4C0KA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one calcium ion (ca-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
b'ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0kA03
1QX2A 1YZTA 2DFLA 2HUPA 2KHNA 5CLQA 1B1GA 1NRJB 2IHBA 4TNCA 1LW7A 4JMPA 3O8RA 1SCMC 3U61B 2PASA 2EC6B 3ZZUA 2IS2A 2ZI9A 4XD7A 2BECA 4KXFB 2MMGA 3AEZA 1TQ2A 4D25A 4MZLA 3TUYC 2NCOA 3A58B 4EJSA 2C2HA 4YI8A 2KDHA 2LUXA 4RJLA 2IYYA 2NGRA 2GZHA 1OFHA 1E2KA 4IDNA 1CDLA 4C0BA 3E5HA 1Z6GA 2FSFA 1K93D 3NXAA 2AK2A 3NDPA 3Q5DA 4PHFA 3W8NA 3PITA 4ASUD 1MT0A 2JXLA 1CFCA 3EZ2A 3IQOA 1UAAA 1G18A 1QRAA 1DAFA 4PHHA 4TT3A 1SBJA 2OAP1 1IN5A 1QS7A 4CZ2A 3B7GA 4BLPA 1ZJ6A 3U7EB 1G4AE 2V1UA 3A6PC 1GWNA 4DB4A 1JI0A 1XK4C 2CT9A 1WRLA 1KKMA 1SNLA 3SG6A 2ZE8A 2ZSDA 2A7QA 2PBRA 4B76A 1KO7A 3CR5X 2GK7A 3CRMA 4V0LA 2QQEA 3OIWA 1XTJA 2J5XA 4P4SB 3I5XA 3WNDA 2BBOA 2Y5IA 1A03A 3L0PA 1FP7A 1WA5A 2K7DA 1SXJA 2F9LA 1YQTA 3GLFB 2VP4A 4UNRA 5HLVA 2H61A 3Q3JB 2CVFA 2KI6D 1FMLA 2QGZA 3VMFA 1YVLA 2NZJA 3HWSA 5DYIA 1W0JA 1Z6TA 2QPOA 2O8BA 1H8EA 3KQUA 1TIZA 4WZAE 1AUIB 1MUXA 5FOWA 2R8RA 5FR1A 1TEVA 2G9BA 4YMVA 3EPKA 4B44A 4XJKB 1KO5A 1NL3A 1KAGA 3NBFA 3C14C 4TL7A 3PENA 3SIBA 3EZ6A 4DLWA 2WAXA 2Z0MA 3DKVA 1Y0VH 2JJ8A 2Z4RA 3RVBA 3K1JA 4TL9A 3FS7A 3X1ZA 4B6EA 3PSRA 2ZKMX 4RZXA 4CGZA 1J7KA 1M7GA 4GMDA 1TUEA 4MRPA 1G8IA 4F7WA 2LMVA 1OXXK 1HEIA 1YJ5A 2K7OA 2CHGA 3QE0A 5AJYA 5I2LA 4PPFA 5AXIA 2CNPA 1GP2A 4BUJA 2FWRA 2VSOA 2WNDA 4AOMA 1CNPA 4Z8XA 5IDVA 3TR5A 2ZN8A 3AKYA 3SJZA 3UATA 1LNZA 2LV7A 2QP4A 4I1SA 3U3OA 2DR3A 4TMTA 2JJ1D 4MKHA 2KI5A 1B9AA 2GV5A 3KJGA 3ZVMA 3DO6A 3SG7A 3TGPA 3AH8A 4L8GA 1P75A 2QQ0A 1HT2E 5I8NA 4DCVA 2ZRJA 1DPFA 2DPXA 2GETA 1IQ3A 2LE9B 4KO8A 2C04A 4GUKA 4YMUA 3FFBA 1AGRA 3CF6R 2VLIA 5BWMA 4OV2A 3BYAA 2GGZA 1XB2A 1RIFA 2XB4A 2OO7A 4B34A 3THXB 3HU3A 4FMBB 2JAQA 1D8TA 2F1RA 2Q0HA 4JBXA 4N0DA 5EE0A 4P4SA 2UVQA 4PO9A 2W6IA 3D31A 3CTNA 1AS2A 1U0LA 4TSFD 1TNPA 1AKYA 1XCPA 3VHXA 4M1OA 2OFOA 2XEXA 5BYKA 1Z0AA 2A78A 4C0AC 3GLFA 1W4BA 2AWOA 2RGNC 3QF4B 4BLTA 4PALA 2QI9C 4IOLA 1KIMA 3C8UA 1U0HC 1AJ5A 4M22A 3LA6A 1SKTA 3K53A 1NUBA 4HATA 4WVFA 2P6UA 2HF9A 2G1JA 4V0MA 4CEIB 5FBRB 2AKYA 1ZFSA 4PZLA 4D26A 3F3YA 2GZDA 4OHWA 5E7MA 4ETOA 3R8CA 1GRQA 3LV8A 4XJKA 1KFXS 1EWRA 4TYPA 3ZJYA 3I5GB 3CKLA 2KI4B 4S35A 1LKJA 5C4MA 1T5LA 1XXHE 2JJ2D 3IIKA 3DF0B 3PQCA 4Q7LA 5HCIA 1EL4A 3BFVA 4GL2A 5TNCA 1N3BA 2G3YA 3O8BA 1YZGA 1NF3A 4DZZA 2YINC 5FTNA 2FDCA 2HF8A 1ZUNB 2CK3D 2VSXA 5FUXA 3O4YA 1G17A 4IKEA 1UDWA 4US0R 2HF5A 4V02A 5ANRB 5AANA 4JLVA 2CCJA 2PLFA 3CX8A 2AN9A 2ORWA 2WVJA 3NHAA 1ALVA 1CEEA 1KY3A 4OHVA 5KNDA 2XTNA 4PE0A 1RRFA 1QLSA 1HE1C 5SZIA 1SL7A 1UKZA 1P3JA 1ZM4A 4BFSA 4IDHA 4PHJA 2BBSA 3KF9A 4QGAA 5FL7D 1ZIPA 4PR0A 1M45A 5HZKA 2F2PA 3U4QB 5CSFA 2F6RA 2Y8EA 3KJHA 4YI9A 2ISDA 1Q0UA 2FNAA 2UKDA 3N70A 4EAQA 4HAWA 2GF9A 2BMEA 2GXSA 1KK7Z 2PMYA 4BEJA 5JSZB 1YR5A 3PVSA 5LB2A 3VTKA 4KYIB 1GILA 1OXTA 2WWIA 2ATVA 1RKBA 3P27A 4Q4AB 4LHVA 5EP3A 5EUQB 4DLXA 4XIGS 3X1YA 4F91B 2K2AA 1KDPA 2M0RA 4MZKA 4M1KA 1X3SA 2KQ6A 4DHEA 3U60B 3THXA 1NVVQ 1V1FA 1BLQA 1LVGA 2JGNA 2ZE7A 2BMFA 3PCRB 1RFLA 1Q44A 4PQFA 4UPGA 1VPLA 2KJQA 1G3IA 2C5LA 1PULA 1C07A 5K89A 3SS8A 3U7FB 1DF0B 2VHQA 4WQ2A 4JSYA 1NN1A 5IT5A 1F55A 1P2UA 1E9FA 2EYQA 1PLKA 3M0EA 3CX6A 1XCMA 2L5XB 2QEQA 1S8FA 3QF4A 3OAAA 4MUAA 4L5BA 2N46A 5H1YA 2H57A 4ZCIA 4O2RA 5AUQA 4JT2A 1AJ4A 3U6BA 1G4UR 3DM5A 3ONWA 2JRFA 3KKMA 1ALWA 2OILA 3CM0A 4B3DA 2CJWB 4CEIA 3OEED 2M1KB 3C1VA 1R0YA 2WJYA 1C7VA 3TK1A 1LTQA 1XFVO 1Y63A 1HUQA 1FUKA 5K8LA 4E5UA 3Q8XB 1L4UA 4RZ3A 2HYDA 2K2FA 4DDTA 3DF0A 3R9XA 3DEFA 5G40A 1W44A 4MGIR 4D81A 2PX0A 2W00A 5JLJA 1IQ5A 3UK6A 5BPJA 2JWWA 1JWDA 1AS0A 1S96A 3ZVLA 2VO1A 4ZI2A 2W6JD 1S2MA 2KGBC 5GJCA 5CSJA 2GXUA 1IN4A 3LW8A 3EIEA 1Y1AA 1HV8A 2D7CA 1SKYE 4W7SA 4JJZA 1Q57A 3PFIA 5LB4A 4ZDIA 2J0SA 1JAIA 1XD9A 1CR0A 2LCPA 4CFQA 1UFQA 3FMOB 3EK8A 1BT6A 3U4QA 1NYAA 1WDCC 2LVJA 4YRUA 4PPQA 3W34A 2ANCA 4JL8A 1SVSA 2QAGC 4QGFA 2QTFA 5L3QB 1U0JA 2GHIA 2OS8B 3ZDQA 3WXAA 2Q9CA 2WV9A 2X19A 2E1RA 2WJJA 3AQ4A 3B13B 4LV6A 3A4NA 4B33A 5JSZA 3PEYA 4NCHA 5KSOA 3K09C 1A2XA 1II9A 4QGHA 2BCBA 1E94E 3CR4X 4Q4AA 2HYIC 1XFZO 1B23P 2LM5A 3AVPA 2JLVA 1CU1A 2VEDA 3DKPA 3BUMB 3A1SA 4OJQA 3VR4A 1FZQA 4B6FA 3KQNA 1T3HA 1DTLA 5HYDA 4M1MA 1NP6A 1CLBA 1IQPA 1KZ7B 3LX8A 2WOJA 2BWJA 1E1RD 2YV5A 5HE9A 1Z3IX 4QG7A 1DF0A 4A4CA 5KU1A 2SCPA 3KKNA 4NCNA 5EQTA 3SDZA 4QHYA 2XAUA 4UNPA 1JUOA 3OF5A 1G8PA 1SQ5A 4PAOA 2OESA 3A1UA 1WQ1R 3LXXA 4R98A 2FA9A 1DTSA 1B7TY 1DO0A 1PLJA 1NLZA 5DN6A 1Z6XA 4V0OA 3V4RA 1SY9A 2CJWA 1SVIA 3GEHA 2ASEA 3KFVA 3VHLB 2GJSA 2C96A 4KLZA 2OTGB 3EA5A 1GM5A 3JTDB 2KAXA 3T06B 4QJ5B 4CEHB 2WM9B 1XJQA 4BRUA 5HKKD 2FCDA 4GDFA 2IC5A 5EP2A 4HDCA 4PC7A 4D82A 4YGAA 2KNEA 5JMTA 1M39A 2MJWB 3D6TB 3CPEA 3RHFA 5C1BA 5H70A 1TCFA 3K9HA 4LPKA 5J40A 3U7GA 2H92A 2EU8A 4CW7A 1XMJA 2Q3FA 3LAWA 1XU4A 2Z6VA 1ZMXA 1NY5A 4EFMA 4LBZA 3QRXA 2G88A 4KYUA 5E4FA 1YRBA 3KQLA 4GFDA 4PANA 5J4LA 1O87A 4DT1B 2XGJA 4I5NB 4WZBE 3HYRA 4F4IA 2V7QA 1QASA 3NC1C 1NVWQ 4MRRA 3ZIAD 3BC1A 2AX4A 2I1QA 1XXHB 5L3QA 3KKOA 3K21A 2DWOA 2NO7A 1P9RA 3E70C 3BUXB 4MZJA 4JSTA 5H68A 1RW4A 4MA4A 1AN0A 1AQUA 2IX3A 2AFIE 4R71A 3OX5A 3RRZA 1E9BA 4Q7KA 4Z8YA 4NHOA 4G5OA 3CR2A 2J59A 3C4JA 4WOPA 3KB2A 4MITA 3UG7A 1QX5B 1XA5A 4CFRA 3DMDA 2GJ8A 1BH2A 2ORVA 3T5GA 3VRQA 1C9KA 1KDOA 1Q1EA 4MKFA 2LLUA 1E4VA 5LBIA 4AKEA 4D80A 4PX9A 1LF0A 2I7AA 4OI0A 1XJCA 1RRPA 4M1SA 4Q5IA 1GAJA 4G3XA 4TLDA 4B43A 3BUOB 1SPYA 4WBSA 4D0LB 2P3SA 4A15A 1MWNA 1GIAA 2BM1A 2IYWA 2P6BB 1S3GA 1XPUA 1ZNXA 2L51A 1AS3A 1US8B 4RCYA 3EAQA 1WBDA 4BFUA 1BJFA 1F3OA 3V00A 4LYAA 3D8BA 3TMKA 1A4PA 4ZPXA 2IXEA 3TSOA 5M04A 1M31A 1S5GY 4QJ5A 5GVSA 2LWIA 2ZVQX 5EZ6B 4CEHA 1XBTA 2E87A 3BB3A 3WXMA 3SG5A 2KI4C 4LBVA 3IDQA 3BRWD 1VYUA 4B35A 1MV5A 2ZUDA 2XX3A 3NHBA 5KYKA 2B8WA 4W5JA 4X8OA 3I5IB 2EQBA 5F6TA 2JZIA 2WKQA 4YGBB 1COWA 2DYKA 3EWSA 3U3RA 1FPMA 4NDBA 1LA0A 1ZCBA 2Y1MA 3E2IA 3CH4B 2H5EA 3I73A 4LYJA 3RM1A 1EXMA 1OJLA 2EFGA 2F55A 5LD2C 2BEJA 4M1YA 2EW1A 2EWVA 1W2HA 2F3TA 2P5TB 4GRAA 1CR1A 2NXQA 3B5JA 3KTAB 2V53A 3LK1A 2CE2X 4GNKB 4I5KA 1XXHA 1XDBA 2ZJZA 2JLWA 2BEKA 1E2QA 4JBYA 1TUIA 4JLDA 4D2IA 1QV1A 4URUR 2QU8A 4FI3C 2ZRMA 5HKWA 2OZEA 3B1WA 4IDOA 4ACBA 3CF2A 3AKAA 2M7LA 2GVZC 3I3SR 1PVAA 5CITA 4WW0A 2BHRA 4ZCLA 1OHHD 2NOAA 3QG1A 2IBMA 2IWRA 4D4JA 4DC9A 3GLIE 1RJ9B 1WXQA 2JQ6A 5FUYA 2FH5B 1W5SA 3QEOA 1JR3A 1SKYB 1SXJE 5EE3A 3WBJA 1BMFD 3VFDA 1PK0D 4A92A 1WCV1 5FTLA 2Z43A 3RWMB 3O78A 1PZNA 1ZU5A 4C0HA 2J7PA 2OFXA 2ZSBA 4EKDA 4KLNA 2QENA 3VR5A 1Z6AA 3CNOA 4DBLC 4R2HA 2P67A 3M4YA 2ONJA 5KSYA 2QE7A 4HREE 1XRJA 1NG9A 1JFJA 1XEWY 5EUMA 3N5CA 4C4PA 2BV3A 2M7NA 1US8A 2IUUA 4V0KA 5CJPA 1KQMB 1EG7A 1GSIA 2IF0A 1HQVA 3K0FB 2ATXA 4IEIA 3ZLJA 1EJ3A 4NZYA 1E9RA 2GEUA 1RYHA 4LHXA 2ZE6A 3SHWA 2ZU6A 2GAAA 1EFTA 4N1GA 1K6MA 3LLUA 3LW7A 4PC3A 1VCIA 5J4HA 1JQJC 5FBVB 2ZSAA 4TL6A 3A37A 4MGKR 2I2RE 2IWHA 3T1TA 5KO2A 1UBCA 3DMNA 1B8RA 3LNCA 1GOTA 2EVWX 3AM1A 2KWIA 2DOQA 4YXWA 2FCEA 5TMPA 2GCPA 3KL4A 3SG4A 1R6BX 2VQSA 3G5UA 3T1OA 4OHYA 3A4UB 4QRHA 4OJKA 2ZJBA 1R8QA 3T15A 1QG4A 1GKUB 3KTAA 3A36A 1M46A 4EUNA 5FTKA 1A7JA 4GZMA 3AB3A 4JS0A 2K0JA 2FFQA 2Z4SA 1E2IA 2G6BA 4PSAA 4I5JA 2GTPA 4DLZA 2B6HA 1W4CA 2PCJA 1CJKC 4BFTA 3K70B 2TN4A 1G6OA 1H4BA 2ZI4A 4FQOA 2BL0B 4JYBA 1VCOA 2E9SA 4ACAA 3LVRE 4FCWA 1KSOA 1RJ9A 3GEEA 2F3ZA 4KODA 5SZJA 4BFZA 4NE2A 4Z54A 4HLDA 3GLFE 3OB1B 4KV9A 3EVVA 4HZUB 4BY4A 1BIFA 5C4GB 2X77A 2J7KA 2J87A 2ZRCA 4HYYA 2FEMA 2ZR9A 4V0ME 2DB3A 1HQYE 4G5RA 1SCVA 2QPAA 3M1IA 3AF1A 1GJYA 3N2EA 1JALA 1KI3A 2R6AA 1CKKA 1IN6A 3DM9B 4KSCA 2B7CA 5HPYB 3K0FA 1S6CA 2WKRA 1FBVA 1PSBA 1TL7C 1TF2A 1R5OA 1OZOA 2ZRTA 1JAHA 2MSEB 3BH6A 3MSXA 5J5CA 2C95A 3W6PA 2WTUA 4DCUA 4A9AA 2W0SA 5KSZA 3JTDC 1EFHA 1UHNA 2BCXA 3DPUA 4IOMA 2GESA 4P3YA 1WF3A 1VMAA 3GLHB 1NG1A 2JXCA 1N6PA 2WSSD 2IUTA 1MR8A 1N0YA 4CIDA 1RZ3A 1CKEA 4MUBA 1W7AA 5JCPA 1NNEA 1N6HA 4GFTA 2GWHA 2VP9A 1R5NA 2IEYA 1J8YF 4XTRA 1ZUZA 3PLFB 4LJ4A 5JJIA 3HX4A 3AF4A 1N0VC 5FH9A 3BB4A 4MH0R 2G0TA 5K8IA 2JT3A 2LHIA 2GEDA 2FOTA 1BF5A 4OKHA 1IBRA 1QHNA 1UEJA 2G77B 1BO6A 1SL9A 1P2VA 2WWHA 3AUXA 1JXOA 2LKDA 4HLUC 4BFWA 3AKBA 3UWOA 1EH2A 4D0NA 2GBLC 5UKDA 2WPDD 2JIZD 1RECA 1HH4A 4HAYA 2OV2A 4LCBA 4PO8A 2PMKA 4PZZA 4M21A 1AKEA 1MH1A 4PSVA 3FFAA 3I1FA 3PATA 1XTIA 3TSWA 5HLOA 1M7BA 3KHEA 3IEVA 3EVRA 1VDZA 2VHUA 4HSEA 1S3PA 1MXLC 2ZJYA 1SGWA 5IK2A 1KI2A 1J90A 1MF8B 5CM8B 2P2LA 2A30A 3R9WA 3TSZA 1W1WA 1AVSA 4HZUA 5FR2A 3X1DA 1J1EA 2OPOA 4Q9IA 4LZZA 3V4FA 2ZYTX 3EARA 4CRWB 3AVOA 1FNMA 4ITRC 3RNLA 3KXKA 2Y4QA 1LS1A 3CRQA 3FWYA 3QUSA 4I4LA 4M1TA 4QHSA 4YGDB 1YZLA 2HQ8A 1KK2A 1JQLB 3KJIA 2A5DA 4M9QA 3R7WB 3U44B 3QBVA 2ZRIA 2WC8A 3GK1A 2D2FA 2ZI7A 5L3VA 1X86B 5FOUA 4BFVA 2W2XA 1BYIA 1VG0B 4C30A 4BZQA 4DKXA 3GLIB 4Q9KA 2QTVB 4HDOB 1NX0A 1B0UA 4LWZA 1LINA 2BMJA 3GLHA 1TCOB 2BE4A 2LVVA 1N2DA 1XFYO 3DVLA 4I1UA 4M8NE 1N2CE 2EGDA 3SYLA 3B6EA 1JBAA 2JPTA 2FSIA 1ZUIA 2VF8A 3GJ0A 3FKQA 1J70A 3M6AA 1KCYA 2QPTA 1W4RA 3GEIA 2WIAA 4XD7D 1WP9A 4OQMA 5B58C 1E2NA 1W0KA 1AM4D 3X1XA 2ODWA 3KPXA 3U5ZB 1T8TA 1W47A 5SZKB 1CR2A 4U7DA 1FQKA 3FVQA 4KVAA 2YOHA 5GJBA 4D1EA 1DO2A 1NJGA 2VP6A 5JZVA 3BAFA 4GP6A 5H8WA 3AVYA 2VL7A 4AC9A 2R9VA 3R8FA 4QOSA 4OI2A 3P26A 5B8IB 2BDTA 1AA9A 5F3WB 2C9CA 4ILEA 1ESMA 3L8YA 4NQGA 1F54A 3RSLA 1DAHA 4TQ9A 1QXPA 5HKZA 1TN4A 2RAPA 2C77A 4LC0A 2YWHA 3K0CC 4TT3D 5FPKA 2GVDC 4WXRA 2OUKA 1VYTA 1E2FA 1SYMA 1H8HA 2GCNA 1QIVA 3EC1A 3E1SA 3KB1A 4KSBA 2MLEC 4IL1A 3W8RA 3RRYA 1E32A 4LSGA 1UKEA 1KNXA 2JULA 3U3KA 4OK6A 1BYUA 4PE1A 5DKRA 3W3AA 3LH5A 4HUQB 4YDSA 3WY9A 1U99A 3WRYC 2MLFC 1E2JA 2WWWA 5DI3B 1YUSA 3KEVA 1MQ1A 3VRRA 1ZNWA 3T34A 5L3SB 3J81k 1E99A 1W7IB 1CFFA 2VPPA 1GDDA 3ZGXA 3CWZA 3W90A 4BLQA 1T91A 4BRWA 1SXJD 2BOVA 3FWBA 4BE7B 2PT7A 4U02A 1KSHA 2DY1A 3PEWA 1AGPA 3X2SA 4HDQB 1TTXA 5FTMA 3LBIA 3R7WA 3AKEA 1FPWA 5GQQC 2ZREA 4R1EA 3CW2A 1F5NA 1Z06A 3U44A 2ZJOA 1ZCAA 1RK9A 1W0JD 3SBEA 4JT4A 3VRPA 1Q22A 5KDDA 1LXFC 1DELA 3I5FC 1OQPA 4M2PA 4KCGA 1W46A 4DLVA 3FTQA 3LL8B 4GPLB 4LHWA 3GLIA 4XVUA 3O8DA 5L3RA 3T12A 3PUYA 2BJWA 4PC2A 1XCGB 1XFWO 4W5WA 4XTCS 3ZWHA 1E9SA 1Q1BA 4JVMA 4BLRA 4EPRA 2O8DB 2RGXA 4C3ZA 4EFNA 1EX6A 4ABYA 3UG6A 1JJ7A 1IY2A 3OIUA 2BCJQ 5JHHB 1BOFA 1S6IA 2Q91A 1KK1A 3VGOA 3Q7QA 3TE6A 3O6BA 1Y3AA 2L0XA 2OXRA 3FKSA 4RD1A 2V3CC 3KX2A 2JT0A 4I1OA 1JC2A 3FPAA 2JLXA 3B78A 1CDMA 3WBKA 4B73A 1G7CA 4A0FA 1WBBA 1IJ5A 2J0VA 4C0LA 4LV8B 3TAUA 3H2YA 1TNQA 4MRNA 1A4RA 3AV0B 1NIJA 3IGFA 1YRTB 1BS1A 1G3MA 1QX7A 1G6HA 4HRHA 4MEWA 1JEEA 2ZJAA 3BERA 3OFNA 2UZ3A 4AWXA 1Z47A 5FYXA 2VF7A 2QSZA 1VKJA 4Q1CA 1NSFA 1YHNA 4HAXA 4ZV4A 4IHQA 3I72A 1AP4A 2AXPA 4QM7A 3K70C 2CXJA 4AYXA 2HJGA 2XNSA 1P61B 2OBMA 3REGA 5J47A 4GOXA 4AYWA 4P32A 2ZS9A 3RS5A 4TMVA 4TL8A 4GOKA 2H18A 1QVIY 4HUQA 2XOKD 2KFGA 1JNYA 4XWAA 1OSNA 3SU8A 5L3SA 5DI3A 2W6ID 1GL7A 1YVDA 4LX0A 3RLZA 1XP8A 4YDHB 3P1JA 2P65A 5EE1A 5JI3E 2RKOA 2OLKA 1IJFA 1XEWX 2C98A 2FSHA 2VHTA 5C46F 1QHGA 1SR6B 3BXZA 2F43B 2FJUB 3M0WA 1R7RA 4LJ9A 1HT1E 1KFXL 1KHTA 1FP6A 4M9SA 4Q7MB 5KTYA 1GZSA 1DAMA 2HETA 3CX7A 5JRZA 5FFMA 4M2QA 1F48A 3GFOA 4IVQA 1B7TZ 3PM8A 3PXGA 4LJ5A 1WB9A 4BFXA 2SASA 1IJEA 3DVJA 1Z2CA 1E0AA 2KBMA 1CMFA 4D0GA 1HQCA 2AKAB 2LHLA 2KSPA 2F9MA 5CM9C 2ZS8A 2BE6A 3TVDA 3WMEA 2O8DA 4JLKA 2M8UA 2QMHA 2FGKA 5JWOA 4WXPA 1FF1A 1MR3F 5FPTA 2QY9A 1BG1A 4YQFA 2DFTA 1GGWA 1WLZA 3SC3A 1QG2A 3HP1A 4FN5A 4IVRA 3UMSA 4NYJR 2JJ1A 1U2RA 3C41J 5GADl 2CNWD 1F60A 1YR8A 2N42A 1MXEA 1FW6A 4Q03A 1KO8A 4RY2A 3CWGA 621PA 3VAAA 3BB1A 3K9GA 1CDPA 3D3QA 1EG4A 2H7VA 1SHKA 1NI3A 4IOJA 4EPTA 3CF0A 1N25A 5FBQB 4X8HA 4O2LA 4MYHA 1K95A 1NN5A 1IWQA 121PA 1Z28A 2M1UA 1YR6A 2O8FB 1JB1A 5KUTA 1Z5ZA 4OVNF 1P60A 4X8MA 1KI7A 3EZ7A 1JR3E 4Q4HB 5JBQA 2JU0A 4QJ3B 3ZQ6A 2OCYC 1LVCD 3GOFA 2FX3A 2NG1A 4LY6A 5FBLB 4EJSC 3I62A 2QTHA 3GQBA 1A75A 3MSEB 1X8KA 4MYCA 5AR1A 2ZE5A 5BN5A 3CB4A 3SE0A 3CZPA 4JLBA 2RGDA 4IOKA 4O25A 4GGFA 1D2EA 1K9KA 3DHWC 1RWYA 4MYTA 3VKGA 1JF0A 1TADA 1NCZA 2FPMA 3B82A 4IDQA 3MWLA 4JIMA 4UNNA 5TXGA 4TYNA 1DJHA 2Q3HA 5E7JA 3SZRA 3TAHA 2COLB 2LAPA 3GCGA 1C4OA 1M8PA 3LQRA 4QJ4B 3QPVA 2F43A 2FJUA 1L2OC 1CTRA 1E1QA 2KQYA 2ZANA 2ZRBA 3MLEA 1DADA 1CIPA 4CT4B 2E30A 1ZU4A 2JJ2A 4TLCA 3RAPR 3T35A 4Q4LA 4Q9JA 3FMPB 4NYMR 1DAIA 4AKGA 3B1XA 2KAVA 1CULC 5EXSA 3I5HC 3QXSA 4BQSA 2CL7X 4PHNA 2YKGA 1S0UA 2JASA 2ZUCA 1DOAA 3JVTC 1ZMZA 1SXJC 4GBMA 4LC1A 3TVTA 3B60A 2ZU0C 2QA5A 4JJKA 2PZFA 4A2WA 3VQTA 4ICBA 2H61C 2I94A 2RB4A 4MLWA 1L4YA 2GK6A 3RWOA 1OE0A 1NWDA 5FL7A 3WNBA 2ZYWX 1U90A 1Z2AA 1IXSB 1QIWA 3FB4A 4NDCA 4BZXA 1E0KA 1QDEA 1DJGA 4TQAA 3ADBA 1S6JA 4D4MA 1F70A 4M4SA 1CMGA 1G3QA 5AJXA 4BPBA 2KYFA 2ZUBA 3K8YA 2I18A 2IYLD 2BC9A 1E79A 1GRRA 1Z08A 2EFHB 3TUZC 1YUUA 1AQYA 3NSOA 3SBDA 4NDDA 3QG5A 5DIFA 4IDPA 5D3MB 1LA3A 1KMHB 3RYTC 2MMCA 2GDJA 4QBFA 1E2DA 1I2MA 2BM0A 4Q02A 2O8FA 2EC6C 1N6LA 2FF7A 2NO1A 1CJVC 1LF5A 4DUGA 4M1WA 4B3GA 4Q4HA 1AZSC 1T9HA 3QEJA 1N6IA 4QJ3A 5JJKA 4UKDA 2DCUA 2AAOA 2VHCA 2IYXA 1NBME 1YX8A 2Y1NA 5AUOB 4R9UC 4MDEA 4RFSA 4LBWA 5JWRA 5HKYA 2RCNA 3GJXC 3QVUA 4PTLA 4AG5A 3SJBA 2J0QA 1OKKA 1N0UA 2I4IA 1KDTA 1E69A 2PZGA 2VRGA 2IK8A 3P32A 4A8JB 3Q85A 2C8VA 1QJTA 4YBHB 1JXMA 4QJ4A 2QORA 2ZRGA 4M9XA 1KSGA 4DJTA 1OMVA 4E09A 3A1VA 1G1MA 2CLSA 1AZTA 1OH6A 1E9CA 3PIRA 4OBEA 3WMFA 3WYFA 4MSPA 3BORA 4L16A 4C0QC 1ZINA 2F2OA 4HI0E 4GPTA 4L9WA 4XWKA 3G0HA 3HPQA 1SKQA 1CLMA 2W6JA 4Z51A 5AUNB 4LPSA 3SHFA 1OT3A 1UPTA 4NYIR 4EPWA 2KGRA 3SYNA 1G8GA 5EXPA 1G41A 1D2MA 3ICBA 2L2EA 3TNFA 3OP0A 4FW9A 3KO0A 3KKPA 2E6WA 1I4TD 1II8B 2PMDA 2R6DA 5SZHB 4G5QA 4A6XA 1KI1A 1UURA 2WWGA 4DCSA 4AKHA 1OV4A 4G0NA 4JLNA 1MHOA 3SG3A 4I99A 1T5IA 4HRGA 2YNMA 5J4KA 2H17A 2ZRAA 2IUSA 3DDCA 4NBSA 3RRNA 3MRSA 3PN7B 2L4IA 2ZI5A 4GI7A 1GL9B 1KMHA 5D3MA 4MGYR 4ZCMA 4I1VA 1QHXA 2O0HA 2DFKB 2IYVA 3RABA 1OFTA 2ZN9A 2X2FA 2A4JA 2RGBA 1ANKA 2HLDA 1E1RA 5FOXA 3T1QA 4NDZA 1ELOA 2WBLC 4ARZB 4MRVA 4Q1BA 1DS6A 5D69A 3WHLA 4PDZA 5JCZA 2FGJA 4TTPA 4IVPA 4QHTA 1ZYUA 2ZAMA 2DWPA 4KFRA 4UNSA 1B8CA 3EC2A 3QXXA 5BN4A 3PALA 3AP2A 1GITA 4JBWA 1BOCA 2CL0X 4KFTA 4DEXA 3KUCA 3PEVA 3VKWA 2HDNB 4CVNA 1WDTA 2ZNEA 5HZHA 2VRWA 4A8JA 1S1MA 3D7MA 3MMPA 3EVUA 2YVUA 3TS5B 3CRRA 2L4HA 1OMDA 1TRFA 1XD8A 2YJTD 1R0ZA 2IS4A 1KWOB 4LBYA 2QM7A 1VHLA 1EESA 4DUQA 1LS6A 3NC0C 2C03A 1KSMA 1U98A 1FL9A 1FX0B 4D4LA 3ZS9A 5KDLA 1SVLA 3GLHE 1N5LA 1OW3B 2MBXA 1HA3A 2WIBA 2YOFA 1TU4A 3GJ5A 4I5LB 1VYVA 2D7DA 3BOWB 2FPLA 1CP2A 2VSFA 1W36B 1F2TB 1OFIA 3W6NA 4ZIRB 1XFXO 3R20A 1D5CA 3RS2A 2QM8A 3E3RA 5FBWB 1ODBA 2HT1A 4K81B 2CMKA 2WOSA 1CF4A 4TLBA 1YR7A 2GILA 5DSZA 1KAOA 1II8A 1COWD 2NTYC 2ZJ8A 3IBGA 3IILA 4DLSA 1NMYA 1XTQA 3AAKA 5IBWA 3DVKA 3CZQA 4L15A 4URYR 4GSYA 2YZ2A 2WWFA 1IJ6A 1CM1A 1G3RA 2I3BA 1KK7Y 3EG5A 3L8ZA 3I5GC 2RGCA 2ZRDA 1G5TA 5BYJA 3KUDA 1BR1B 2BKHB 2IYQA 3MWJA 3OE7A 2AR7A 3ZD6A 2MSCB 5FOVA 1UWOA 1VG9B 2R44A 3H4SE 4OYHA 3LCPC 4MGZR 5CYOA 1QHHB 3IUYA 3O8CA 1DJXA 3BH0A 1E98A 5CPVA 2OHFA 3EK7A 1J7RA 4Q9HA 3D0YB 1PSRA 2R62A 5CLLA 1S9HA 1SMGA 1LB1B 3T5DA 2JT8A 1D9ZA 1TPZA 4JLAA 1HYQA 4XOIA 1OYWA 4ARZA 5CSIA 4ZCVA 2HEIA 2LKCA 5JJLA 4ZO4A 4KBFA 4L9SA 4E03A 1XO5A 1JR3D 1Q3HA 3B2EA 1KO4A 3FYHA 4DSOA 1YX7A 1RRGA 4BGDA 1PV4A 4TLAA 1RC8A 3EPJA 2J7PD 2KFFA 4MRYA 3LWNA 3BUNB 4Q9LA 1Z29A 1FQJA 2LP3A 1X6VA 4YMTA 1G20E 1ZW6A 2QE7D 3H1TA 1P5ZB 1T0HB 5CJ2A 2GNOA 3OZXA 1Y6WA 1E2GA 3I8SA 2O52A 4HAZA 3THYB 2EYUA 3B9PA 1OF1A 3B1YA 1FX0A 5AK0A 1ODFA 2XSZA 1EK0A 5DE3A 1NLYA 1VTKA 4JWQA 2KBEA 2FOLA 2XNDD 3BIFA 4NYJQ 3OIYA 1SCMB 4OI1A 1QHIA 3WP1B 2Q3MA 4C0SA 2NPIA 3VX3A 1V43A 1FOEB 2LMTA 3BOWA 1ZC4A 1UKVY 4NU0A 4PFSA 4Q7JB 4D4KA 2LMUA 3QSYA 1F2TA 2IXGA 2REBA 4TYQA 3TUYB 4ZIRA 4WA7A 1DG1G 2SHKA 3CLVA 4LDJA 2YC2C 3RRMA 2R2IA 4DB2A 3FMFA 3HPRA 2CEAA 3SFVA 2AD5A 3OEHA 4DDVA 3CS1A 3A4LA 3DOEA 2FPKA 4YXWD 1VIYA 3Q7PA 2ZIAA 4U8DA 1QF9A 3MWKA 1IN7A 4PAMA 5J4YA 2XZLA 1QV0A 4FXPA 1N6NA 3PFVA 3K9LA 3P4YA 4HEJA 2WCFA 1MO3A 1XMSA 4LJ7A 421PA 1YZUA 3AAJA 4OI4A 4FMDB 4Z1MD 5HR5A 2A3RA 2HT6A 1W7JB 4RD3A 2PLRA 3A1WA 4NKRA 4DVGA 3LBNA 3IO3A 1OFUX 2ZRLA 2WWYA 2O8EB 1E0SA 4B74A 2BBNA 4USLA 5AERA 1QZXA 1ZOTB 1QHHA 1SW8A 4H1VA 4XJXA 1BKDR 5FPYA 2PSRA 2BKEA 1RJVA 1G19A 4DSUA 3D0YA 1S36A 2MRDA 2NO0A 4POAA 3NH6A 5B2ZA 1ZVQA 4HUTA 1R0XA 1VIAA 1S1CA 3PR1A 3DL0A 3QI2A 2VP2A 3ETLA 5EE9A 4AKIA 1FUUA 1PALA 3DZ8A 2V9PA 1BMOA 1G7RA 3B9QA 4PC6A 2A9KA 1M2OB 1P9NA 3TH5A 2AMIA 4JQ0D 1QVRA 1SVOA 4P33A 4Q00A 3TQFA 3GP8A 3I61A 1H65A 2AK3A 1DAKA 1FNNA 5JS7A 1K90D 3EZFA 1CJUC 1N0WA 2OS8C 2KBFA 1G5PA 2ZITA 1EFRA 1Q21A 2O5VA 2J46A 2QROA 4NTZA 2O0JA 3F5FA 1GVNB 4B2LA 3UWKA 1MO6A 1VG8A 1Q80A 4KJZA 3LO5A 4TYYA 4XVRA 3NBZC 3THYA 5A0FA 3WHTB 2WSMA 3LK0A 2CCKA 4C0KA 4IRUB 4Q01A 1RYFA 2FZ4A 2JEOA 2KB0A 3QKTA 4B2PA 5JRJA 4BLOA 1SULA 2IYTA 2JA1A 3LRPA 1QTXA 2ZSFA 1NBMA 3NKVA 2OT3B 4ORBB 3VKHA 2LNKA 1G8FA 2YHSA 4HAVA 3AF0A 4V03A 1EX7A 1KJYA 4Y0AA 4Q48A 1XTSA 2JC2A 5CK5A 3W9YA 2QT0A 2ONKA 1OXVA 2OXCA 2R6FA 3FHOA 4HB4A 3UXMA 3WHKA 1RE0A 5DH9A 2JTTA 2OM2A 1JR6A 3JVUA 1S9DA 3RS4A 1FI5A 1FI6A 3AVTA 5DKNA 2OTGC 1UHHA 1RVDA 3B8HA 1XMVA 4AYTA 1I2DA 1KFUL 1Z63A 1KDRA 2REXB 2Q9BA 1K9UA 3NEJA 4AD8A 5CSNA 4QNMA 2G9NA 4AK9A 3IIMA 5A4JA 3WMGA 3GK2A 3SQXA 4I81A 2O8EA 1N65A 1T8UA 2X1VA 1DAGA 1XK4A 1XPRA 1YVHA 2CVHA 5AFPA 2ZVPX 1SHZA 2F33A 2CDNA 1SRAA 3P20A 2WKPA 2IS9A 3FDIA 4TN1A 3AVXA 4XSHA 5FI1B 3SN6A 3K70D 5TVKA 2JDID 1A2KC 1A5TA 3IIJA 1KI6B 3FIAA 1S26D 1E2HA 4O3MA 1DARA 1ZRHA 2BMDA 3ZYCA 4MVFA 5TARA 2HCJB 1IM2A 1YE8A 5IK2D 1P9WA 4URXR 1ZACA 1C7WA 2F7SA 4HZIA 3ICQB 2V6JA 3A4MA 1KFUS 2M49B 1QVIZ 1NPQA 2FU5C 3AKDA 1KJWA 2WJHA 1K96A 3BJIC 4HB0A 3WP0A 4US2R 4WZ6A 1SVMA 3OESA 1ZBDA 3NSIA 1ZD8A 4LJ6A 3NBYC 4B3FX 1RFJA 2WOOA 4LGMA 5FOSA 3UPUA 3ZVNA 2RMKA 3HJNA 5HTKA 4ZKEA 1CRPA 4NYIQ 3JZMA 3FHCB 2LP2A 3QXCA 2I1VB 4YC7A 1QHSA 2JNXA 1R8SA 1F4OA 4ZKDA 4FMDF 1MRSA 2ECKA 4QBIA 4R7ZA 4Q1AA 3ZNIA 4OR9B 3QNUA 1R0WA 4HB2A 1K94A 4IEEA 3NH9A 2F3YA 3GPLA 1Y1UA 4ON9A 5TY0A 1P62B 2FSGA 1Q1QA 4LOAA 3EXAA 5JECA 1J55A 1ZM3A 1T4GA 2QP3A 4URWR 5JEEA 4JLPA 2C78A 5JS8A 3KJEA 1YZQA 4KFUA 5DHAA 2ZEJA 4FMCB 1OH5A 3AVUA 2R6CA 4MDFA 2X2EA 3OIVA 5KSPA 3V9PA 1MABB 1GKIA 2RHMA 2JLYA 2OAQ1 3C15C 4NCKA 4EFLA 4A82A 4MRSA 4M9ZA 1CDNA 1J7OA 3TUIC 3U7HB 3G82C 1W0KD 3KZ1E 1F6BA 4DSNA 4F4JA 4YONB 2WPDA 1E2PA 5JI2E 4ESVA 1QLKA 3L0OA 1XEXB 4X8LA 5K8TA 2HPSA 2MAZA 1UDXA 1KI4A 2P0EA 1W49A 2YWFA 1IGVA 3QKRA 3BFXA 1Z83A 1XVJA 1IY1A 1UADA 3EW9A 4V0NA 1B8LA 3I5IC 1OIVA 1IHUA 4DCNA 4GOJA 4KITB 5JFGA 1HTWA 2F1HA 3QXJA 4OKSA 4IFEA 1OB5A 2RGAA 4IJMA 4YLGA 1CRQA 2ZR0A 1OMRA 1KI6A 1XTKA 1H8HD 3ZVRA 1RRCA 5C18A 4M0LA 5G3ZA 4JZKA 2XTZA 1Z0IA 4A4BA 1JFKA 2RGNA 5J3XA 1YKSA 1ZAKA 4BFYA 4TTRA 1R2UA 4LJYA 2WAYA 3EX7C 1Z0DA 2RGEA 1ZNZA 2NZ8A 4LRWA 1RROA 3F45A 4GP7A 4OQXA 1WRBA 2GRJA 2C9YA 5AJZA 2BCAA 3CLNA 3CUEF 4BWYA 1Q1ZA 1GRNA 1I4DD 1NMZA 4CF7A 4YMWA 2CLDX 4PHTA 3U6KA 3EKHA 4O0MA 1FTNA 2QMOA 3TBKA 2K61A 4MN0A 2H1LA 4DXAA 1ZP6A 2V1XA 4Q18A 4GGNA 1G8YA 5AJVB 2VP0A 1GNPA 1OXUA 1E96A 1PVOA 3BE4A 2WJVA 2A5YB 2GJAA 2W2VA 3A8RA 4H9GA 3TDUA 2RGGA 3AP1A 4FINA 4RKEA 3B1VA 4BECA 4EIWA 5KNCA 2P6NA 3ZZTA 2QT1A 2CHQA 1CLLA 1L8QA 1W4AA 3CWQA 3LLEA 3ZD7A 4DEYA 4B3XA 1NCYA 2WICA 4ZCUA 1MABA 1ZIOA 1H8ED 1NSHA 3MWYW 3FKSD 3KFXA 3NG1A 3LD9A 1WDCB 1KQMC 4G01B 4Q66C 4ZDJA 1KJZA 1A2BA 5ER5A 4HAUA 1F8HA 2QAGB 3ZQJA 3BUWB 2R6GA 2NQ2C 4II7A 3A8TA 3IPXA 3TW4A 1PLLA 4F38A 2ERYA 5F9FA 2BCGY 3OX6A 4MBEA 1NSTA 5DKQA 3L0SA 4PE4A 2ZR7A 2ZS7A 4FWIB 1XEXA 4B71A 2IT1A 1HY3A 1F4QA 1NVUQ 4JVSB 3JZAA 4W9MC 5D7FA 5B30A 3AUYA 2FFAA 1M6NA 3OFND 3MJRA 4NCJA 3CZTX 1VECA 2H2KA 4XSGA 3TW8B 1G8HA 3ND9A 1YTZC 4GBAA 1DJWA 3C16C 1D2NA 1II0A 4ORCB 4E68A 1KTVA 1K8RA 1X8JA 3ZS8A 4ASUA 4A36A 1XWIA 2ZRNA 2OE2A 1M63B 3IHLA 1BR4B 3PUXA 3FWCA 4BASA 1AK2A 2G1KA 2H8KA 4QFMA 4OQLA 2G83A 1OB2A 2PH1A 2GGMA 4ESHA 1Z07A 3EIQA 4RD6A 1R6PA 1DVRA 1G33A 2J9RA 4OHZA 4DIEA 1DJIA 1U9IA 3L82B 4JYCA 3SYKA 3IHWA 1DEKA 4DDWA 4FMCF 5CDFE 4RFSB 1UUSA 1M7HA 1Y1XA 2C9OA 4RZ2A 1OIXA 2VP5A 2HXYA 2YYZA 2CXXA 3EWAA 5TV2A 2BL0C 1A75B 1GGZA 2BIFA 4OQFA 4QGGA 1MRNA 1Q3TA 3LLMA 2BVNA 4LYFA 3FHTA 4PHMA 2PRUA 1T6NA 3QQ5A 2AWNA 2ZSEA 3CR7A 8OHMA 1PJRA 1UEIA 4U5XA 5JWHA 2K8MB 4KHZA 3RC3A 2IS6A 1NIPA 2DHRA 3Q9LA 4W5HA 3RS0A 3SOPA 1G4YR 2O8CB 4FWTA 2W2TA 3EA0A 1PUIA 1UKYA 4TLEA 4XWOA 2NO9A 5KPDA 1M34E 1DGUA 1IG5A 1EWQA 2L50A 2ODEA 1KK8B 4QBHA 2BJVA 2QAGA 2YC4C 3NVAA 4PPGA 1KSFX 4KVGA 3H84A 1E4YA 4DS7A 1TNDA 1VRKA 1JEDA 3A1TA 3I32A 3QPUA 3QBTA 4JLMA 2ODBA 5FPSA 3K09A 3S1AB 4MQBA 1UP5A 1K5DA 4KFSA 2QUZA 1KI9A 1G9XA 5JEDA 1K9PA 2QMEA 3NWJA 1D9XA 2QRNA 2L0PA 3O2PA 2DFNA 2IW3A 4QC2A 5B57C 2V54A 3KXIA 2QAJA 1NX2A 4C0JA 1E6CA 5E7IA 1JJVA 3QVVA 3K0SA 2QACA 1KOFA 2XOKA 5G41A 4PHGA 2WORA 1WLMA 4LHYA 2GJ9A 4QXAA 4RFVA 4NPHA 3BK7A 4QBGB 3VU9B 2CCMA 1LY1A 4PSKA 5EE5B 3AF3A 4AG6A 3W5JA 1CFDA 2GXAA 5DI9A 4RCZA 2OCAA 3KQKA 3TKLA 4MKGA 1IN8A 1N5JA 1A29A 4ZDKA 1L7ZA 4HSZA 1F2UB 5EZ5A 2A2ZA 2PZEA 1NIWA 4RD4A 5DNYB 2IYRA 1XPOA 3SR0A 4TZ0A 3CNNA 1OZSA 1AJEA 1NN3A 721PA 5JJGA 2VA8A 4G5GA 3RDPA 3I5YA 1E3MA 4TSFA 1A82A 5DGXA 1E1QD 1UJ2A 2P5SA 2A5JA 2PX3A 3I92A 2EHBA 4OCIA 2Q6TA 3WNCA 4OL0A 4RSGA 1R10A 3BBPA 3ICEA 3IF7A 3IKJA 1S3SA 1DT7B 2YWGA 2DBYA 3IQQA 1P2TA 2VYFA 5BQ5A 3TR0A 4K8OA 4PPNA 5KOYA 1NKTA 2JCSA 1KYIA 3HDTA 4C2UA 1OH7A 2PJZA 2WMNB 1QVAA 2CNWA 2YWEA 3IBYA 1IONA 1YR9A 3OAAD 5LD2B 4EPVA 2O8CA 5I2OA 2ZROA 2QMUA 1D6JA 2ANBA 2O5GA 5BXQC 4MRXA 5F98A 3ADDA 1OLOA 5KNBA 3EZ9A 3VRNA 5BW8A 2M3WA 3EKJA 1DVIA 5KHOC 2CK3A 2QGNA 3SFZA 1UHIA 2K7CA 3OHMB 2Q9AA 3Q72A 5JHGB 1KGDA 3GFTA 3S1AA 5EXTA 1S5GZ 4K46A 4UJ5A 4DLYA 1Q12A 4Q21A 5TB5A 3QKSB 2FZLA 2LVIA 1E79D 3LBHA 3MD0A 3O47A 5A5GA 5KPJA 3NDBB 1V5WA 2GA8A 4JVLA 2VIIA 4P0TA 4URZR 1KI8A 2W58A 4DUGD 3VR3A 1GQMA 3VU9A 4LHZA 3H0KA 2D3WA 1KZGB 1J1DA 2JLQA 4TZ6A 1VCMA 1TNWA 3LFUA 1FW4A 5FOTA 4PC1A 2ZJ5A 2IHYA 4KAXA 4DCTA 5CIQA 1O3YA 3CONA 1K5GA 1ZD9A 2KOTA 2AD1A 1OKKD 4RD0A 1F2UA 1VG1A 1NX3A 5ER4X 3RC8A 4N5XA 2HJVA 2IYZA 3JVVA 2LC5A 3CRW1 4PE7A 5IF9A 4E22A 3BWDD 1G21E 1W48A 3CPHA 2MHHA 2HXSA 2D8NA 5FUVA 1U9IC 3VX4A 3W5IA 1U5IB 3EK4A 3VR1A 3CPJB 1CLUA 1N6OA 3SG2A 1XF9A 3I8XA 2F8PA 4RD2A 2JLRA 2NIPA 1YZKA 3NSLA 4CPVA 1J7QA 2AHOA 3GJ8A 5FUWA 1EGAA 2G0NA 3EIHA 2GXQA 3NEYA 2ERXA 4P5OE 3CR8A 1H8BA 5G08A 2KI6C 4Q1FA 2K7BA 3OEEA 1DMOA 4CEJB 3U2QA 3MAAC 2BKIB 4RKFA 1AHRA 2D06A 1G7SA 1GL6A 2OCBA 4PXAA 3CIOA 1G7TA 4JL6A 4AY2A 1GKYA 2ZJ2A 1EXRA 3GMTA 4A0GA 5DN6D 1UF9A 1NVXQ 1S1EA 2J45A 5ELXA 1NN0A 3ADKA 4P4TA 3K0EA 6Q21A 4FTGA 4TMXA 3SI7A 4ZI3A 4EQ6B 1D1OA 3ASYA 1KNQA 1XX6A 3OHMA 4NCIA 2PALA 1TEXA 3ASZA 2J0UB 3BH7A 4LJAA 1N6KA 2WHXA 2NLNA 4TYWA 2NCPA 2WCBA 1JBKA 2GJKA 2OBNA 3QKSA 4PO1A 1M1YE 1WMSA 3HCMA 3HR8A 3QENA 2K5UA 3U3JA 5TDHA 3OB2B 3QY0A 2ZYVX 5P21A 4BLSA 2KSQA 3RSOA 5DISB 4EPYA 1OOJA 3PG5A 2C99A 4N3NA 4IFBA 1PRWA 5BN3A 2HLDD 3BS4A 3PUWA 4DLTA 2VBCA 1GUAA 5DYGA 1TNXA 2XXAB 2ZRSA 2JLSA 2V4ZA 2V7QD 2AUCA 2KFHA 2N1BA 1E2EA 1Z0FA 2V6IA 4B47A 3SJSA 3TQCA 3RS7A 1ETUA 1DG3A 2FE4A 3IQWA 4FIDA 4JL5A 2F1IA 3THWB 1DJYA 3QF7A 2IYUA 1ZUHA 3AKCA 1RPZA 1VCNA 1IXRC 2V55B 4AQIA 1CFPA 2UZIR 3H4MA 3HU2A 3UMRA 1HE8B 4N1FA 1TU3A 2EWWA 3VR2A 1U5IA 1KSJA 3T1VA 4E07A 3ND8A 1Z8FA 4DRZA 1N5IA 2O0KA 1WY9A 2QP9X 1GTVA 5LDDC 2BBWA 4GT1A 3SJAA 4GGFC 3CGAA 5DO9A 4PZYA 2ZNDA 2B1UA 1DJZA 1CM4A 4CEJA 1XEFA 2M97A 4NMMA 4JLOA 2EFCB 3ZZ0A 1NY6A 1SR6C 1IXZA 821PA 3FE2A 2FFHA 3AVVA 1ZM2A 5FTJA 2WJIA 1XD2B 5CDFA 1E8AA 3THOA 5HKKA 1T3LA 5LPNA 3IQXA 1NCXA 1C1YA 1N6RA 2ZRKA 1YURA 2Q21A 2BKUA 2LANA 5G53C 4EQ6A 5GJVC 1PVBA 3Q5EA 1KK8C 4C7OB 5D3QA 2Q4UA 2X8AA 3LDAA 2W0MA 2J0UA 2IA5A 1CS4C 4RVCA 5AUPB 4UQOA 3WNXB 4DWJA 2J41A 4EPXA 3CBQA 3SJCA 5B64A 4PQRA 5I2QA 2PT5A 3OE7D 2D62A 3LX5A 1YZNA 3TIFA 5J4VA 1P6XA 1ZD1A 3KKQA 4NP6A 5CIWA 1GNQA 1OYYA 2B21A 4TWZA 3F0TA 1IH0A 3PUVA 1OH8A 2M9GA 3C7KA 2CL6X 2KBIA 3ZIAA 3DVMA 2LLSA 2KYCA 3BOSA 3PEUA 3L43A 2EFDB 1IAQA 2LUCA 1HT9A 2XJ9A 2XXAA 4KBGA 1TOPA 1CJTC 2BBMA 1UHJA 1U8AA 1XTRA 221PA 2B92A 2NO6A 1GFIA 2WJGA 5AWFC 3SNHA 4YMSA 2CE7A 4M53A 1I4LD 4KU4A 4DDUA 1AK8A 3GLGE 5L8VA 1S4QA 1TF5A 2FEOA 3KXLA 4FD2A 4IXMA 1M74A 4G5SA 1KO1A 4QL3A 3THWA 3TRFA 4C9BA 4OQNA 4UXIA 5K8UA 2YOGA 2JOJA 4CYMA 2LLTA 4P2YB 4Q1DA 1DGVA 1R4AA 5EP1A 5G3YA 4A2PA 4ORAB 1QATA 1X1SA 1OPXA 4G1UC 1JPJA 2OFWA 4F92B 5IHPA 2QNRA 3UANA 4B2IA 2JATA 1E2LA 2OG2A 3PV0A 3UIEA 4DSTA 4QKQA 4OK5A 1V1GA 3QKUA 1TF7A 1ONBA 2XSZD 4UJ3A 5CYPA 1IOZA 2JTZA 1JECA 1UBFA 3K0AB 1NP8A 4PAQA 4R2IA 3NIBA 4UNQA 4CDGA 3P4XA 1MKYA 4DLRA 2FMXA 1W36D 3WYAA 3WYGA 1IRJA 3ZH9B 4NL4H 1W2GA 3L2OB 2W83A 2ZRFA 1LFDB 1JSAA 1TQDA 3ADCA 4US1R 1OIWA 3W3ZB 5GVRA 1XD2A 4DT1A 5CB6A 4Q47A 3WHUB 3OEHD 3IO5A 3GFPA 1XMIA 2GEVA 5EXXA 5FL3A 1CTQA 2NPFA 4Q04A 4XYNA 2XTMA 4HLUA 2WMOB 2RGIA 4QM6A 1SVWA 4M2LA 4C7OA 1U81A 2GBLA 1DE0A 1YRAA 3RANA 4P31A 3MCAA 4UXHA 2XITA 2QZ4A 3GJ4A 4A0RA 3HYTA 3LY5A 1IKUA 1L7VC 3EASA 5EJEA 2CTNA 4JKYA 1BODA 1WRKA 1J99A 2CHVA 3BD9A 1ZNYA 4QNRA 1EFUA 3KDSE 3AVWA 2OEPA 3AP3A 5F2EA 1T3SA 1E2MA 2J3EA 3BGWA 1G64A 4LYHA 2MSDB 3FMIA 3VNUA 2AFHE 1TTTA 4Q4JB 3BFKA 3IEUA 5EP4A 4XH9B 2ZYUX 2FV8A 3MFYA 4FCTA 1A1VA 1U94A 3SIAA 1K8UA 2CBLA 2EFEB 2ODNA 2ZETA 4OHXA 2ZM5A 5HCNA 4TTQA 4WAUA 4B32A 4LV5B 2D2EA 4AIIA 1JF2A 2KAYA 4N0EA 1XYDA 1OHHA 1DBSA 1WRZA 2ZPTX 4F4CA 3I5FB 1EFRD 4JKIA 2GAOA 1BMFA 4U00A 3B85A 2RH5A 2XNDA 1QHYA 4TMKA 2G2BA 1SZPA 2HCBA 3IPYA 1WE2A 2H16A 3CRVA 1U8ZA 3GD7A 4GMXA 3R9IA 2AL7A 3GJ3A 1U8YA 4IXNA 3VR6A 4A0HA 1T0JB 4ERNA 1J8MF 2B8TA 1CJMA 3HU1A 1Z0KA 2A5FA 1XFUO 1G291 1OE9B 4J0QA 2MA2A 1NX1A 1PUJA 1LV7A 1NBMD 3B1ZA 2QN6A 2GZAA 3DZDA 3I4LA 3TZ1A 3TDZA 3K0AA 4NYMQ 3T61A 4DIDA 4C2TA 1P4SA 2B7BA 2D4HA 2Z5FA 1CR4A 4B75A 4A8JC 1B4CA 3C5HA 3DOFA 2FFBA 3N2IA 1YUTA 1CB1A 5IRCD 4P4UA 4Z1MA 2XJ4A 4DIRA 3SQWA 2PJRA 4TMZA 1UHKA 2PL3A 2JNFA 2PEYA 1OXSC 4TMWA 1MO4A 2F3RA 1P73A 2QL6A 2ZRHA 2XZPA 4B3BA 2ZQ5A 2ZAOA 5PALA 2GCOB 4GNKA 5DHFA 4IW3B 4A4DA 2HV8A 3VNVA 4BEBA 3K0CA 2OSBA 4F93B 5E3HA 4KI0A 4HLQB 1KKLA 1QBKC 1AIPA 1ZC3A 3AGQA 2FN4A 1VHTA 2CBZA 1R2QA 4WRIA 1ZM9A 3PJRA 3MGCA 3QOFA 1UBGA 2IS1A 4Q1EA 5AJWA 2HQWA 3L0IB 2ZRPA 3NBXX 2P6RA 1KK0A 2J1LA 2ZXUA 2WCEA 2ZTSA 4Q4JA 1XNJA 5FPHA 2ORIA 1X8LA 2LCFA 4PQYA 1RTP1 4DCKA 4H1UA 2QRZA 1FMJA 2OBLA 4LJ8A 3RS3A 3DD4A 5E95A 4A6PA 1ESNA 1F71A 3QXHA 1MOZA 5CB8A 1G5RA 1KMQA 3FOZA 2VTKA 3NXSA 1N5KA 4XVQA 5HE8A 3QKRB 1P7CA 2LVKA 3PN7C 4WQ3A 1P72A 4URVR 5F9HA 1Q20A 1XJ0A 1TQ4A 2IEZA 3BXKA 1GNRA 3HR7A 4WIAA 3TUJC 1ZM7A 2OCPA 1DAEA 4A1FA 1EFCA 2R2AA 4B3CA 4F0ZB 1TX4B 2WZQA 3AGPA 1UBEA 4LK2A 1UM8A 3KQHA 1CBUA 5AEQA 3QPWA 1SVKA 5DLQC 3GJ6A 4YGEB 521PA 2Z83A 3PUZA 1J7PA 1NVVR 1X1RA 1X02A 1Z22A 2AXNA 2QG6A 3W6OA 1XFAA 4M2OA 3NSKA 1KY2A 3TJZA 2FG5A 4AURA 2NZ0A 2QBYB 1XZPA 2PCLA 3GLGB 3EPLA 3TS5C 2IXFA 2WWXA 2A5GA 2ZI6A 1IY0A 3DVEA 5KDOA 1SL8A 1KWOC 4ZDWA 4HLCA 1Z0JA 4Y0VA 3BQ3A 3TDIA 3F8TA 1BU3A 2PEZA 4TQUS 2WSSA 3VROA 2GCOA 3D10A 4NH0A 4D6PA 1Z6YA 3QIAA 2O60A 3X1WA 1L2TA 3U3MA 2ZFDA 4Q19A 3K9NA 1K2HA 1XZQA 2R65A 4JVNA 1W36C 2TMKA 1E0JA 4AQJA 2JDIA 2QSYA 4NONA 4OK3A 2IF2A 2V8OA 4EJSB 1NKSA 3MJHA 3CNLA 1E9AA 3H86A 3LXRA 4L4UA 4HB3A 2D74A 4PHKA 2JLUA 3EPHA 3SEAA 3ECCA 1MO5A 1W5TA 4PCWA 2VHJA 4UXJA 4EDHA 1YU9A 2JLZA 2JIZA 3UKDA 2KE5A 4JPZB 4AI6A 3FGNA 4B48A 2CCGA 1L2OB 2DWQA 1J2JA 1JPNA 4GAOA 3TLXA 1R5BA 1EG3A 3MUFA 2F1JA 3UMFA 3CH5A 2IL1A 2REOA 2GF0A 1NMXA 3NTUA 4MKIA 4CLNA 2RHDA 5GJWC 2PVBA 4A2QA 1TAGA 4DLUA 1OSAA 3LQQA 3QJYA 3LVQE 4FCVA 3I5HB 2XB2A 1G16A 2GKSA 2VH5R 3CO5A 4CT5A 4BZPA 1FTSA 1CXZA 2L98A 1NLFA 2IYSA 3REFA 4YGCB 5C2JB 1GG2A 3JVTB 1KQVA 1SXJB 4RZUA 1G3UA 5JOLA 2CLCX 1HURA 1E9EA 2BBTA 1NJFA 2OLJA 3C5CA 5CK4A 3MG9A 4DRWA 4S2EA 2M29A 3WRXC 2O8BB 1TMKA 1B47A 2ZI3A 2QBYA 3GK4X 4JLJA 3AVQA 4BY5A 3RLFA 1FFHA 1P2SA 4LI0A 3GLGA 1KK3A 4L9MA 1E9DA 1SK6D 1YRUB 4N1AA 2NMVA 3GJ7A 1TQ6A 2XZOA 4GZLA 4MYUA 5FI0B 3AF2A 4LUCA
chains in the Genus database with same CATH superfamily
4EGSA 3NEPX 4IUCS 4RZQA 1KE2A 2BECA 4MUMA 4EJSA 3OLYA 2NGRA 2Q5QA 4PZAA 3HA2A 4R7TA 3W78A 1QS7A 4KWHA 4BLPA 4QU0A 1KO7A 3D1VA 2QUJA 3LC1O 3L4BC 3PQ6A 4YAEA 2Y4NA 5BVHA 4ALMA 3TOXA 3MBIA 4E21A 3MGGA 2YH2A 1WU8A 4QULA 1TKRA 5FOWA 1OI4A 4YMVA 3MWEB 3NBFA 3RIGA 3RNOA 5ALVA 1XA3A 5CA0F 1YWGO 3F1KA 3KWLA 3I9LA 1KEKA 1M1NB 1EHYA 4MV4A 1GP2A 4AUKA 2XCTB 4MKHA 3LUCA 5JNVA 1RXWA 1P75A 3WQQA 1QFZA 4HYEA 1AT1A 3DZGA 5BNTA 2H07A 2FEAA 2XB8A 2VLIA 3DQQA 5BWMA 5L3ZA 1XB2A 1UZNA 2ACKA 5JTUA 1AS2A 4TSFD 2VRBA 4M1OA 2HA7A 4IJQA 4YYZA 2E4WA 2QI9C 3NC4A 4AS2A 3C8UA 3MJVA 3SEQA 4M22A 1FU8A 1V35A 2AKYA 3MWEA 4YROA 4HNGA 4DV0B 3OX3A 1BWSA 5THXA 4KC0A 3VYUB 2EX4A 1LLDA 5FUXA 1M1NA 1TUGA 3UJCA 3VPAA 3CT6A 5ELLA 4S12A 3ROFA 5DCUA 4PR0A 3SR3A 5K2MA 5LUBA 2Q28A 1ZO8A 2FWAA 4D9NA 2Z6AA 3WGHA 1T14A 3HLKA 2JCVA 2EZ9A 4MUAA 2AOWA 3KKMA 1QANA 2ABWA 3WQRA 2JLBA 2DTXA 3A25A 5G40A 1ZN2A 4ZYVA 2ZPAA 3T9BA 5EJAA 5HA5A 1CFJA 3O4FA 4ZT5A 2PR7A 5B4VA 2QRPA 1UT6A 1NYAA 1ENOA 1M67A 4MCHA 4HH0A 1TYBE 2VJDA 3TZCA 3G8AA 1M8FA 4S04A 3DKPA 4L28A 1T3HA 1DTLA 2LP4Y 3JXEA 1C7JA 1LRKA 2FEXA 4KR3A 5AXAA 3R23A 1KBZA 2V9ZA 2R2GA 3EGEA 3N8GA 2YV3A 4K28A 2D5AA 3UH0A 1XQ6A 2ONYA 4ER0A 2EFYA 5HKKD 3I3OA 5CFMA 4LPKA 2H92A 4MS3B 1CQZA 3DO8A 1XMJA 4IIBA 1MCZA 3OFSA 4QTUB 1U0BB 2C1EA 3NM6B 1J1IA 2WC5A 1VKZA 1XEAA 4O59O 4WLFA 4Z8YA 1P1FA 4ARIA 3QM1A 4WOPA 1FS6A 2GJ8A 2XBLA 1ULSA 1A9QA 2CDBA 1J25A 1OY1A 3ZNOA 3SD7A 4A15A 4D56A 2BM1A 1S3GA 2XBUA 1ZNXA 4W8HA 2OV3A 2IXEA 3H1PA 4GWGA 1Z75A 4ZVPA 4W5JA 4MS3A 5T5QA 2EQBA 5CRIA 1T2FA 4RSMA 3AL2A 3UGTA 4CMJA 2DBVO 3IIEA 2H5EA 1QTNA 1TUIA 4Q6WA 1A5SB 1EDOA 3D1JA 4LGVA 4FGKA 1SU6A 2I4LA 4D4JA 1WLSA 2DH5A 3Q0IA 1PK0D 1IVSA 4KJXA 4EOGA 2HTEA 1D7OA 2G63A 3G49A 1EUDB 4ZC8A 2NV2B 1Y8AA 2ZRQA 4IEIA 2P8JA 3ICWA 4PTZA 4PZCA 4OG2A 4RY9A 3LNCA 2KWIA 2DOQA 4P36A 3ISVA 1R6BX 4OGWA 2KLHA 3A4UB 4AWBA 4DR7B 3Q10A 5J59A 3A36A 2GF2A 5FTKA 3AG5A 1WVIA 4GZMA 3U9SA 2G6BA 4YV1A 3ZZ1A 1AKMA 2Y1WA 2ZYSA 4ACAA 4L6CA 1VP9A 2IY8A 5JSQA 3H2BA 2XH8A 4KWTA 2GEKA 2O8NA 3EVVA 5BWBA 3GHHA 2X77A 3T7EA 4HYYA 1EUDA 4MI1A 4MKRA 2QPAA 3LGXA 3FN4A 2DE0X 2HSZA 1JAHA 3BH6A 2W0SA 4KWEA 3LT1A 1YBMA 5C52B 1G0OA 1PI3A 1MR8A 1XTZA 4M0DA 2XA2A 1W7AA 1PS8A 1I0ZA 1U3TA 2HMWA 5JJIA 3UWMA 5ECWA 3AF4A 1ECFA 4IZ6A 2FUG1 2LHIA 4DXDA 2WWHA 3DNFA 2LKDA 1B3RA 2GRUA 5UKDA 4CIBA 1Y5LA 2BF4A 3GVPA 3D6VA 4HR7A 3I1FA 5CLGA 3A9TA 3VPSA 3IAS1 3MPOA 3MTIA 3ZU3A 1JS1X 5JD4A 3WB1A 2O1XA 3AVOA 5HF8A 1MNAA 1YL5A 4PG4A 4F5WA 2ZI7A 1ZH4A 5F64A 1CIJA 2BMJA 3FWNA 5DCLA 1I2CA 4UDNA 3PB3A 2VF8A 4UE2A 3FMVA 3E22B 4RIIA 4XDYA 1V8BA 3AR2A 2VP6A 2R6JA 4OI2A 2G1PA 2ZWPA 4TQ9A 4OYRA 1IIOA 1JUDA 2HRQA 1E32A 1M1XB 4HUQB 3W3AA 2WUFA 2HO4A 3ETCA 1T91A 1Y5IA 1QR2A 1VKHA 3DBHB 3RFTA 6ADHA 1RK9A 3L7DA 1A9SA 3BFPA 4GXTA 3FTQA 4G1BA 4F0JA 4JVMA 4EPRA 3PGJA 3QU5A 1UK7A 1GUYA 4ABYA 1QRTA 3ZE9A 4YAWA 2BCJQ 1BOFA 4OKIA 4B7UA 3L0CA 1QQTA 1X70A 3E22A 5HZGA 1CFZA 4R8RA 4HUJA 1GPWB 5D51S 3OUTA 4BV8A 3RD5A 4PX3A 3IVCA 4Q1CA 3FFXA 3ETDA 3K70C 4AYXA 1JHPA 4AYWA 1HOTA 4D3DA 4HUQA 4QE3A 3F6PA 1CY8A 4NOLA 4BMZA 5FHRA 3GX1A 4LJ9A 3HDJA 3DBHA 1AOXA 1GZSA 1XVVA 3G2OA 3SIWA 2IIBA 1HQCA 2LE0A 4L4RA 3UPTA 2BSXA 2WSIA 4G0XA 4UW9A 5EERA 1HYEA 2AA3A 3H17A 1YR8A 4RULA 5B12A 1APBA 4M6WB 2CKMA 4RY2A 4M54A 1EG4A 2H7VA 4EPTA 3EOBI 3IODA 2DSNA 4J3FA 3S5UA 2O8FB 5L51A 5JO0A 4HNQA 1KI7A 1TMOA 1N9ZA 4D3ZA 3JASB 4PS0A 5FBLB 4KYTA 2QYHA 1EPUA 1E5TA 1USIA 2ZUVA 1SZCA 3W1EA 5E9JA 5E6SB 3W2TA 3DAGA 1XO1A 3UNXA 4NDNE 4HRAA 2PZMA 1W34A 3M5WA 5JS6A 1Y8RB 3WNBA 3UAWA 3G9XA 4M6WA 4TRNA 4BZXA 5JNRA 2KYFA 2HTFA 2BC9A 3IRVA 1X39A 1LA3A 2O8FA 1U5CA 3JSAA 1CVLA 2AR0A 2O3UA 3JASA 3RIXA 2AAOA 5AUOB 3CX3A 2O4CA 2I4IA 3RUIA 2XE6A 4JY7A 3ZDRA 3P32A 1A27A 3ZHYA 3NATA 5E6SA 4BEVA 2ZYDA 4D9MA 3PIRA 4L16A 2PSHA 1V41E 3R4CA 4NYIR 1Y6GA 1VL6A 1XROA 1Y8RA 5CCEA 1YFJA 4CCSA 3ZCUA 1HL3A 2H1HA 3NFYA 1MT3A 5ALFA 4RK5A 4CQMB 3A2MA 2NYUA 2O0HA 5I4CA 1UOPA 1KEUA 5CVJA 2GD2A 2RK4A 4UUPA 5K03A 2B69A 4WE3A 4N3GA 3UT6A 2JAPA 1KJ9A 1WDTA 2XCRB 2ID9A 4TUYF 1XD8A 4LBYA 2COEA 1C7EA 1G2PA 1VYVA 4B46A 2HT1A 3S5JA 1U80A 1NMYA 3CZQA 4YC7A 2I3BA 3B1KA 2VJYA 4CQMA 2MSCB 2H1WA 3VNQA 1QYXA 2OHFA 1FU7A 4JB3A 4DWVA 2P4HX 1UP6A 3CV3A 1AB5A 1Q3HA 4IICA 1FJXA 1NTOA 3GUYA 2DQKA 3FLBA 2C59A 4V0QA 3WLLA 3OZXA 3WMWA 3WK6A 1Y6WA 4HH4A 3I8SA 3RKRA 1Y1PA 4ZN6A 1FOEB 2LMUA 4DCJA 2OENG 3GZ4A 3CS1A 4HBGA 5FAXA 2JGAA 3ZWWA 4GNRA 4L22A 4Z1MD 2QLTA 4TKZA 4FFNA 1OFUX 2WV7A 2RKBA 2ZB7A 3PD7A 1ZVQA 1VIAA 1G6Q1 1PALA 5D87A 1V2HE 1HORA 2V9PA 3WYDA 3U9LA 3I61A 4DQUA 5C8YB 1JQBA 6PFKA 2Z5GA 1I30A 4UMDA 3NBZC 3WHPA 1RRKA 1UPUA 3E5MA 4RM2A 4Z9XA 1E5DA 2HA5A 4DJAA 4HWTA 5CYFA 4KRYA 4KRXA 2H2WA 1C81A 2W8BB 1HDYA 1JFVA 2X9VA 1BWPA 4MIKA 1QGAA 1QNLA 1V71A 2ZP1A 1LRJA 3GK2A 1N65A 1N0HA 1XPRA 2Z8YM 1JHQA 3BA6A 2VKQA 4RDCA 4Z86A 2IHTA 2ATIA 4O3MA 2P78A 2BMDA 3VH2A 5AQEA 3PWSA 1P7WA 3TQQA 1SAYA 3PNMA 1PJSA 4KVZA 3ICQB 2QU7A 2M49B 3M33A 5C8YA 3RIMA 4WZ6A 1GZDA 4AN1A 3NJ4A 2XLBA 4NENB 2X6RA 1ZJJA 1AVTA 3E3NA 3FYUB 3R0XA 4ZKDA 4K2AA 4K6KA 3E35A 3KJEA 3A6GA 5KWJA 2W8BA 4G84A 1VBNA 5H0IA 1JXQA 1UDXA 3AJ8A 1Z83A 3EMVA 3NHFA 3QJGA 1PKEA 3OF3A 1DRWA 1HTWA 1OB5A 4I50B 2EJCA 1CRQA 3CISA 4J4BA 3ILHA 4E13A 2PQ2A 1MIOB 1RRMA 1OZGA 3FCUB 3BWCA 3R0QA 3CUEF 1I4DD 4CF7A 4FGSA 3WDSA 4O0MA 4AUEA 3TBKA 4NENA 1D0IA 2X7XA 3FYUA 5BSFA 4UM5A 3U62A 1J1UA 3KKZA 4NESA 3DXXA 2H8GA 2G40A 5ERGB 4BNJA 5F35A 4RUKA 3ZD7A 5LKAA 1B7GO 3KFXA 5ER5A 1DKPA 2R6GA 1RWBA 5IEJA 2V7TA 3GNQA 2QI9F 3ISTA 4PRKA 3U40A 3AFIA 3ND9A 4I50A 4X1OA 4TXNA 5K99A 3PUXA 4ZQFA 4PLFA 2OV6A 1MIOA 2G83A 2W6QA 4RD6A 1R6PA 2JFOA 4WKOA 3OP4A 3UMYA 5TX7A 4IIUA 3SYKA 1NGSA 1M7HA 4NFLA 4ZVMA 2WILA 5IU6A 2ZSEA 8OHMA 1T5SA 4U5XA 3KBBA 3RS0A 3SZUA 3LVBA 4L7QA 4BQEA 1K5DA 1KI9A 3M8KA 3SZGA 3BMOB 2WJ6A 4PSKA 3TN7A 1PX0A 2ORYA 5IKOA 2PSJA 4EQZA 1IN8A 2C2KA 3D6NB 4TZ0A 3I5YA 1Z0SA 1PDOA 5DGXA 1HDXA 4FQ5A 1C14A 4Y2UA 4K8OA 1DJNA 9GPBA 3Q3HA 2OMEA 5COBA 5AKIA 1C8LA 2MINB 2VPYA 4TS4A 3QFHA 2VQFB 5EKSA 1T5BA 2AEJA 2P3LA 1GSAA 4JI2B 4K46A 2WY2D 3O47A 5F78A 3BMOA 3MMSA 2AW3A 3RC7A 2BUBA 2I8LA 4EA6A 4ILKA 1VA4A 2LC5A 4E22A 3BZWA 3DT9A 5FLXA 3SG2A 2AHOA 3L1HA 3PYXA 5EJ7A 2FR1A 3CR8A 3VMMA 4TWAA 4QO7A 4CEJB 3QWFA 3LBYA 3SDSA 3QZUA 4HMPA 2MINA 2WF5A 1GKYA 4A0GA 4B82A 3ABRB 3PQFA 3TVYA 5BUZA 1KNQA 1XX6A 5CHYA 2PALA 3ASZA 2XYVA 4CR8A 2VZEA 5K0BA 1WJGA 3QHQA 4M60A 2CV2A 2EKBA 3R0ZA 3I6YA 2XI4A 2D7JA 3GDGA 3C7CB 1Q0RA 3PUWA 4IFTA 1KQ3A 1GUAA 5DYGA 1TNXA 4E2XA 2ZRSA 3U3ZA 1V5IA 4MVYA 3AR8A 3QF7A 4JCCA 2P5UA 4N1FA 1TU3A 3I2JA 1Y9JA 4AL4A 1KSJA 3KR0A 1QVZA 1GSOA 4H1TA 1JG1A 4GT1A 4CEJA 1XEFA 1BU8A 5KX5B 1M2NA 4HSGA 2WAAA 2IQ5A 4U0KA 3OQPA 3BSWA 3JVDA 1U2TA 1V7PC 1J9ZA 1M9NA 3PNLA 4RVCA 4UQOA 2J41A 4AQYB 2ZT7A 2OORC 3ULKA 2BN4A 5M7EA 1OYYA 2RHJA 4LJKA 3BOSA 3F67A 9LDTA 5EJ2A 2CE7A 2JFNA 2FJPA 4FNAA 3CABA 1M74A 5KYTA 5CG2A 1TZMA 3OJFA 3RFCA 3C5VA 2LLTA 5G3YA 1IK4A 5KYVA 4F92B 5IHPA 3KLMX 3L8GA 2FCAA 4IH9A 3NIBA 4ECAA 1TRHA 3RTBA 4YB8A 4JOQA 4QARA 5KX5A 4Q47A 3CZMA 1FRQA 2NPFA 2L82A 4HLUA 3U81A 2GBLA 4C7MA 1YBVA 5LIRA 2I4NA 4UVEA 3WJ7A 3D9QX 1JFSA 4ZVOA 2O9JA 1P1KA 5GOTA 3G02A 4K6OA 3EFOB 1OHHA 4ZTBA 1HE2A 5BWCA 4H60A 4CF4A 3AUUA 1EMDA 5BR4A 3GJ3A 1XQVA 1OR8A 4A0HA 3KB6A 4OP2A 4Q3BA 5AI5A 2Z5FA 4A8JC 4ZJYA 1CB1A 5IRCD 3RVRA 2ZQ5A 4CKWB 1KKLA 1QIGA 3E8MA 3Q2KA 1U3GA 4B0PA 2ZTSA 4Z0HO 1PF7E 1XNJA 4K9KA 2ORIA 5FPHA 4DCKA 5DW0A 3IVMA 3FA2A 3FPKA 3LUDA 3EFOA 4WQ3A 3UAVA 2JGIA 5IDYA 1EDEA 1TQ4A 2IEZA 1UKAA 1EFCA 3VSDA 5B2FA 1X1RA 1JHYA 1XFAA 4DMUB 3WK4A 3N07A 3V8QA 5DNVA 1KJJA 4F45A 1RACA 3VROA 2ST1A 4CKWA 2DLDA 1GU1A 1L2TA 1DIRA 4E46A 4NONA 5H9WA 3TKYA 3O95A 5TS2A 4OYLA 5HFJA 3ECCA 4PN3A 4IWXA 2D0OB 1UP4A 4CM9A 5JC1A 2QG4A 1ZUWA 5E1DA 4EP1A 2XUDA 2I2DA 1R5BA 2GEFA 1V16B 3UMFA 2ZCUA 4FCVA 3LVQE 1KXJA 1ZD5A 3N6VA 2AI3A 4I5EA 3W3AD 5DMHA 3W9BA 4AJ1A 2NSYA 1P2SA 3IH5A 1UPXA 4U63A 2NMVA 5F3RA 3COWA 1EBFA 4ZOLB 2HUPA 2KHNA 2FKNA 1DKQA 4AW9A 2YWBA 2IS2A 1Y3HA 4ZV7A 3TUYC 1EE9A 1SD5A 1E2KA 2YJGA 4C0BA 2JXLA 3EZ2A 1G18A 5E9WA 2C61A 5KYNA 1H5NA 3IT2A 2NSLA 4MI3A 1V16A 3WGGA 1B8VA 1DJMA 3CLTD 4OSPA 2FN9A 4B7AA 2BBOA 2DH6A 1FP7A 3AIMA 4D79A 2QTVA 3JD3A 1NW7A 2HCFA 4QAQA 1TIZA 4LHEA 1WX1A 1NU6A 2BFMA 4IJ7A 1R4MB 3PSRA 4P4LA 1JLMA 1A3CA 4EB6B 4PPFA 3PNQA 2FWRA 1B9AA 3ZVMA 2QQ0A 4D45A 5DOVA 3NHTA 2GETA 4KO8A 1BEEA 1SZJG 2JAQA 2UVQA 1ONNA 2XKJE 2YZGA 3L7NA 4RTNA 1YBHA 1ADJA 4C1BA 4TLMB 5LQSA 4O4IB 3L0YA 1R4MA 1EHCA 4XOUA 3ROKA 4EB6A 2BGKA 3H4IA 5ALJA 1ZM4A 3CXRA 3B6ZA 1C9MA 3KR1A 4V3BA 2BGMA 3U4DA 2JIBA 4ME6A 1IG0A 1GR1A 5LB2A 3P27A 5EP3A 1PFQA 1RKBA 3UKOA 3IMFA 2EKDA 2OK7A 4MZKA 1AMOA 2J31A 3MXTA 1DF0B 4KQIA 4XCXA 1G0NA 3LA8A 1Q7TA 1S8FA 1ALWA 1QRSA 2X0FA 2CJWB 4NF2A 3C1VA 1QIHA 4RZHA 4O4IA 5JLJA 1S96A 5EY5B 2Q0QA 1IN4A 1Y1AA 1W9MA 1S8AA 5ICEA 1CQPA 1U0JA 5CCDA 2WB2A 1H2ZA 3E15A 4EG0A 2A92A 3MQ4A 5GMOA 3C1UA 1DF0A 1JUOA 4BVFA 1DO0A 5KQSA 2CJWA 1ZD3A 4D43A 1SKMA 1U8TA 3GMIA 4YGAA 3KQQA 2KNEA 4OQQA 3AVVA 5F2NA 1K3FA 4IVNA 1UXGA 1KS2A 1ZMXA 4GFDA 5AOAA 5KKNB 1FP2A 5J4LA 2FWPA 4TXJA 4TTAA 2XCLA 4AO6A 3H2ZA 4C2AA 3E70C 3CUKA 3QLEA 1QF6A 4RQBA 3ZCQA 4EATA 1XA5A 5LBIA 2C4HA 1N7IA 1O4VA 4G3XA 3CZAA 3B6KA 1MWNA 4CV2A 1S5PA 1XPUA 1SY7A 1US8B 4RCYA 3EAQA 4BFUA 4DV4B 1YB1A 5DICA 5GVSA 1JFFA 3LFHA 3WXMA 1TJYA 3NHBA 2VTBB 3EEBA 4DMLA 5C5IA 5EJ5A 4XIIA 3L41A 1FPQA 2QMZA 5LD2C 2EW1A 2F3TA 5ENDA 1NF9A 1CR1A 3OU6A 3HKDB 3LK1A 4KQ1A 3Q88A 2JLWA 5FHQA 2B2CA 3DJFA 4PZEA 3ZWBA 4ACBA 3AKAA 2M7LA 3I3SR 4X93A 5HVNA 3E2PA 2JFXA 3E8XA 4DC9A 1MH9A 4Q3EA 4A92A 3LC2O 5D5PA 1PZNA 4K40A 5HKLA 2ICAA 2ONJA 1US8A 4EG6A 3EEQA 4LHXA 1H4SA 2ILTA 5J4HA 4P22A 2PWBA 4B8ZA 4L6AA 1UBCA 2VTBA 1B42A 2I3GA 2ZBDA 3IP1A 3LHFA 2FR8C 3HKDA 4PIVA 4JEUA 1ZK2A 4YRJA 2TN4A 2ZI4A 1LQUA 3HNRA 4EF4A 4Z54A 3OJXA 2JC3A 1C9JA 3E82A 2A3NA 3OCYA 3NHZA 4XGNA 4QXQA 4H7DA 1CVRA 1OGIA 4D57A 4P3YA 4RL6A 1SK9A 2IH4A 4X6XA 4IUBS 3ROGA 1MZPA 2RJ3A 1NNEA 1UMDB 1CRZA 5KVVA 2IPXA 4MH0R 1NAIA 1AUOA 4N3AA 2GEDA 2OCXA 4LCBA 2PMKA 4H77A 4FFLA 3KYIB 2HFKA 3DZCA 3FPEA 4X6UA 2GBIA 1HNNA 5HKBA 2MWMA 4N3CA 2IVZA 1H93A 4WCDA 4M1TA 1YZLA 1FYWA 5KC8A 1DRUA 1VPVA 5I9BA 3AIIA 5IG2A 4KNYA 1TPYA 1X7GA 1LINA 2BE4A 4M8NE 2QNBA 4IMRA 1JBAA 3BBLA 1T9GR 3X1JA 3IBTA 1UMDA 4IUYA 3X43A 4D1EA 1MF7A 2AXQA 1JMYA 3E4DA 3IDFA 4MVJA 5EXDA 3TLYA 1U9YA 2KYRA 3QA3E 2YX1A 3ZWCA 2F59A 2RHOA 3WY9A 3WRYC 5DBFA 1MQ1A 4YUAA 3CWZA 3IAAA 2JFUA 4PQGA 3I5UA 2IBTA 3S7TA 1AGPA 2DUWA 5EGSA 4BBAA 4O2BB 3NV7A 3K0BA 2QTLA 4R54A 2P9QA 3BGIA 1EEXB 2B5WA 3DWEX 5JXJA 1EFVB 1U7DA 3L5KA 4RD1A 4XEUA 5TQVA 1FRVA 4LSWA 3GG2A 2DGDA 3TAUA 1CUJA 3KE8A 1G6HA 4F12A 3KTDA 4QJIA 4GYYA 4G36A 2NZVG 3KDAA 4CLXA 4IHQA 2YV2A 4FLMA 1GDHA 5AKJA 3P5SA 1B93A 1C3OB 5HBGA 3KJXA 1OSNA 4A0QA 5T8KC 1IJFA 3CSSA 3NJRA 5FADA 4O2BA 4CFSA 4ED9A 3EPRA 1Q5PA 2PA0A 1SBHA 1DFGA 2KSPA 3TR6A 3U56A 2QMHA 4BX8A 1J2YA 4WXPA 1MR3F 3W5DA 1EFVA 5GZ6A 1GGWA 1L8XA 4YDRA 1RLMA 4G1EB 3HEAA 1RC0A 3L5OA 4YO8A 3U7JA 3AJRA 2LRHA 1AO0A 3QBDA 3IV6A 1K95A 1YK1A 1RHQA 4JD9A 3EQ2A 3WYBA 4MYCA 1C3OA 5CNIA 2B4KA 3AHHA 1UJMA 1E1QA 1Q6YA 1W5AA 2ZJFA 3VOTA 4QWWA 2OM6A 1S02A 2WAOA 1Z88A 4NYMR 2XODA 3B1XA 3H8SA 5DBOA 2C4TA 2C7BA 1TZKA 4UU7A 1GAXA 3ML1A 4KR7A 3NUGA 2R79A 2ZUBA 4X3CA 1N6LA 5CB4B 3LQ1A 1ORGA 1WDMA 4UFPA 1MW9X 3SX0A 2XVZA 4LBWA 1K92A 2RCNA 3EWNA 1KOLA 1E69A 1A9TA 2VRGA 1K1EA 2QORA 4FDLA 3WAGA 2FEWB 2UYQA 4WV3A 1OH6A 1Y1RA 1WW2A 3WYFA 4HKTA 1R66A 4GPTA 4I4IA 1KQFA 5T41A 3T7JA 4DQVA 2L2EA 1GZ6A 3KKPA 4G5QA 2C2XA 3MOSA 3RROA 1BGWA 4I99A 1GTMA 4OHBA 4KH1A 3ZW8A 4YASA 2ZI5A 1OWLA 5ALDA 4TVOA 5ICMA 5CB4A 4XQEA 3VTFA 1MAWA 4ZU3A 2XB9A 4H59A 1TJPB 3ADPA 4JA0A 1XRSB 3WO0A 4FFPA 1U1CA 4YRMA 1S1MA 4G1CA 1XLTA 4RLHA 1KWOB 1R9NA 1V6CA 1FL9A 1FX0B 1Z5VA 2NSJA 5KDLA 1P0PA 2PL9A 2YOFA 1P0QA 1W36B 4DV7B 4YO7A 3E3RA 4C7XA 1ATIA 1E3TA 2GILA 4EEZA 5C37A 1H0SA 4G0YA 3UO8B 4CTOA 3OT5A 3PPXA 1UWOA 3EUFA 4OYHA 3D8UA 4K9RA 3BH0A 3EK7A 3UBTA 5CLLA 3IQEA 1HDEA 4RXMA 2HEIA 3BE6A 1I1OA 3V7YA 1XO5A 4BS9A 7REQB 2ZSUA 1VMIA 5ES3A 3LWNA 3JWPA 3TZBA 3THYB 2HV9A 5BSWA 1FX0A 2QTNA 1EK0A 1T9DA 4JLWA 2IE0A 3U09A 1U7HA 1F0YA 2YC2C 3RRMA 4XUDA 2DMRA 2Y1KA 3MWKA 3NQ41 2C82A 4OI4A 5DGDA 3EVCA 4YCLA 4RTPA 5ILOA 4DQ0A 4USLA 2IYPA 1S1CA 2MYUA 3OMLA 4IF6A 4PC6A 7REQA 1J0CA 2EW2A 3A3KA 4MHTA 2J4CA 1P74A 1K90D 5JS7A 2XR1A 1Q80A 3WC4A 3LO5A 4MB0A 3THYA 1JZTA 4RJJA</