4C0KA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one calcium ion (ca-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0kA03
3C41J 2BE6A 4M1KA 4GNKB 2P67A 3LD9A 4MQBA 1TQ6A 4MGYR 2OAP1 1VYVA 1GAJA 1V1FA 1GILA 3AF2A 4XWAA 2BJVA 4ZKDA 4XJKA 2KI5A 1FQJA 2V4ZA 2OLKA 1FTSA 1L8QA 1OF1A 3F0TA 3K0CC 1MQ1A 1FP7A 3KF9A 3RDPA 1IAQA 1UF9A 2EFHB 3PM8A 2MRDA 1NBMA 1P2VA 3H2YA 4CT5A 2G3YA 3EPKA 3EA5A 1YR8A 1YZLA 1YZTA 5LD2B 4D1EA 4X8LA 5FTJA 1K2HA 5F98A 3TSZA 2MSCB 3KQHA 4URUR 1HYQA 3GJ4A 3IKJA 5C18A 1W4CA 5FH9A 4AD8A 2KAVA 3ZVRA 5FOTA 2XZLA 3GFOA 1E8AA 2J0VA 2UZ3A 3X2SA 1YUSA 3NKVA 2FE4A 2H16A 3IEVA 5FTMA 2NTYC 3CH4B 2PJZA 5JFGA 1EX6A 2MA2A 5AEQA 3D7MA 1J2JA 1E2NA 2Q3HA 2BMEA 4DT1A 5GADl 1GGWA 3LLUA 4OQXA 2GILA 1OXTA 4FQOA 3FWBA 5FR2A 1TN4A 3NH6A 3C5HA 3K0AA 2KJQA 1EK0A 2A5GA 4YGAA 1BO6A 2JLSA 2XZPA 1KMQA 3WMGA 3BUNB 2ZEJA 1RYHA 5GVSA 4TMVA 5CLQA 3AF1A 2FA9A 2VTKA 3P4XA 5FOWA 3GLGA 4QL3A 1K96A 1AGRA 4MGKR 3LVQE 5DYIA 2ZPTX 3MSXA 5IHPA 3ADCA 3Q7PA 4PHNA 8OHMA 1Z0JA 2V8OA 3TRFA 4DKXA 3TSWA 1NCZA 4M2LA 2ODNA 2V9PA 3Q8XB 1D6JA 4DDTA 1PULA 4PANA 1CM4A 1DBSA 3MWYW 4JLNA 1KO5A 2KAYA 3PEVA 5I2QA 5F9HA 1KJZA 1JBKA 1S1CA 4QJ5B 4Y0AA 3GMTA 5AERA 3FKSA 4LUCA 4FD2A 4M2OA 2PEYA 3B1XA 4ZI3A 2REBA 1OT3A 1CR2A 1QVAA 2YC2C 1TL7C 1UPTA 3CS1A 1UKVY 2K7BA 1LXFC 1WCV1 2H1LA 3ADKA 3G5UA 3AF0A 4PQFA 3S1AB 4DLYA 4Q4JB 1U5IA 3LNCA 3I73A 1NWDA 3CX7A 5AJWA 2F1JA 3KKMA 2K61A 4NDCA 1SVIA 4KI0A 3D0YA 4N1FA 2MMCA 2IW3A 2QQ0A 2OBLA 3SYNA 4U5XA 4YMUA 4ZDKA 4PO8A 1T0JB 1Z2AA 1KZ7B 2FNAA 2Z83A 5KDLA 3BOWA 3WMFA 5EP4A 4XWKA 3KHEA 1HA3A 4BEJA 4LI0A 4M2PA 1TNWA 2LVKA 3GJ3A 2KBFA 1CJKC 1N25A 3BRWD 2QT1A 3LO5A 2BL0C 3RS0A 2OCPA 1HV8A 1N0UA 2V1XA 3CO5A 5I2OA 1R10A 1R6PA 3W6PA 4OI1A 2Q4UA 1RJVA 4NCJA 4Q9IA 1NN0A 4FTGA 4KHZA 1MHOA 5EZ6B 2W2TA 3F8TA 2WIBA 3W6OA 3CZPA 3TGPA 2BKUA 2C8VA 1FUUA 4LYJA 2A2ZA 5AK0A 5IK2A 3O4YA 1S96A 5JJLA 1KYIA 5EE3A 1KO7A 2VBCA 2XX3A 2BBMA 1XMIA 5IK2D 1ESNA 3O8BA 4BZXA 4MDFA 1WE2A 2ZRAA 3QIAA 2BJWA 3NBYC 1JECA 1EJ3A 3SJSA 2BECA 4ZIRA 3O2PA 2NO9A 1ALWA 2IYTA 1J7PA 2HUPA 1QBKC 3K1JA 1DJZA 1MF8B 2K8MB 2JQ6A 1W7AA 1AA9A 1BYUA 3OB1B 3CF2A 4FIDA 2AX4A 2E9SA 1ZUZA 3KB1A 3LL8B 1NP8A 2NQ2C 3SJZA 5B57C 1N0YA 3MWJA 5JI2E 1OH8A 4IDNA 1Q3TA 4Q9KA 4D0NA 5JCZA 3D31A 1CBUA 1M39A 3EZ2A 1JJVA 2ONKA 4QJ4B 5FOUA 2OBNA 3ZDQA 2D74A 3LW8A 1KHTA 4XD7A 4OBEA 4YMWA 1JR3E 2B92A 2I3BA 4ARZA 1N5IA 3FS7A 1R0XA 3BB3A 2GJ9A 4LPKA 4TL6A 4HLDA 2BBSA 2WICA 3GJ0A 4TTPA 3FDIA 1D9ZA 3K0CA 3K0AB 4Q7MB 4QGFA 1HE1C 2VP6A 3FFBA 5D3MB 3ZH9B 5IF9A 2AUCA 4LJ8A 4DT1B 2NZ0A 2J0UA 2LKDA 1E94E 3A1TA 3AEZA 2E30A 2QU8A 1T4GA 721PA 5D69A 2V55B 2GK7A 1WMSA 4OJKA 4OHVA 5B8IB 2P2LA 4M1MA 3TBKA 4LJ5A 1W36D 2J59A 2R62A 2HPSA 2OSBA 4HB4A 2J7KA 2ORVA 3JVTB 1YHNA 4TMWA 3LH5A 5AUQA 2NZJA 3UMFA 2VHTA 1XJ0A 2J0SA 1CKEA 4F7WA 3U44A 3TUYB 3BYAA 4ZKEA 2OCAA 1UBFA 3B1WA 3W34A 1FI5A 5A5GA 1N0VC 1HQVA 1ZIPA 2CJWA 5GJCA 3AAKA 3WYAA 3SIBA 3GEHA 3L8YA 2ZRKA 1TUEA 2ECKA 4NTZA 2BKHB 1IGVA 1S0UA 1RFJA 4IDQA 3BUOB 4DLUA 1BIFA 3U5ZB 3AKBA 4C30A 4IFBA 4AYTA 3IF7A 1LTQA 2H61A 1M45A 4YQFA 1JF2A 4D4LA 4DRZA 1B23P 4PPNA 3ETLA 3LXRA 3KB2A 1XO5A 1CR1A 3T1QA 1A75A 4Q4JA 3U6BA 1IJ6A 4C0SA 3TE6A 1DVRA 1PVAA 2JJ1D 3EVUA 1KI3A 4IEEA 1KSOA 1NUBA 4LJ9A 2JAQA 2AR7A 1VMAA 4V0KA 3T1TA 5E3HA 1II0A 1C7VA 2ZJ2A 1WRLA 2ZNDA 1G64A 1VYUA 1XF9A 1KCYA 1XD2A 4NHOA 3FWCA 2PZFA 5G40A 4UXHA 3SBEA 3TR5A 4TYQA 2O8FB 2WOSA 2FDCA 1XRJA 2AL7A 1DAHA 1QHSA 1IJ5A 1BKDR 2ZSAA 3JZMA 3WNBA 4KSCA 1UBEA 4B2IA 1G9XA 1CP2A 2QUZA 5EQTA 3RC8A 2KI6D 2OS8B 2FJUA 1GTVA 2ODBA 2A9KA 5I2LA 3TAUA 5KDOA 2CJWB 4XIGS 5JS7A 3EW9A 1G18A 1GWNA 3UWKA 4TQAA 4A2QA 3I5GB 4FMDF 1SHKA 1DAKA 3GP8A 1Z08A 2BBOA 1NNEA 4PHJA 1KK2A 1GFIA 1KDTA 4QXAA 3SI7A 3D0YB 1AP4A 3WBJA 4B3BA 1KNQA 1P5ZB 4JZKA 4DLSA 4D81A 3QNUA 2WSSD 3LA6A 3QPWA 4L9WA 4OI2A 1LA3A 1KI1A 3LK1A 2JLZA 2P6RA 1U9IA 1Q44A 4MRVA 1E2HA 2ERYA 3Q5EA 1UKEA 2PX3A 5JJIA 1Z6YA 1G8IA 2ZUDA 2RHMA 1E2QA 4BFTA 5FBWB 3SQWA 2D62A 4Z54A 3A37A 4EFMA 4PXAA 1W0JD 1OMDA 2BCAA 3MLEA 2GEUA 5DSZA 1JPNA 1RRPA 1AN0A 1Q20A 2WAXA 3QI2A 1UKZA 3TJZA 3VR4A 4C0AC 4W5JA 1JPJA 1X8JA 2OO7A 5C1BA 1OXUA 4B75A 2JLVA 2YZ2A 3SR0A 1UAAA 1JR3D 3L82B 3CRQA 1BT6A 4QJ4A 4BQSA 2QP3A 3DEFA 3DM9B 1X02A 1KZGB 2Y5IA 1P60A 1IH0A 4Q4HA 2GZHA 3KXKA 3AV0B 3I5HB 2QNRA 2PRUA 5JRJA 4MRSA 2ZKMX 3AVVA 3ICQB 3M6AA 4JLJA 1J7QA 2WSMA 3BH7A 5HZKA 1VHTA 4A2WA 2HT1A 1ZM7A 3PATA 2B7BA 4TT3A 1B8LA 1KJYA 1KO1A 3QVVA 4CF7A 3EZ7A 1F4QA 2NXQA 1R4AA 1T6NA 3QF7A 1E2IA 1U81A 1I2MA 1I4TD 2IWHA 3RC3A 4A1FA 1P72A 2FV8A 4ZIRB 1EG4A 2LVJA 3FWYA 3OESA 2XB2A 2QE7D 1R6BX 4DUGA 3K0FA 3ZD7A 1XXHE 2BVNA 2JJ8A 4CEIA 5BQ5A 4P0TA 5J40A 4DUGD 2WCFA 4YGBB 3B85A 4ZV4A 2QT0A 2O8CB 1G8PA 1UHIA 2I2RE 4US1R 4A0HA 5K89A 2FGJA 2Q6TA 5B64A 4Q66C 3N5CA 2ZS9A 4R98A 3DVLA 1NIWA 2JA1A 1OB5A 2JLYA 1NCYA 3O8RA 3PVSA 5DI3B 2WJVA 1IN4A 2QMEA 1TNXA 2Y1NA 3A8RA 1XJCA 2VEDA 3CRW1 4WZAE 3OEHA 3QF4B 4F92B 2Y8EA 4NCNA 2IHYA 4GRAA 2WORA 1IN6A 1JXMA 2QPOA 4P4TA 4PSKA 4AG6A 4B35A 3L0OA 4DDVA 1NN5A 121PA 2DR3A 4ILEA 3EXAA 4EIWA 3NXAA 2IS4A 5JJKA 3MWLA 2YWEA 3P27A 4JL5A 4S2EA 5JS8A 1F54A 5SZKB 2Q21A 5EE1A 3SG4A 1M31A 1A75B 3D6TB 1QX2A 2V7QA 2J7PD 1G33A 2CCGA 4CLNA 4M1TA 4ZI2A 2DFNA 1DG3A 4JLBA 1XZQA 3K70C 2WHXA 3CWQA 1K94A 2AD5A 3C5CA 2Q9CA 2GZDA 1XK4C 2F43B 1J55A 3BD9A 4RFSA 3O6BA 1AK2A 1MOZA 2K7CA 4N1AA 3KKNA 4AK9A 1Z0FA 3SFZA 3NSKA 3N70A 3EKHA 1UDWA 3CR7A 3RM1A 3I72A 3MFYA 5BN3A 4MZKA 2XJ9A 2G0TA 3IHWA 4W7SA 3GQBA 1DT7B 4HLUC 4GPTA 3ZVLA 2VSOA 2GRJA 3OHMA 1UHHA 1VECA 5J4KA 2ISDA 1E2JA 5CDFA 2R44A 4R2IA 2QGZA 1BMFA 3LRPA 1M7HA 1KWOC 2DFLA 5F3WB 4PHMA 1KGDA 1Q21A 2R9VA 4OQLA 4CW7A 5CB8A 4L8GA 3GJ8A 2JT8A 1DJXA 4MUAA 4IVQA 4WA7A 3E3RA 1JUOA 4YDSA 1NKTA 2Y1MA 1ZD1A 3GLIA 4BFYA 1I2DA 3W5IA 3AF4A 3RWMB 4QBGB 1Z06A 5HLVA 1NRJB 1Y63A 1ZU4A 1F8HA 3H4SE 2IYVA 3AGPA 3QF4A 4JIMA 4KU4A 1MH1A 4HZUA 2PASA 1YUUA 1QHHA 4LHXA 3EVVA 3U3MA 4RKFA 1C7WA 4D4MA 2WWHA 1II8B 4Q9JA 2WOOA 1CDMA 1SVSA 3CB4A 1E69A 1YURA 4OL0A 2WZQA 3EPLA 3ICBA 2QPAA 3EPJA 1DAMA 4XH9B 2PLRA 5TV2A 2HYDA 2CLCX 1SVMA 1U99A 1GSIA 3WY9A 4V0OA 1NYAA 2Y4QA 2Z4RA 4MUBA 1EXMA 3N2EA 5KSZA 5CYPA 2L98A 3OIVA 3SJAA 4PSVA 3GEEA 1SZPA 3A1UA 1B9AA 2KOTA 4YBHB 1ZIOA 2J0UB 1ZNXA 2IBMA 4Q4HB 2V53A 4ASUD 2BEJA 1MRSA 3IPYA 4RFVA 3THWA 3AH8A 2OHFA 2V1UA 1SKYB 2VP9A 5FPTA 3K9HA 1TNDA 2HCBA 5C4GB 3CTNA 1N0WA 3R9WA 1ZUIA 1U8YA 1COWD 2ATVA 2BE4A 1XEXB 1S36A 1G1MA 2BEKA 4BRUA 1KSHA 3PJRA 1K9PA 1VPLA 3THXA 1P2UA 2JEOA 2ZTSA 2NPIA 1GNRA 1NMXA 2JJ1A 1DGUA 1NBME 2G83A 3BORA 3TAHA 4V0MA 3I1FA 1B1GA 3ICEA 3PR1A 3HDTA 5EXTA 5FI0B 1I4DD 3JZAA 3ONWA 1FQKA 3GK4X 1KJWA 2DY1A 4X8OA 4YGCB 3SNHA 2Z6VA 3CM0A 4JJKA 4TQ9A 2FN4A 3FOZA 3UWOA 1AUIB 3RS5A 3QRXA 4RVCA 5J5CA 3F3YA 2FX3A 3B82A 3NDBB 2FZLA 2LVVA 2QE7A 1WRBA 1BMOA 1OPXA 1XX6A 4D25A 5AJVB 1G4AE 3UPUA 2CXXA 2NO7A 3QXJA 5CSIA 4BLQA 4KVGA 2LUXA 2ZNEA 1KI8A 1O87A 3LX8A 5KPJA 1W0KD 1D8TA 2IUUA 1OKKD 2K7DA 1TAGA 4YMSA 4B43A 4JKYA 4LV8B 4M21A 4BECA 1FW6A 2YOHA 4F91B 3EX7C 4D4KA 3TNFA 1NPQA 4PCWA 1UADA 2PMDA 1YTZC 2X1VA 4PTLA 2HJGA 2D2EA 1OB2A 3NSLA 1ZFSA 2JULA 2L51A 1XK4A 3VMFA 3FTQA 3OF5A 1LF0A 4QBIA 4EQ6A 4GGNA 2D8NA 4E22A 4AQIA 4LYFA 4Y0VA 3FYHA 3PUZA 1RJ9B 5CYOA 4CEIB 1IXSB 5LB2A 1NX3A 2A3RA 1H8HA 3BOWB 2AHOA 2OS8C 2CK3A 2PLFA 2K5UA 1B4CA 1FNNA 2QROA 2WAYA 2BBWA 2BM1A 2VHCA 2VO1A 1H8ED 4NQGA 1KOFA 5JOLA 1LNZA 2GESA 2IXGA 4LJ6A 4M22A 5JZVA 1RIFA 2PALA 1CULC 1ZBDA 3MG9A 4GMDA 2M9GA 4IFEA 3X1ZA 1W4BA 1G6OA 4IOMA 4MLWA 1JFKA 4DCKA 1R8QA 2XTNA 2ZRNA 1GOTA 2QY9A 1HY3A 1F48A 1CDLA 1E9RA 1XZPA 3SG7A 4YXWA 4WRIA 3TDIA 3RS7A 2LM5A 1R2UA 3E5HA 1E2EA 4C2TA 3VR6A 2OEPA 3EARA 1P9WA 2MBXA 1ANKA 2VP0A 2VSXA 1AS2A 3B6EA 2ZANA 2L0PA 1EG7A 4A6XA 2RKOA 3R9IA 1G5TA 4Q21A 1PLJA 4DLWA 4CEHA 2EQBA 1MXLC 4EFNA 4TYPA 4KCGA 1WRKA 3KJGA 5G3ZA 3AUYA 4XVQA 2J7PA 3HWSA 2AAOA 2BCBA 4KJZA 2J3EA 4PQRA 4XVRA 1XA5A 3OAAD 1BJFA 1E98A 2HJVA 4LHVA 2F3YA 1I4LD 1UHKA 2L50A 3RS2A 4AC9A 3TUZC 4URWR 2LKCA 1DAFA 3WNDA 2HCJB 1K8RA 3IUYA 2IYQA 3QXCA 1YRTB 2NLNA 1IRJA 4B74A 3B2EA 5ANRB 1N5JA 1EWQA 2FOTA 4JL6A 2F2OA 3DMDA 4JBYA 5DKRA 4Q02A 4Z51A 5HR5A 1L4UA 5HKKD 1SR6C 2IHBA 2WJYA 1L7ZA 4XTRA 2CLDX 1ZJ6A 5JHGB 1UDXA 3E1SA 3ZS9A 4OYHA 1RWYA 5CM9C 3QBVA 2GA8A 3BFKA 4HLUA 1XTSA 3BXZA 3GJXC 3IBYA 5EP3A 5EXPA 2HEIA 4C4PA 3GLHB 1QHHB 4DSOA 4HRHA 3IO3A 3GPLA 1DAEA 4YI8A 1OHHA 2XB4A 3CRVA 2KBEA 2QMUA 4GBMA 4DEYA 4A2PA 5A4JA 5K8LA 4HSEA 2GCOB 4MGZR 3T1OA 1YR6A 1LS6A 1MR8A 2GXAA 2W6JD 1XFWO 2DBYA 3W6NA 2KBMA 2KNEA 1GL7A 1QIWA 1GIAA 4DS7A 1A2BA 1G6HA 2OM2A 3MSEB 3IIJA 3QVUA 1NIPA 2PT5A 3VHXA 1P62B 1CLLA 1RRFA 2WMOB 1HUQA 1CR0A 2KB0A 1SKQA 3DZ8A 1A5TA 5FPHA 1G41A 1J1EA 1QATA 4PDZA 1OFHA 1F2TB 3GEIA 3QY0A 1XTQA 3BOSA 1LVGA 5L3QB 1LKJA 2IF0A 5E4FA 1Z8FA 1XFXO 3OE7D 2ZAMA 1U94A 2AWOA 5DNYB 1J7KA 5ER4X 1BR4B 2GETA 3PFVA 1E79D 3C8UA 3WYFA 4GDFA 1TF7A 2FFQA 3HYRA 4RD2A 2ZYWX 4IOKA 4XD7D 4Z1MD 1DEKA 3VTKA 3QEOA 4WW0A 2G6BA 1LS1A 3G0HA 1MR3F 2ZR9A 3PCRB 4UXJA 2DFKB 2IUTA 1TCOB 1Z0IA 3RRNA 1A1VA 3B13B 4AWXA 1D2NA 2FPLA 2KI4C 1W5SA 4KYIB 4EJSA 1P75A 3GLGB 4B6FA 3L0IB 2CCMA 4FMDB 5KNBA 1S6CA 1XMSA 2ZM5A 3EIEA 2ZU0C 2L4IA 3IGFA 521PA 4D6PA 4DVGA 5E7MA 3BH6A 2KHNA 1F5NA 2RAPA 1KNXA 4A8JC 2XNDA 1G17A 5AANA 2O8BB 2LVIA 4JT4A 1Z63A 1JNYA 4DWJA 1US8B 3M0WA 2O8EB 5G53C 4QBHA 4BE7B 3IPXA 4DSTA 3TDUA 1CFCA 1SXJA 1KIMA 4JLVA 2P3SA 4A0RA 2HLDD 4JLMA 5EZ5A 2VYFA 3UG6A 1SL7A 1J99A 5HE8A 2QMHA 3HR7A 1H65A 2D3WA 1OH5A 1DF0B 5DKQA 1KMHB 4LJ4A 4V0ME 4DIDA 3P32A 1CDNA 2G2BA 2XTMA 4HI0E 4M9SA 4JBXA 4OK6A 5H1YA 1G4YR 5HTKA 1MO6A 2DPXA 2IT1A 1F71A 3FVQA 3LVRE 4EUNA 5BN5A 4V02A 5EP1A 3MRSA 1DF0A 4L9MA 1KMHA 1P9RA 2JGNA 4BY5A 3U4QB 1CJVC 3SHWA 2ZSDA 3IIKA 3NDPA 1ZNYA 3QKTA 4HLQB 1COWA 3QQ5A 5FL3A 2QSYA 4KYUA 4UQOA 4A92A 5HZHA 5L3VA 3D3QA 1S1EA 5GQQC 2CVHA 3DOEA 2VLIA 4GSYA 2FSGA 4P5OE 1KSGA 3SE0A 1E1QA 1ELOA 3X1WA 1XPOA 4P4SB 3AKCA 1DVIA 4PE4A 2GWHA 2YOGA 4XSHA 3VX4A 2O8DB 2ZN8A 2ZRSA 4ZCUA 4NKRA 3V4RA 3ZS8A 4PPQA 1N2CE 2QQEA 4QOSA 1S5GY 1W4RA 4U02A 3A8TA 4BRWA 1Y3AA 3GCGA 1RK9A 2EYQA 2R6GA 1YVDA 3WNCA 2JNFA 4II7A 1XWIA 3K53A 1KSJA 1MUXA 5JHHB 4L9SA 3NHBA 2UKDA 2XOKA 4NYIR 1NN1A 4OQNA 2KFHA 1A2XA 2LV7A 1XMJA 1DPFA 4Q4LA 3FMPB 3CZQA 3N2IA 1K6MA 3PEWA 2ZFDA 1FF1A 2W0SA 3OEED 1XPRA 1Z29A 3R8FA 5CJPA 1G5RA 4F4JA 3GJ5A 1CU1A 4LV5B 5DI9A 1QX7A 2LMTA 1G16A 1TTTA 3I5YA 2W0MA 1VCOA 2QAJA 1JBAA 1M2OB 2VPPA 3VU9A 2EC6B 2EYUA 1AJEA 4AYXA 2JJ2D 1CLBA 2ZRFA 5D7FA 1ZD9A 1Z47A 4KXFB 1CMFA 5K8IA 3QXXA 2JT3A 1C07A 3ZZTA 3Q7QA 1P6XA 4BWYA 1EH2A 5DN6A 2H61C 1P61B 4I5NB 4M0LA 4GZLA 2XITA 4OQFA 4RZUA 4B33A 3WXMA 1RKBA 2HF9A 3D10A 4S35A 5C4MA 3FMOB 2HYIC 2J0QA 2H57A 2C96A 5CB6A 3ZZ0A 4LGMA 1YE8A 1D9XA 1Z0AA 2M1KB 2QP4A 2O8FA 1WBBA 1N6IA 4ARZB 4PZZA 1J7RA 2WCBA 4LY6A 2WJIA 3VRNA 1L2OC 3FHTA 1E2GA 4V03A 1K5DA 4WAUA 2GJAA 1XB2A 3U3KA 1UBCA 3PQCA 5F9FA 3W5JA 1KDOA 2AMIA 4Q1EA 1X1SA 2WWWA 3WHKA 1KKMA 2GEVA 4XVUA 5FOXA 1N6HA 1IHUA 4A36A 1NVWQ 2OUKA 3VNUA 1CDPA 2O0KA 2EFCB 4PFSA 3EZ9A 1YX8A 3TKLA 4Q9LA 2Q9AA 4FN5A 3AF3A 1PSBA 4JLOA 4Q47A 2CNPA 3Q9LA 4ZDJA 4TZ6A 1SXJB 3GK1A 1KK3A 3BQ3A 3EKJA 3W9YA 2O8EA 3HYTA 2EW1A 4C0QC 3BIFA 1S3SA 1US8A 5HKKA 4F38A 5AWFC 4ESVA 1EESA 1LY1A 1W1WA 4RD1A 3WHLA 1NCXA 1CTRA 4PE7A 3VHLB 1UHNA 2JZIA 4CIDA 2ZREA 5IT5A 3BE4A 3LWNA 5DIFA 1KQVA 4LYAA 1TQDA 2IS9A 2ODEA 3LY5A 4JJZA 2ZJ8A 1XPUA 2PH1A 2GHIA 1KK7Z 5JWRA 2W58A 1ZAKA 2XJ4A 2XOKD 4IEIA 4MITA 4NE2A 1B7TZ 4WVFA 3TLXA 2RCNA 2ZJAA 4DXAA 2RGNC 2FSHA 2H8KA 3NEJA 1AJ4A 2CHQA 3O47A 4IOLA 4TMTA 2ZRGA 2ANCA 1EFRA 3U6KA 1J70A 4IVRA 1SMGA 4ETOA 3EK8A 3HPQA 1PALA 3BXKA 1YR7A 2C9CA 2ZRJA 3P26A 4NH0A 5E7IA 4CT4B 4GT1A 3R8CA 4R71A 2V6JA 2X8AA 4DDUA 3V9PA 5FUWA 1G4UR 1U8AA 2V7QD 2YV5A 1H8BA 4M1YA 1QVIZ 3BJIC 1EFHA 1E4YA 4HAYA 1W48A 4I1SA 4NZYA 1SR6B 3TUJC 3I5FC 4L15A 2FPKA 3TW4A 1E6CA 4GP6A 4PE0A 1OZOA 2ZSFA 2JDIA 2GJ8A 3CPHA 2FFHA 4M4SA 3QKUA 4QHYA 2NO6A 1ZC4A 2D2FA 3CW2A 3K0SA 1WQ1R 3WP1B 4J0QA 3DKPA 5KOYA 1N5KA 3L0SA 4ORAB 4MYTA 1R7RA 4OJQA 3MAAC 2JT0A 3TZ1A 2WV9A 2JLWA 1K9KA 3NH9A 2CHGA 3TW8B 2GXQA 1CLUA 3U4QA 2O5VA 5BW8A 2Q91A 2QP9X 4GOJA 4NCIA 4QG7A 221PA 4X8MA 5H70A 1N2DA 4JVLA 5EXSA 4DLZA 2I1VB 2ZI6A 4G5OA 4JS0A 4Q7JB 1YZQA 5JJGA 3K09A 4ZCLA 2YNMA 4D80A 2IS1A 1N6KA 3RLFA 2R6AA 4G5RA 2OG2A 4TSFA 2F55A 2M97A 2A5FA 4DBLC 3KPXA 1F70A 2ZAOA 1DJGA 4ZDWA 4CZ2A 4ERNA 5AJYA 1QRAA 4JL8A 2I1QA 2WWGA 1K93D 1D5CA 1JFJA 2FU5C 3SDZA 4D0GA 1AVSA 3CKLA 3LXXA 5GVRA 4JSTA 4DLRA 1B8CA 3EK7A 2OFXA 1FP6A 3NC0C 2P6NA 1OJLA 5SZJA 4AKEA 5C46F 3E70C 5KNCA 5G3YA 2PJRA 4HB3A 4OK5A 5CSFA 3VROA 1H8EA 4PC1A 2JCSA 1S3GA 3KUCA 5CIWA 2QTFA 2W6IA 3A4LA 4IDHA 4EPRA 1VG1A 5KUTA 1W7IB 1HURA 1KI2A 2MLFC 3EG5A 1GDDA 2E87A 4C7OA 1SCMB 3BUMB 3A4UB 1TX4B 1Y1AA 3EK4A 4NP6A 3NWJA 2EWVA 4AIIA 4TL8A 1E4VA 5TARA 2DFTA 1FX0B 5FBLB 4E68A 3GFTA 4JLPA 2WMNB 4CEHB 4BFZA 4DJTA 3GLIB 4A0FA 2QI9C 2KSPA 3EIHA 4YMVA 5J4LA 5FPSA 1KO4A 3EWAA 2C78A 4B32A 3X1XA 1YR9A 3FGNA 1Y0VH 2DOQA 2LC5A 2REXB 2RGNA 4QHTA 4YDHB 1FTNA 2A30A 5K8UA 4WZBE 1CJTC 2YWGA 3ASZA 5D3QA 2F3TA 4ZCIA 1EFUA 3RSLA 3PV0A 1JR6A 2ZR7A 1QHGA 4ITRC 2WC8A 1VG0B 5TY0A 4BLPA 1F4OA 2CL6X 3SS8A 2C99A 1OLOA 1S26D 3AUXA 3CBQA 4LDJA 5JI3E 1SCMC 4H1UA 3TS5C 4QHSA 4HUTA 2CTNA 3SG6A 5FBVB 3UANA 3QXSA 2EFDB 1H8HD 2CK3D 5AFPA 1BOCA 4FMBB 1E79A 2G0NA 4MKFA 4A15A 3OB2B 4UNPA 1TUIA 1YKSA 6Q21A 1EFTA 1RJ9A 2AFIE 3CF0A 1SL9A 1KKLA 1XCMA 2ZJOA 5LB4A 4EPTA 2YVUA 4YMTA 4TYNA 4MDEA 2JXLA 1VCNA 2NOAA 2OXRA 1C4OA 4JT2A 4KLZA 4B73A 2SCPA 5BXQC 3LAWA 3QPVA 2DHRA 4FCTA 4G0NA 1GRQA 2ZROA 3EWSA 4PPFA 1JC2A 4QBFA 1OIVA 1W7JB 2M8UA 2ONJA 3CWGA 3PALA 3V00A 1NVUQ 2KGRA 2F3RA 2P0EA 4NDZA 3U7GA 4Q18A 5TXGA 1Z83A 3RS3A 3QG1A 2ZVPX 1KDRA 2J45A 4IOJA 1NL3A 3BB1A 2GVZC 5CK4A 4BGDA 2FCDA 1G8HA 4Z1MA 5JWHA 3DF0B 3KQLA 2RHDA 3OHMB 1K95A 1U2RA 3Q72A 2AWNA 2KAXA 3U3OA 3T1VA 4LC1A 4BFVA 4OI0A 4A9AA 2ZYVX 4OHYA 4KV9A 2ZE5A 2G9BA 5FL7D 2PZEA 3KDSE 3UMRA 1DTLA 1U5IB 3FMFA 2A4JA 1Z6GA 3KJIA 1GJYA 1ZM2A 4U00A 5KTYA 4PALA 4DCSA 1IBRA 2I94A 4WZ6A 1E2LA 3VRQA 1S9HA 3NIBA 1OYWA 2M49B 3NTUA 3T12A 5EP2A 2KQYA 1VCIA 2XSZA 4IJMA 2KSQA 3SG3A 4BUJA 4OV2A 3ZVMA 1DMOA 1AIPA 3LV8A 1C9KA 4TLEA 2X19A 3U2QA 4HLCA 2VHQA 3K70B 3QPUA 1WLZA 1ZVQA 2ZRIA 1ZM4A 2VQSA 1FMLA 3TQFA 2IK8A 2CDNA 4POAA 2D06A 1DELA 821PA 1NLZA 1LF5A 1XTRA 3I61A 3BAFA 3LBHA 1OQPA 4AG5A 3DVJA 3K21A 2IF2A 4TL7A 1SY9A 1NIJA 2NO0A 3A1VA 3CIOA 3OFND 2QBYA 1SHZA 2WPDA 1GQMA 3H4MA 1P2TA 3THWB 4YGEB 2D7CA 2R2AA 2ZI4A 1ZMZA 3QE0A 4JQ0D 2QM7A 4GAOA 5J3XA 2AXPA 2LWIA 3LQRA 1QV1A 2NO1A 2JWWA 2I18A 3ZIAD 1HT1E 2C9OA 1NY6A 2QBYB 4ZCVA 1GKUB 2DWPA 1CFFA 2WIAA 3LLMA 4LBWA 5AUNB 5JEDA 2QGNA 3LBNA 1CNPA 3PENA 4KFTA 4I5JA 1G21E 3CF6R 4IDPA 3DPUA 3I4LA 3CNLA 4A4CA 4L5BA 5LBIA 1FFHA 2IUSA 1OMVA 2SHKA 2IA5A 3IDQA 4KITB 3RHFA 1YU9A 2DWQA 5IBWA 1G3UA 1W0KA 3TSOA 4W5HA 5LD2C 1G20E 4GI7A 4GFTA 1PUJA 5CDFE 2WKPA 4AKIA 2AK2A 3OE7A 3K9LA 2IYRA 2XAUA 3B8HA 3WMEA 1Y1UA 4NDBA 4LHWA 5JCPA 2R2IA 2LLUA 2XSZD 3ZQJA 2VHUA 1UUSA 2JXCA 1F2TA 3J81k 1PV4A 1S2MA 3ZNIA 1ZD8A 4OQMA 4XSGA 4LYHA 3AQ4A 4F4IA 4KLNA 3RABA 1GKYA 4PAQA 421PA 4EPYA 2FG5A 2BMFA 2N42A 1KI7A 1JSAA 2WVJA 4N0EA 1XD9A 4HB0A 1PJRA 5HKZA 1E9EA 3ZIAA 3TUYC 5C2JB 1OSAA 2HQ8A 1WDCB 2OE2A 3QG5A 4PR0A 4Q1CA 3WHTB 5FPKA 3DOFA 1PVBA 4HDQB 2GJSA 4JYBA 4BFXA 1IONA 3G82C 1QJTA 2R6FA 1SXJE 4NYJQ 5JECA 1QX5B 4OR9B 3DHWC 3LX5A 3MUFA 1CKKA 4CFQA 1SKTA 5TDHA 2ZRLA 2EC6C 2ZE7A 2QRZA 4Q1FA 2B1UA 3SU8A 3AVXA 2LHLA 3A36A 1M63B 1QASA 3I5FB 4FW9A 4Q48A 2ANBA 1E0KA 1JEDA 1W2GA 2AN9A 3QENA 3BK7A 1XFUO 5FTNA 3T5GA 1LVCD 1Z6TA 4MZLA 3ND9A 5DGXA 3C16C 1VKJA 3RNLA 3U44B 4PE1A 3H1TA 1N6NA 1R0WA 4OHWA 2HQWA 1KY2A 1F6BA 2CNWA 4D2IA 1AGPA 2IXEA 2B21A 2E1RA 1XBTA 5CK5A 2OLJA 3PEUA 3ZYCA 1F2UB 4ABYA 1CMGA 5H8WA 4Q4AB 2JASA 1TTXA 2OPOA 2ZVQX 4FMCF 3KQNA 4AI6A 3IQXA 2PVBA 1T3HA 3SYKA 2X2FA 1XVJA 1DARA 4M1WA 1ZUNB 4WBSA 1B0UA 1CF4A 3B60A 2C9YA 4HATA 1SBJA 3SJCA 3OFNA 2HETA 4ICBA 4NMMA 4HAXA 2L4HA 1FPMA 1S5GZ 2F1IA 1G7SA 4MYHA 3CUEF 1WRZA 2ORWA 4DCNA 3AGQA 2MMGA 2WKQA 2AFHE 2O0JA 2KQ6A 2IS6A 3ZZUA 1U0JA 1EXRA 2QAGB 2QMOA 3NBXX 1C1YA 4MRPA 1L2TA 3ZQ6A 1Y1XA 1SXJD 4Z8XA 3NHAA 2LAPA 1G291 3DD4A 2RGBA 2ZUBA 2QL6A 3NBZC 3LFUA 4QGGA 4WXRA 4EPWA 1XTJA 1QDEA 3PSRA 1BMFD 2FPMA 4LHYA 1OE9B 5DE3A 1U90A 1CLMA 1N3BA 1SVOA 1YZNA 2PCLA 4NCKA 4P4SA 4YGDB 1ONBA 4B3DA 3DF0A 1CB1A 3QUSA 2HT6A 4RD3A 5BWMA 3H84A 2D4HA 3P4YA 3VRRA 4USLA 1IG5A 2ZYTX 2ZS7A 2YKGA 2A5DA 2ZETA 3FHOA 4Q7LA 1MO4A 4BLOA 4OHXA 3DDCA 2N1BA 4M8NE 5K8TA 1OXXK 3LCPC 2VRWA 4TLCA 2ZN9A 1UWOA 4C0BA 3B1ZA 2VL7A 4PSAA 2BDTA 3K8YA 2MAZA 1KK7Y 1OXSC 3I3SR 1UEIA 1ZUHA 4LV6A 1B47A 1VDZA 3U3JA 1FX0A 4MRYA 2P5SA 4UNRA 4KAXA 4F93B 4TMZA 3W90A 3UK6A 4CEJB 4KBFA 2TMKA 2BCJQ 3VKHA 4P32A 3I5HC 2WJHA 1LA0A 2V6IA 5FYXA 2HF5A 1IM2A 4RCYA 3VGOA 1TMKA 4M9XA 1AK8A 1HT2E 2IYXA 4PO1A 3EVRA 3B1YA 4TSFD 1RC8A 3OEHD 4PX9A 4BZQA 1YR5A 1CJUC 1GNPA 1PLLA 3FHCB 1IJEA 3SQXA 3EC1A 5F2EA 1WXQA 3PUYA 3HX4A 2ASEA 2L2EA 2F7SA 2JLQA 1EG3A 3PUVA 2WJGA 1OV4A 2KYCA 1SK6D 1HEIA 2C03A 2IYUA 2VSFA 4MVFA 2ZRCA 2ZXUA 2LNKA 1NLYA 3THOA 2ZJ5A 2JJ2A 5FPYA 5IRCD 3FB4A 1K9UA 1E99A 5FTKA 3SHFA 3CR2A 3U7EB 5JEEA 4G5QA 1RW4A 2PSRA 3BUXB 3QBTA 3HJNA 3SEAA 3K09C 1FW4A 1Z28A 2QM8A 4DUQA 1G5PA 1W49A 5FBQB 2EFEB 2HXSA 4Q00A 3JVUA 3JVTC 4C0KA 1K5GA 1RECA 1E2FA 1GM5A 4HZUB 1E2DA 3MJHA 4E07A 3Q3JB 4GBAA 1VCMA 2OILA 3HU3A 4DCTA 4M9ZA 2WWFA 3DKVA 1AS3A 2L0XA 2REOA 3PUWA 4JLDA 4P31A 2BMJA 1FNMA 2TN4A 4AQJA 1JWDA 1ZM3A 1D2EA 5HYDA 5AUOB 5G08A 5JRZA 3AM1A 3ND8A 1AQYA 2PL3A 5DI3A 3IBGA 2XGJA 3ZLJA 4FCVA 2A5JA 1Q1EA 1BLQA 1Y6WA 4QM7A 1WDTA 5M04A 1Q1BA 4U7DA 1KSFX 2K0JA 1DJWA 1T5IA 3OX6A 1GKIA 2VP2A 1M1YE 2GXSA 1P9NA 2W2VA 2WOJA 3IQOA 5CJ2A 4FI3C 4HYYA 4DCUA 2BBNA 1CRQA 2HV8A 2IYYA 4US2R 3DL0A 3SBDA 2K2AA 4JMPA 1KWOB 1BH2A 3L43A 4KSBA 2ZRBA 1YRBA 4O2RA 1KI6A 2EFGA 2ERXA 2IEZA 4NCHA 4MKIA 1KDPA 4PAMA 4CYMA 2UVQA 1T9HA 1E96A 4LX0A 4MKHA 3PIRA 3CNOA 2H7VA 1Z6AA 3GOFA 4N5XA 1G8GA 2MJWB 4PC3A 4EJSB 4B3GA 3DMNA 4QNMA 5DYGA 3SZRA 4A4BA 2LLTA 3EZ6A 3RSOA 2Q3MA 4AKGA 3IIMA 4XWOA 1EFCA 4NYMR 4ESHA 1SL8A 1YZUA 1OSNA 3W3AA 4MRRA 3TS5B 3VR5A 4GZMA 4TL9A 4P3YA 2OAQ1 3I32A 4K81B 3QEJA 3NSIA 4IXMA 4UJ5A 3RAPR 4IKEA 2BCGY 2ZS8A 3AP1A 1SVLA 2GGMA 2ZITA 2C2HA 3WRXC 4A8JB 3M4YA 3HU1A 3EASA 1RYFA 2R8RA 1HQYE 1CFDA 1QXPA 1VTKA 3NEYA 1M7GA 1E1RA 1GP2A 2P6BB 1QHYA 2JRFA 2BMDA 4HUQB 4KO8A 1WBDA 4O3MA 4XOIA 5SZIA 2IYWA 4E09A 4URXR 2GJKA 4P2YB 1G3RA 1P7CA 2PZGA 5FUXA 1QG4A 4BFSA 5BYKA 3DVKA 4HEJA 4B48A 1SKYE 1WP9A 1GGZA 2XTZA 1NY5A 4DB2A 1XTIA 3BS4A 4RD0A 4B71A 2AKYA 3C4JA 4UXIA 3LDAA 1A03A 2VF8A 4MKGA 4O25A 5HLOA 1BS1A 2VP5A 3VU9B 5JSZB 5LPNA 2IYLD 1JJ7A 1YZKA 1ZNZA 4PO9A 5BYJA 4ACAA 4B44A 1Z07A 1HE8B 1X6VA 1U0HC 3CZTX 2QSZA 4TN1A 5KSYA 4JLKA 2ZRHA 4ORBB 1X3SA 3GJ6A 4WQ3A 1XCGB 1A7JA 3LLEA 4PZLA 2NCPA 3DVMA 3OZXA 1WA5A 1XP8A 4FWIB 1E9BA 1QIVA 5FUYA 3QXHA 1KQMB 3PG5A 1E0AA 3CR5X 1JXOA 3MMPA 4RKEA 3I5XA 3NSOA 4MA4A 3BBPA 3HP1A 3O8CA 5F6TA 3CR8A 2K7OA 1M8PA 1VRKA 2BC9A 4RZXA 1LW7A 2WBLC 4Q01A 2QTHA 1T3SA 1YVLA 2IC5A 5EXXA 1DAGA 2IL1A 3CX8A 2C98A 5CLLA 1W36B 3T15A 1MABB 4LCBA 5JLJA 1QS7A 1JAIA 2JTZA 1IQPA 3VRPA 3LBIA 2K2FA 3UXMA 2BM0A 2F8PA 4D4JA 5DN6D 4AOMA 1KFXS 1H4BA 2J5XA 4JLAA 1MO5A 4TT3D 3RRZA 2GGZA 1SYMA 1JEEA 3BH0A 1RTP1 3AKEA 4EKDA 1KQMC 2VHJA 2J1LA 2DYKA 2GAOA 5HPYB 3AP3A 5L3QA 4OVNF 4DCVA 2JLUA 1ZC3A 5TVKA 3Q85A 4A82A 3SC3A 1VIYA 4GOKA 2OTGB 2F1RA 1K90D 1XFZO 1SVKA 3EIQA 1HH4A 1CTQA 1TU3A 3CRMA 4HAWA 4I1UA 4IXNA 3VR3A 2Q0HA 4R7ZA 1MV5A 4TMXA 2O0HA 3KXIA 4C3ZA 2QN6A 4H9GA 4TTQA 3T35A 5CITA 1XEXA 5CM8B 4GP7A 1OKKA 1Q3HA 4TYYA 1TNPA 4LWZA 3TUIC 2JTTA 5DLQC 1AM4D 1E2MA 1AHRA 2B8TA 5IDVA 1TRFA 2WJJA 3I8XA 3UG7A 1N6OA 1W47A 1TADA 4YONB 3RRYA 4MEWA 4KODA 4BPBA 2FFBA 1SW8A 1Q12A 3CR4X 4KBGA 3EAQA 1YUTA 5L3SB 4I1VA 1QG2A 3EC2A 2NCOA 4JPZB 1KI6B 3RWOA 4GL2A 1IN7A 2YINC 1Q1QA 3KL4A 3THYB 1EWRA 3OIWA 1D2MA 3CLNA 1ZINA 3NBFA 2KE5A 4WOPA 1NG9A 3CGAA 2Z0MA 1FUKA 1UEJA 4DDWA 1S6IA 4TYWA 4HSZA 1F55A 4M9QA 2O8CA 3CPEA 1IOZA 4NBSA 1JALA 1GG2A 2OBMA 2CXJA 1X86B 4UNNA 4MN0A 4UPGA 4WXPA 2FJUB 5JMTA 5ELXA 3WBKA 2CVFA 3AVTA 2WCEA 1P3JA 4LJYA 4UNQA 1S8FA 4H1VA 1CM1A 4A8JA 5AXIA 4C0HA 4N0DA 1T8UA 2GCPA 3UKDA 3CNNA 4PHGA 1U9IC 4L4UA 1KFUS 3IQWA 2ZJZA 4IW3B 4LBZA 2OFOA 3WP0A 3AB3A 3GLHE 4NYMQ 4LZZA 3QKRB 1NMZA 3RRMA 4IL1A 4A0GA 4MYUA 4DLTA 2ZSBA 3KFXA 4EAQA 1LB1B 4HAZA 3X1YA 5KO2A 4G01B 1N6RA 3B9QA 1UFQA 1KY3A 1E1QD 3A58B 4URYR 1XTKA 3DZDA 5EJEA 2CE7A 5B30A 3KQUA 4CRWB 5E7JA 4CPVA 4R1EA 3ZD6A 4DIEA 1PSRA 3FKSD 2UZIR 2ZE6A 1PLKA 2QAGA 4BFWA 2GK6A 4P4UA 2F43A 4CGZA 3K9GA 1S4QA 2FCEA 4NPHA 3ZGXA 4M2QA 1GVNB 3MJRA 3GLFB 2B7CA 3IEUA 3ZJYA 2BHRA 1YRUB 1NVXQ 1TIZA 3PUXA 1IQ3A 3W3ZB 2GCNA 2F33A 4XJXA 2YJTD 4OKHA 4LPSA 4AURA 1NSTA 2RGAA 2YWHA 3CONA 2MLEC 4AY2A 1T91A 3C7KA 4PHHA 3ECCA 5DKNA 1IQ5A 1UHJA 3MWKA 3R20A 4OI4A 5AJZA 5KSPA 4EDHA 3BB4A 2JLXA 1OFUX 5FOSA 1ZU5A 2LP3A 1IN8A 2VA8A 2MHHA 4MZJA 3C14C 1SRAA 2FEMA 4QRHA 2I4IA 1R2QA 5EE9A 5B2ZA 2GCOA 4HB2A 1GRRA 4ZDIA 1PK0D 1NKSA 3A1SA 4YI9A 2LUCA 1X1RA 3HPRA 5I8NA 1KAGA 2J87A 3OIUA 2WPDD 4I81A 4KFUA 3AKYA 3L2OB 1RZ3A 3FFAA 3UMSA 2JDID 5TMPA 2BWJA 4LBVA 5FR1A 2OZEA 3QKSB 3M1IA 3K70D 2FEOA 4OKSA 1OOJA 4LJ7A 3U3RA 1J8MF 2PMKA 2FWRA 2WM9B 2M1UA 4PHKA 1XYDA 1R5BA 3KKQA 3P1JA 3VKGA 2H17A 1YVHA 1QV0A 4W5WA 3ADDA 2JPTA 2CCKA 3GFPA 4BZPA 3I5GC 1W44A 2M3WA 1UM8A 3CX6A 1IY2A 3NC1C 1JI0A 2KI4B 1ZRHA 5GJVC 1XEWX 5J47A 2R65A 4UKDA 3T34A 2EU8A 4FXPA 4X8HA 2H2KA 3WXAA 1II9A 4MRXA 1DO0A 2C5LA 4WIAA 5B58C 5AUPB 3GLFA 2NZ8A 3KX2A 1QVRA 2VF7A 2CT9A 3DVEA 5FUVA 3P20A 4YXWD 2QG6A 3I92A 1KK0A 4GFDA 3I5IC 3ADBA 1RVDA 2VP4A 2MSEB 2NPFA 2OCBA 3Q5DA 1W5TA 3M0EA 4EJSC 3QOFA 3IHLA 1GITA 2JATA 4E03A 1TQ2A 1KK8B 1IXZA 3TMKA 5GJWC 2AKAB 1EL4A 5TB5A 2Z43A 1M34E 1RE0A 5DH9A 2ZIAA 2QZ4A 3E2IA 3GD7A 2EWWA 1BR1B 1W4AA 2C77A 4MRNA 3LK0A 5E95A 1AZTA 1KSMA 2JC2A 3FMIA 3OAAA 4Q7KA 2RGXA 2BV3A 3GJ7A 3A6PC 2IX3A 2Q3FA 2F3ZA 2G77B 2ZI7A 1R5NA 1P2SA 3RS4A 4D82A 4QKQA 3U60B 1NJFA 4BASA 1SVWA 1PRWA 4DLXA 1F2UA 4KFRA 4A4DA 2XZOA 4RJLA 1NX1A 2GVDC 4US0R 1NLFA 2ATXA 1DS6A 3FKQA 3BUWB 2FOLA 2PX0A 5D3MA 2FZ4A 5EUQB 4DZZA 1R0YA 2C95A 3H86A 2A5YB 2NMVA 2CNWD 1CJMA 4I1OA 2ZJBA 4TLDA 3H0KA 3DM5A 1S6JA 2YC4C 4B47A 3B5JA 4QFMA 5KHOC 1VG9B 1N6LA 1Z6XA 2B6HA 2CL7X 2VIIA 4EFLA 2G1JA 4XYNA 2ZI9A 2G1KA 2CBLA 4EQ6B 4PAOA 2CL0X 4JVNA 5AJXA 3VKWA 2HF8A 3UATA 4JWQA 1G7RA 2XNDD 4CVNA 3BFVA 4HAVA 3AKAA 4A6PA 1XFAA 1E0JA 4CDGA 1XD2B 3GK2A 4QM6A 5FTLA 5KU1A 2RH5A 1CRPA 1XJQA 3AKDA 1NI3A 5LDDC 3U7FB 1RRCA 4TNCA 1LFDB 2O8DA 1DJYA 3SG2A 4HREE 3AVWA 3EZFA 2AK3A 1A4PA 1NSHA 3JTDB 3WNXB 1QTXA 2GKSA 5A0FA 1DAIA 2N46A 4TQUS 3KKOA 3D8BA 1WLMA 4G5SA 4RZ2A 3VX3A 3PLFB 2QRNA 2GEDA 2RGEA 4Q04A 5CSJA 2C04A 4LC0A 4M53A 4RSGA 4Z8YA 4ASUA 2IXFA 1J7OA 5G41A 5FI1B 2FGKA 2ZUCA 3VFDA 1DJIA 1TPZA 4MBEA 1DOAA 3TIFA 2J41A 2RMKA 1YJ5A 4DRWA 1QHXA 5J4HA 4TMKA 4C0JA 1JQLB 1NJGA 4BLTA 4LHZA 1DJHA 1A4RA 1A2KC 3SG5A 2KWIA 2V3CC 2BBTA 3HCMA 1DTSA 5L8VA 1QLSA 1WB9A 1U8ZA 1E9FA 1ZM9A 1SNLA 3VR2A 4DSNA 2LE9B 5HKWA 4Q5IA 4HDCA 4DC9A 2KI6C 1XEWY 3B1VA 1TOPA 5ER5A 4M1SA 3I62A 3SYLA 3T06B 3BERA 1T8TA 4TLBA 1T0HB 1E32A 1ZMXA 2CHVA 4C0LA 4PC7A 3I5IB 1W0JA 2GZAA 1QVIY 1EX7A 2ODWA 2RGDA 2VH5R 1Q22A 2BOVA 4B34A 2BKIB 2QA5A 5BPJA 3OX5A 1EFRD 1VHLA 2IYZA 1IWQA 3UIEA 3THYA 2GNOA 2GV5A 2ZRTA 1KK8C 2ZI3A 4QJ5A 1FI6A 2OESA 1OIWA 5KNDA 3A1WA 3C1VA 3I8SA 3TR0A 3B7GA 4NONA 1G7CA 4HUQA 4ACBA 4KVAA 1F60A 4FCWA 1XD8A 3W8NA 1L7VC 1BU3A 1DGVA 3PN7C 1T5LA 4PC2A 1U0LA 3TVDA 3QSYA 1B7TY 2GF9A 1XFVO 2HDNB 4GNKA 4HZIA 3U7HB 1MXEA 1WF3A 4DIRA 3KUDA 1XMVA 3LQQA 4OK3A 2JNXA 1W46A 4PZYA 4EPVA 2J9RA 1TEXA 4C9BA 4C7OB 2WNDA 1G3QA 1GZSA 2KBIA 2EVWX 3KZ1E 5EE0A 3X1DA 2W83A 2YOFA 2M7LA 2W6JA 1N6PA 1ESMA 2PCJA 4XTCS 1SGWA 5CPVA 1ETUA 2CLSA 3CLVA 1KFXL 4ZPXA 3REFA 3SJBA 3QJYA 3ZWHA 1CXZA 4LRWA 2W6ID 4TWZA 2GAAA 1NF3A 3KJHA 1XXHB 2DCUA 4Q03A 2HXYA 4AYWA 5PALA 1Z22A 3CH5A 2H92A 2XXAB 2O8BA 4LSGA 4JVMA 3PN7B 1G3MA 3T5DA 1W36C 1E9DA 3NVAA 4Q4AA 1M6NA 5DHAA 2ZQ5A 5UKDA 1HTWA 4I99A 1AJ5A 2ZSEA 4RCZA 1BYIA 2QENA 4LOAA 3EA0A 1M46A 3AVOA 3O8DA 5KPDA 3KQKA 3W8RA 2QACA 4Q1AA 3RANA 2KYFA 2X2EA 1LINA 5FBRB 5JBQA 1FZQA 2OV2A 1SULA 1JR3A 1XEFA 1FMJA 4HAUA 3TK1A 4JKIA 5HE9A 1Z2CA 4PQYA 3PEYA 4WQ2A 1MT0A 1IXRC 1AS0A 1R5OA 2M0RA 2OTGC 1V43A 3NXSA 4B3XA 4NL4H 5GJBA 4YRUA 2O60A 5AR1A 5BN4A 1KI9A 2QTVB 1GUAA 3TVTA 2PMYA 5DISB 2CCJA 1E2KA 3CRRA 4JVSB 3R7WB 2JIZA 1FOEB 1MO3A 1TU4A 1CIPA 4LK2A 1QHIA 4G1UC 4I5KA 5FOVA 1ZACA 1NVVQ 3OP0A 1Z3IX 1L4YA 1E9CA 1E2PA 2F6RA 3K9NA 4B6EA 2Z5FA 2ZU6A 3S1AA 2RGIA 1AKEA 1QF9A 2LMVA 1TCFA 2KFFA 1XXHA 3B9PA 2IS2A 3BWDD 2ZYUX 2KGBC 1BOFA 4QGHA 3L8ZA 4LBYA 1PUIA 1JQJC 2P5TB 3ZVNA 1XDBA 2LANA 3NG1A 4CEJA 2GBLA 2IWRA 2A78A 4MSPA 1DO2A 3FE2A 3MD0A 2YHSA 4RY2A 4L16A 1XCPA 3QKRA 5FFMA 2F9MA 2GDJA 1TF5A 4FINA 3OIYA 4MGIR 5KDDA 1JAHA 1Q0UA 2EGDA 3BGWA 4B3FX 1ZP6A 4ZCMA 1G7TA 3LW7A 621PA 1UURA 2Q9BA 2XEXA 1N65A 4ON9A 4RZ3A 4D26A 2IYSA 2LHIA 2RB4A 3T61A 1OE0A 1OH7A 1CR4A 2JLRA 5TNCA 1NMYA 1KFUL 1HQCA 4DHEA 3GLFE 1QLKA 3WYGA 4RD4A 1OH6A 1MWNA 1TF2A 1GL9B 3AP2A 2QORA 1AQUA 1SCVA 1RFLA 1KI4A 1B8RA 4MH0R 1IJFA 2RGCA 2MSDB 2WWIA 1D1OA 3VNVA 5KSOA 4B2PA 4DEXA 5J4VA 3R7WA 2SASA 1UKYA 2FSFA 2CBZA 1II8A 1ZCBA 3BFXA 4JYCA 5L3SA 1DG1G 2CMKA 1OZSA 3FIAA 1RRGA 1F3OA 4NYIQ 1HT9A 1ZYUA 1WDCC 1E9AA 1MRNA 3KXLA 1VIAA 1PVOA 3SIAA 2W2XA 1S1MA 4KFSA 3REGA 2OT3B 1XU4A 1GNQA 2HLDA 3TQCA 2V54A 3F5FA 1SXJC 4DSUA 1FL9A 1NBMD 2DWOA 1GRNA 3VR1A 2XNSA 4R2HA 5JSZA 2JOJA 1NSFA 4XJKB 4NDDA 1TQ4A 4W9MC 3CWZA 1SQ5A 2RGGA 1T3LA 2B8WA 4D0LB 1NX2A 1E1RD 3AVQA 1ZNWA 2WWYA 2FH5B 1R0ZA 1QZXA 2WWXA 1KTVA 2WSSA 3HR8A 1QHNA 4G5GA 3EPHA 2FFAA 4URVR 1CFPA 4PHTA 2M7NA 4HDOB 2OFWA 1M7BA 4P33A 4K46A 4N3NA 3SN6A 4UNSA 5CSNA 2W00A 1FBVA 2G88A 2P65A 2R6DA 1N5LA 4PPGA 4CFRA 3THXB 4GGFA 2YWFA 3RYTC 4RFSB 2BL0B 2LP2A 4TLAA 2BKEA 4GMXA 4TZ0A 3B78A 1YRAA 2CE2X 4OHZA 3VQTA 5EUMA 2NGRA 4BLRA 4GGFC 1X8LA 4B3CA 4UJ3A 2R6CA 2AD1A 1TNQA 1DADA 2PBRA 1J1DA 2PT7A 1RROA 4DB4A 1JB1A 1G19A 5JWOA 3CPJB 5DHFA 4OCIA 2ZRMA 5EE5B 1V1GA 1X8KA 2A7QA 3ASYA 5SZHB 4F4CA 2GXUA 4ZO4A 1E3MA 1ALVA 2ZRPA 3L0PA 2DB3A 5L3RA 4V0NA 2LLSA 2ZI5A 2QAGC 4B2LA 4M1OA 5P21A 2IEYA 3DO6A 4R9UC 3JTDC 2F9LA 4AKHA 2O5GA 3GLHA 2LCFA 2YYZA 4BEBA 3MCAA 4LJAA 1IKUA 1G3IA 5J4YA 1AKYA 4Q1DA 2ZR0A 4IRUB 1J8YF 3K0FB 5H68A 1Q80A 1ZCAA 4EPXA 3GLIE 3K0EA 2F1HA 4PC6A 1S3PA 4Q19A 3TDZA 3AAJA 4N1GA 1OYYA 4JSYA 4QGAA 1L2OB 1UJ2A 1P4SA 4U8DA 2NIPA 1P73A 2I7AA 2JIZD 1E9SA 2GF0A 4Q1BA 1AZSC 1CS4C 1DE0A 1ODFA 3PITA 3AVYA 1VG8A 3C15C 3BC1A 1NVVR 1OXVA 5CIQA 1OMRA 3F45A 1JF0A 3FPAA 5HKYA 2FF7A 3KKPA 2O52A 2J46A 3PFIA 4HRGA 4MYCA 2BCXA 4URZR 2VRGA 4BFUA 2X77A 3U61B 3A4NA 3SFVA 2QPTA 5DO9A 1IY0A 2CEAA 1SPYA 1KO8A 3OEEA 2D7DA 2H5EA 4B76A 1Q57A 1A29A 1UP5A 1EGAA 2BIFA 1Z0KA 5HCNA 1BG1A 3AVPA 4RD6A 2KDHA 1YZGA 3IILA 1NN3A 3AVUA 1U98A 5FL7A 1Q1ZA 4K8OA 1A82A 2ZJYA 3MGCA 2F2PA 1Z0DA 1KAOA 3WHUB 1G8FA 1TEVA 3KTAA 3VAAA 4C2UA 1CEEA 2Z4SA 1FPWA 1OW3B 4FMCB 4JBWA 4DLVA 3O78A 4ORCB 2GBLC 1OFTA 4QJ3A 3KFVA 1XNJA 4I4LA 1BODA 4GUKA 2P6UA 1PZNA 3HU2A 4E5UA 2AXNA 3KO0A 4GPLB 3A4MA 4QC2A 2WTUA 1IN5A 3IQQA 4GOXA 3QKSA 1V5WA 1UBGA 1NG1A 5KYKA 1Z5ZA 4F0ZB 4YC7A 2ZRDA 4IVPA 1J90A 1E0SA 4NU0A 3KJEA 2G9NA 1RPZA 4BLSA 2H18A 4QNRA 1G8YA 4YLGA 2M29A 1ODBA 2L5XB 1OFIA 2XXAA 1BF5A 1VYTA 3IO5A 5HCIA 2ORIA 2KFGA 2QEQA 1K8UA 1XFYO 4G3XA 4TTRA 1OHHD 3WRYC 3R9XA 1WY9A 1IY1A 3SOPA 3RVBA 1W2HA 4O0MA 2EHBA 2JU0A 2NG1A 2PEZA 3PXGA 1R8SA 3KEVA 1KK1A 1YQTA 3JVVA 2LMUA 2COLB 1GL6A 1S9DA 2WKRA 4FWTA 1M74A 1YX7A 1OIXA 2ZE8A 4NYJR 3TH5A 2GTPA 2E6WA 1NP6A 1LV7A 2FMXA 1MKYA 2OCYC 2FSIA 4V0LA 4IDOA 4IHQA 1ZOTB 4QJ3B 3RLZA 4O2LA 4PHFA 4BY4A 4Q9HA 3GLGE 1MABA 1O3YA 4I5LB 1NX0A 2LCPA 3KTAB 3V4FA 2OXCA 1ZW6A
chains in the Genus database with same CATH superfamily
4ND8A 3ZNOA 4GNKB 2GEJA 5BR7A 4N3AA 1XALA 4KAFA 4L8WB 1HL7A 1VYVA 1GAJA 1V1FA 1IEVA 2PS3A 3GDGA 3GT0A 4IF4A 3RT7A 1K0UA 1X1EA 2BJVA 4UU7A 3HYSA 4WFKA 1PK8A 1EEHA 1FTSA 3K0CC 5B2ZA 3F0TA 3KFLA 2XWBF 5ALMA 4BEVA 1UF9A 3H2YA 1YQQA 2MRDA 1NBMA 1Z5WA 2NT3A 2W93A 2G3YA 3HWX1 3DXFA 3NHSA 3UWMA 3EPKA 4LC9A 4OJYA 4D1EA 5FTJA 2IY8A 1K2HA 2BDEA 3ILVA 2PUJA 3EVCA 4WE3A 2MSCB 3I2JA 1P81A 4BCBA 1QTIA 4URUR 5FT9A 3KQHA 1R1DA 3DLPX 5FX2A 3I04A 1Q7CA 3CKKA 4OFZA 4HH3C 5FOTA 4UTNA 1JKMA 5JVDA 1O96B 3DLIA 2FE4A 2H16A 2HA3A 5ALLA 5FTMA 2NTYC 3CH4B 3U9LA 3A10A 3GJZA 2MA2A 3D7MA 1J2JA 1E2NA 2I4LA 4RHFA 1HO3A 5GADl 4G8CA 4OQXA 3RK0A 3ZE0B 2GHQA 4S1VA 1M2EA 2VNJA 2P3QA 1QYDA 4BGVA 1Z2EA 5G0UA 3UJNA 1EK0A 4YGAA 2DF8A 1O0SA 1QYRA 3KE8A 3O91A 1XQWA 2ZEJA 2CMGA 1RYHA 4TWIA 3UQYS 3GAZA 1QMGA 4KN9S 2C3YA 3RSSA 1MC8A 2F62A 3ET4A 2I7CA 4HRAA 4CDRA 2CXTA 2FA9A 3P4XA 3GLGA 1DV1A 5JCOC 4QL3A 4AQYB 1K96A 1AGRA 4MGKR 5H80A 2OM6A 2ZPTX 2XTJA 3ADCA 2WNIA 2V59A 3Q7PA 5EIAA 8OHMA 3UJCA 4DUPA 2QUKA 2O20A 2WYHA 3DCNA 3HJGA 2X13A 4DABA 1FSFA 4PANA 1DBSA 1RCUA 1HBJA 1E4EA 5KOJA 4A0QA 3H7IA 1UMDB 4JLNA 3DULA 4H35A 1U9YA 4COKA 3CT4A 5F9HA 4GZ6A 4KTVE 3H1PA 4C4OA 1ECPA 4LKRA 2IVFA 3FKSA 3ONFA 4ZI3A 4FD2A 4MVJG 2REBA 3QJGA 1QVAA 5BQOA 4UAUA 2DTEA 4IGEA 4NG5A 1TL7C 3PYMA 3CS1A 5EJIA 4HVTA 2IH5A 1YASA 1LXFC 1WCV1 1ODIA 3G5UA 4NZ9A 4B3SB 1U5IA 1R9MA 3LNCA 4EY3A 4WLUA 3IKLA 3CX7A 3ZE7A 3ZU2A 2F1JA 2I2XB 2V7BA 4JDPA 4TYMA 4BDTA 3D0YA 2RHBA 3Q3HA 4E5SA 2MMCA 1P19A 3WMWA 3DEZA 2OBLA 3SYRA 3S6JA 4AB1A 4U5XA 1G9TA 1XKQA 3UJ7A 1VZ3A 4YMUA 1YS1X 2O3SA 4KP7A 3OQPA 2PKEA 3ODGA 1E8DA 3E7XA 4KO4S 1M2GA 4OHPA 5DT2A 5KDLA 3T7DA 3WMFA 5BR1A 2TYSB 1HA3A 4LI0A 5KAMA 3HYNA 1TNWA 3AUAA 2GHRA 4IF6A 2Y92A 3M4ZA 4HWOA 3T3NA 2HDHA 4ALKA 3I2FA 4RA6B 4AN4A 3PC4A 2ICAA 1Z9BA 2OCPA 5JC1A 1HV8A 1Z33A 3DD5A 1RNLA 3O2NA 1R10A 4FUTA 2C7QA 1JLMA 2CDAA 2C5BA 4NCJA 3LWDA 2ZXFA 5M3BA 1ZCFA 4UHFA 3D8RA 4QDJA 3GGGA 3N2GA 4RF3A 3CZPA 3CG4A 4F2WA 2D0OB 5AK0A 5JJLA 4D44A 5EE3A 1U8UA 2VBCA 3MW8A 1UK6A 3MINA 1ESNA 3O8BA 4BZXA 1WE2A 1RSZA 1HNWB 3CA8A 1OBOA 1EJ0A 3PUIA 1ML4A 2Z2KA 1EJ3A 4MW5A 3FFXA 4XA8A 4X8OA 5ARBA 2BECA 2UXBB 2OHXA 1ALWA 2P2SA 3PGA1 2W8ZA 3O4HA 3WJ1A 2JQ6A 1NVEA 3R7AA 4UATA 4G5FA 3BCHA 5EJ2A 4XX0B 1V5FA 3NKFA 4FIDA 4R1LA 4RMGA 1WZNA 3H4VA 5IBQA 5T4HA 3BJMA 3O8OB 4DS3A 3SJZA 1LZKA 3VNAA 4ENUA 2SICE 2VBFA 1QZZA 1ZXXA 5JCZA 3D31A 1GG8A 1K9SA 1CBUA 1CDEA 1YKGA 3NO4A 1YRQA 5DEOA 4YAIA 2OBNA 4ML3A 2AJTA 2CXNA 1KHTA 3LW8A 3Q7SA 1U7UA 4YMWA 3AILA 1L4GA 2W6NA 2AQ8A 4E3ZA 2GN4A 1R0XA 4TL6A 2GJ9A 3BT7A 6YASA 2XBMA 1KJIA 1LPOA 1O5OA 2NO4A 4Q7MB 1LU9A 2F64A 2MINB 1EZZA 1HE1C 3FFBA 4MGHA 1U28A 3ZH9B 5IF9A 2JCYA 3ME5A 5BW4A 3FR8A 3RASA 3IUBA 4L1KA 3FOFC 1T4GA 5D86A 5BP7A 5D69A 1ZS9A 2GK7A 1PZHA 3INYA 2CLEB 4OJKA 3ED5A 4RE6A 4EGQA 1V9SA 5A4IS 3EMKA 3JQQA 1W36D 4YREA 2QJFA 3O95A 2R62A 1I94B 4NECA 5GIPE 3FLBA 1WNTA 2ZQZA 1YHNA 4TMWA 4RTSA 3VR6D 1NJ8A 5AUQA 5LBUA 4WNIA 3S1SA 3DZGA 1XJ0A 3NWBA 4QTZA 1ATIA 4WFJA 4YAOA 4YRQA 3U4CA 3UENA 5L7WA 1PZMA 2PH5A 4Y9RA 3BYAA 5ECWA 1UBFA 3W34A 3DXZA 4MEAA 1N0VC 3DMPA 1GT91 2OOKA 3FDZA 3LVBA 3WYAA 2Y67A 3V55A 2D1TA 3GEHA 3IVAA 4Q4DA 2Y99A 4ZT7A 5TC4A 2NLOA 2WVGA 2ECKA 4DWVA 1SXQA 1JILA 2V0GA 1EDOA 2FJ0A 1GPJA 1DRJA 4IDQA 5ALEA 1KEEB 4RY0A 3L7AA 3BMCA 4TSKA 5CXXA 3U5ZB 2OKCA 3VU8A 2R7AA 4IFBA 1VI2A 1ISIA 2H61A 1M45A 2Q4TA 4FDUA 2QJTA 4PPNA 5ALVA 2DWCA 3KB2A 1PR0A 3DT6A 1C7ZA 4MP6A 2O3UA 1Z2OX 1Z4PX 1QP4A 3Q9NA 3KHSA 3QVGB 4JI3B 5BOVA 3E1KA 3GVCA 3GZNB 4MWTA 4V0KA 3T1TA 2J9FB 5FWYA 3NHUA 4DYVA 2ZNDA 1A9RA 1VYUA 2W2LA 5L3VA 2DFVA 2H2IA 3QLUC 3SBEA 1L4KA 2AIRA 2O8FB 5TX7A 5A0TA 4UM5A 4EW1A 4KPYA 5M34A 3ASUA 3JSAA 1BKDR 1UBEA 1G9XA 3V4OA 4BQIA 2KI6D 4RPCA 3V4LA 3UAXA 3ZCVA 2E3JA 2Z3VA 5ALZA 3ZE6A 3KKLA 1XF1A 3EW9A 3UWKA 4TQAA 3QYAA 2W70A 1UP6A 4FONA 5MN5A 1WUJS 2KW5A 1N36B 1Z08A 2BBOA 1XEAA 1NNEA 4Z0NA 1NJSA 4GLOA 4QQ8A 3PWTA 1MCZA 2XUIA 3KUXA 4I1PA 3N6VA 4BOYA 1ZJZA 3V2HA 3WBJA 1KNQA 1P5ZB 4OI2A 3O4VA 2QUIA 1GCUA 5GAJA 3RBXA 4C3VA 2CFRA 2DKOA 1ZGHA 3P5BA 1ECBA 2X22A 2ZPAA 1E2HA 4CLRB 3Q5EA 1B93A 4FXOA 1DQRA 1UL1X 1XDGA 1DWQA 4AJNA 1E2QA 5A5EA 3HU5A 2D62A 1PFUA 3IFSA 3P96A 1I80A 3H5NA 4HQRA 4GBGA 4EFMA 1G1AA 1VJ1A 2HWUA 3LCMA 2QZSA 5FHRA 3L4KA 2WAXA 1LBTA 4IYJA 1ENZA 5I7OA 1CDDA 2GBCA 3KWMA 1SCIA 3O31A 4B75A 2NT4A 3ND6A 4P4GA 2AZ4A 3ZQUA 3RSLA 1UAAA 1JR3D 1XNGA 2BFCB 1BT6A 1F8YA 3CRQA 1VE5A 3LFHA 4BQSA 3DM9B 1YE3A 5ARDA 5JATA 2RK4A 4TXHA 2Y5IA 4HYQA 3DZFA 4QU8A 3H05A 4O4HB 4MR8A 1UP4A 2PUVA 3I5HB 2QNRA 4DE5A 2ZKMX 2AQHA 1GSOA 3QVLA 1MQAA 4NI5A 4WKNA 1QONA 1WMDA 4C4SA 3AVVA 5H81A 1Y34E 4MPJA 3U1TA 5JV5A 4NR0A 2G09A 1KJYA 1KO1A 3CUTA 4TT3A 3MJCA 5C80A 2WIKA 4RYLA 3ET5A 3L04A 3RC3A 2IWHA 2HU5A 1I2MA 3OU2A 3OOYA 4F6LA 4ZIRB 1JHAA 1EG4A 2F17A 3EDOA 4IJ5A 4OYLA 4X61A 4QUAA 3CVOA 3IPAA 3N8NA 1A9XB 1WY7A 2XB2A 1DZIA 2GK4A 3ZD7A 1XXHE 2GBPA 2DPGA 2UYYA 2IDZA 3NJ8A 4AQDA 2WCFA 1T3TA 1XOIA 4JUDX 1JHDA 1G8PA 2YRFA 1TKRA 3OQJA 4US1R 5K89A 1OC4A 2H52A 4KMMA 2X23A 1JDBB 2XRFA 4R2MA 1C2YA 5EL0A 2JA1A 1L3BA 4PVCA 2OQVA 1OB5A 1NCYA 4OXIA 5EY5B 5DI3B 3WOHA 4UHCA 1IULA 2PTGA 5JCJA 4L57A 3LOPA 4WZAE 2VEDA 3CRW1 3STTA 4F92B 1OOEA 5HK9A 4P4TA 4GRAA 2R0QC 4B35A 3TTYA 2NXWA 1XZDA 1NN5A 4P3PA 1EFPA 1RBZA 4ILEA 1ZMBA 3ANYB 1AOXA 3BMQB 3H99A 4OQPA 5E7QA 4HDKA 5DULA 2I3ZA 1N9GB 3MWLA 4ZCPA 4S2EA 3WK6A 3R3SA 4JSRA 3V8VA 3FYSA 4IIYA 4HUJA 3L93A 4A7PA 3D6TB 1QX2A 3MJ4A 4OQYA 1PHRA 1G33A 4CKZA 4CLNA 1DG3A 1KERA 3FCEA 3I5AA 1U2DC 2WHXA 3AOEC 2JRLA 3C5CA 3K35A 4HC4A 4IO0A 3ZWAA 3O6BA 4XWWA 1MOQA 3PQ5A 3EJ6A 4KQGA 3KUKA 2R87A 4IS2A 4AK9A 3SFZA 1U6JA 2Z95A 1GGFA 3FGZA 5BN3A 5BXYA 2XJ9A 4GPIB 5H83A 4TQGA 4W7SA 1N2GA 1NE2A 2OG1A 5BVHB 4P34A 2E4ZA 4LQ4A 2GRJA 1VLJA 1YJAA 1A9XA 3OHMA 1UHHA 1VECA 3UJDA 1UMCB 1E2JA 1AY0A 3T7AA 2R44A 1CEQA 2H2GA 2OZVA 4M8SA 2XUZA 4FC7A 2A1TR 3KLOA 1M7HA 2Q27A 3FPBA 1XMPA 2OXIA 5ISMA 2WTXA 4OQLA 1YQEA 4C29A 5HM6A 4XYBA 2AOTA 3NZEA 1IDOA 2Q49A 4MUAA 5T57A 3E3RA 5C1DA 1NKTA 5ITWA 5CX1A 1W29A 2AG6A 4BFYA 1I2DA 2QEOA 4FYYA 1BRTA 1DKOA 3RWMB 4AX4A 1QZUA 5FOXA 1CVRA 4AZ0A 3TOXA 3A04A 1L7EA 1CUWA 4KXWA 3CFYA 1MH1A 2PASA 1QHEA 4TXJA 3WRXA 1QHHA 4LHXA 2Y93A 1JIJA 3HBJA 1X9GA 2DKFA 5ALTA 5D2CA 4I36A 5BWCA 3UNWA 1KFBB 1Y4DE 1SVSA 3NGVA 1IFXA 4OL0A 5BT9A 2WZQA 2HMYB 3ZHZA 3ICBA 5JT1A 3EPJA 2I2AA 2HYDA 2FF5A 3GU3A 1B43A 4QXQA 4UQPA 4V0OA 1NYAA 5IW8A 1K4MA 1KOGA 1EXMA 3N2EA 2N9UA 3G02A 2B1QA 1A5BB 2XLBA 4ZFNA 4AROA 2Q0SA 2O2GA 3OF3A 4EM6A 4DR4B 4R8RA 1NW8A 1B9AA 4M7PA 3SQLA 4EL0A 1ZNXA 3QEMB 2VC2B 2V53A 4MV7A 1U5AA 4BLVA 4C0XA 4NBRA 1L5HA 3GAMA 3IPYA 2O59A 3KZOA 3AH8A 3IODA 3ONNA 3GCXA 4EARA 1H0RA 1ZXLA 2PN1A 4XB6B 5C4GB 1MIOA 5DM4A 2BTQB 2CF6A 5F78A 5A9SA 1U8YA 4AS1A 2FAXA 2ATVA 2ZBDA 4BRUA 4NENB 1KSHA 4RMJA 1NM5A 1R9GA 1VFPA 3O03A 5LLDA 3IALA 1GNRA 3L6DA 1NMXA 3TIGA 2IYOA 1DRUA 2WUFA 5C0OE 4B3MB 3TAHA 3OC6A 3BORA 3WO1A 5BOSA 3I1FA 5DHQA 1RT9A 2XMRA 1I4DD 2BFEB 3ZY3A 3VA7A 4CG3A 3WGOA 2KPHA 2H00A 3SNHA 5KYUB 1IBMB 2EJCA 5IVKA 4UREA 5EWLA 1F2DA 1QRUA 3IR5A 3ELBA 3QRXA 5J5CA 4UEWA 3F3YA 3B82A 3P9KA 3FPKA 1BHJA 3OURA 4M0PA 1WRBA 1YUNA 5JXWA 1W581 4KLRA 4LVOA 1IPHA 1G6Q1 4KB5A 1PQUA 3CLUC 1ACMA 2CL5A 2RI6A 4BLQA 3VVMA 1ACLA 1KI8A 1LJ8A 2SNIE 4N3CA 4DG9A 4ESEA 4L3OA 4AJJA 1OKKD 4O4HF 1TAGA 3SK0A 1N9ZA 2Z09A 4HDRB 3QM1A 4JKYA 2C97A 5E1BA 4B43A 1FW6A 1V5EA 4F91B 4KWHA 4D4KA 1FUEA 1OLUB 1T1RA 1U3WA 1GPMA 1V6CA 1YE5A 2AW5A 2PMDA 2Y3IA 2Z9DA 3AL2A 1JQ3A 1Y4ZA 3E48A 5JAHA 1QS0B 1ABBA 4DR1B 4DM3A 2XGOA 3VMFA 3BXHA 1X1BA 4GGNA 4FYVA 3HVRA 3AT1A 3AEKB 5ALIA 7MDHA 5I8WA 3FYHA 1A5AB 1T1GA 3IP6A 1RPJA 5K0LA 4LY0A 5LL6P 1NOJA 4CEIB 5JG7A 3OFVA 1NX3A 2FEXA 5LB2A 4V1CB 2OS8C 5IG2A 2PLFA 1NM5C 4ZC1A 3IEMA 4RPJA 1TZJA 3AR9A 2W6QA 2QROA 3CZ9A 3KTOA 2IYPA 4KFCA 2R1TB 5CXUA 2HUNA 2GTHA 2VO1A 4K9QA 1M75A 2QV7A 2BTOA 4KGZA 1PD1A 1Z4OA 2FX5A 1GZ6A 2NUPA 3ESAA 4N54A 4L78A 4YALA 2M9GA 2I29A 1X7DA 3CO0S 3WLHA 1W4BA 5LMZA 1ZOPA 5AP9A 1C1XA 1VOTA 1SD1A 3FX2A 4MLWA 5AJUA 1QX3A 2QY9A 4CODB 1F48A 2EZ9A 1C5KA 4YXWA 4PCAA 2Y68A 3EJWA 3FI0A 5LFAA 2PYQA 4X95A 1Q0LA 1UR5A 3CSDA 3WLOA 1ECLA 3VR6A 4UVIA 2C57A 8MHTA 2LGJA 2OEPA 2B34A 3EARA 2PUAA 3D8SA 3G85A 5AVUA 2VP0A 3LQ4A 3MS2A 1GG9A 2ZANA 2WF8A 4ZTBA 2L0PA 3QX3A 3DDSA 1NR5A 2I4OA 1D4AA 1G5TA 1BXRB 3H97A 1UODA 3RFCA 2WRZA 2EQBA 3HY3A 2QDXA 3I23A 3K4HA 4G86A 1WRKA 1U2EA 1Q16A 3KJGA 1ITZA 2V9ZA 2PQMA 4KCGA 5L53A 3DLHA 3AUYA 3VSAA 1KEKA 4EEZA 3E3MA 5F2KA 3HWSA 4KJZA 2BCBA 2J3EA 3NR2A 3O93A 4PQRA 1XA5A 3ED1A 3RJ5A 4JC5A 1G2IA 2DZDA 4RCVA 5LQUA 5FADA 3RS2A 4LDAA 4Y2VA 3DAGA 3CLKA 4IUYA 4DDKA 1Z7BA 4AFNA 3UB4A 1VE3A 4OHCA 3UW3A 2IYQA 3QXCA 4YJGB 3JYPA 3L7YA 1M5TA 3AESB 4KH0A 2BEWB 3O1HB 1XZMA 2H1HA 3QH4A 4HVAA 5U4XA 3RFTA 3BQNB 4JB2A 4CCSA 4D4IA 1SUBA 5FNVB 3DMDA 1YB1A 3C3JA 4U7HA 4Z51A 5HR5A 1QWVA 1L4UA 4MVJM 3DV0B 3C43A 1RXCA 3IEIA 4OKNA 5D1NA 4ZQBA 1KDVA 1Z6QA 5EMKA 3GLTA 4B6GA 4ZOQI 3D7NA 1H2ZA 3PNBA 3UJ6A 1EGHA 1XTZA 3E1SA 1A9OA 3K1YA 2JFFA 1MAWA 3V48A 4EQZA 1U2GC 2ZB3A 3BXZA 3GHYA 3QFRA 4B81A 2FW7A 2HEIA 5CP8A 5ICEA 3EULA 3E9QA 4L8YA 3GPLA 4HRHA 1DAEA 4YI8A 4JBNA 3TZLA 3CRVA 3SY8A 2QMUA 3HFJA 3MTAA 4GBMA 1U9ZA 1W34A 3L6CA 3OHPA 4M55A 3RPEA 4B4VA 5FO1A 3QITA 2JG3A 1YR6A 3GPCA 1MR8A 2J67A 3GYGA 3NT2A 2W6JD 3R6GA 4XQ0A 4KSYA 1R0LA 1UQUA 2BFEA 4OJNA 1Y80A 1V45E 1E63A 1OI4A 1I13A 2IXAA 4S1OA 4WESA 2V6BA 3W6NA 4DS7A 1GIAA 2Z4TA 1A2BA 1ISRA 3QU5A 4BGEA 4ZVRA 4FR0A 1VL0A 4CMJA 2PGJA 1NBIA 1P62B 3A9UA 3FUTA 1HUQA 1CR0A 4LXXA 4XJVA 3TAXA 1PBTA 2B2CA 3AR5A 3DZ8A 1G41A 1J1EA 2VJYA 3KSUA 4JC4A 1QATA 5U1PA 5AHWA 1LI4A 3WGIA 2QRMA 3BSWA 4L0DA 4HWPA 3FNBA 1LVGA 5L3QB 1QGDA 1LKJA 2IF0A 3QWBA 1O4VA 1CY8A 4JLUA 2JI4A 5B12A 4IQ4A 1X1DA 2AWOA 3MJEA 4FEYA 4ZGBA 3A31A 3DAOA 3PFVA 1E79D 3E03A 1Q92A 1EIZA 1J8QA 4M3NA 4PG6A 4DLLA 3KZCA 2FFQA 3RBAA 4ARBA 4U0KA 1RPTA 3LCVB 4RANA 4XD7D 5FORA 2XT9A 4U63A 4Z1MD 2CHFA 4B3IA 3VTKA 2AZTA 1WSBA 2DAPA 3IEPA 4P0PB 3KT8A 4CM5A 3G0HA 4UTZA 1MR3F 2ZR9A 4CHGA 1SCBA 2FW9A 3KAPA 1KPGA 3OA2A 4N9WA 3T5PA 2IUTA 1GQ2A 1H9AA 4AWXA 4KYIB 4NG4A 1W5SA 2X86A 3ENWA 1PSWA 1X74A 2WE8A 4XRRA 2CCMA 3FYUC 5K0FA 3FZQA 3RR2A 1YIDA 4O4IA 3I2HA 4DN6A 4E5KA 3BH6A 1DJNA 1TVEA 2HRQA 4YIHA 1G17A 1IJKA 2AC2A 1D2GA 4MWSA 1ONNA 4LN1A 4TKMA 2AI3A 1JNYA 3IRUA 1US8B 1V7CA 3IBFA 4OXYA 4BKMA 4BE7B 1P7WA 1SXJA 4BQQA 4A0RA 4KQKA 2QTCA 2VYFA 1SL7A 1RHQA 1JU9A 2GSDA 3HR7A 1H65A 5HE8A 4FGSA 5DKQA 2CZQA 2H2WA 3EHDA 3PNPA 2YXPX 4QIHA 4UD6A 4V0ME 2P91A 3TEJA 2BGJA 3P32A 1XZFA 5IBRA 2JGMA 3G59A 2G2BA 4H3HB 5G4KA 5TGTA 2VPYA 4I9UA 4M9SA 3LLCA 2L18A 4JBXA 4KN6A 4ZMBA 2WDZA 1K6IA 4H7JA 5HTKA 3OZAA 4Z7QB 1NX9A 4RK0A 3IOEA 3OJFA 1FFYA 1FYVA 1W0CA 3LHKA 1CY6A 1R8YA 3PD0A 4J3NA 3INNA 5JALA 7MHTA 2ZSDA 5B1SA 4HLQB 1ZNYA 3WYDA 4WL0A 3U0VA 5JZSA 3N3AC 4KYUA 2OV3A 3WGJA 1L7BA 3SE0A 1T9KA 1YI8A 3PLRA 1E1QA 4N6OA 3TIXB 1PSZA 3PB3A 4YP9A 2C58A 3AKCA 3MF4A 5B3LA 2NUAA 2O8DB 4H3SA 1UBMS 3ONVA 4WZAA 5AKKA 2XHEA 3IEXA 4G36A 3W2GA 4A1FA 4F72A 2QX6A 5IJ9A 4ZMSA 3CE6A 1CVLA 4DJJA 2CB9A 4QXMA 3LA8A 1P44A 4Y6PA 4ALJA 4EZBA 4II7A 1XWIA 4A8TA 5KYGA 4XLTA 1RWVA 1MUXA 2GLXA 4HD8A 4IIUA 3RU9A 4OQNA 2P7HA 1NX6A 1P2GA 1P5RA 1U5CA 1XMJA 3GOQA 3U4DA 3O90A 3KCNA 3UT5A 3KXPA 4BYGA 3FMPB 4EY6A 3L7IA 2X1HA 3JSXA 2JH3A 3ST7A 3BBLA 3OEED 1Z29A 3R8FA 5ALRA 5FLYA 4GECA 2LMTA 5IXSA 2OHOA 1TTTA 4YRIA 2W0MA 2R85A 3TXXA 1VCOA 2QAJA 1M2OB 3B1FA 3WRWA 1CUAA 4JJ8A 2BZ0A 2EYUA 2VPZA 4KGDA 3HXPA 4GXTA 5JAUA 3AR8A 1AJEA 4BN0A 5JAPA 2DVMA 2XI4A 4KXFB 1EHYA 4FYHA 3NNSA 2YJ3A 4FZ5A 3JAKA 4ZYVA 1NC3A 1EH2A 3JVIA 2YRXA 2IJGX 4M8LA 5DN6A 4OQFA 4REQA 1ZUD1 5C5IA 1CERA 4PR3A 4Z4IA 1RKBA 4JP5A 1H2RS 3FMOB 3IXLA 4KI7A 2GF2A 1UUFA 2C96A 4YR9A 5I51A 3ZZ0A 5K5EA 2HYIC 1D9XA 2ZDQA 3PICA 1I3LA 2Q6OA 5IAJA 2VSYA 2O8FA 2QP4A 2H2DA 1T1SA 5IM4A 3WFJA 3G5MA 2WCBA 5KYXA 2BE9A 5EJ4A 1B00A 1TIPA 4WGFA 1OFUA 3QHAA 4LY6A 5JDCA 2NUAB 4CL8A 2JGIA 3DA8A 3NTVA 3JAMA 5L51A 1L2OC 2QEVA 1BCRB 3QPCA 1DBPA 3O3NB 5ERXA 3FHTA 4YCLA 3ZR4B 1YRWA 4V03A 1K5DA 3PXEA 2GJAA 4GR5A 3FOAA 5IAEA 3L07A 2K2WA 4DLKA 3AO0B 4JOCA 4XVUA 1WZUA 5HMMA 5B3AA 4H3KB 4MUYA 2OUKA 3MBIA 4IGFA 2Z56A 1TAQA 3NP7A 4PFSA 2JAXA 1YZYA 4YYEA 4KQXA 4NFYA 4Q9LA 3G49A 1SK8A 3LIPA 2PL1A 2WFLA 4HMOA 1PSBA 3A28A 2HPAA 4PPYA 4A03A 4TZ6A 4OFWA 1SXJB 2PO5A 5CTJA 2ZOSA 1IY8A 1NW3A 4KXQA 5L45A 4U2KA 2O8EA 1N5DA 2EW1A 4C0QC 5E2BA 4XYEA 2VYVA