2HF5A 1TIZA 2EHBA 3V2LA 3JTDC 1A2XA 4DRWA 2BNXA 5D7FA 2K7OA 2MRDA 1QASA 1TNPA 5HKWA 1A75B 3SG3A 2JOJA 2F2PA 2JULA 1CFDA 2LMVA 2P70A 5I2LA 3EK8A 5DKNA 1XO5A 3MSEB 1JF0A 1A03A 1WY9A 1SMGA 2F8PA 1ALWA 2WCLA 1NX1A 2BL0C 4GFTA 1B4CA 1OQPA 3VGOA 3H4SE 4I5LB 3OHMB 4ZCVA 2PSRA 1RFJA 1SCMB 2H2KA 1UHNA 4MZLA 2BBNA 2K0JA 2JPOA 2LVVA 2M7NA 2MA2A 4GBAA 4PT1A 1DC1A 2K61A 1KFUL 1RROA 5GQQC 2QEBA 3CDNA 5JJGA 1KWOB 2IS9A 2MLEC 4JD9A 2JZIA 1J7QA 4JWQA 1MQ1A 5KU1A 2SASA 3I5HC 4PALA 2K2AA 1CMGA 4XJKB 2ERBA 4HRHA 1IIOA 1RK9A 3EVRA 4YGCB 2LLTA 3D73A 1TUJA 2QEOA 2ZNDA 2LNKA 3LK0A 1S6IA 2M29A 4FQOA 3FE8A 3RZSA 2O5GA 1UUSA 1R2UA 1E8AA 1SCVA 3CTNA 4ORAB 1ODBA 1SK6D 1DJWA 3OX5A 1G4YR 3R72A 2FCEA 3BFAA 1AUIB 1K90D 5ER4X 4JQ0D 1B47A 1WRZA 3KEVA 3VRNA 3WXAA 4N1GA 2KQYA 3AKAA 5HLVA 1U5IB 1LS8A 4GGNA 5CSIA 3CZ2A 2WCKA 4DIRA 2FCDA 1W9ZA 1IWQA 1EXRA 5EL2A 3S0BA 4M2OA 5HL1A 1SW8A 1IQ3A 3S0GA 5KTYA 2KGBC 1KK8B 4YBHB 4F0ZB 1B8CA 4TNCA 1OOFA 2BKIB 2LVJA 1YVHA 1YUSA 1ZOTB 1IJ5A 4M2QA 1S1EA 1YVLA 1BMOA 2P71A 3A4UB 1QX7A 2VRGA 1EL4A 2FOTA 1N0YA 1S6JA 2DOQA 2KI6C 3EKHA 2OTGC 3B6XA 3I5IB 1CLMA 3FS7A 2ZRTA 2JU0A 4WQ3A 4WRIA 1EJ3A 1M45A 3E3RA 1OW4A 2F2OA 1QLSA 4YGAA 1XFXO 1CFFA 1QV0A 4QJ5B 1EG4A 3D77A 5FI7A 1T14A 1Y1UA 4P2YB 1UWOA 2KYCA 3NSKA 1PULA 2LUXA 4HREE 3SIAA 1DF0A 1B7TZ 2WOSA 2NCPA 1Y6WA 3B88A 1JWDA 2PRUA 1GGZA 3DXLA 1BU3A 3BUOB 3TS5C 3HX4A 3JVTB 2WCHA 3SS5A 2MLFC 1DEKA 3KO0A 1B7TY 2BCBA 1NIWA 3OGNA 3CR2A 3NSIA 2CBLA 1TNWA 2L98A 1CLBA 3NSOA 4ETOA 1GM0A 2L5YA 2JNFA 1KFUS 2LVIA 4I5JA 2WCJA 4I5KA 2OTGB 2Y1NA 3CWGA
chains in the Genus database with same CATH topology
1J7RA 2LM5A 3BQ3A 3PM8A 4AQJA 1EH2A 2CCMA 4I5NB 2LHIA 5HKZA 4GUKA 1XFZO 2LP3A 4M2PA 3SIBA 1JBAA 1CDPA 1M39A 4AQIA 1L2OC 1BG1A 1K9KA 4A4BA 3O6BA 2HPSA 1OE9B 3O78A 1GGWA 2LHLA 3LLEA 3VROA 1V1GA 1QATA 1PRWA 2JT0A 1WDCC 1IJ6A 4CFRA 1S3PA 2TN4A 2KI4C 2AUCA 3JTDB 3DVEA 2KFFA 2BECA 3BYAA 1SPYA 2COLB 2ZNEA 1SL9A 4OR9B 5TNCA 1DF0B 1M63B 2KYFA 1UHIA 1DJHA 4AOMA 2K7BA 4IL1A 4MEWA 1AJ4A 2KI6D 2L0PA 2CT9A 1J1DA 1W7JB 3IQOA 1R6PA 2L51A 3LK1A 1Y1XA 4YI8A 4PE4A 1IGVA 1D1OA 3BUXB 2PVBA 3RM1A 1TN4A 3TDZA 1FF1A 3D10A 1CB1A 2HQ8A 1QTXA 4MRYA 1FI5A 3DD4A 1OOJA 3EVVA 2KHNA 3BOWA 3JVTC 4NDDA 2JWWA 4NDBA 1S26D 2FJUB 2KAYA 3HCMA 1MHOA 1NYAA 4YGDB 2K7CA 4PHKA 3TDUA 1J1EA 4MSPA 2CXJA 2A4JA 3EKJA 3BUNB 1IKUA 2NLNA 4FTGA 1VRKA 4PHMA 1U5IA 3CGAA 4DCKA 5CSNA 1Y1AA 1SRAA 2KFGA 2L4HA 1OMDA 3VRPA 1MF8B 1KQVA 2BBMA 1KFXS 2Q4UA 2M0RA 3ZWHA 1PVAA 1W7IB 2KFHA 2LV7A 2PASA 1DGVA 1K9UA 2EGDA 3PLFB 1YUUA 1FPWA 2K8MB 1IH0A 3TDIA 1JSAA 3OB1B 4YI9A 1NP8A 1QX2A 4OKHA 1BODA 4C0JA 2M1KB 4MN0A 2JTZA 1KK7Y 1YR5A 3KHEA 1OZSA 1UHJA 5FYXA 1SL7A 2JQ6A 4GNKB 3C1VA 3I5FC 3GOFA 3KF9A 4PE1A 2OS8B 3BUMB 3KPXA 2EC6B 3BOWB 4BY5A 5BPJA 2I2RE 2L4IA 3EK4A 2M3WA 1RTP1 1OZOA 2LAPA 2RGIA 1DVIA 1QVIY 1YRTB 2KQ6A 2V53A 2I18A 1J55A 1WLZA 1J7OA 2Y1MA 2JC2A 5D69A 1LVCD 3I5GC 1K94A 1AK8A 2F33A 2BCXA 1H8BA 2CNPA 1S6CA 2G2BA 2BL0B 1A75A 1CKKA 5HYDA 2AAOA 2BE6A 3WHTB 1DTLA 1TCOB 3TS5B 1TNXA 1NCYA 2PALA 2KAVA 4GGFC 2K7DA 2JPTA 1NX3A 1OSAA 1NSHA 3I5FB 1RWYA 3VRQA 4DUQA 1QS7A 4CFQA 1NX2A 1UURA 2O60A 3SG6A 5KSZA 4ZCUA 1M31A 2KGRA 1CMFA 2M8UA 4ORCB 4OV2A 1SYMA 3CZTX 3ZNIA 1BOCA 4MRXA 5F6TA 1F54A 1A4PA 3I5GB 1CLLA 1ZACA 5DKRA 5IBWA 1TCFA 3PFVA 1J7PA 5JOLA 2B1UA 4HSZA 1PALA 2L5XB 1EG3A 1L7ZA 1G8IA 1WRKA 1CTRA 2BE4A 2NCOA 2LUCA 4P5OE 2F3YA 1RECA 2BKHB 3BXKA 3CLNA 3OP0A 1SL8A 5HLOA 2LP2A 4DS7A 4MVFA 1NWDA 5K89A 1SNLA 2K2FA 1B9AA 2E30A 2PMYA 4E68A 1KQMC 1PK0D 4PE7A 1F4OA 2OS8C 4C0KA 4R1EA 2Y4QA 1IRJA 1LA0A 1ZFSA 1UHHA 2LC5A 1BLQA 3EK7A 1WDCB 1C7VA 4JPZB 4PE0A 4MZKA 4WQ2A 1FW4A 2QACA 1CM1A 3O4YA 1WLMA 4L9MA 3SJSA 1BF5A 1FBVA 2M9GA 2NZ0A 1Q80A 1KCYA 1NX0A 3AAJA 1BT6A 2LLUA 4PCWA 3TZ1A 3SG2A 1S5GZ 1MXLC 4CLNA 2L2EA 1K93D 1F71A 1GQMA 1XFVO 1K9PA 2L50A 2M97A 1CDMA 1MXEA 5DKQA 1ALVA 1CM4A 2WCEA 3DVKA 4MZJA 1MR8A 2QPTA 1F55A 3RLZA 4PDZA 4OVNF 5I2QA 3LL8B 4BY4A 1TTXA 1DJXA 4A4CA 2JT8A 1DT7B 1QVIZ 1KK8C 2CTNA 4YGBB 3F45A 1JFJA 4CIDA 1PSRA 2KSPA 1LKJA 1IG5A 4GPLB 2JT3A 3DF0B 3I5IC 2JXLA 1DJIA 1S5GY 5AANA 3FWBA 3FWCA 1XK4A 1K96A 1XYDA 2LVKA 1DJYA 2M49B 1KSMA 1TRFA 3PSRA 3FIAA 2WCBA 4NDCA 2D8NA 2GGMA 2JXCA 1QXPA 3GK2A 4HRGA 1JFKA 3AKBA 1K95A 4YRUA 1SCMC 5PALA 2JNXA 3PN7C 1G33A 1XVJA 4XJKA 2H61A 1DJGA 1SY9A 2P6BB 3TUYB 1FI6A 5AEQA 5HKYA 1OMRA 5CSFA 2JTTA 3I5HB 1XA5A 2AMIA 1RJVA 1DJZA 2KI4B 3VRRA 3WHUB 3IQQA 1SR6C 3WNXB 2LCPA 3GK4X 1MUXA 1IQ5A 2LMUA 1NPQA 3ICBA 2I7AA 2KNEA 1ZUZA 1A29A 1B8LA 1JF2A 1WRLA 1AHRA 2Y5IA 4OCIA 1QX5B 4D1EA 1F70A 3GK1A 2WC8A 3NXAA 3CR5X 1YX8A 1X02A 4C0LA 3OX6A 5ER5A 1XK4C 1CNPA 2LLSA 1K8UA 1LXFC 3PN7B 2F3ZA 3DF0A 3TUYC 2NXQA 4YGEB 1BJFA 3OB2B 4MLWA 1QJTA 1YTZC 4NQGA 1KFXL 1H4BA 5B8IB 2ZN8A 2ZFDA 1BR4B 2Q91A 1NUBA 1CDLA 2GGZA 1AVSA 1Y0VH 1N2DA 1BR1B 1YUTA 1KSOA 1V1FA 1F4QA 3PALA 1SR6B 1HQVA 2H61C 3AAKA 5I8NA 5AERA 4N1FA 1GJYA 1S36A 4QJ4B 2M7LA 4N5XA 5I2OA 1AP4A 1B1GA 3D0YA 3M0WA 2MBXA 2MHHA 5CPVA 3K21A 1YURA 1XFUO 1XFYO 2KAXA 2LE9B 1JUOA 3EVUA 5CSJA 2HQWA 1YRUB 4CPVA 1C07A 1DGUA 1YX7A 2WCFA 1CFCA 2GV5A 1NCXA 2KDHA 3SG4A 1OMVA 2EC6C 4PHJA 4PHNA 3SG5A 1KK7Z 3BUWB 1HT9A 1TOPA 2BCAA 1KQMB 3NSLA 4GGFA 3CR4X 3DVMA 2E6WA 5J3XA 4ORBB 2OPOA 1PSBA 4QJ3B 2ISDA 1QIVA 3LCPC 1TNQA 2ZRSA 1XFWO 3PATA 2WORA 2I94A 4UPGA 1CDNA 1SKTA 2KBIA 2M1UA 4USLA 1SBJA 2KOTA 2LANA 4ICBA 1LA3A 3D0YB 4XYNA 1QV1A 3O2PA 1LINA 2KBMA 2SCPA 2ZN9A 1QIWA 1L2OB 1N65A 4GAOA 5AFPA 1F8HA 1PVBA 3A8RA 2JRFA 1K2HA 4U8DA 2HETA 4Q04A 1UHKA 3DVJA 1ZMZA 1NCZA 2MAZA 3IF7A 2MJWB 1QLKA 5AXIA 1MWNA 1C7WA 3CS1A 1AJ5A 1M46A 5G08A 1JC2A 1B8RA 2G9BA 2R2IA 1KWOC 1UP5A 2ZKMX 3QRXA 2WNDA 2LMTA 4MBEA 3SG7A 1CFPA 1DMOA 2HF5A 1TIZA 2EHBA 3JTDC 1A2XA 4DRWA 5D7FA 2K7OA 2MRDA 1QASA 1TNPA 5HKWA 1A75B 3SG3A 2JOJA 2F2PA 2JULA 1CFDA 2LMVA 5I2LA 3EK8A 5DKNA 1XO5A 3MSEB 1JF0A 1A03A 1WY9A 1SMGA 2F8PA 1ALWA 1NX1A 2BL0C 4GFTA 1B4CA 1OQPA 3VGOA 3H4SE 4I5LB 3OHMB 4ZCVA 2PSRA 1RFJA 1SCMB 2H2KA 1UHNA 4MZLA 2BBNA 2K0JA 2LVVA 2M7NA 2MA2A 4GBAA 2K61A 1KFUL 1RROA 5GQQC 5JJGA 1KWOB 2IS9A 2MLEC 1J7QA 2JZIA 4JWQA 1MQ1A 5KU1A 2SASA 3I5HC 4PALA 2K2AA 1CMGA 4XJKB 4HRHA 1RK9A 3EVRA 4YGCB 2LLTA 2ZNDA 2LNKA 3LK0A 1S6IA 2M29A 4FQOA 2O5GA 1UUSA 1R2UA 1E8AA 1SCVA 3CTNA 4ORAB 1ODBA 1SK6D 1DJWA 3OX5A 1G4YR 2FCEA 1AUIB 1K90D 5ER4X 4JQ0D 1B47A 1WRZA 3KEVA 3VRNA 3WXAA 4N1GA 2KQYA 3AKAA 5HLVA 1U5IB 4GGNA 5CSIA 4DIRA 2FCDA 1IWQA 1EXRA 4M2OA 1SW8A 1IQ3A 5KTYA 2KGBC 1KK8B 4YBHB 4F0ZB 1B8CA 4TNCA 2BKIB 2LVJA 1YVHA 1YUSA 1ZOTB 1IJ5A 4M2QA 1S1EA 1YVLA 1BMOA 3A4UB 1QX7A 2VRGA 1EL4A 2FOTA 1N0YA 1S6JA 2DOQA 2KI6C 3EKHA 2OTGC 3I5IB 1CLMA 3FS7A 2ZRTA 2JU0A 4WQ3A 4WRIA 1EJ3A 1M45A 3E3RA 2F2OA 4YGAA 1QLSA 1CFFA 1XFXO 1QV0A 4QJ5B 1EG4A 1Y1UA 4P2YB 1UWOA 2KYCA 3NSKA 1PULA 2LUXA 4HREE 3SIAA 1DF0A 1B7TZ 2WOSA 2NCPA 1Y6WA 1JWDA 2PRUA 1GGZA 1BU3A 3BUOB 3TS5C 3HX4A 3JVTB 2MLFC 3KO0A 1B7TY 2BCBA 1NIWA 3CR2A 3NSIA 2CBLA 1TNWA 2L98A 1CLBA 3NSOA 4ETOA 2JNFA 1KFUS 2LVIA 4I5JA 4I5KA 2OTGB 2Y1NA 3CWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7R A;  2LM5 A;  3BQ3 A;  3PM8 A;  4AQJ A;  1EH2 A;  2CCM A;  4I5N B;  2LHI A;  5HKZ A;  4GUK A;  1XFZ O;  2LP3 A;  4M2P A;  3SIB A;  1JBA A;  1CDP A;  1M39 A;  4AQI A;  1L2O C;  1BG1 A;  1K9K A;  4A4B A;  3O6B A;  2HPS A;  1OE9 B;  3O78 A;  1GGW A;  2LHL A;  3LLE A;  3VRO A;  1V1G A;  1QAT A;  1PRW A;  2JT0 A;  1WDC C;  1IJ6 A;  4CFR A;  1S3P A;  2TN4 A;  2KI4 C;  2AUC A;  3JTD B;  3DVE A;  2KFF A;  2BEC A;  3BYA A;  1SPY A;  2COL B;  2ZNE A;  1SL9 A;  4OR9 B;  5TNC A;  1DF0 B;  1M63 B;  2KYF A;  1UHI A;  1DJH A;  4AOM A;  2K7B A;  4IL1 A;  4MEW A;  1AJ4 A;  2KI6 D;  2L0P A;  2CT9 A;  1J1D A;  1W7J B;  3IQO A;  1R6P A;  2L51 A;  3LK1 A;  1Y1X A;  4YI8 A;  4PE4 A;  1IGV A;  1D1O A;  3BUX B;  2PVB A;  3RM1 A;  1TN4 A;  3TDZ A;  1FF1 A;  3D10 A;  1CB1 A;  2HQ8 A;  1QTX A;  4MRY A;  1FI5 A;  3DD4 A;  1OOJ A;  3EVV A;  2KHN A;  3BOW A;  3JVT C;  4NDD A;  2JWW A;  4NDB A;  1S26 D;  2FJU B;  2KAY A;  3HCM A;  1MHO A;  1NYA A;  4YGD B;  2K7C A;  4PHK A;  3TDU A;  1J1E A;  4MSP A;  2CXJ A;  2A4J A;  3EKJ A;  3BUN B;  1IKU A;  2NLN A;  4FTG A;  1VRK A;  4PHM A;  1U5I A;  3CGA A;  4DCK A;  5CSN A;  1Y1A A;  1SRA A;  2KFG A;  2L4H A;  1OMD A;  3VRP A;  1MF8 B;  1KQV A;  2BBM A;  1KFX S;  2Q4U A;  2M0R A;  3ZWH A;  1PVA A;  1W7I B;  2KFH A;  2LV7 A;  2PAS A;  1DGV A;  1K9U A;  2EGD A;  3PLF B;  1YUU A;  1FPW A;  2K8M B;  1IH0 A;  3TDI A;  1JSA A;  3OB1 B;  4YI9 A;  1NP8 A;  1QX2 A;  4OKH A;  1BOD A;  4C0J A;  2M1K B;  4MN0 A;  2JTZ A;  1KK7 Y;  1YR5 A;  3KHE A;  1OZS A;  1UHJ A;  5FYX A;  1SL7 A;  2JQ6 A;  4GNK B;  3C1V A;  3I5F C;  3GOF A;  3KF9 A;  4PE1 A;  2OS8 B;  3BUM B;  3KPX A;  2EC6 B;  3BOW B;  4BY5 A;  5BPJ A;  2I2R E;  2L4I A;  3EK4 A;  2M3W A;  1RTP 1;  1OZO A;  2LAP A;  2RGI A;  1DVI A;  1QVI Y;  1YRT B;  2KQ6 A;  2V53 A;  2I18 A;  1J55 A;  1WLZ A;  1J7O A;  2Y1M A;  2JC2 A;  5D69 A;  1LVC D;  3I5G C;  1K94 A;  1AK8 A;  2F33 A;  2BCX A;  1H8B A;  2CNP A;  1S6C A;  2G2B A;  2BL0 B;  1A75 A;  1CKK A;  5HYD A;  2AAO A;  2BE6 A;  3WHT B;  1DTL A;  1TCO B;  3TS5 B;  1TNX A;  1NCY A;  2PAL A;  2KAV A;  4GGF C;  2K7D A;  2JPT A;  1NX3 A;  1OSA A;  1NSH A;  3I5F B;  1RWY A;  3VRQ A;  4DUQ A;  1QS7 A;  4CFQ A;  1NX2 A;  1UUR A;  2O60 A;  3SG6 A;  5KSZ A;  4ZCU A;  1M31 A;  2KGR A;  1CMF A;  2M8U A;  4ORC B;  4OV2 A;  1SYM A;  3CZT X;  3ZNI A;  1BOC A;  4MRX A;  5F6T A;  1F54 A;  1A4P A;  3I5G B;  1CLL A;  1ZAC A;  5DKR A;  5IBW A;  1TCF A;  3PFV A;  1J7P A;  5JOL A;  2B1U A;  4HSZ A;  1PAL A;  2L5X B;  1EG3 A;  1L7Z A;  1G8I A;  1WRK A;  1CTR A;  2BE4 A;  2NCO A;  2LUC A;  4P5O E;  2F3Y A;  1REC A;  2BKH B;  3BXK A;  3CLN A;  3OP0 A;  1SL8 A;  5HLO A;  2LP2 A;  4DS7 A;  4MVF A;  1NWD A;  5K89 A;  1SNL A;  2K2F A;  1B9A A;  2E30 A;  2PMY A;  4E68 A;  1KQM C;  1PK0 D;  4PE7 A;  1F4O A;  2OS8 C;  4C0K A;  4R1E A;  2Y4Q A;  1IRJ A;  1LA0 A;  1ZFS A;  1UHH A;  2LC5 A;  1BLQ A;  3EK7 A;  1WDC B;  1C7V A;  4JPZ B;  4PE0 A;  4MZK A;  4WQ2 A;  1FW4 A;  2QAC A;  1CM1 A;  3O4Y A;  1WLM A;  4L9M A;  3SJS A;  1BF5 A;  1FBV A;  2M9G A;  2NZ0 A;  1Q80 A;  1KCY A;  1NX0 A;  3AAJ A;  1BT6 A;  2LLU A;  4PCW A;  3TZ1 A;  3SG2 A;  1S5G Z;  1MXL C;  4CLN A;  2L2E A;  1K93 D;  1F71 A;  1GQM A;  1XFV O;  1K9P A;  2L50 A;  2M97 A;  1CDM A;  1MXE A;  5DKQ A;  1ALV A;  1CM4 A;  2WCE A;  3DVK A;  4MZJ A;  1MR8 A;  2QPT A;  1F55 A;  3RLZ A;  4PDZ A;  4OVN F;  5I2Q A;  3LL8 B;  4BY4 A;  1TTX A;  1DJX A;  4A4C A;  2JT8 A;  1DT7 B;  1QVI Z;  1KK8 C;  2CTN A;  4YGB B;  3F45 A;  1JFJ A;  4CID A;  1PSR A;  2KSP A;  1LKJ A;  1IG5 A;  4GPL B;  2JT3 A;  3DF0 B;  3I5I C;  2JXL A;  1DJI A;  1S5G Y;  5AAN A;  3FWB A;  3FWC A;  1XK4 A;  1K96 A;  1XYD A;  2LVK A;  1DJY A;  2M49 B;  1KSM A;  1TRF A;  3PSR A;  3FIA A;  2WCB A;  4NDC A;  2D8N A;  2GGM A;  2JXC A;  1QXP A;  3GK2 A;  4HRG A;  1JFK A;  3AKB A;  1K95 A;  4YRU A;  1SCM C;  5PAL A;  2JNX A;  3PN7 C;  1G33 A;  1XVJ A;  4XJK A;  2H61 A;  1DJG A;  1SY9 A;  2P6B B;  3TUY B;  1FI6 A;  5AEQ A;  5HKY A;  1OMR A;  5CSF A;  2JTT A;  3I5H B;  1XA5 A;  2AMI A;  1RJV A;  1DJZ A;  2KI4 B;  3VRR A;  3WHU B;  3IQQ A;  1SR6 C;  3WNX B;  2LCP A;  3GK4 X;  1MUX A;  1IQ5 A;  2LMU A;  1NPQ A;  3ICB A;  2I7A A;  2KNE A;  1ZUZ A;  1A29 A;  1B8L A;  1JF2 A;  1WRL A;  1AHR A;  2Y5I A;  4OCI A;  1QX5 B;  4D1E A;  1F70 A;  3GK1 A;  2WC8 A;  3NXA A;  3CR5 X;  1YX8 A;  1X02 A;  4C0L A;  3OX6 A;  5ER5 A;  1XK4 C;  1CNP A;  2LLS A;  1K8U A;  1LXF C;  3PN7 B;  2F3Z A;  3DF0 A;  3TUY C;  2NXQ A;  4YGE B;  1BJF A;  3OB2 B;  4MLW A;  1QJT A;  1YTZ C;  4NQG A;  1KFX L;  1H4B A;  5B8I B;  2ZN8 A;  2ZFD A;  1BR4 B;  2Q91 A;  1NUB A;  1CDL A;  2GGZ A;  1AVS A;  1Y0V H;  1N2D A;  1BR1 B;  1YUT A;  1KSO A;  1V1F A;  1F4Q A;  3PAL A;  1SR6 B;  1HQV A;  2H61 C;  3AAK A;  5I8N A;  5AER A;  4N1F A;  1GJY A;  1S36 A;  4QJ4 B;  2M7L A;  4N5X A;  5I2O A;  1AP4 A;  1B1G A;  3D0Y A;  3M0W A;  2MBX A;  2MHH A;  5CPV A;  3K21 A;  1YUR A;  1XFU O;  1XFY O;  2KAX A;  2LE9 B;  1JUO A;  3EVU A;  5CSJ A;  2HQW A;  1YRU B;  4CPV A;  1C07 A;  1DGU A;  1YX7 A;  2WCF A;  1CFC A;  2GV5 A;  1NCX A;  2KDH A;  3SG4 A;  1OMV A;  2EC6 C;  4PHJ A;  4PHN A;  3SG5 A;  1KK7 Z;  3BUW B;  1HT9 A;  1TOP A;  2BCA A;  1KQM B;  3NSL A;  4GGF A;  3CR4 X;  3DVM A;  2E6W A;  5J3X A;  4ORB B;  2OPO A;  1PSB A;  4QJ3 B;  2ISD A;  1QIV A;  3LCP C;  1TNQ A;  2ZRS A;  1XFW O;  3PAT A;  2WOR A;  2I94 A;  4UPG A;  1CDN A;  1SKT A;  2KBI A;  2M1U A;  4USL A;  1SBJ A;  2KOT A;  2LAN A;  4ICB A;  1LA3 A;  3D0Y B;  4XYN A;  1QV1 A;  3O2P A;  1LIN A;  2KBM A;  2SCP A;  2ZN9 A;  1QIW A;  1L2O B;  1N65 A;  4GAO A;  5AFP A;  1F8H A;  1PVB A;  3A8R A;  2JRF A;  1K2H A;  4U8D A;  2HET A;  4Q04 A;  1UHK A;  3DVJ A;  1ZMZ A;  1NCZ A;  2MAZ A;  3IF7 A;  2MJW B;  1QLK A;  5AXI A;  1MWN A;  1C7W A;  3CS1 A;  1AJ5 A;  1M46 A;  5G08 A;  1JC2 A;  1B8R A;  2G9B A;  2R2I A;  1KWO C;  1UP5 A;  2ZKM X;  3QRX A;  2WND A;  2LMT A;  4MBE A;  3SG7 A;  1CFP A;  1DMO A;  2HF5 A;  1TIZ A;  2EHB A;  3JTD C;  1A2X A;  4DRW A;  5D7F A;  2K7O A;  2MRD A;  1QAS A;  1TNP A;  5HKW A;  1A75 B;  3SG3 A;  2JOJ A;  2F2P A;  2JUL A;  1CFD A;  2LMV A;  5I2L A;  3EK8 A;  5DKN A;  1XO5 A;  3MSE B;  1JF0 A;  1A03 A;  1WY9 A;  1SMG A;  2F8P A;  1ALW A;  1NX1 A;  2BL0 C;  4GFT A;  1B4C A;  1OQP A;  3VGO A;  3H4S E;  4I5L B;  3OHM B;  4ZCV A;  2PSR A;  1RFJ A;  1SCM B;  2H2K A;  1UHN A;  4MZL A;  2BBN A;  2K0J A;  2LVV A;  2M7N A;  2MA2 A;  4GBA A;  2K61 A;  1KFU L;  1RRO A;  5GQQ C;  5JJG A;  1KWO B;  2IS9 A;  2MLE C;  1J7Q A;  2JZI A;  4JWQ A;  1MQ1 A;  5KU1 A;  2SAS A;  3I5H C;  4PAL A;  2K2A A;  1CMG A;  4XJK B;  4HRH A;  1RK9 A;  3EVR A;  4YGC B;  2LLT A;  2ZND A;  2LNK A;  3LK0 A;  1S6I A;  2M29 A;  4FQO A;  2O5G A;  1UUS A;  1R2U A;  1E8A A;  1SCV A;  3CTN A;  4ORA B;  1ODB A;  1SK6 D;  1DJW A;  3OX5 A;  1G4Y R;  2FCE A;  1AUI B;  1K90 D;  5ER4 X;  4JQ0 D;  1B47 A;  1WRZ A;  3KEV A;  3VRN A;  3WXA A;  4N1G A;  2KQY A;  3AKA A;  5HLV A;  1U5I B;  4GGN A;  5CSI A;  4DIR A;  2FCD A;  1IWQ A;  1EXR A;  4M2O A;  1SW8 A;  1IQ3 A;  5KTY A;  2KGB C;  1KK8 B;  4YBH B;  4F0Z B;  1B8C A;  4TNC A;  2BKI B;  2LVJ A;  1YVH A;  1YUS A;  1ZOT B;  1IJ5 A;  4M2Q A;  1S1E A;  1YVL A;  1BMO A;  3A4U B;  1QX7 A;  2VRG A;  1EL4 A;  2FOT A;  1N0Y A;  1S6J A;  2DOQ A;  2KI6 C;  3EKH A;  2OTG C;  3I5I B;  1CLM A;  3FS7 A;  2ZRT A;  2JU0 A;  4WQ3 A;  4WRI A;  1EJ3 A;  1M45 A;  3E3R A;  2F2O A;  4YGA A;  1QLS A;  1CFF A;  1XFX O;  1QV0 A;  4QJ5 B;  1EG4 A;  1Y1U A;  4P2Y B;  1UWO A;  2KYC A;  3NSK A;  1PUL A;  2LUX A;  4HRE E;  3SIA A;  1DF0 A;  1B7T Z;  2WOS A;  2NCP A;  1Y6W A;  1JWD A;  2PRU A;  1GGZ A;  1BU3 A;  3BUO B;  3TS5 C;  3HX4 A;  3JVT B;  2MLF C;  3KO0 A;  1B7T Y;  2BCB A;  1NIW A;  3CR2 A;  3NSI A;  2CBL A;  1TNW A;  2L98 A;  1CLB A;  3NSO A;  4ETO A;  2JNF A;  1KFU S;  2LVI A;  4I5J A;  4I5K A;  2OTG B;  2Y1N A;  3CWG A; 
#chains in the Genus database with same CATH topology
 1J7R A;  2LM5 A;  2QEH A;  3BQ3 A;  3QME A;  3PM8 A;  4AQJ A;  1EH2 A;  2CCM A;  4I5N B;  2LHI A;  5HKZ A;  1C3Z A;  4GUK A;  3NHT A;  1XFZ O;  2LP3 A;  4M2P A;  3SIB A;  1JBA A;  1CDP A;  1M39 A;  4AQI A;  1L2O C;  1BG1 A;  1K9K A;  4A4B A;  2QEV A;  3O6B A;  2HPS A;  1OE9 B;  3B87 A;  3O78 A;  1GGW A;  2LHL A;  4INX A;  1TUZ A;  3LLE A;  3VRO A;  1QWV A;  1V1G A;  1QAT A;  1PRW A;  3L47 A;  3S0A A;  1P28 A;  2JT0 A;  1WDC C;  1IJ6 A;  4CFR A;  1S3P A;  2TN4 A;  2KI4 C;  2AUC A;  3DY9 A;  3JTD B;  3DVE A;  2KFF A;  2BEC A;  3BYA A;  1SPY A;  2COL B;  4IJ7 A;  2ZNE A;  1SL9 A;  4OR9 B;  5TNC A;  1DF0 B;  1M63 B;  2KYF A;  1UHI A;  1DJH A;  4AOM A;  2K7B A;  4IL1 A;  4MEW A;  1AJ4 A;  2KI6 D;  2L0P A;  2CT9 A;  1J1D A;  1W7J B;  3IQO A;  1R6P A;  2L51 A;  3LK1 A;  1Y1X A;  4YI8 A;  4PE4 A;  1IGV A;  3R1V A;  5D3O A;  1D1O A;  3BUX B;  2PVB A;  3RM1 A;  1TN4 A;  3TDZ A;  1FF1 A;  3D10 A;  3B86 A;  1CB1 A;  2HQ8 A;  1QTX A;  4MRY A;  1XFR A;  1FI5 A;  3DD4 A;  1OOJ A;  3EVV A;  2KHN A;  3BOW A;  3JVT C;  4NDD A;  2JWW A;  4FQT A;  4NDB A;  1DQE A;  1S26 D;  2FJU B;  2KAY A;  3HCM A;  5DIC A;  1MHO A;  1NYA A;  2WC5 A;  2K7C A;  4YGD B;  4PHK A;  3TDU A;  2KLD A;  1J1E A;  4MSP A;  2CXJ A;  2A4J A;  3EKJ A;  3BUN B;  1IKU A;  2NLN A;  4FTG A;  1VRK A;  4PHM A;  1U5I A;  3CGA A;  4DCK A;  5CSN A;  1Y1A A;  1SRA A;  2KFG A;  2L4H A;  1OMD A;  2KPH A;  3VRP A;  1MF8 B;  1KQV A;  1ORG A;  2BBM A;  2GTE A;  3EG5 B;  1KFX S;  2Q4U A;  2M0R A;  3ZWH A;  1PVA A;  1W7I B;  2KFH A;  2LV7 A;  2PAS A;  1DGV A;  1K9U A;  2EGD A;  3PLF B;  1YUU A;  1FPW A;  3DYE A;  2K8M B;  1IH0 A;  3TDI A;  1JSA A;  3OB1 B;  4YI9 A;  1NP8 A;  1QX2 A;  3PM2 A;  4OKH A;  1BOD A;  4C0J A;  2M1K B;  4MN0 A;  2JTZ A;  1KK7 Y;  1YR5 A;  3KHE A;  1OZS A;  1UHJ A;  5FYX A;  1SL7 A;  2JQ6 A;  4GNK B;  3C1V A;  3B7A A;  3GOF A;  3I5F C;  3KF9 A;  4PE1 A;  3D74 A;  1OOG A;  2OS8 B;  3BUM B;  3KPX A;  2EC6 B;  3BOW B;  4BY5 A;  5BPJ A;  2I2R E;  2L4I A;  3EK4 A;  2M3W A;  1RTP 1;  1OZO A;  2LAP A;  2RGI A;  1DVI A;  1QVI Y;  1YRT B;  2KQ6 A;  2V53 A;  2I18 A;  1J55 A;  1WLZ A;  1J7O A;  2Y1M A;  2JC2 A;  5D69 A;  1LVC D;  3I5G C;  1K94 A;  1AK8 A;  2F33 A;  2BCX A;  4INW A;  1H8B A;  3S0F A;  2CNP A;  1S6C A;  2G2B A;  2BL0 B;  3R1P A;  1A75 A;  1CKK A;  3CZ1 A;  5HYD A;  2AAO A;  3Q8I A;  2BE6 A;  3NGV A;  2QDI A;  3WHT B;  1DTL A;  1TCO B;  3TS5 B;  1TNX A;  1NCY A;  2PAL A;  2KAV A;  4GGF C;  2K7D A;  2JPT A;  1NX3 A;  1OSA A;  1NSH A;  3I5F B;  1RWY A;  5FI2 A;  3VRQ A;  4DUQ A;  1QS7 A;  3CYZ A;  4CFQ A;  1NX2 A;  1UUR A;  2O60 A;  3SG6 A;  5KSZ A;  4ZCU A;  1M31 A;  2KGR A;  1CMF A;  2M8U A;  4ORC B;  4OV2 A;  1SYM A;  3CZT X;  3ZNI A;  1BOC A;  3L4L A;  4MRX A;  5F6T A;  3BFB A;  1F54 A;  1A4P A;  3I5G B;  1CLL A;  2WC6 A;  3CAB A;  1ZAC A;  3IVT A;  5DKR A;  5IBW A;  1TCF A;  3PFV A;  5FI6 A;  5JOL A;  1J7P A;  2B1U A;  4HSZ A;  1PAL A;  2L5X B;  1EG3 A;  1L7Z A;  5I94 A;  1G8I A;  1WRK A;  1CTR A;  2BE4 A;  2NCO A;  2LUC A;  4P5O E;  2F3Y A;  3NHI A;  1REC A;  2BKH B;  3BXK A;  3CLN A;  3OP0 A;  1SL8 A;  5HLO A;  2LP2 A;  4DS7 A;  4MVF A;  1NWD A;  5K89 A;  1SNL A;  2K2F A;  1B9A A;  2E30 A;  2PMY A;  4E68 A;  1KQM C;  1PK0 D;  4OZD A;  4PE7 A;  1F4O A;  2OS8 C;  2PQL A;  4C0K A;  4R1E A;  3K1E A;  2Y4Q A;  1IRJ A;  1ZFS A;  1LA0 A;  1UHH A;  2LC5 A;  1BLQ A;  3EK7 A;  1WDC B;  1C7V A;  4JPZ B;  4PE0 A;  2WCM A;  4MZK A;  4WQ2 A;  1FW4 A;  2QAC A;  1CM1 A;  2K60 A;  1WLM A;  3O4Y A;  4L9M A;  3SJS A;  3SS4 A;  1BF5 A;  1FBV A;  2M9G A;  2NZ0 A;  1Q80 A;  1KCY A;  1NX0 A;  3BJH A;  3AAJ A;  1BT6 A;  2LLU A;  4PCW A;  3TZ1 A;  3SG2 A;  1S5G Z;  1MXL C;  4CLN A;  2L2E A;  1K93 D;  1F71 A;  1GQM A;  1XFV O;  1K9P A;  2L50 A;  2M97 A;  1CDM A;  1MXE A;  5DKQ A;  1ALV A;  1CM4 A;  2WCE A;  1OOH A;  3DVK A;  1MR8 A;  2QPT A;  4MZJ A;  3S0D A;  1F55 A;  3RLZ A;  4PDZ A;  4OVN F;  5I2Q A;  3LL8 B;  4BY4 A;  1TTX A;  1DJX A;  4A4C A;  2JT8 A;  1DT7 B;  1QVI Z;  1KK8 C;  2CTN A;  4YGB B;  3F45 A;  1JFJ A;  3D75 A;  4CID A;  1PSR A;  2KSP A;  1LKJ A;  3FE9 A;  1IG5 A;  4GPL B;  2JT3 A;  3DF0 B;  3I5I C;  2JXL A;  1DJI A;  1S5G Y;  5AAN A;  3FWB A;  3FWC A;  1XK4 A;  1K96 A;  1XYD A;  1OOI X;  4KYN A;  2LVK A;  1DJY A;  2M49 B;  1KSM A;  1TRF A;  3PSR A;  3FIA A;  2WCB A;  4NDC A;  2D8N A;  2GGM A;  2JXC A;  1QXP A;  3GK2 A;  4HRG A;  1JFK A;  3AKB A;  1K95 A;  4YRU A;  1SCM C;  5PAL A;  3R1O A;  2JNX A;  3PN7 C;  1G33 A;  1XVJ A;  3UO9 A;  4XJK A;  1Z2C B;  1DJG A;  1SY9 A;  2H61 A;  2P6B B;  3D76 A;  3FE6 A;  3O4X A;  3TUY B;  1FI6 A;  5AEQ A;  5HKY A;  1OMR A;  3CZ0 A;  5CSF A;  2JTT A;  3I5H B;  1XA5 A;  2AMI A;  1RJV A;  1DJZ A;  2KI4 B;  3VRR A;  3WHU B;  3IQQ A;  1SR6 C;  3WNX B;  2LCP A;  3GK4 X;  3PJI A;  1MUX A;  2KLE A;  1IQ5 A;  2LMU A;  1NPQ A;  3ICB A;  2I7A A;  2KNE A;  1ZUZ A;  1A29 A;  1B8L A;  1JF2 A;  1WRL A;  3N7H A;  3UNW A;  1AHR A;  2Y5I A;  4OCI A;  1QX5 B;  4D1E A;  1F70 A;  2PYQ A;  3GK1 A;  2WC8 A;  3NXA A;  3CR5 X;  1YX8 A;  1X02 A;  4C0L A;  2YGU A;  3OX6 A;  5ER5 A;  1XK4 C;  2BAP A;  1CNP A;  2LLS A;  1K8U A;  1LXF C;  3PN7 B;  2F3Z A;  3VB1 A;  3DF0 A;  3TUY C;  2NXQ A;  4YGE B;  1BJF A;  3OB2 B;  1SSE B;  4MLW A;  1QJT A;  1YTZ C;  1DEL A;  1KFX L;  4NQG A;  1H4B A;  5B8I B;  1TWO A;  2ZN8 A;  2ZFD A;  1BR4 B;  2Q91 A;  1NUB A;  3DZT A;  1CDL A;  2GGZ A;  2FJY A;  1AVS A;  1Y0V H;  1N2D A;  4JKT A;  1BR1 B;  1YUT A;  1KSO A;  1V1F A;  1F4Q A;  3PAL A;  1C3Y A;  1SR6 B;  1HQV A;  2H61 C;  3AAK A;  5I8N A;  5AER A;  4N1F A;  1GJY A;  1S36 A;  4QJ4 B;  2M7L A;  4N5X A;  5I2O A;  1AP4 A;  1B1G A;  3D0Y A;  3D78 A;  3M0W A;  2MBX A;  2MHH A;  5CPV A;  3K21 A;  1YUR A;  1XFU O;  1XFY O;  2KAX A;  2LE9 B;  1JUO A;  3EVU A;  5CSJ A;  1YRU B;  2HQW A;  4CPV A;  1C07 A;  1DGU A;  1YX7 A;  2WCF A;  2L2C A;  4F7F A;  2GV5 A;  1NCX A;  1CFC A;  3S0E A;  2KDH A;  3SG4 A;  1OMV A;  2EC6 C;  3SS3 A;  4PHJ A;  4PHN A;  3SG5 A;  1KK7 Z;  3BUW B;  1HT9 A;  1TOP A;  2BCA A;  1KQM B;  3NSL A;  4GGF A;  3BFH A;  3CR4 X;  3DVM A;  2E6W A;  5J3X A;  4ORB B;  2OPO A;  1PSB A;  4QJ3 B;  2ISD A;  1QIV A;  3LCP C;  1TNQ A;  2ZRS A;  1XFW O;  3PAT A;  2WOR A;  2I94 A;  4UPG A;  1CDN A;  1SKT A;  2H8V A;  2KBI A;  2M1U A;  4USL A;  1SBJ A;  2KOT A;  2LAN A;  4ICB A;  1LA3 A;  3D0Y B;  4XYN A;  1QV1 A;  3O2P A;  1LIN A;  2KBM A;  2SCP A;  2ZN9 A;  1QIW A;  1L2O B;  1N65 A;  4GAO A;  5AFP A;  1F8H A;  1PVB A;  3A8R A;  2JRF A;  1K2H A;  4U8D A;  1Z4H A;  2HET A;  4Q04 A;  1UHK A;  3DVJ A;  1ZMZ A;  1NCZ A;  2MAZ A;  3IF7 A;  2MJW B;  1QLK A;  3OBV A;  5AXI A;  1MWN A;  3L4A A;  1C7W A;  3CS1 A;  1AJ5 A;  1M46 A;  5G08 A;  1JC2 A;  1B8R A;  2G9B A;  2R2I A;  1KWO C;  1UP5 A;  2ZKM X;  3QRX A;  2WND A;  2LMT A;  4MBE A;  3SG7 A;  1CFP A;  1DMO A;  2HF5 A;  1TIZ A;  2EHB A;  3V2L A;  3JTD C;  1A2X A;  4DRW A;  2BNX A;  5D7F A;  2K7O A;  2MRD A;  1QAS A;  1TNP A;  5HKW A;  1A75 B;  3SG3 A;  2JOJ A;  2F2P A;  2JUL A;  1CFD A;  2LMV A;  2P70 A;  5I2L A;  3EK8 A;  5DKN A;  1XO5 A;  3MSE B;  1JF0 A;  1A03 A;  1WY9 A;  1SMG A;  2F8P A;  1ALW A;  2WCL A;  1NX1 A;  2BL0 C;  4GFT A;  1B4C A;  1OQP A;  3VGO A;  3H4S E;  4I5L B;  3OHM B;  4ZCV A;  2PSR A;  1RFJ A;  1SCM B;  2H2K A;  1UHN A;  4MZL A;  2BBN A;  2K0J A;  2JPO A;  2LVV A;  2M7N A;  2MA2 A;  4GBA A;  4PT1 A;  1DC1 A;  2K61 A;  1KFU L;  1RRO A;  5GQQ C;  2QEB A;  3CDN A;  5JJG A;  1KWO B;  2IS9 A;  2MLE C;  4JD9 A;  2JZI A;  1J7Q A;  4JWQ A;  1MQ1 A;  5KU1 A;  2SAS A;  3I5H C;  4PAL A;  2K2A A;  1CMG A;  4XJK B;  2ERB A;  4HRH A;  1IIO A;  1RK9 A;  3EVR A;  4YGC B;  2LLT A;  3D73 A;  1TUJ A;  2QEO A;  2ZND A;  2LNK A;  3LK0 A;  1S6I A;  2M29 A;  4FQO A;  3FE8 A;  3RZS A;  2O5G A;  1UUS A;  1R2U A;  1E8A A;  1SCV A;  3CTN A;  4ORA B;  1ODB A;  1SK6 D;  1DJW A;  3OX5 A;  1G4Y R;  3R72 A;  2FCE A;  3BFA A;  1AUI B;  1K90 D;  5ER4 X;  4JQ0 D;  1B47 A;  1WRZ A;  3KEV A;  3VRN A;  3WXA A;  4N1G A;  2KQY A;  3AKA A;  5HLV A;  1U5I B;  1LS8 A;  4GGN A;  5CSI A;  3CZ2 A;  2WCK A;  4DIR A;  2FCD A;  1W9Z A;  1IWQ A;  1EXR A;  5EL2 A;  3S0B A;  4M2O A;  5HL1 A;  1SW8 A;  1IQ3 A;  3S0G A;  5KTY A;  2KGB C;  1KK8 B;  4YBH B;  4F0Z B;  1B8C A;  4TNC A;  1OOF A;  2BKI B;  2LVJ A;  1YVH A;  1YUS A;  1ZOT B;  1IJ5 A;  4M2Q A;  1S1E A;  1YVL A;  1BMO A;  2P71 A;  3A4U B;  1QX7 A;  2VRG A;  1EL4 A;  2FOT A;  1N0Y A;  1S6J A;  2DOQ A;  2KI6 C;  3EKH A;  2OTG C;  3B6X A;  3I5I B;  1CLM A;  3FS7 A;  2ZRT A;  2JU0 A;  4WQ3 A;  4WRI A;  1EJ3 A;  1M45 A;  3E3R A;  1OW4 A;  2F2O A;  1QLS A;  4YGA A;  1XFX O;  1CFF A;  1QV0 A;  4QJ5 B;  1EG4 A;  3D77 A;  5FI7 A;  1T14 A;  1Y1U A;  4P2Y B;  1UWO A;  2KYC A;  3NSK A;  1PUL A;  2LUX A;  4HRE E;  3SIA A;  1DF0 A;  1B7T Z;  2WOS A;  2NCP A;  1Y6W A;  3B88 A;  1JWD A;  2PRU A;  1GGZ A;  3DXL A;  1BU3 A;  3BUO B;  3TS5 C;  3HX4 A;  3JVT B;  2WCH A;  3SS5 A;  2MLF C;  1DEK A;  3KO0 A;  1B7T Y;  2BCB A;  1NIW A;  3OGN A;  3CR2 A;  3NSI A;  2CBL A;  1TNW A;  2L98 A;  1CLB A;  3NSO A;  4ETO A;  1GM0 A;  2L5Y A;  2JNF A;  1KFU S;  2LVI A;  4I5J A;  2WCJ A;  4I5K A;  2OTG B;  2Y1N A;  3CWG A; 
#chains in the Genus database with same CATH homology
 1J7R A;  2LM5 A;  3BQ3 A;  3PM8 A;  4AQJ A;  1EH2 A;  2CCM A;  4I5N B;  2LHI A;  5HKZ A;  4GUK A;  1XFZ O;  2LP3 A;  4M2P A;  3SIB A;  1JBA A;  1CDP A;  1M39 A;  4AQI A;  1L2O C;  1BG1 A;  1K9K A;  4A4B A;  3O6B A;  2HPS A;  1OE9 B;  3O78 A;  1GGW A;  2LHL A;  3LLE A;  3VRO A;  1V1G A;  1QAT A;  1PRW A;  2JT0 A;  1WDC C;  1IJ6 A;  4CFR A;  1S3P A;  2TN4 A;  2KI4 C;  2AUC A;  3JTD B;  3DVE A;  2KFF A;  2BEC A;  3BYA A;  1SPY A;  2COL B;  2ZNE A;  1SL9 A;  4OR9 B;  5TNC A;  1DF0 B;  1M63 B;  2KYF A;  1UHI A;  1DJH A;  4AOM A;  2K7B A;  4IL1 A;  4MEW A;  1AJ4 A;  2KI6 D;  2L0P A;  2CT9 A;  1J1D A;  1W7J B;  3IQO A;  1R6P A;  2L51 A;  3LK1 A;  1Y1X A;  4YI8 A;  4PE4 A;  1IGV A;  1D1O A;  3BUX B;  2PVB A;  3RM1 A;  1TN4 A;  3TDZ A;  1FF1 A;  3D10 A;  1CB1 A;  2HQ8 A;  1QTX A;  4MRY A;  1FI5 A;  3DD4 A;  1OOJ A;  3EVV A;  2KHN A;  3BOW A;  3JVT C;  4NDD A;  2JWW A;  4NDB A;  1S26 D;  2FJU B;  2KAY A;  3HCM A;  1MHO A;  1NYA A;  4YGD B;  2K7C A;  4PHK A;  3TDU A;  1J1E A;  4MSP A;  2CXJ A;  2A4J A;  3EKJ A;  3BUN B;  1IKU A;  2NLN A;  4FTG A;  1VRK A;  4PHM A;  1U5I A;  3CGA A;  4DCK A;  5CSN A;  1Y1A A;  1SRA A;  2KFG A;  2L4H A;  1OMD A;  3VRP A;  1MF8 B;  1KQV A;  2BBM A;  1KFX S;  2Q4U A;  2M0R A;  3ZWH A;  1PVA A;  1W7I B;  2KFH A;  2LV7 A;  2PAS A;  1DGV A;  1K9U A;  2EGD A;  3PLF B;  1YUU A;  1FPW A;  2K8M B;  1IH0 A;  3TDI A;  1JSA A;  3OB1 B;  4YI9 A;  1NP8 A;  1QX2 A;  4OKH A;  1BOD A;  4C0J A;  2M1K B;  4MN0 A;  2JTZ A;  1KK7 Y;  1YR5 A;  3KHE A;  1OZS A;  1UHJ A;  5FYX A;  1SL7 A;  2JQ6 A;  4GNK B;  3C1V A;  3I5F C;  3GOF A;  3KF9 A;  4PE1 A;  2OS8 B;  3BUM B;  3KPX A;  2EC6 B;  3BOW B;  4BY5 A;  5BPJ A;  2I2R E;  2L4I A;  3EK4 A;  2M3W A;  1RTP 1;  1OZO A;  2LAP A;  2RGI A;  1DVI A;  1QVI Y;  1YRT B;  2KQ6 A;  2V53 A;  2I18 A;  1J55 A;  1WLZ A;  1J7O A;  2Y1M A;  2JC2 A;  5D69 A;  1LVC D;  3I5G C;  1K94 A;  1AK8 A;  2F33 A;  2BCX A;  1H8B A;  2CNP A;  1S6C A;  2G2B A;  2BL0 B;  1A75 A;  1CKK A;  5HYD A;  2AAO A;  2BE6 A;  3WHT B;  1DTL A;  1TCO B;  3TS5 B;  1TNX A;  1NCY A;  2PAL A;  2KAV A;  4GGF C;  2K7D A;  2JPT A;  1NX3 A;  1OSA A;  1NSH A;  3I5F B;  1RWY A;  3VRQ A;  4DUQ A;  1QS7 A;  4CFQ A;  1NX2 A;  1UUR A;  2O60 A;  3SG6 A;  5KSZ A;  4ZCU A;  1M31 A;  2KGR A;  1CMF A;  2M8U A;  4ORC B;  4OV2 A;  1SYM A;  3CZT X;  3ZNI A;  1BOC A;  4MRX A;  5F6T A;  1F54 A;  1A4P A;  3I5G B;  1CLL A;  1ZAC A;  5DKR A;  5IBW A;  1TCF A;  3PFV A;  1J7P A;  5JOL A;  2B1U A;  4HSZ A;  1PAL A;  2L5X B;  1EG3 A;  1L7Z A;  1G8I A;  1WRK A;  1CTR A;  2BE4 A;  2NCO A;  2LUC A;  4P5O E;  2F3Y A;  1REC A;  2BKH B;  3BXK A;  3CLN A;  3OP0 A;  1SL8 A;  5HLO A;  2LP2 A;  4DS7 A;  4MVF A;  1NWD A;  5K89 A;  1SNL A;  2K2F A;  1B9A A;  2E30 A;  2PMY A;  4E68 A;  1KQM C;  1PK0 D;  4PE7 A;  1F4O A;  2OS8 C;  4C0K A;  4R1E A;  2Y4Q A;  1IRJ A;  1LA0 A;  1ZFS A;  1UHH A;  2LC5 A;  1BLQ A;  3EK7 A;  1WDC B;  1C7V A;  4JPZ B;  4PE0 A;  4MZK A;  4WQ2 A;  1FW4 A;  2QAC A;  1CM1 A;  3O4Y A;  1WLM A;  4L9M A;  3SJS A;  1BF5 A;  1FBV A;  2M9G A;  2NZ0 A;  1Q80 A;  1KCY A;  1NX0 A;  3AAJ A;  1BT6 A;  2LLU A;  4PCW A;  3TZ1 A;  3SG2 A;  1S5G Z;  1MXL C;  4CLN A;  2L2E A;  1K93 D;  1F71 A;  1GQM A;  1XFV O;  1K9P A;  2L50 A;  2M97 A;  1CDM A;  1MXE A;  5DKQ A;  1ALV A;  1CM4 A;  2WCE A;  3DVK A;  4MZJ A;  1MR8 A;  2QPT A;  1F55 A;  3RLZ A;  4PDZ A;  4OVN F;  5I2Q A;  3LL8 B;  4BY4 A;  1TTX A;  1DJX A;  4A4C A;  2JT8 A;  1DT7 B;  1QVI Z;  1KK8 C;  2CTN A;  4YGB B;  3F45 A;  1JFJ A;  4CID A;  1PSR A;  2KSP A;  1LKJ A;  1IG5 A;  4GPL B;  2JT3 A;  3DF0 B;  3I5I C;  2JXL A;  1DJI A;  1S5G Y;  5AAN A;  3FWB A;  3FWC A;  1XK4 A;  1K96 A;  1XYD A;  2LVK A;  1DJY A;  2M49 B;  1KSM A;  1TRF A;  3PSR A;  3FIA A;  2WCB A;  4NDC A;  2D8N A;  2GGM A;  2JXC A;  1QXP A;  3GK2 A;  4HRG A;  1JFK A;  3AKB A;  1K95 A;  4YRU A;  1SCM C;  5PAL A;  2JNX A;  3PN7 C;  1G33 A;  1XVJ A;  4XJK A;  2H61 A;  1DJG A;  1SY9 A;  2P6B B;  3TUY B;  1FI6 A;  5AEQ A;  5HKY A;  1OMR A;  5CSF A;  2JTT A;  3I5H B;  1XA5 A;  2AMI A;  1RJV A;  1DJZ A;  2KI4 B;  3VRR A;  3WHU B;  3IQQ A;  1SR6 C;  3WNX B;  2LCP A;  3GK4 X;  1MUX A;  1IQ5 A;  2LMU A;  1NPQ A;  3ICB A;  2I7A A;  2KNE A;  1ZUZ A;  1A29 A;  1B8L A;  1JF2 A;  1WRL A;  1AHR A;  2Y5I A;  4OCI A;  1QX5 B;  4D1E A;  1F70 A;  3GK1 A;  2WC8 A;  3NXA A;  3CR5 X;  1YX8 A;  1X02 A;  4C0L A;  3OX6 A;  5ER5 A;  1XK4 C;  1CNP A;  2LLS A;  1K8U A;  1LXF C;  3PN7 B;  2F3Z A;  3DF0 A;  3TUY C;  2NXQ A;  4YGE B;  1BJF A;  3OB2 B;  4MLW A;  1QJT A;  1YTZ C;  4NQG A;  1KFX L;  1H4B A;  5B8I B;  2ZN8 A;  2ZFD A;  1BR4 B;  2Q91 A;  1NUB A;  1CDL A;  2GGZ A;  1AVS A;  1Y0V H;  1N2D A;  1BR1 B;  1YUT A;  1KSO A;  1V1F A;  1F4Q A;  3PAL A;  1SR6 B;  1HQV A;  2H61 C;  3AAK A;  5I8N A;  5AER A;  4N1F A;  1GJY A;  1S36 A;  4QJ4 B;  2M7L A;  4N5X A;  5I2O A;  1AP4 A;  1B1G A;  3D0Y A;  3M0W A;  2MBX A;  2MHH A;  5CPV A;  3K21 A;  1YUR A;  1XFU O;  1XFY O;  2KAX A;  2LE9 B;  1JUO A;  3EVU A;  5CSJ A;  2HQW A;  1YRU B;  4CPV A;  1C07 A;  1DGU A;  1YX7 A;  2WCF A;  1CFC A;  2GV5 A;  1NCX A;  2KDH A;  3SG4 A;  1OMV A;  2EC6 C;  4PHJ A;  4PHN A;  3SG5 A;  1KK7 Z;  3BUW B;  1HT9 A;  1TOP A;  2BCA A;  1KQM B;  3NSL A;  4GGF A;  3CR4 X;  3DVM A;  2E6W A;  5J3X A;  4ORB B;  2OPO A;  1PSB A;  4QJ3 B;  2ISD A;  1QIV A;  3LCP C;  1TNQ A;  2ZRS A;  1XFW O;  3PAT A;  2WOR A;  2I94 A;  4UPG A;  1CDN A;  1SKT A;  2KBI A;  2M1U A;  4USL A;  1SBJ A;  2KOT A;  2LAN A;  4ICB A;  1LA3 A;  3D0Y B;  4XYN A;  1QV1 A;  3O2P A;  1LIN A;  2KBM A;  2SCP A;  2ZN9 A;  1QIW A;  1L2O B;  1N65 A;  4GAO A;  5AFP A;  1F8H A;  1PVB A;  3A8R A;  2JRF A;  1K2H A;  4U8D A;  2HET A;  4Q04 A;  1UHK A;  3DVJ A;  1ZMZ A;  1NCZ A;  2MAZ A;  3IF7 A;  2MJW B;  1QLK A;  5AXI A;  1MWN A;  1C7W A;  3CS1 A;  1AJ5 A;  1M46 A;  5G08 A;  1JC2 A;  1B8R A;  2G9B A;  2R2I A;  1KWO C;  1UP5 A;  2ZKM X;  3QRX A;  2WND A;  2LMT A;  4MBE A;  3SG7 A;  1CFP A;  1DMO A;  2HF5 A;  1TIZ A;  2EHB A;  3JTD C;  1A2X A;  4DRW A;  5D7F A;  2K7O A;  2MRD A;  1QAS A;  1TNP A;  5HKW A;  1A75 B;  3SG3 A;  2JOJ A;  2F2P A;  2JUL A;  1CFD A;  2LMV A;  5I2L A;  3EK8 A;  5DKN A;  1XO5 A;  3MSE B;  1JF0 A;  1A03 A;  1WY9 A;  1SMG A;  2F8P A;  1ALW A;  1NX1 A;  2BL0 C;  4GFT A;  1B4C A;  1OQP A;  3VGO A;  3H4S E;  4I5L B;  3OHM B;  4ZCV A;  2PSR A;  1RFJ A;  1SCM B;  2H2K A;  1UHN A;  4MZL A;  2BBN A;  2K0J A;  2LVV A;  2M7N A;  2MA2 A;  4GBA A;  2K61 A;  1KFU L;  1RRO A;  5GQQ C;  5JJG A;  1KWO B;  2IS9 A;  2MLE C;  1J7Q A;  2JZI A;  4JWQ A;  1MQ1 A;  5KU1 A;  2SAS A;  3I5H C;  4PAL A;  2K2A A;  1CMG A;  4XJK B;  4HRH A;  1RK9 A;  3EVR A;  4YGC B;  2LLT A;  2ZND A;  2LNK A;  3LK0 A;  1S6I A;  2M29 A;  4FQO A;  2O5G A;  1UUS A;  1R2U A;  1E8A A;  1SCV A;  3CTN A;  4ORA B;  1ODB A;  1SK6 D;  1DJW A;  3OX5 A;  1G4Y R;  2FCE A;  1AUI B;  1K90 D;  5ER4 X;  4JQ0 D;  1B47 A;  1WRZ A;  3KEV A;  3VRN A;  3WXA A;  4N1G A;  2KQY A;  3AKA A;  5HLV A;  1U5I B;  4GGN A;  5CSI A;  4DIR A;  2FCD A;  1IWQ A;  1EXR A;  4M2O A;  1SW8 A;  1IQ3 A;  5KTY A;  2KGB C;  1KK8 B;  4YBH B;  4F0Z B;  1B8C A;  4TNC A;  2BKI B;  2LVJ A;  1YVH A;  1YUS A;  1ZOT B;  1IJ5 A;  4M2Q A;  1S1E A;  1YVL A;  1BMO A;  3A4U B;  1QX7 A;  2VRG A;  1EL4 A;  2FOT A;  1N0Y A;  1S6J A;  2DOQ A;  2KI6 C;  3EKH A;  2OTG C;  3I5I B;  1CLM A;  3FS7 A;  2ZRT A;  2JU0 A;  4WQ3 A;  4WRI A;  1EJ3 A;  1M45 A;  3E3R A;  2F2O A;  4YGA A;  1QLS A;  1CFF A;  1XFX O;  1QV0 A;  4QJ5 B;  1EG4 A;  1Y1U A;  4P2Y B;  1UWO A;  2KYC A;  3NSK A;  1PUL A;  2LUX A;  4HRE E;  3SIA A;  1DF0 A;  1B7T Z;  2WOS A;  2NCP A;  1Y6W A;  1JWD A;  2PRU A;  1GGZ A;  1BU3 A;  3BUO B;  3TS5 C;  3HX4 A;  3JVT B;  2MLF C;  3KO0 A;  1B7T Y;  2BCB A;  1NIW A;  3CR2 A;  3NSI A;  2CBL A;  1TNW A;  2L98 A;  1CLB A;  3NSO A;  4ETO A;  2JNF A;  1KFU S;  2LVI A;  4I5J A;  4I5K A;  2OTG B;  2Y1N A;  3CWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...