1CMFA

Nmr solution structure of apo calmodulin carboxy-terminal domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
73
structure length
73
Chain Sequence
b'MKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALMODULIN (VERTEBRATE)
publication title Calcium-induced structural changes and domain autonomy in calmodulin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Calcium-binding protein
total genus 11
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 1995-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1cmfA00
1K9KA 1OOJA 1OZSA 2JWWA 3NSKA 2NCPA 3BOWB 3VRRA 2P6BB 5KU1A 2WNDA 4BY5A 2LNKA 3I5HB 3O4YA 4YGBB 1EH2A 1AJ4A 3O2PA 1F4QA 1Y1XA 1SR6B 2HQWA 4XJKB 4GBAA 1D1OA 1TNQA 1RECA 1K93D 3F45A 1IKUA 1DJHA 1PVAA 1JBAA 1QJTA 1ZFSA 4PHMA 2Q4UA 5HLOA 5I2LA 3I5HC 1ALVA 4A4CA 1YUUA 5AANA 1SYMA 4GUKA 3H4SE 4MRYA 1NYAA 3KPXA 2LMTA 5AXIA 2QACA 2Y1MA 1A2XA 3FIAA 1S6JA 2KSPA 2LP2A 1B8CA 3OX5A 1K8UA 1TN4A 1GGZA 3K21A 5ER5A 2NCOA 2ZFDA 2FOTA 4ETOA 2M1UA 2WORA 3BUMB 3ICBA 3C1VA 2L0PA 1NCZA 2GGMA 3WHTB 2O5GA 3SIAA 3TDUA 2LE9B 2ZNDA 5FYXA 2G2BA 2GGZA 3BUOB 3LCPC 1N2DA 1G8IA 1IWQA 1YR5A 5I8NA 4PHJA 4TNCA 2KQ6A 1XFZO 2CXJA 1S26D 1NP8A 5HKZA 3JVTC 1KK8C 1JF0A 4M2OA 2LANA 2ISDA 2LLUA 1MWNA 4QJ3B 5HKWA 1FPWA 3FS7A 5B8IB 1MXEA 1XYDA 2WCEA 4UPGA 1KFUL 2SCPA 1U5IB 2AUCA 1YUSA 2OPOA 3AKBA 3EK4A 1NUBA 3O6BA 4U8DA 1CB1A 2CNPA 2CT9A 3HCMA 1S36A 5CSFA 1UURA 1SRAA 1B8LA 2AMIA 2BL0C 2V53A 2KYCA 1NCXA 2KHNA 4NDCA 3GOFA 2K2FA 3SG7A 4YGEB 5D7FA 2HF5A 1MUXA 4HSZA 1CLMA 1UHNA 2QPTA 3I5FC 1CFFA 2JTTA 4PHNA 2VRGA 1CFCA 4OR9B 3EK7A 1F70A 1WDCB 1DGUA 1ALWA 2L50A 3SG2A 3WXAA 1XK4A 2I94A 1R6PA 2Y4QA 3DF0A 1UHJA 1OMRA 2K7BA 1A03A 2M1KB 3CR5X 1IH0A 1KK7Y 1V1GA 5AFPA 1ZACA 1M39A 1C7VA 1BU3A 2JT8A 1B4CA 1WDCC 1DJWA 2BBMA 2BE4A 1J7PA 1RK9A 4HREE 1YUTA 4N1GA 5ER4X 1S6IA 1MHOA 2CTNA 1B7TZ 3SG6A 2L2EA 2K2AA 4CPVA 1BOCA 1TCFA 5D69A 3LK1A 1DJGA 3OB2B 1IQ5A 2LUCA 1J55A 1CTRA 1JF2A 2KDHA 1PALA 3BUXB 3DVMA 4FTGA 4MZLA 1BMOA 4PE1A 2KYFA 2LVVA 2PSRA 1GQMA 2PRUA 1SKTA 3IQQA 5DKRA 3NSIA 1DTLA 1KFXL 1MXLC 3ZNIA 1GGWA 1CLLA 1SK6D 1W7JB 3DF0B 1QATA 1WRZA 3IQOA 1UHIA 4OVNF 1PSBA 1R2UA 2LVKA 2M97A 1J7OA 1CLBA 3A4UB 4YGAA 5G08A 2KFGA 2WCFA 4N5XA 1M45A 1OE9B 4I5JA 1JWDA 1TIZA 3O78A 1QLSA 4MN0A 1QTXA 1XK4C 4QJ4B 1KK7Z 1UUSA 2DOQA 3VROA 4BY4A 1XFVO 1DJXA 4PALA 1QX2A 4PDZA 1K94A 1C7WA 1SCMB 1YX8A 3NSLA 1QX7A 4MZJA 4ZCUA 2F33A 1J1EA 2RGIA 2I18A 1TNXA 1VRKA 2E6WA 4JQ0D 2MA2A 1RROA 5JOLA 1DT7B 1MR8A 1F4OA 1AVSA 2PALA 1K90D 2KFFA 2KOTA 3MSEB 5CSIA 4YRUA 1KSOA 1SCMC 4AOMA 3PM8A 2BBNA 4NDBA 2H61A 1QASA 4P2YB 3AAKA 2KFHA 3TUYC 1SL7A 4DUQA 1DF0A 3KHEA 2LC5A 1L7ZA 1M46A 2F8PA 3JVTB 1EG4A 1KK8B 1K96A 1S1EA 2GV5A 3LK0A 3PLFB 3RLZA 1KQVA 1LA3A 3E3RA 1ZMZA 1RJVA 4CLNA 1K2HA 3D10A 2KGBC 3D0YA 2LLTA 1CDLA 2KAVA 1XFXO 4GGNA 2FCDA 4WQ2A 1Y1UA 4FQOA 1UHHA 2LLSA 4A4BA 1KWOB 3WNXB 1FI6A 4QJ5B 2K61A 1F71A 4OV2A 3HX4A 1B47A 1G33A 1HT9A 2BL0B 2KBIA 2ZNEA 3RM1A 1A75A 2BKHB 2MLFC 1BG1A 2KGRA 1EJ3A 5CPVA 2ZRTA 2I2RE 3EKJA 5JJGA 4MSPA 3SG5A 5I2OA 2BCAA 1B9AA 3EVVA 1LVCD 1KWOC 1QLKA 3PATA 3SIBA 4C0LA 4IL1A 2KI4B 1CFPA 3EKHA 3I5FB 3CLNA 1IJ5A 5CSNA 4GFTA 1BJFA 1DMOA 2IS9A 5HYDA 2OS8B 2KAXA 4CIDA 4CFQA 1AJ5A 2BCBA 1H8BA 1XA5A 2LCPA 1C07A 1MF8B 1JC2A 3CR2A 2H61C 1DVIA 2KI4C 5HLVA 1JSAA 1NCYA 1XFUO 3TDIA 1UP5A 4Q04A 2D8NA 2EC6B 2OS8C 4M2QA 1OMDA 1QXPA 2M49B 4ICBA 2F3YA 3EVUA 1J1DA 2ZRSA 1CDMA 4E68A 1QVIY 2BECA 4MEWA 1NIWA 1YTZC 2MJWB 1SL8A 1GJYA 1BLQA 2EC6C 3EK8A 4OKHA 1CFDA 4MLWA 1F54A 4F0ZB 1A29A 2WOSA 2JC2A 2JNXA 1L2OC 1QIWA 1ZOTB 4MZKA 1LINA 4PE4A 2NLNA 4L9MA 2L4IA 4P5OE 4AQIA 4D1EA 2MAZA 1H4BA 3FWBA 3LLEA 1N0YA 3I5IB 2KI6C 1V1FA 3CR4X 1CMFA 2JRFA 2NXQA 4DRWA 2O60A 4PE0A 1TCOB 2JT3A 1NX0A 2OTGC 2L51A 3BUNB 2MLEC 4XJKA 1ZUZA 3IF7A 2R2IA 3I5IC 5HKYA 1TNWA 1N65A 3NXAA 2AAOA 4HRGA 4C0JA 2H2KA 3PN7C 4CFRA 4DIRA 5DKNA 1CDPA 4PHKA 3BYAA 3PALA 2E30A 1EG3A 2L4HA 2PVBA 1QVIZ 2K7CA 2M9GA 5AEQA 1IQ3A 2LMUA 2G9BA 2JTZA 1QIVA 5F6TA 2JQ6A 1M31A 1OSAA 2LMVA 1EXRA 1TOPA 1F55A 3PSRA 1FI5A 4GPLB 2B1UA 1RTP1 1NPQA 1YURA 2SASA 1YVLA 1IGVA 2NZ0A 2KBMA 4MBEA 3DVEA 1FF1A 2M3WA 2A4JA 2MHHA 2MRDA 2M7LA 1SL9A 4OCIA 5DKQA 3BQ3A 3ZWHA 3TUYB 3LL8B 1SPYA 2LM5A 1XFWO 1BR1B 4C0KA 2ZN9A 1RFJA 2JT0A 2L5XB 3CTNA 1BODA 1S6CA 1DGVA 1BT6A 4YGDB 3VRNA 1XO5A 3NSOA 2Q91A 1TRFA 4NQGA 1NX3A 2LHLA 4ORCB 2K7DA 2Y5IA 1SY9A 3TS5B 1LA0A 2WCBA 5BPJA 1KSMA 1SCVA 4USLA 3EVRA 4GNKB 2TN4A 3JTDB 2HPSA 3KF9A 1PVBA 5J3XA 4JWQA 4GAOA 1SR6C 1KFXS 1MQ1A 1UHKA 2Y1NA 3BUWB 1QV0A 1PULA 1U5IA 3SG4A 2JULA 2LP3A 3OHMB 1S3PA 1WLMA 2ZN8A 2MBXA 3BXKA 4HRHA 1NSHA 1IG5A 1CNPA 1FW4A 1CMGA 1Q80A 2M8UA 2K8MB 4GGFA 2F2PA 3JTDC 1Y0VH 1AK8A 1IJ6A 4I5NB 3SG3A 2M0RA 1AUIB 3VRPA 1FBVA 1SMGA 2LVIA 1M63B 1NX2A 1OQPA 2WC8A 1G4YR 4PE7A 4XYNA 1WLZA 4I5LB 4ORBB 2PASA 2K7OA 1OMVA 1E8AA 1S5GY 1PRWA 2KI6D 1PK0D 1Y1AA 1DF0B 1SBJA 2KAYA 3TS5C 2LV7A 2BE6A 3OP0A 1DJZA 1Y6WA 5AERA 4N1FA 4NDDA 2CCMA 1RWYA 1B1GA 3CGAA 2JPTA 2CBLA 1XVJA 3GK1A 2M29A 4DCKA 1QS7A 1EL4A 1TTXA 1LXFC 1K9PA 1KQMB 2JXCA 3D0YB 3DVKA 1K9UA 1TNPA 2K0JA 4YI9A 3VGOA 3WHUB 4JPZB 4YBHB 4YGCB 1LKJA 1QX5B 1X02A 4M2PA 3TZ1A 1F8HA 1B7TY 5TNCA 2FCEA 2KQYA 3TDZA 3AKAA 3QRXA 1YRUB 1L2OB 1A4PA 1A75B 5KSZA 1KQMC 1NWDA 1HQVA 4YI8A 3KO0A 1ODBA 2JZIA 2BCXA 5GQQC 1DJYA 2LAPA 4R1EA 2KNEA 4MVFA 1K95A 1W7IB 3AAJA 5I2QA 2F2OA 1J7RA 4GGFC 1QV1A 5K89A 5CSJA 1BR4B 3VRQA 1B8RA 2JU0A 1KFUS 3KEVA 1JFKA 1JUOA 2EGDA 2BKIB 1S5GZ 1YRTB 2OTGB 2COLB 2JNFA 1XFYO 1WY9A 3DD4A 2LUXA 1JFJA 3GK4X 3BOWA 1SW8A 1CKKA 3PN7B 5PALA 3CWGA 2LVJA 2M7NA 1YVHA 3OX6A 2JOJA 4WRIA 3CS1A 1CM1A 1OZOA 4I5KA 3M0WA 1AP4A 4ORAB 1WRKA 2EHBA 3I5GB 3PFVA 2LHIA 4ZCVA 3OB1B 1YX7A 1BF5A 1J7QA 1WRLA 4AQJA 5KTYA 1IRJA 2HQ8A 1AHRA 4PCWA 1NX1A 2HETA 3GK2A 1PSRA 1UWOA 1CDNA 1CM4A 4MRXA 3I5GC 4WQ3A 2F3ZA 3CZTX 2JXLA 1KCYA 2L98A 3FWCA 1SNLA 3A8RA 3DVJA 2I7AA 4DS7A 1DJIA 2FJUB 2ZKMX 5IBWA 2PMYA 3SJSA
chains in the Genus database with same CATH superfamily
1K9KA 1OOJA 1OZSA 2JWWA 3NSKA 2NCPA 3BOWB 3VRRA 2P6BB 3CDNA 5KU1A 3VB1A 2WCJA 2WNDA 4BY5A 2LNKA 3I5HB 3O4YA 4YGBB 1EH2A 1AJ4A 2PQLA 3O2PA 1F4QA 1Y1XA 3L47A 1SR6B 2HQWA 4XJKB 4GBAA 1D1OA 1TNQA 1RECA 1K93D 3F45A 1IKUA 1DJHA 1PVAA 1JBAA 1QJTA 1ZFSA 3RZSA 4PHMA 2Q4UA 3CZ0A 2L5YA 5HLOA 5I2LA 3I5HC 1ALVA 4A4CA 1YUUA 2WCLA 1SYMA 5AANA 4GUKA 3H4SE 4MRYA 1NYAA 3KPXA 2LMTA 5AXIA 3UNWA 3B87A 2QACA 3S0AA 2Y1MA 1A2XA 3FIAA 1S6JA 2KSPA 2LP2A 1B8CA 2JPOA 3OX5A 1DELA 1K8UA 1TN4A 1GGZA 3K21A 4JKTA 5ER5A 2NCOA 2ZFDA 2FOTA 4ETOA 2M1UA 5FI2A 2WORA 3BUMB 3ICBA 3C1VA 2L0PA 1DQEA 1NCZA 2GGMA 3WHTB 2O5GA 3B86A 3SIAA 3TDUA 2LE9B 2ZNDA 5FYXA 2G2BA 2GGZA 3BUOB 3LCPC 3SS4A 1N2DA 1G8IA 1IWQA 1YR5A 5I8NA 4PHJA 4TNCA 2KQ6A 4FQTA 1OOIX 1XFZO 2CXJA 1C3ZA 1NP8A 1S26D 5HKZA 3DY9A 5FI6A 2WCMA 3JVTC 1KK8C 1JF0A 4M2OA 2LANA 3CYZA 2ISDA 2LLUA 1MWNA 4QJ3B 5HKWA 1FPWA 3FS7A 5B8IB 1MXEA 1XYDA 2WCEA 4UPGA 1KFUL 2SCPA 1U5IB 2AUCA 3CZ2A 1YUSA 2OPOA 3AKBA 5FI7A 3EK4A 1NUBA 3O6BA 4U8DA 1CB1A 2CNPA 2CT9A 3CZ1A 3HCMA 1S36A 5CSFA 1UURA 1SRAA 1B8LA 2AMIA 2BL0C 2V53A 2KYCA 1NCXA 2KHNA 2PYQA 4NDCA 3GOFA 2K2FA 3SG7A 4YGEB 5D7FA 2HF5A 1MUXA 4PT1A 4HSZA 1CLMA 1UHNA 2QPTA 3I5FC 1IIOA 1CFFA 2JTTA 4PHNA 1TUZA 2VRGA 1CFCA 4OR9B 3EK7A 1F70A 1QWVA 1WDCB 1DGUA 1ALWA 2L50A 3SG2A 3WXAA 1XK4A 2I94A 3FE8A 1R6PA 2Y4QA 3DF0A 1UHJA 1OMRA 2K7BA 1A03A 2M1KB 3CR5X 3B88A 1KK7Y 1V1GA 1IH0A 5AFPA 1ZACA 1M39A 1C7VA 1BU3A 2JT8A 2QDIA 1B4CA 1WDCC 1DJWA 2BBMA 2BE4A 3D77A 1J7PA 1RK9A 1W9ZA 1Z2CB 4HREE 2GTEA 1YUTA 4N1GA 5ER4X 1S6IA 1MHOA 2CTNA 2K60A 1B7TZ 1XFRA 3SG6A 2L2EA 2K2AA 4CPVA 1BOCA 1TCFA 2KLEA 5D69A 1ORGA 3LK1A 1DJGA 3OB2B 2WCHA 1IQ5A 2LUCA 1J55A 1CTRA 1JF2A 2KDHA 1PALA 3BUXB 3DVMA 4FTGA 4MZLA 1BMOA 4PE1A 2KYFA 3SS3A 2LVVA 2PSRA 3D75A 3S0EA 1GQMA 2PRUA 1SKTA 3IQQA 5DKRA 3NSIA 1DTLA 1KFXL 5EL2A 3D73A 1MXLC 3ZNIA 1GGWA 1CLLA 1SK6D 1W7JB 3DF0B 1QATA 1WRZA 3IQOA 1UHIA 4OVNF 1PSBA 1R2UA 2LVKA 2M97A 2YGUA 1J7OA 1CLBA 3A4UB 3FE9A 4YGAA 1GM0A 5G08A 2KFGA 2WCFA 4N5XA 1M45A 1OE9B 4I5JA 1JWDA 1TIZA 3O78A 1QLSA 4MN0A 1QTXA 1XK4C 4QJ4B 1KK7Z 1UUSA 3ZWHA 2DOQA 3OBVA 3VROA 4BY4A 1XFVO 3R72A 1DJXA 4PALA 1QX2A 2P70A 4PDZA 1K94A 1C7WA 1SCMB 1YX8A 3NSLA 1QX7A 4MZJA 4ZCUA 2F33A 1J1EA 2RGIA 2I18A 1TNXA 1VRKA 2E6WA 4JQ0D 2MA2A 1RROA 3IVTA 4IJ7A 1MR8A 5JOLA 1DT7B 1F4OA 1AVSA 2PALA 3NHIA 1K90D 2KFFA 2KOTA 3MSEB 5CSIA 4YRUA 1KSOA 1SCMC 1T14A 4AOMA 3PM8A 2BBNA 4NDBA 1P28A 1OOGA 1QASA 2H61A 3AAKA 4P2YB 2KFHA 3TUYC 1SL7A 5DICA 3L4AA 4DUQA 1DF0A 3KHEA 5I94A 2LC5A 1L7ZA 1M46A 2F8PA 3JVTB 1EG4A 1KK8B 1K96A 1S1EA 2GV5A 3LK0A 3PLFB 3RLZA 2L2CA 3S0FA 1KQVA 1LA3A 3K1EA 3E3RA 3N7HA 1ZMZA 1RJVA 4CLNA 1K2HA 3D10A 2BNXA 3EG5B 2KGBC 3NGVA 2ERBA 3D0YA 2LLTA 1CDLA 2KLDA 2KAVA 1XFXO 4GGNA 2FCDA 4WQ2A 1Y1UA 4FQOA 1UHHA 2LLSA 4A4BA 1KWOB 3WNXB 1DC1A 1FI6A 4QJ5B 2K61A 1F71A 4OV2A 3HX4A 1B47A 1G33A 1HT9A 2BL0B 2KBIA 2ZNEA 3RM1A 1A75A 2BKHB 2MLFC 1BG1A 2KGRA 1EJ3A 5D3OA 5CPVA 2ZRTA 2I2RE 3EKJA 5JJGA 4MSPA 3SG5A 5I2OA 2BCAA 1B9AA 3EVVA 1LVCD 1KWOC 1QLKA 3PATA 3SIBA 4C0LA 4IL1A 2KI4B 3R1VA 1CFPA 3EKHA 3I5FB 3CLNA 1C3YA 1IJ5A 5CSNA 4F7FA 4GFTA 1BJFA 1DMOA 2IS9A 2QEBA 5HYDA 2OS8B 2KAXA 4CIDA 4CFQA 2BAPA 1AJ5A 2BCBA 1H8BA 1XA5A 2LCPA 1C07A 1MF8B 1JC2A 3CR2A 2H61C 1DVIA 5HL1A 2KI4C 5HLVA 1JSAA 1NCYA 1XFUO 3D78A 3TDIA 1UP5A 3SS5A 4Q04A 2D8NA 2EC6B 2OS8C 4M2QA 1OMDA 1QXPA 2M49B 4ICBA 2F3YA 3EVUA 1J1DA 2ZRSA 1CDMA 4E68A 1QVIY 2BECA 4INXA 3S0GA 4MEWA 3L4LA 1NIWA 1YTZC 2MJWB 1SL8A 1GJYA 2P71A 2WC5A 2EC6C 1BLQA 3EK8A 4OKHA 1CFDA 4MLWA 1F54A 4F0ZB 1A29A 2WOSA 2JC2A 2JNXA 1L2OC 1QIWA 1ZOTB 4MZKA 1LINA 4PE4A 2NLNA 4L9MA 2L4IA 4P5OE 4AQIA 4D1EA 2MAZA 1H4BA 3FWBA 3LLEA 1N0YA 3I5IB 2KI6C 1V1FA 3CR4X 1CMFA 2JRFA 2NXQA 2QEHA 3R1OA 3DXLA 3B6XA 4DRWA 2O60A 4PE0A 1OW4A 1TCOB 2JT3A 1NX0A 2OTGC 2L51A 3BUNB 2MLEC 4XJKA 3BFAA 1ZUZA 3IF7A 2R2IA 3I5IC 5HKYA 1TNWA 1N65A 3NXAA 2AAOA 4HRGA 4C0JA 2H2KA 3PN7C 4CFRA 4DIRA 5DKNA 1CDPA 4PHKA 3BYAA 3PALA 2E30A 3R1PA 1EG3A 2L4HA 2PVBA 1QVIZ 2K7CA 2M9GA 5AEQA 1IQ3A 2LMUA 2G9BA 2JTZA 1QIVA 2QEOA 1Z4HA 5F6TA 2JQ6A 1M31A 1OSAA 2LMVA 1EXRA 1TOPA 1F55A 3PSRA 3PM2A 1FI5A 4GPLB 2B1UA 1RTP1 1NPQA 1YURA 2SASA 3D74A 3DYEA 1YVLA 1IGVA 2NZ0A 3QMEA 2KBMA 4MBEA 3DVEA 1FF1A 2M3WA 2A4JA 2MHHA 2MRDA 4KYNA 1SL9A 4OCIA 2WC6A 3BQ3A 5DKQA 2M7LA 3LL8B 3TUYB 1SPYA 2LM5A 1XFWO 1BR1B 3NHTA 4C0KA 2ZN9A 1RFJA 3BJHA 2JT0A 2L5XB 3CTNA 1BODA 1S6CA 1DGVA 1BT6A 4YGDB 3VRNA 1XO5A 3NSOA 2Q91A 1TRFA 4NQGA 1NX3A 2LHLA 4ORCB 2K7DA 2Y5IA 1OOFA 3OGNA 1SY9A 3TS5B 1LA0A 2WCBA 5BPJA 1KSMA 1TUJA 1SCVA 3BFHA 4USLA 3EVRA 4GNKB 2TN4A 3JTDB 2HPSA 3KF9A 1PVBA 5J3XA 4JWQA 4GAOA 1SR6C 2FJYA 2QEVA 1KFXS 1MQ1A 1UHKA 2Y1NA 3BUWB 1QV0A 1PULA 1U5IA 3SG4A 2JULA 2LP3A 3OHMB 1S3PA 1WLMA 2ZN8A 2MBXA 3BXKA 4HRHA 1NSHA 1IG5A 1CNPA 1FW4A 1CMGA 1Q80A 3DZTA 3S0BA 1LS8A 2M8UA 2K8MB 4GGFA 2F2PA 3JTDC 1Y0VH 3CABA 1AK8A 1IJ6A 4I5NB 3SG3A 2M0RA 1AUIB 3VRPA 1FBVA 1SMGA 2LVIA 1M63B 1NX2A 1OQPA 2WC8A 1DEKA 1G4YR 4PE7A 4XYNA 1WLZA 2WCKA 4I5LB 4ORBB 2PASA 3FE6A 2K7OA 1OMVA 1E8AA 1S5GY 1PRWA 2KI6D 1PK0D 1Y1AA 1DF0B 1SBJA 2KAYA 3TS5C 2LV7A 2BE6A 3OP0A 1DJZA 1SSEB 1Y6WA 4N1FA 5AERA 4NDDA 2KPHA 2CCMA 1RWYA 1B1GA 3CGAA 2JPTA 2CBLA 1XVJA 3GK1A 2M29A 4DCKA 1QS7A 1EL4A 1TTXA 1LXFC 1K9PA 1KQMB 2JXCA 3D0YB 3DVKA 1K9UA 1TNPA 2K0JA 3PJIA 4YI9A 4JD9A 3VGOA 3WHUB 4JPZB 4YBHB 4YGCB 1LKJA 1QX5B 1X02A 4M2PA 3TZ1A 1F8HA 1B7TY 5TNCA 2FCEA 2KQYA 3TDZA 1OOHA 3AKAA 3QRXA 1YRUB 1L2OB 1A4PA 1A75B 5KSZA 1KQMC 1NWDA 1HQVA 4YI8A 3KO0A 1ODBA 2JZIA 2BCXA 5GQQC 1DJYA 2LAPA 4R1EA 2KNEA 4MVFA 1K95A 1W7IB 3AAJA 5I2QA 2F2OA 1J7RA 4GGFC 1QV1A 5K89A 2H8VA 5CSJA 1BR4B 3VRQA 1B8RA 2JU0A 1KFUS 3KEVA 4OZDA 3V2LA 1JFKA 1JUOA 2EGDA 2BKIB 1S5GZ 1YRTB 2OTGB 2COLB 2JNFA 1XFYO 1WY9A 3DD4A 3D76A 3UO9A 2LUXA 3O4XA 1JFJA 3GK4X 4INWA 3BOWA 1SW8A 1CKKA 3PN7B 5PALA 3CWGA 2LVJA 1TWOA 1YVHA 2M7NA 3OX6A 2JOJA 4WRIA 3CS1A 1CM1A 3S0DA 1OZOA 4I5KA 3M0WA 1AP4A 4ORAB 1WRKA 2EHBA 3I5GB 3PFVA 2LHIA 4ZCVA 3OB1B 1YX7A 1BF5A 1J7QA 1WRLA 4AQJA 5KTYA 1IRJA 2HQ8A 1AHRA 3BFBA 4PCWA 1NX1A 2HETA 3GK2A 1PSRA 1UWOA 1CDNA 1CM4A 4MRXA 3I5GC 4WQ3A 2F3ZA 3CZTX 2JXLA 1KCYA 2L98A 3FWCA 1SNLA 3A8RA 3DVJA 2I7AA 4DS7A 1DJIA 2FJUB 2ZKMX 5IBWA 3Q8IA 2PMYA 3B7AA 3SJSA
chains in the Genus database with same CATH topology
1K9KA 1OOJA 1OZSA 2JWWA 3NSKA 2NCPA 3BOWB 3VRRA 2P6BB 5KU1A 2WNDA 4BY5A 2LNKA 3I5HB 3O4YA 4YGBB 1EH2A 1AJ4A 3O2PA 1F4QA 1Y1XA 1SR6B 2HQWA 4XJKB 4GBAA 1D1OA 1TNQA 1RECA 1K93D 3F45A 1IKUA 1DJHA 1PVAA 1JBAA 1QJTA 1ZFSA 4PHMA 2Q4UA 5HLOA 5I2LA 3I5HC 1ALVA 4A4CA 1YUUA 5AANA 1SYMA 4GUKA 3H4SE 4MRYA 1NYAA 3KPXA 2LMTA 5AXIA 2QACA 2Y1MA 1A2XA 3FIAA 1S6JA 2KSPA 2LP2A 1B8CA 3OX5A 1K8UA 1TN4A 1GGZA 3K21A 5ER5A 2NCOA 2ZFDA 2FOTA 4ETOA 2M1UA 2WORA 3BUMB 3ICBA 3C1VA 2L0PA 1NCZA 2GGMA 3WHTB 2O5GA 3SIAA 3TDUA 2LE9B 2ZNDA 5FYXA 2G2BA 2GGZA 3BUOB 3LCPC 1N2DA 1G8IA 1IWQA 1YR5A 5I8NA 4PHJA 4TNCA 2KQ6A 1XFZO 2CXJA 1S26D 1NP8A 5HKZA 3JVTC 1KK8C 1JF0A 4M2OA 2LANA 2ISDA 2LLUA 1MWNA 4QJ3B 5HKWA 1FPWA 3FS7A 5B8IB 1MXEA 1XYDA 2WCEA 4UPGA 1KFUL 2SCPA 1U5IB 2AUCA 1YUSA 2OPOA 3AKBA 3EK4A 1NUBA 3O6BA 4U8DA 1CB1A 2CNPA 2CT9A 3HCMA 1S36A 5CSFA 1UURA 1SRAA 1B8LA 2AMIA 2BL0C 2V53A 2KYCA 1NCXA 2KHNA 4NDCA 3GOFA 2K2FA 3SG7A 4YGEB 5D7FA 2HF5A 1MUXA 4HSZA 1CLMA 1UHNA 2QPTA 3I5FC 1CFFA 2JTTA 4PHNA 2VRGA 1CFCA 4OR9B 3EK7A 1F70A 1WDCB 1DGUA 1ALWA 2L50A 3SG2A 3WXAA 1XK4A 2I94A 1R6PA 2Y4QA 3DF0A 1UHJA 1OMRA 2K7BA 1A03A 2M1KB 3CR5X 1IH0A 1KK7Y 1V1GA 5AFPA 1ZACA 1M39A 1C7VA 1BU3A 2JT8A 1B4CA 1WDCC 1DJWA 2BBMA 2BE4A 1J7PA 1RK9A 4HREE 1YUTA 4N1GA 5ER4X 1S6IA 1MHOA 2CTNA 1B7TZ 3SG6A 2L2EA 2K2AA 4CPVA 1BOCA 1TCFA 5D69A 3LK1A 1DJGA 3OB2B 1IQ5A 2LUCA 1J55A 1CTRA 1JF2A 2KDHA 1PALA 3BUXB 3DVMA 4FTGA 4MZLA 1BMOA 4PE1A 2KYFA 2LVVA 2PSRA 1GQMA 2PRUA 1SKTA 3IQQA 5DKRA 3NSIA 1DTLA 1KFXL 1MXLC 3ZNIA 1GGWA 1CLLA 1SK6D 1W7JB 3DF0B 1QATA 1WRZA 3IQOA 1UHIA 4OVNF 1PSBA 1R2UA 2LVKA 2M97A 1J7OA 1CLBA 3A4UB 4YGAA 5G08A 2KFGA 2WCFA 4N5XA 1M45A 1OE9B 4I5JA 1JWDA 1TIZA 3O78A 1QLSA 4MN0A 1QTXA 1XK4C 4QJ4B 1KK7Z 1UUSA 2DOQA 3VROA 4BY4A 1XFVO 1DJXA 4PALA 1QX2A 4PDZA 1K94A 1C7WA 1SCMB 1YX8A 3NSLA 1QX7A 4MZJA 4ZCUA 2F33A 1J1EA 2RGIA 2I18A 1TNXA 1VRKA 2E6WA 4JQ0D 2MA2A 1RROA 5JOLA 1DT7B 1MR8A 1F4OA 1AVSA 2PALA 1K90D 2KFFA 2KOTA 3MSEB 5CSIA 4YRUA 1KSOA 1SCMC 4AOMA 3PM8A 2BBNA 4NDBA 2H61A 1QASA 4P2YB 3AAKA 2KFHA 3TUYC 1SL7A 4DUQA 1DF0A 3KHEA 2LC5A 1L7ZA 1M46A 2F8PA 3JVTB 1EG4A 1KK8B 1K96A 1S1EA 2GV5A 3LK0A 3PLFB 3RLZA 1KQVA 1LA3A 3E3RA 1ZMZA 1RJVA 4CLNA 1K2HA 3D10A 2KGBC 3D0YA 2LLTA 1CDLA 2KAVA 1XFXO 4GGNA 2FCDA 4WQ2A 1Y1UA 4FQOA 1UHHA 2LLSA 4A4BA 1KWOB 3WNXB 1FI6A 4QJ5B 2K61A 1F71A 4OV2A 3HX4A 1B47A 1G33A 1HT9A 2BL0B 2KBIA 2ZNEA 3RM1A 1A75A 2BKHB 2MLFC 1BG1A 2KGRA 1EJ3A 5CPVA 2ZRTA 2I2RE 3EKJA 5JJGA 4MSPA 3SG5A 5I2OA 2BCAA 1B9AA 3EVVA 1LVCD 1KWOC 1QLKA 3PATA 3SIBA 4C0LA 4IL1A 2KI4B 1CFPA 3EKHA 3I5FB 3CLNA 1IJ5A 5CSNA 4GFTA 1BJFA 1DMOA 2IS9A 5HYDA 2OS8B 2KAXA 4CIDA 4CFQA 1AJ5A 2BCBA 1H8BA 1XA5A 2LCPA 1C07A 1MF8B 1JC2A 3CR2A 2H61C 1DVIA 2KI4C 5HLVA 1JSAA 1NCYA 1XFUO 3TDIA 1UP5A 4Q04A 2D8NA 2EC6B 2OS8C 4M2QA 1OMDA 1QXPA 2M49B 4ICBA 2F3YA 3EVUA 1J1DA 2ZRSA 1CDMA 4E68A 1QVIY 2BECA 4MEWA 1NIWA 1YTZC 2MJWB 1SL8A 1GJYA 1BLQA 2EC6C 3EK8A 4OKHA 1CFDA 4MLWA 1F54A 4F0ZB 1A29A 2WOSA 2JC2A 2JNXA 1L2OC 1QIWA 1ZOTB 4MZKA 1LINA 4PE4A 2NLNA 4L9MA 2L4IA 4P5OE 4AQIA 4D1EA 2MAZA 1H4BA 3FWBA 3LLEA 1N0YA 3I5IB 2KI6C 1V1FA 3CR4X 1CMFA 2JRFA 2NXQA 4DRWA 2O60A 4PE0A 1TCOB 2JT3A 1NX0A 2OTGC 2L51A 3BUNB 2MLEC 4XJKA 1ZUZA 3IF7A 2R2IA 3I5IC 5HKYA 1TNWA 1N65A 3NXAA 2AAOA 4HRGA 4C0JA 2H2KA 3PN7C 4CFRA 4DIRA 5DKNA 1CDPA 4PHKA 3BYAA 3PALA 2E30A 1EG3A 2L4HA 2PVBA 1QVIZ 2K7CA 2M9GA 5AEQA 1IQ3A 2LMUA 2G9BA 2JTZA 1QIVA 5F6TA 2JQ6A 1M31A 1OSAA 2LMVA 1EXRA 1TOPA 1F55A 3PSRA 1FI5A 4GPLB 2B1UA 1RTP1 1NPQA 1YURA 2SASA 1YVLA 1IGVA 2NZ0A 2KBMA 4MBEA 3DVEA 1FF1A 2M3WA 2A4JA 2MHHA 2MRDA 2M7LA 1SL9A 4OCIA 5DKQA 3BQ3A 3ZWHA 3TUYB 3LL8B 1SPYA 2LM5A 1XFWO 1BR1B 4C0KA 2ZN9A 1RFJA 2JT0A 2L5XB 3CTNA 1BODA 1S6CA 1DGVA 1BT6A 4YGDB 3VRNA 1XO5A 3NSOA 2Q91A 1TRFA 4NQGA 1NX3A 2LHLA 4ORCB 2K7DA 2Y5IA 1SY9A 3TS5B 1LA0A 2WCBA 5BPJA 1KSMA 1SCVA 4USLA 3EVRA 4GNKB 2TN4A 3JTDB 2HPSA 3KF9A 1PVBA 5J3XA 4JWQA 4GAOA 1SR6C 1KFXS 1MQ1A 1UHKA 2Y1NA 3BUWB 1QV0A 1PULA 1U5IA 3SG4A 2JULA 2LP3A 3OHMB 1S3PA 1WLMA 2ZN8A 2MBXA 3BXKA 4HRHA 1NSHA 1IG5A 1CNPA 1FW4A 1CMGA 1Q80A 2M8UA 2K8MB 4GGFA 2F2PA 3JTDC 1Y0VH 1AK8A 1IJ6A 4I5NB 3SG3A 2M0RA 1AUIB 3VRPA 1FBVA 1SMGA 2LVIA 1M63B 1NX2A 1OQPA 2WC8A 1G4YR 4PE7A 4XYNA 1WLZA 4I5LB 4ORBB 2PASA 2K7OA 1OMVA 1E8AA 1S5GY 1PRWA 2KI6D 1PK0D 1Y1AA 1DF0B 1SBJA 2KAYA 3TS5C 2LV7A 2BE6A 3OP0A 1DJZA 1Y6WA 5AERA 4N1FA 4NDDA 2CCMA 1RWYA 1B1GA 3CGAA 2JPTA 2CBLA 1XVJA 3GK1A 2M29A 4DCKA 1QS7A 1EL4A 1TTXA 1LXFC 1K9PA 1KQMB 2JXCA 3D0YB 3DVKA 1K9UA 1TNPA 2K0JA 4YI9A 3VGOA 3WHUB 4JPZB 4YBHB 4YGCB 1LKJA 1QX5B 1X02A 4M2PA 3TZ1A 1F8HA 1B7TY 5TNCA 2FCEA 2KQYA 3TDZA 3AKAA 3QRXA 1YRUB 1L2OB 1A4PA 1A75B 5KSZA 1KQMC 1NWDA 1HQVA 4YI8A 3KO0A 1ODBA 2JZIA 2BCXA 5GQQC 1DJYA 2LAPA 4R1EA 2KNEA 4MVFA 1K95A 1W7IB 3AAJA 5I2QA 2F2OA 1J7RA 4GGFC 1QV1A 5K89A 5CSJA 1BR4B 3VRQA 1B8RA 2JU0A 1KFUS 3KEVA 1JFKA 1JUOA 2EGDA 2BKIB 1S5GZ 1YRTB 2OTGB 2COLB 2JNFA 1XFYO 1WY9A 3DD4A 2LUXA 1JFJA 3GK4X 3BOWA 1SW8A 1CKKA 3PN7B 5PALA 3CWGA 2LVJA 2M7NA 1YVHA 3OX6A 2JOJA 4WRIA 3CS1A 1CM1A 1OZOA 4I5KA 3M0WA 1AP4A 4ORAB 1WRKA 2EHBA 3I5GB 3PFVA 2LHIA 4ZCVA 3OB1B 1YX7A 1BF5A 1J7QA 1WRLA 4AQJA 5KTYA 1IRJA 2HQ8A 1AHRA 4PCWA 1NX1A 2HETA 3GK2A 1PSRA 1UWOA 1CDNA 1CM4A 4MRXA 3I5GC 4WQ3A 2F3ZA 3CZTX 2JXLA 1KCYA 2L98A 3FWCA 1SNLA 3A8RA 3DVJA 2I7AA 4DS7A 1DJIA 2FJUB 2ZKMX 5IBWA 2PMYA 3SJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9K A;  1OOJ A;  1OZS A;  2JWW A;  3NSK A;  2NCP A;  3BOW B;  3VRR A;  2P6B B;  5KU1 A;  2WND A;  4BY5 A;  2LNK A;  3I5H B;  3O4Y A;  4YGB B;  1EH2 A;  1AJ4 A;  3O2P A;  1F4Q A;  1Y1X A;  1SR6 B;  2HQW A;  4XJK B;  4GBA A;  1D1O A;  1TNQ A;  1REC A;  1K93 D;  3F45 A;  1IKU A;  1DJH A;  1PVA A;  1JBA A;  1QJT A;  1ZFS A;  4PHM A;  2Q4U A;  5HLO A;  5I2L A;  3I5H C;  1ALV A;  4A4C A;  1YUU A;  5AAN A;  1SYM A;  4GUK A;  3H4S E;  4MRY A;  1NYA A;  3KPX A;  2LMT A;  5AXI A;  2QAC A;  2Y1M A;  1A2X A;  3FIA A;  1S6J A;  2KSP A;  2LP2 A;  1B8C A;  3OX5 A;  1K8U A;  1TN4 A;  1GGZ A;  3K21 A;  5ER5 A;  2NCO A;  2ZFD A;  2FOT A;  4ETO A;  2M1U A;  2WOR A;  3BUM B;  3ICB A;  3C1V A;  2L0P A;  1NCZ A;  2GGM A;  3WHT B;  2O5G A;  3SIA A;  3TDU A;  2LE9 B;  2ZND A;  5FYX A;  2G2B A;  2GGZ A;  3BUO B;  3LCP C;  1N2D A;  1G8I A;  1IWQ A;  1YR5 A;  5I8N A;  4PHJ A;  4TNC A;  2KQ6 A;  1XFZ O;  2CXJ A;  1S26 D;  1NP8 A;  5HKZ A;  3JVT C;  1KK8 C;  1JF0 A;  4M2O A;  2LAN A;  2ISD A;  2LLU A;  1MWN A;  4QJ3 B;  5HKW A;  1FPW A;  3FS7 A;  5B8I B;  1MXE A;  1XYD A;  2WCE A;  4UPG A;  1KFU L;  2SCP A;  1U5I B;  2AUC A;  1YUS A;  2OPO A;  3AKB A;  3EK4 A;  1NUB A;  3O6B A;  4U8D A;  1CB1 A;  2CNP A;  2CT9 A;  3HCM A;  1S36 A;  5CSF A;  1UUR A;  1SRA A;  1B8L A;  2AMI A;  2BL0 C;  2V53 A;  2KYC A;  1NCX A;  2KHN A;  4NDC A;  3GOF A;  2K2F A;  3SG7 A;  4YGE B;  5D7F A;  2HF5 A;  1MUX A;  4HSZ A;  1CLM A;  1UHN A;  2QPT A;  3I5F C;  1CFF A;  2JTT A;  4PHN A;  2VRG A;  1CFC A;  4OR9 B;  3EK7 A;  1F70 A;  1WDC B;  1DGU A;  1ALW A;  2L50 A;  3SG2 A;  3WXA A;  1XK4 A;  2I94 A;  1R6P A;  2Y4Q A;  3DF0 A;  1UHJ A;  1OMR A;  2K7B A;  1A03 A;  2M1K B;  3CR5 X;  1IH0 A;  1KK7 Y;  1V1G A;  5AFP A;  1ZAC A;  1M39 A;  1C7V A;  1BU3 A;  2JT8 A;  1B4C A;  1WDC C;  1DJW A;  2BBM A;  2BE4 A;  1J7P A;  1RK9 A;  4HRE E;  1YUT A;  4N1G A;  5ER4 X;  1S6I A;  1MHO A;  2CTN A;  1B7T Z;  3SG6 A;  2L2E A;  2K2A A;  4CPV A;  1BOC A;  1TCF A;  5D69 A;  3LK1 A;  1DJG A;  3OB2 B;  1IQ5 A;  2LUC A;  1J55 A;  1CTR A;  1JF2 A;  2KDH A;  1PAL A;  3BUX B;  3DVM A;  4FTG A;  4MZL A;  1BMO A;  4PE1 A;  2KYF A;  2LVV A;  2PSR A;  1GQM A;  2PRU A;  1SKT A;  3IQQ A;  5DKR A;  3NSI A;  1DTL A;  1KFX L;  1MXL C;  3ZNI A;  1GGW A;  1CLL A;  1SK6 D;  1W7J B;  3DF0 B;  1QAT A;  1WRZ A;  3IQO A;  1UHI A;  4OVN F;  1PSB A;  1R2U A;  2LVK A;  2M97 A;  1J7O A;  1CLB A;  3A4U B;  4YGA A;  5G08 A;  2KFG A;  2WCF A;  4N5X A;  1M45 A;  1OE9 B;  4I5J A;  1JWD A;  1TIZ A;  3O78 A;  1QLS A;  4MN0 A;  1QTX A;  1XK4 C;  4QJ4 B;  1KK7 Z;  1UUS A;  2DOQ A;  3VRO A;  4BY4 A;  1XFV O;  1DJX A;  4PAL A;  1QX2 A;  4PDZ A;  1K94 A;  1C7W A;  1SCM B;  1YX8 A;  3NSL A;  1QX7 A;  4MZJ A;  4ZCU A;  2F33 A;  1J1E A;  2RGI A;  2I18 A;  1TNX A;  1VRK A;  2E6W A;  4JQ0 D;  2MA2 A;  1RRO A;  5JOL A;  1DT7 B;  1MR8 A;  1F4O A;  1AVS A;  2PAL A;  1K90 D;  2KFF A;  2KOT A;  3MSE B;  5CSI A;  4YRU A;  1KSO A;  1SCM C;  4AOM A;  3PM8 A;  2BBN A;  4NDB A;  2H61 A;  1QAS A;  4P2Y B;  3AAK A;  2KFH A;  3TUY C;  1SL7 A;  4DUQ A;  1DF0 A;  3KHE A;  2LC5 A;  1L7Z A;  1M46 A;  2F8P A;  3JVT B;  1EG4 A;  1KK8 B;  1K96 A;  1S1E A;  2GV5 A;  3LK0 A;  3PLF B;  3RLZ A;  1KQV A;  1LA3 A;  3E3R A;  1ZMZ A;  1RJV A;  4CLN A;  1K2H A;  3D10 A;  2KGB C;  3D0Y A;  2LLT A;  1CDL A;  2KAV A;  1XFX O;  4GGN A;  2FCD A;  4WQ2 A;  1Y1U A;  4FQO A;  1UHH A;  2LLS A;  4A4B A;  1KWO B;  3WNX B;  1FI6 A;  4QJ5 B;  2K61 A;  1F71 A;  4OV2 A;  3HX4 A;  1B47 A;  1G33 A;  1HT9 A;  2BL0 B;  2KBI A;  2ZNE A;  3RM1 A;  1A75 A;  2BKH B;  2MLF C;  1BG1 A;  2KGR A;  1EJ3 A;  5CPV A;  2ZRT A;  2I2R E;  3EKJ A;  5JJG A;  4MSP A;  3SG5 A;  5I2O A;  2BCA A;  1B9A A;  3EVV A;  1LVC D;  1KWO C;  1QLK A;  3PAT A;  3SIB A;  4C0L A;  4IL1 A;  2KI4 B;  1CFP A;  3EKH A;  3I5F B;  3CLN A;  1IJ5 A;  5CSN A;  4GFT A;  1BJF A;  1DMO A;  2IS9 A;  5HYD A;  2OS8 B;  2KAX A;  4CID A;  4CFQ A;  1AJ5 A;  2BCB A;  1H8B A;  1XA5 A;  2LCP A;  1C07 A;  1MF8 B;  1JC2 A;  3CR2 A;  2H61 C;  1DVI A;  2KI4 C;  5HLV A;  1JSA A;  1NCY A;  1XFU O;  3TDI A;  1UP5 A;  4Q04 A;  2D8N A;  2EC6 B;  2OS8 C;  4M2Q A;  1OMD A;  1QXP A;  2M49 B;  4ICB A;  2F3Y A;  3EVU A;  1J1D A;  2ZRS A;  1CDM A;  4E68 A;  1QVI Y;  2BEC A;  4MEW A;  1NIW A;  1YTZ C;  2MJW B;  1SL8 A;  1GJY A;  1BLQ A;  2EC6 C;  3EK8 A;  4OKH A;  1CFD A;  4MLW A;  1F54 A;  4F0Z B;  1A29 A;  2WOS A;  2JC2 A;  2JNX A;  1L2O C;  1QIW A;  1ZOT B;  4MZK A;  1LIN A;  4PE4 A;  2NLN A;  4L9M A;  2L4I A;  4P5O E;  4AQI A;  4D1E A;  2MAZ A;  1H4B A;  3FWB A;  3LLE A;  1N0Y A;  3I5I B;  2KI6 C;  1V1F A;  3CR4 X;  1CMF A;  2JRF A;  2NXQ A;  4DRW A;  2O60 A;  4PE0 A;  1TCO B;  2JT3 A;  1NX0 A;  2OTG C;  2L51 A;  3BUN B;  2MLE C;  4XJK A;  1ZUZ A;  3IF7 A;  2R2I A;  3I5I C;  5HKY A;  1TNW A;  1N65 A;  3NXA A;  2AAO A;  4HRG A;  4C0J A;  2H2K A;  3PN7 C;  4CFR A;  4DIR A;  5DKN A;  1CDP A;  4PHK A;  3BYA A;  3PAL A;  2E30 A;  1EG3 A;  2L4H A;  2PVB A;  1QVI Z;  2K7C A;  2M9G A;  5AEQ A;  1IQ3 A;  2LMU A;  2G9B A;  2JTZ A;  1QIV A;  5F6T A;  2JQ6 A;  1M31 A;  1OSA A;  2LMV A;  1EXR A;  1TOP A;  1F55 A;  3PSR A;  1FI5 A;  4GPL B;  2B1U A;  1RTP 1;  1NPQ A;  1YUR A;  2SAS A;  1YVL A;  1IGV A;  2NZ0 A;  2KBM A;  4MBE A;  3DVE A;  1FF1 A;  2M3W A;  2A4J A;  2MHH A;  2MRD A;  2M7L A;  1SL9 A;  4OCI A;  5DKQ A;  3BQ3 A;  3ZWH A;  3TUY B;  3LL8 B;  1SPY A;  2LM5 A;  1XFW O;  1BR1 B;  4C0K A;  2ZN9 A;  1RFJ A;  2JT0 A;  2L5X B;  3CTN A;  1BOD A;  1S6C A;  1DGV A;  1BT6 A;  4YGD B;  3VRN A;  1XO5 A;  3NSO A;  2Q91 A;  1TRF A;  4NQG A;  1NX3 A;  2LHL A;  4ORC B;  2K7D A;  2Y5I A;  1SY9 A;  3TS5 B;  1LA0 A;  2WCB A;  5BPJ A;  1KSM A;  1SCV A;  4USL A;  3EVR A;  4GNK B;  2TN4 A;  3JTD B;  2HPS A;  3KF9 A;  1PVB A;  5J3X A;  4JWQ A;  4GAO A;  1SR6 C;  1KFX S;  1MQ1 A;  1UHK A;  2Y1N A;  3BUW B;  1QV0 A;  1PUL A;  1U5I A;  3SG4 A;  2JUL A;  2LP3 A;  3OHM B;  1S3P A;  1WLM A;  2ZN8 A;  2MBX A;  3BXK A;  4HRH A;  1NSH A;  1IG5 A;  1CNP A;  1FW4 A;  1CMG A;  1Q80 A;  2M8U A;  2K8M B;  4GGF A;  2F2P A;  3JTD C;  1Y0V H;  1AK8 A;  1IJ6 A;  4I5N B;  3SG3 A;  2M0R A;  1AUI B;  3VRP A;  1FBV A;  1SMG A;  2LVI A;  1M63 B;  1NX2 A;  1OQP A;  2WC8 A;  1G4Y R;  4PE7 A;  4XYN A;  1WLZ A;  4I5L B;  4ORB B;  2PAS A;  2K7O A;  1OMV A;  1E8A A;  1S5G Y;  1PRW A;  2KI6 D;  1PK0 D;  1Y1A A;  1DF0 B;  1SBJ A;  2KAY A;  3TS5 C;  2LV7 A;  2BE6 A;  3OP0 A;  1DJZ A;  1Y6W A;  5AER A;  4N1F A;  4NDD A;  2CCM A;  1RWY A;  1B1G A;  3CGA A;  2JPT A;  2CBL A;  1XVJ A;  3GK1 A;  2M29 A;  4DCK A;  1QS7 A;  1EL4 A;  1TTX A;  1LXF C;  1K9P A;  1KQM B;  2JXC A;  3D0Y B;  3DVK A;  1K9U A;  1TNP A;  2K0J A;  4YI9 A;  3VGO A;  3WHU B;  4JPZ B;  4YBH B;  4YGC B;  1LKJ A;  1QX5 B;  1X02 A;  4M2P A;  3TZ1 A;  1F8H A;  1B7T Y;  5TNC A;  2FCE A;  2KQY A;  3TDZ A;  3AKA A;  3QRX A;  1YRU B;  1L2O B;  1A4P A;  1A75 B;  5KSZ A;  1KQM C;  1NWD A;  1HQV A;  4YI8 A;  3KO0 A;  1ODB A;  2JZI A;  2BCX A;  5GQQ C;  1DJY A;  2LAP A;  4R1E A;  2KNE A;  4MVF A;  1K95 A;  1W7I B;  3AAJ A;  5I2Q A;  2F2O A;  1J7R A;  4GGF C;  1QV1 A;  5K89 A;  5CSJ A;  1BR4 B;  3VRQ A;  1B8R A;  2JU0 A;  1KFU S;  3KEV A;  1JFK A;  1JUO A;  2EGD A;  2BKI B;  1S5G Z;  1YRT B;  2OTG B;  2COL B;  2JNF A;  1XFY O;  1WY9 A;  3DD4 A;  2LUX A;  1JFJ A;  3GK4 X;  3BOW A;  1SW8 A;  1CKK A;  3PN7 B;  5PAL A;  3CWG A;  2LVJ A;  2M7N A;  1YVH A;  3OX6 A;  2JOJ A;  4WRI A;  3CS1 A;  1CM1 A;  1OZO A;  4I5K A;  3M0W A;  1AP4 A;  4ORA B;  1WRK A;  2EHB A;  3I5G B;  3PFV A;  2LHI A;  4ZCV A;  3OB1 B;  1YX7 A;  1BF5 A;  1J7Q A;  1WRL A;  4AQJ A;  5KTY A;  1IRJ A;  2HQ8 A;  1AHR A;  4PCW A;  1NX1 A;  2HET A;  3GK2 A;  1PSR A;  1UWO A;  1CDN A;  1CM4 A;  4MRX A;  3I5G C;  4WQ3 A;  2F3Z A;  3CZT X;  2JXL A;  1KCY A;  2L98 A;  3FWC A;  1SNL A;  3A8R A;  3DVJ A;  2I7A A;  4DS7 A;  1DJI A;  2FJU B;  2ZKM X;  5IBW A;  2PMY A;  3SJS A; 
#chains in the Genus database with same CATH topology
 1K9K A;  1OOJ A;  1OZS A;  2JWW A;  3NSK A;  2NCP A;  3BOW B;  3VRR A;  2P6B B;  3CDN A;  5KU1 A;  3VB1 A;  2WCJ A;  2WND A;  4BY5 A;  2LNK A;  3I5H B;  3O4Y A;  4YGB B;  1EH2 A;  1AJ4 A;  2PQL A;  3O2P A;  1F4Q A;  1Y1X A;  3L47 A;  1SR6 B;  2HQW A;  4XJK B;  4GBA A;  1D1O A;  1TNQ A;  1REC A;  1K93 D;  3F45 A;  1IKU A;  1DJH A;  1PVA A;  1JBA A;  1QJT A;  1ZFS A;  3RZS A;  4PHM A;  2Q4U A;  3CZ0 A;  2L5Y A;  5HLO A;  5I2L A;  3I5H C;  1ALV A;  4A4C A;  1YUU A;  2WCL A;  1SYM A;  5AAN A;  4GUK A;  3H4S E;  4MRY A;  1NYA A;  3KPX A;  2LMT A;  5AXI A;  3UNW A;  3B87 A;  2QAC A;  3S0A A;  2Y1M A;  1A2X A;  3FIA A;  1S6J A;  2KSP A;  2LP2 A;  1B8C A;  2JPO A;  3OX5 A;  1DEL A;  1K8U A;  1TN4 A;  1GGZ A;  3K21 A;  4JKT A;  5ER5 A;  2NCO A;  2ZFD A;  2FOT A;  4ETO A;  2M1U A;  5FI2 A;  2WOR A;  3BUM B;  3ICB A;  3C1V A;  2L0P A;  1DQE A;  1NCZ A;  2GGM A;  3WHT B;  2O5G A;  3B86 A;  3SIA A;  3TDU A;  2LE9 B;  2ZND A;  5FYX A;  2G2B A;  2GGZ A;  3BUO B;  3LCP C;  3SS4 A;  1N2D A;  1G8I A;  1IWQ A;  1YR5 A;  5I8N A;  4PHJ A;  4TNC A;  2KQ6 A;  4FQT A;  1OOI X;  1XFZ O;  2CXJ A;  1C3Z A;  1NP8 A;  1S26 D;  5HKZ A;  3DY9 A;  5FI6 A;  2WCM A;  3JVT C;  1KK8 C;  1JF0 A;  4M2O A;  2LAN A;  3CYZ A;  2ISD A;  2LLU A;  1MWN A;  4QJ3 B;  5HKW A;  1FPW A;  3FS7 A;  5B8I B;  1MXE A;  1XYD A;  2WCE A;  4UPG A;  1KFU L;  2SCP A;  1U5I B;  2AUC A;  3CZ2 A;  1YUS A;  2OPO A;  3AKB A;  5FI7 A;  3EK4 A;  1NUB A;  3O6B A;  4U8D A;  1CB1 A;  2CNP A;  2CT9 A;  3CZ1 A;  3HCM A;  1S36 A;  5CSF A;  1UUR A;  1SRA A;  1B8L A;  2AMI A;  2BL0 C;  2V53 A;  2KYC A;  1NCX A;  2KHN A;  2PYQ A;  4NDC A;  3GOF A;  2K2F A;  3SG7 A;  4YGE B;  5D7F A;  2HF5 A;  1MUX A;  4PT1 A;  4HSZ A;  1CLM A;  1UHN A;  2QPT A;  3I5F C;  1IIO A;  1CFF A;  2JTT A;  4PHN A;  1TUZ A;  2VRG A;  1CFC A;  4OR9 B;  3EK7 A;  1F70 A;  1QWV A;  1WDC B;  1DGU A;  1ALW A;  2L50 A;  3SG2 A;  3WXA A;  1XK4 A;  2I94 A;  3FE8 A;  1R6P A;  2Y4Q A;  3DF0 A;  1UHJ A;  1OMR A;  2K7B A;  1A03 A;  2M1K B;  3CR5 X;  3B88 A;  1KK7 Y;  1V1G A;  1IH0 A;  5AFP A;  1ZAC A;  1M39 A;  1C7V A;  1BU3 A;  2JT8 A;  2QDI A;  1B4C A;  1WDC C;  1DJW A;  2BBM A;  2BE4 A;  3D77 A;  1J7P A;  1RK9 A;  1W9Z A;  1Z2C B;  4HRE E;  2GTE A;  1YUT A;  4N1G A;  5ER4 X;  1S6I A;  1MHO A;  2CTN A;  2K60 A;  1B7T Z;  1XFR A;  3SG6 A;  2L2E A;  2K2A A;  4CPV A;  1BOC A;  1TCF A;  2KLE A;  5D69 A;  1ORG A;  3LK1 A;  1DJG A;  3OB2 B;  2WCH A;  1IQ5 A;  2LUC A;  1J55 A;  1CTR A;  1JF2 A;  2KDH A;  1PAL A;  3BUX B;  3DVM A;  4FTG A;  4MZL A;  1BMO A;  4PE1 A;  2KYF A;  3SS3 A;  2LVV A;  2PSR A;  3D75 A;  3S0E A;  1GQM A;  2PRU A;  1SKT A;  3IQQ A;  5DKR A;  3NSI A;  1DTL A;  1KFX L;  5EL2 A;  3D73 A;  1MXL C;  3ZNI A;  1GGW A;  1CLL A;  1SK6 D;  1W7J B;  3DF0 B;  1QAT A;  1WRZ A;  3IQO A;  1UHI A;  4OVN F;  1PSB A;  1R2U A;  2LVK A;  2M97 A;  2YGU A;  1J7O A;  1CLB A;  3A4U B;  3FE9 A;  4YGA A;  1GM0 A;  5G08 A;  2KFG A;  2WCF A;  4N5X A;  1M45 A;  1OE9 B;  4I5J A;  1JWD A;  1TIZ A;  3O78 A;  1QLS A;  4MN0 A;  1QTX A;  1XK4 C;  4QJ4 B;  1KK7 Z;  1UUS A;  3ZWH A;  2DOQ A;  3OBV A;  3VRO A;  4BY4 A;  1XFV O;  3R72 A;  1DJX A;  4PAL A;  1QX2 A;  2P70 A;  4PDZ A;  1K94 A;  1C7W A;  1SCM B;  1YX8 A;  3NSL A;  1QX7 A;  4MZJ A;  4ZCU A;  2F33 A;  1J1E A;  2RGI A;  2I18 A;  1TNX A;  1VRK A;  2E6W A;  4JQ0 D;  2MA2 A;  1RRO A;  3IVT A;  4IJ7 A;  1MR8 A;  5JOL A;  1DT7 B;  1F4O A;  1AVS A;  2PAL A;  3NHI A;  1K90 D;  2KFF A;  2KOT A;  3MSE B;  5CSI A;  4YRU A;  1KSO A;  1SCM C;  1T14 A;  4AOM A;  3PM8 A;  2BBN A;  4NDB A;  1P28 A;  1OOG A;  1QAS A;  2H61 A;  3AAK A;  4P2Y B;  2KFH A;  3TUY C;  1SL7 A;  5DIC A;  3L4A A;  4DUQ A;  1DF0 A;  3KHE A;  5I94 A;  2LC5 A;  1L7Z A;  1M46 A;  2F8P A;  3JVT B;  1EG4 A;  1KK8 B;  1K96 A;  1S1E A;  2GV5 A;  3LK0 A;  3PLF B;  3RLZ A;  2L2C A;  3S0F A;  1KQV A;  1LA3 A;  3K1E A;  3E3R A;  3N7H A;  1ZMZ A;  1RJV A;  4CLN A;  1K2H A;  3D10 A;  2BNX A;  3EG5 B;  2KGB C;  3NGV A;  2ERB A;  3D0Y A;  2LLT A;  1CDL A;  2KLD A;  2KAV A;  1XFX O;  4GGN A;  2FCD A;  4WQ2 A;  1Y1U A;  4FQO A;  1UHH A;  2LLS A;  4A4B A;  1KWO B;  3WNX B;  1DC1 A;  1FI6 A;  4QJ5 B;  2K61 A;  1F71 A;  4OV2 A;  3HX4 A;  1B47 A;  1G33 A;  1HT9 A;  2BL0 B;  2KBI A;  2ZNE A;  3RM1 A;  1A75 A;  2BKH B;  2MLF C;  1BG1 A;  2KGR A;  1EJ3 A;  5D3O A;  5CPV A;  2ZRT A;  2I2R E;  3EKJ A;  5JJG A;  4MSP A;  3SG5 A;  5I2O A;  2BCA A;  1B9A A;  3EVV A;  1LVC D;  1KWO C;  1QLK A;  3PAT A;  3SIB A;  4C0L A;  4IL1 A;  2KI4 B;  3R1V A;  1CFP A;  3EKH A;  3I5F B;  3CLN A;  1C3Y A;  1IJ5 A;  5CSN A;  4F7F A;  4GFT A;  1BJF A;  1DMO A;  2IS9 A;  2QEB A;  5HYD A;  2OS8 B;  2KAX A;  4CID A;  4CFQ A;  2BAP A;  1AJ5 A;  2BCB A;  1H8B A;  1XA5 A;  2LCP A;  1C07 A;  1MF8 B;  1JC2 A;  3CR2 A;  2H61 C;  1DVI A;  5HL1 A;  2KI4 C;  5HLV A;  1JSA A;  1NCY A;  1XFU O;  3D78 A;  3TDI A;  1UP5 A;  3SS5 A;  4Q04 A;  2D8N A;  2EC6 B;  2OS8 C;  4M2Q A;  1OMD A;  1QXP A;  2M49 B;  4ICB A;  2F3Y A;  3EVU A;  1J1D A;  2ZRS A;  1CDM A;  4E68 A;  1QVI Y;  2BEC A;  4INX A;  3S0G A;  4MEW A;  3L4L A;  1NIW A;  1YTZ C;  2MJW B;  1SL8 A;  1GJY A;  2P71 A;  2WC5 A;  2EC6 C;  1BLQ A;  3EK8 A;  4OKH A;  1CFD A;  4MLW A;  1F54 A;  4F0Z B;  1A29 A;  2WOS A;  2JC2 A;  2JNX A;  1L2O C;  1QIW A;  1ZOT B;  4MZK A;  1LIN A;  4PE4 A;  2NLN A;  4L9M A;  2L4I A;  4P5O E;  4AQI A;  4D1E A;  2MAZ A;  1H4B A;  3FWB A;  3LLE A;  1N0Y A;  3I5I B;  2KI6 C;  1V1F A;  3CR4 X;  1CMF A;  2JRF A;  2NXQ A;  2QEH A;  3R1O A;  3DXL A;  3B6X A;  4DRW A;  2O60 A;  4PE0 A;  1OW4 A;  1TCO B;  2JT3 A;  1NX0 A;  2OTG C;  2L51 A;  3BUN B;  2MLE C;  4XJK A;  3BFA A;  1ZUZ A;  3IF7 A;  2R2I A;  3I5I C;  5HKY A;  1TNW A;  1N65 A;  3NXA A;  2AAO A;  4HRG A;  4C0J A;  2H2K A;  3PN7 C;  4CFR A;  4DIR A;  5DKN A;  1CDP A;  4PHK A;  3BYA A;  3PAL A;  2E30 A;  3R1P A;  1EG3 A;  2L4H A;  2PVB A;  1QVI Z;  2K7C A;  2M9G A;  5AEQ A;  1IQ3 A;  2LMU A;  2G9B A;  2JTZ A;  1QIV A;  2QEO A;  1Z4H A;  5F6T A;  2JQ6 A;  1M31 A;  1OSA A;  2LMV A;  1EXR A;  1TOP A;  1F55 A;  3PSR A;  3PM2 A;  1FI5 A;  4GPL B;  2B1U A;  1RTP 1;  1NPQ A;  1YUR A;  2SAS A;  3D74 A;  3DYE A;  1YVL A;  1IGV A;  2NZ0 A;  3QME A;  2KBM A;  4MBE A;  3DVE A;  1FF1 A;  2M3W A;  2A4J A;  2MHH A;  2MRD A;  4KYN A;  1SL9 A;  4OCI A;  2WC6 A;  3BQ3 A;  5DKQ A;  2M7L A;  3LL8 B;  3TUY B;  1SPY A;  2LM5 A;  1XFW O;  1BR1 B;  3NHT A;  4C0K A;  2ZN9 A;  1RFJ A;  3BJH A;  2JT0 A;  2L5X B;  3CTN A;  1BOD A;  1S6C A;  1DGV A;  1BT6 A;  4YGD B;  3VRN A;  1XO5 A;  3NSO A;  2Q91 A;  1TRF A;  4NQG A;  1NX3 A;  2LHL A;  4ORC B;  2K7D A;  2Y5I A;  1OOF A;  3OGN A;  1SY9 A;  3TS5 B;  1LA0 A;  2WCB A;  5BPJ A;  1KSM A;  1TUJ A;  1SCV A;  3BFH A;  4USL A;  3EVR A;  4GNK B;  2TN4 A;  3JTD B;  2HPS A;  3KF9 A;  1PVB A;  5J3X A;  4JWQ A;  4GAO A;  1SR6 C;  2FJY A;  2QEV A;  1KFX S;  1MQ1 A;  1UHK A;  2Y1N A;  3BUW B;  1QV0 A;  1PUL A;  1U5I A;  3SG4 A;  2JUL A;  2LP3 A;  3OHM B;  1S3P A;  1WLM A;  2ZN8 A;  2MBX A;  3BXK A;  4HRH A;  1NSH A;  1IG5 A;  1CNP A;  1FW4 A;  1CMG A;  1Q80 A;  3DZT A;  3S0B A;  1LS8 A;  2M8U A;  2K8M B;  4GGF A;  2F2P A;  3JTD C;  1Y0V H;  3CAB A;  1AK8 A;  1IJ6 A;  4I5N B;  3SG3 A;  2M0R A;  1AUI B;  3VRP A;  1FBV A;  1SMG A;  2LVI A;  1M63 B;  1NX2 A;  1OQP A;  2WC8 A;  1DEK A;  1G4Y R;  4PE7 A;  4XYN A;  1WLZ A;  2WCK A;  4I5L B;  4ORB B;  2PAS A;  3FE6 A;  2K7O A;  1OMV A;  1E8A A;  1S5G Y;  1PRW A;  2KI6 D;  1PK0 D;  1Y1A A;  1DF0 B;  1SBJ A;  2KAY A;  3TS5 C;  2LV7 A;  2BE6 A;  3OP0 A;  1DJZ A;  1SSE B;  1Y6W A;  4N1F A;  5AER A;  4NDD A;  2KPH A;  2CCM A;  1RWY A;  1B1G A;  3CGA A;  2JPT A;  2CBL A;  1XVJ A;  3GK1 A;  2M29 A;  4DCK A;  1QS7 A;  1EL4 A;  1TTX A;  1LXF C;  1K9P A;  1KQM B;  2JXC A;  3D0Y B;  3DVK A;  1K9U A;  1TNP A;  2K0J A;  3PJI A;  4YI9 A;  4JD9 A;  3VGO A;  3WHU B;  4JPZ B;  4YBH B;  4YGC B;  1LKJ A;  1QX5 B;  1X02 A;  4M2P A;  3TZ1 A;  1F8H A;  1B7T Y;  5TNC A;  2FCE A;  2KQY A;  3TDZ A;  1OOH A;  3AKA A;  3QRX A;  1YRU B;  1L2O B;  1A4P A;  1A75 B;  5KSZ A;  1KQM C;  1NWD A;  1HQV A;  4YI8 A;  3KO0 A;  1ODB A;  2JZI A;  2BCX A;  5GQQ C;  1DJY A;  2LAP A;  4R1E A;  2KNE A;  4MVF A;  1K95 A;  1W7I B;  3AAJ A;  5I2Q A;  2F2O A;  1J7R A;  4GGF C;  1QV1 A;  5K89 A;  2H8V A;  5CSJ A;  1BR4 B;  3VRQ A;  1B8R A;  2JU0 A;  1KFU S;  3KEV A;  4OZD A;  3V2L A;  1JFK A;  1JUO A;  2EGD A;  2BKI B;  1S5G Z;  1YRT B;  2OTG B;  2COL B;  2JNF A;  1XFY O;  1WY9 A;  3DD4 A;  3D76 A;  3UO9 A;  2LUX A;  3O4X A;  1JFJ A;  3GK4 X;  4INW A;  3BOW A;  1SW8 A;  1CKK A;  3PN7 B;  5PAL A;  3CWG A;  2LVJ A;  1TWO A;  1YVH A;  2M7N A;  3OX6 A;  2JOJ A;  4WRI A;  3CS1 A;  1CM1 A;  3S0D A;  1OZO A;  4I5K A;  3M0W A;  1AP4 A;  4ORA B;  1WRK A;  2EHB A;  3I5G B;  3PFV A;  2LHI A;  4ZCV A;  3OB1 B;  1YX7 A;  1BF5 A;  1J7Q A;  1WRL A;  4AQJ A;  5KTY A;  1IRJ A;  2HQ8 A;  1AHR A;  3BFB A;  4PCW A;  1NX1 A;  2HET A;  3GK2 A;  1PSR A;  1UWO A;  1CDN A;  1CM4 A;  4MRX A;  3I5G C;  4WQ3 A;  2F3Z A;  3CZT X;  2JXL A;  1KCY A;  2L98 A;  3FWC A;  1SNL A;  3A8R A;  3DVJ A;  2I7A A;  4DS7 A;  1DJI A;  2FJU B;  2ZKM X;  5IBW A;  3Q8I A;  2PMY A;  3B7A A;  3SJS A; 
#chains in the Genus database with same CATH homology
 1K9K A;  1OOJ A;  1OZS A;  2JWW A;  3NSK A;  2NCP A;  3BOW B;  3VRR A;  2P6B B;  5KU1 A;  2WND A;  4BY5 A;  2LNK A;  3I5H B;  3O4Y A;  4YGB B;  1EH2 A;  1AJ4 A;  3O2P A;  1F4Q A;  1Y1X A;  1SR6 B;  2HQW A;  4XJK B;  4GBA A;  1D1O A;  1TNQ A;  1REC A;  1K93 D;  3F45 A;  1IKU A;  1DJH A;  1PVA A;  1JBA A;  1QJT A;  1ZFS A;  4PHM A;  2Q4U A;  5HLO A;  5I2L A;  3I5H C;  1ALV A;  4A4C A;  1YUU A;  5AAN A;  1SYM A;  4GUK A;  3H4S E;  4MRY A;  1NYA A;  3KPX A;  2LMT A;  5AXI A;  2QAC A;  2Y1M A;  1A2X A;  3FIA A;  1S6J A;  2KSP A;  2LP2 A;  1B8C A;  3OX5 A;  1K8U A;  1TN4 A;  1GGZ A;  3K21 A;  5ER5 A;  2NCO A;  2ZFD A;  2FOT A;  4ETO A;  2M1U A;  2WOR A;  3BUM B;  3ICB A;  3C1V A;  2L0P A;  1NCZ A;  2GGM A;  3WHT B;  2O5G A;  3SIA A;  3TDU A;  2LE9 B;  2ZND A;  5FYX A;  2G2B A;  2GGZ A;  3BUO B;  3LCP C;  1N2D A;  1G8I A;  1IWQ A;  1YR5 A;  5I8N A;  4PHJ A;  4TNC A;  2KQ6 A;  1XFZ O;  2CXJ A;  1S26 D;  1NP8 A;  5HKZ A;  3JVT C;  1KK8 C;  1JF0 A;  4M2O A;  2LAN A;  2ISD A;  2LLU A;  1MWN A;  4QJ3 B;  5HKW A;  1FPW A;  3FS7 A;  5B8I B;  1MXE A;  1XYD A;  2WCE A;  4UPG A;  1KFU L;  2SCP A;  1U5I B;  2AUC A;  1YUS A;  2OPO A;  3AKB A;  3EK4 A;  1NUB A;  3O6B A;  4U8D A;  1CB1 A;  2CNP A;  2CT9 A;  3HCM A;  1S36 A;  5CSF A;  1UUR A;  1SRA A;  1B8L A;  2AMI A;  2BL0 C;  2V53 A;  2KYC A;  1NCX A;  2KHN A;  4NDC A;  3GOF A;  2K2F A;  3SG7 A;  4YGE B;  5D7F A;  2HF5 A;  1MUX A;  4HSZ A;  1CLM A;  1UHN A;  2QPT A;  3I5F C;  1CFF A;  2JTT A;  4PHN A;  2VRG A;  1CFC A;  4OR9 B;  3EK7 A;  1F70 A;  1WDC B;  1DGU A;  1ALW A;  2L50 A;  3SG2 A;  3WXA A;  1XK4 A;  2I94 A;  1R6P A;  2Y4Q A;  3DF0 A;  1UHJ A;  1OMR A;  2K7B A;  1A03 A;  2M1K B;  3CR5 X;  1IH0 A;  1KK7 Y;  1V1G A;  5AFP A;  1ZAC A;  1M39 A;  1C7V A;  1BU3 A;  2JT8 A;  1B4C A;  1WDC C;  1DJW A;  2BBM A;  2BE4 A;  1J7P A;  1RK9 A;  4HRE E;  1YUT A;  4N1G A;  5ER4 X;  1S6I A;  1MHO A;  2CTN A;  1B7T Z;  3SG6 A;  2L2E A;  2K2A A;  4CPV A;  1BOC A;  1TCF A;  5D69 A;  3LK1 A;  1DJG A;  3OB2 B;  1IQ5 A;  2LUC A;  1J55 A;  1CTR A;  1JF2 A;  2KDH A;  1PAL A;  3BUX B;  3DVM A;  4FTG A;  4MZL A;  1BMO A;  4PE1 A;  2KYF A;  2LVV A;  2PSR A;  1GQM A;  2PRU A;  1SKT A;  3IQQ A;  5DKR A;  3NSI A;  1DTL A;  1KFX L;  1MXL C;  3ZNI A;  1GGW A;  1CLL A;  1SK6 D;  1W7J B;  3DF0 B;  1QAT A;  1WRZ A;  3IQO A;  1UHI A;  4OVN F;  1PSB A;  1R2U A;  2LVK A;  2M97 A;  1J7O A;  1CLB A;  3A4U B;  4YGA A;  5G08 A;  2KFG A;  2WCF A;  4N5X A;  1M45 A;  1OE9 B;  4I5J A;  1JWD A;  1TIZ A;  3O78 A;  1QLS A;  4MN0 A;  1QTX A;  1XK4 C;  4QJ4 B;  1KK7 Z;  1UUS A;  2DOQ A;  3VRO A;  4BY4 A;  1XFV O;  1DJX A;  4PAL A;  1QX2 A;  4PDZ A;  1K94 A;  1C7W A;  1SCM B;  1YX8 A;  3NSL A;  1QX7 A;  4MZJ A;  4ZCU A;  2F33 A;  1J1E A;  2RGI A;  2I18 A;  1TNX A;  1VRK A;  2E6W A;  4JQ0 D;  2MA2 A;  1RRO A;  5JOL A;  1DT7 B;  1MR8 A;  1F4O A;  1AVS A;  2PAL A;  1K90 D;  2KFF A;  2KOT A;  3MSE B;  5CSI A;  4YRU A;  1KSO A;  1SCM C;  4AOM A;  3PM8 A;  2BBN A;  4NDB A;  2H61 A;  1QAS A;  4P2Y B;  3AAK A;  2KFH A;  3TUY C;  1SL7 A;  4DUQ A;  1DF0 A;  3KHE A;  2LC5 A;  1L7Z A;  1M46 A;  2F8P A;  3JVT B;  1EG4 A;  1KK8 B;  1K96 A;  1S1E A;  2GV5 A;  3LK0 A;  3PLF B;  3RLZ A;  1KQV A;  1LA3 A;  3E3R A;  1ZMZ A;  1RJV A;  4CLN A;  1K2H A;  3D10 A;  2KGB C;  3D0Y A;  2LLT A;  1CDL A;  2KAV A;  1XFX O;  4GGN A;  2FCD A;  4WQ2 A;  1Y1U A;  4FQO A;  1UHH A;  2LLS A;  4A4B A;  1KWO B;  3WNX B;  1FI6 A;  4QJ5 B;  2K61 A;  1F71 A;  4OV2 A;  3HX4 A;  1B47 A;  1G33 A;  1HT9 A;  2BL0 B;  2KBI A;  2ZNE A;  3RM1 A;  1A75 A;  2BKH B;  2MLF C;  1BG1 A;  2KGR A;  1EJ3 A;  5CPV A;  2ZRT A;  2I2R E;  3EKJ A;  5JJG A;  4MSP A;  3SG5 A;  5I2O A;  2BCA A;  1B9A A;  3EVV A;  1LVC D;  1KWO C;  1QLK A;  3PAT A;  3SIB A;  4C0L A;  4IL1 A;  2KI4 B;  1CFP A;  3EKH A;  3I5F B;  3CLN A;  1IJ5 A;  5CSN A;  4GFT A;  1BJF A;  1DMO A;  2IS9 A;  5HYD A;  2OS8 B;  2KAX A;  4CID A;  4CFQ A;  1AJ5 A;  2BCB A;  1H8B A;  1XA5 A;  2LCP A;  1C07 A;  1MF8 B;  1JC2 A;  3CR2 A;  2H61 C;  1DVI A;  2KI4 C;  5HLV A;  1JSA A;  1NCY A;  1XFU O;  3TDI A;  1UP5 A;  4Q04 A;  2D8N A;  2EC6 B;  2OS8 C;  4M2Q A;  1OMD A;  1QXP A;  2M49 B;  4ICB A;  2F3Y A;  3EVU A;  1J1D A;  2ZRS A;  1CDM A;  4E68 A;  1QVI Y;  2BEC A;  4MEW A;  1NIW A;  1YTZ C;  2MJW B;  1SL8 A;  1GJY A;  1BLQ A;  2EC6 C;  3EK8 A;  4OKH A;  1CFD A;  4MLW A;  1F54 A;  4F0Z B;  1A29 A;  2WOS A;  2JC2 A;  2JNX A;  1L2O C;  1QIW A;  1ZOT B;  4MZK A;  1LIN A;  4PE4 A;  2NLN A;  4L9M A;  2L4I A;  4P5O E;  4AQI A;  4D1E A;  2MAZ A;  1H4B A;  3FWB A;  3LLE A;  1N0Y A;  3I5I B;  2KI6 C;  1V1F A;  3CR4 X;  1CMF A;  2JRF A;  2NXQ A;  4DRW A;  2O60 A;  4PE0 A;  1TCO B;  2JT3 A;  1NX0 A;  2OTG C;  2L51 A;  3BUN B;  2MLE C;  4XJK A;  1ZUZ A;  3IF7 A;  2R2I A;  3I5I C;  5HKY A;  1TNW A;  1N65 A;  3NXA A;  2AAO A;  4HRG A;  4C0J A;  2H2K A;  3PN7 C;  4CFR A;  4DIR A;  5DKN A;  1CDP A;  4PHK A;  3BYA A;  3PAL A;  2E30 A;  1EG3 A;  2L4H A;  2PVB A;  1QVI Z;  2K7C A;  2M9G A;  5AEQ A;  1IQ3 A;  2LMU A;  2G9B A;  2JTZ A;  1QIV A;  5F6T A;  2JQ6 A;  1M31 A;  1OSA A;  2LMV A;  1EXR A;  1TOP A;  1F55 A;  3PSR A;  1FI5 A;  4GPL B;  2B1U A;  1RTP 1;  1NPQ A;  1YUR A;  2SAS A;  1YVL A;  1IGV A;  2NZ0 A;  2KBM A;  4MBE A;  3DVE A;  1FF1 A;  2M3W A;  2A4J A;  2MHH A;  2MRD A;  2M7L A;  1SL9 A;  4OCI A;  5DKQ A;  3BQ3 A;  3ZWH A;  3TUY B;  3LL8 B;  1SPY A;  2LM5 A;  1XFW O;  1BR1 B;  4C0K A;  2ZN9 A;  1RFJ A;  2JT0 A;  2L5X B;  3CTN A;  1BOD A;  1S6C A;  1DGV A;  1BT6 A;  4YGD B;  3VRN A;  1XO5 A;  3NSO A;  2Q91 A;  1TRF A;  4NQG A;  1NX3 A;  2LHL A;  4ORC B;  2K7D A;  2Y5I A;  1SY9 A;  3TS5 B;  1LA0 A;  2WCB A;  5BPJ A;  1KSM A;  1SCV A;  4USL A;  3EVR A;  4GNK B;  2TN4 A;  3JTD B;  2HPS A;  3KF9 A;  1PVB A;  5J3X A;  4JWQ A;  4GAO A;  1SR6 C;  1KFX S;  1MQ1 A;  1UHK A;  2Y1N A;  3BUW B;  1QV0 A;  1PUL A;  1U5I A;  3SG4 A;  2JUL A;  2LP3 A;  3OHM B;  1S3P A;  1WLM A;  2ZN8 A;  2MBX A;  3BXK A;  4HRH A;  1NSH A;  1IG5 A;  1CNP A;  1FW4 A;  1CMG A;  1Q80 A;  2M8U A;  2K8M B;  4GGF A;  2F2P A;  3JTD C;  1Y0V H;  1AK8 A;  1IJ6 A;  4I5N B;  3SG3 A;  2M0R A;  1AUI B;  3VRP A;  1FBV A;  1SMG A;  2LVI A;  1M63 B;  1NX2 A;  1OQP A;  2WC8 A;  1G4Y R;  4PE7 A;  4XYN A;  1WLZ A;  4I5L B;  4ORB B;  2PAS A;  2K7O A;  1OMV A;  1E8A A;  1S5G Y;  1PRW A;  2KI6 D;  1PK0 D;  1Y1A A;  1DF0 B;  1SBJ A;  2KAY A;  3TS5 C;  2LV7 A;  2BE6 A;  3OP0 A;  1DJZ A;  1Y6W A;  5AER A;  4N1F A;  4NDD A;  2CCM A;  1RWY A;  1B1G A;  3CGA A;  2JPT A;  2CBL A;  1XVJ A;  3GK1 A;  2M29 A;  4DCK A;  1QS7 A;  1EL4 A;  1TTX A;  1LXF C;  1K9P A;  1KQM B;  2JXC A;  3D0Y B;  3DVK A;  1K9U A;  1TNP A;  2K0J A;  4YI9 A;  3VGO A;  3WHU B;  4JPZ B;  4YBH B;  4YGC B;  1LKJ A;  1QX5 B;  1X02 A;  4M2P A;  3TZ1 A;  1F8H A;  1B7T Y;  5TNC A;  2FCE A;  2KQY A;  3TDZ A;  3AKA A;  3QRX A;  1YRU B;  1L2O B;  1A4P A;  1A75 B;  5KSZ A;  1KQM C;  1NWD A;  1HQV A;  4YI8 A;  3KO0 A;  1ODB A;  2JZI A;  2BCX A;  5GQQ C;  1DJY A;  2LAP A;  4R1E A;  2KNE A;  4MVF A;  1K95 A;  1W7I B;  3AAJ A;  5I2Q A;  2F2O A;  1J7R A;  4GGF C;  1QV1 A;  5K89 A;  5CSJ A;  1BR4 B;  3VRQ A;  1B8R A;  2JU0 A;  1KFU S;  3KEV A;  1JFK A;  1JUO A;  2EGD A;  2BKI B;  1S5G Z;  1YRT B;  2OTG B;  2COL B;  2JNF A;  1XFY O;  1WY9 A;  3DD4 A;  2LUX A;  1JFJ A;  3GK4 X;  3BOW A;  1SW8 A;  1CKK A;  3PN7 B;  5PAL A;  3CWG A;  2LVJ A;  2M7N A;  1YVH A;  3OX6 A;  2JOJ A;  4WRI A;  3CS1 A;  1CM1 A;  1OZO A;  4I5K A;  3M0W A;  1AP4 A;  4ORA B;  1WRK A;  2EHB A;  3I5G B;  3PFV A;  2LHI A;  4ZCV A;  3OB1 B;  1YX7 A;  1BF5 A;  1J7Q A;  1WRL A;  4AQJ A;  5KTY A;  1IRJ A;  2HQ8 A;  1AHR A;  4PCW A;  1NX1 A;  2HET A;  3GK2 A;  1PSR A;  1UWO A;  1CDN A;  1CM4 A;  4MRX A;  3I5G C;  4WQ3 A;  2F3Z A;  3CZT X;  2JXL A;  1KCY A;  2L98 A;  3FWC A;  1SNL A;  3A8R A;  3DVJ A;  2I7A A;  4DS7 A;  1DJI A;  2FJU B;  2ZKM X;  5IBW A;  2PMY A;  3SJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...