4C0KA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one calcium ion (ca-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0kA03
1TUIA 2ZU0C 3NBXX 5HLOA 2A5DA 1AK8A 1KK3A 4UXJA 1TTXA 5LB2A 4LWZA 4FQOA 5HKKA 1ZU5A 1MQ1A 4V0OA 2PRUA 1G3UA 3QBTA 4CFQA 3AB3A 1OLOA 3AVWA 1ELOA 2HLDA 1UUSA 2EQBA 5GJCA 2OXCA 3B1ZA 2ZRLA 4KFUA 1BR4B 3GFOA 4Z8YA 4KYUA 3THXA 4TNCA 4Q00A 3C41J 1Z8FA 1YR6A 2IX3A 3C7KA 2CHVA 1X6VA 2NIPA 5G41A 1SR6C 2ZI4A 3B85A 4UNRA 5LPNA 1N0WA 2W2TA 1GILA 1QHHB 3Q3JB 1WE2A 3OAAA 3DD4A 4MDEA 2E6WA 3Q5DA 1XFWO 5JHGB 2GCOB 2GEDA 4EIWA 1Z0IA 3PJRA 1XD2A 5F3WB 4JLPA 1KNXA 4OQLA 2W6JA 2WJIA 4DUGD 4EPYA 4IVQA 2PZGA 1UHNA 3DPUA 2Q91A 2FH5B 4C0SA 2F6RA 5JJIA 1TEXA 1L4YA 1YUSA 2K5UA 3MUFA 5GJVC 4BE7B 2G9NA 3KKNA 2VSOA 2QI9C 3EC2A 2VHTA 1I4TD 3RYTC 3CH5A 2GF9A 4EFNA 1J7QA 3SDZA 4BEBA 2OT3B 5GVSA 3GLGA 4I5KA 2G6BA 3A4NA 3NEJA 4P0TA 4A2QA 2ZS9A 2FFBA 4RFVA 4ZCIA 4C30A 5JEEA 4QGHA 4RFSB 3OP0A 1AM4D 1G6OA 1NLFA 2JULA 1DADA 1G33A 1WP9A 2RH5A 1GGWA 2OLKA 2WHXA 3AF2A 4RD2A 3GJ4A 3TSOA 4AKGA 1NIJA 5FBWB 4BLSA 4ZIRB 5CDFE 1M74A 1QV1A 4YGEB 1QVAA 3NBFA 3T5GA 4JYCA 1BF5A 4M22A 1KMQA 1LA0A 1Q21A 3GLIE 1EFTA 1GIAA 2NO9A 2L4IA 2RGIA 5JS7A 3U5ZB 4OR9B 4IKEA 2O8CA 2CNPA 5H70A 2MRDA 1F70A 2A5FA 5FTMA 4HB4A 2QPTA 2JZIA 1P9NA 1VCOA 3MWLA 3AKCA 3QPWA 5FBRB 2ZRHA 3V9PA 3O6BA 1G5PA 3F3YA 2CCJA 3KQNA 1WBBA 2VHUA 4KAXA 3X2SA 5PALA 4B76A 5JJLA 4QBHA 1NX0A 2F33A 3EVUA 1R0YA 4DIRA 3BUOB 1Q20A 1KAOA 4Q9JA 1DVRA 1L4UA 2X2FA 4NP6A 4XYNA 2NMVA 3K0FB 2C78A 4TMXA 1ZNZA 1I2DA 2YHSA 2F1HA 4IEIA 1NVVQ 2WM9B 1SPYA 3NC1C 4B2PA 3U44A 5L3VA 1T0JB 1X1RA 3U44B 1XZQA 1KI3A 3RS7A 1KFXL 1CLBA 4NYIR 4LBWA 2FWRA 4Q4HA 1U9IA 3ZD6A 4DEYA 3LLEA 3B1XA 2JT3A 2WJVA 2LMVA 1DJHA 1XZPA 4GSYA 1FZQA 1ZIOA 1PJRA 4DLSA 4I1VA 1XA5A 2ISDA 2ZN8A 3GJ3A 2Z5FA 3U3OA 1QRAA 1TAGA 4LJ8A 5AANA 2HJVA 1KKLA 4QBFA 3GP8A 1KSJA 3TZ1A 1XTSA 3SYLA 1A2KC 1GKIA 1BG1A 1EXRA 1KK8B 1E69A 2VF7A 1JR3E 1J1DA 2OUKA 5ER5A 3FIAA 3OIYA 1DAGA 4UJ5A 5DYGA 1NCYA 4KFSA 4GNKA 2BMDA 2BIFA 1MXLC 1C9KA 5C2JB 5FOSA 3E70C 3NDPA 1XXHA 3QPVA 3RNLA 2VHCA 4Q01A 2Q0HA 4UPGA 1OPXA 2FZ4A 2ZUCA 4ILEA 3U7EB 3I73A 4D25A 4JBXA 1XMIA 3FE2A 1XPUA 821PA 1CDLA 3TAUA 1KI8A 1DAMA 4G0NA 4J0QA 1US8A 4TYYA 2OZEA 3UKDA 1HEIA 2QSZA 3GEEA 2LAPA 4MEWA 1WF3A 5I8NA 3C14C 3IPYA 1LXFC 4S2EA 2J0UA 5FH9A 3W6OA 1QX5B 4UQOA 2XTMA 1UBGA 3H1TA 5FPKA 3QSYA 4AQIA 3CNLA 1XXHE 1PV4A 1FMLA 1BJFA 2ZE7A 3KKOA 3WP1B 4AY2A 2YOHA 3W6NA 3SOPA 3I5IB 1R6BX 2CL6X 4JBYA 5AXIA 4N1FA 2BM0A 1WA5A 1M45A 1QVRA 3I72A 1AGPA 5G40A 2ZKMX 3KEVA 1CULC 4U5XA 1U8AA 1G3MA 1ZINA 1SCMB 1PLKA 2GGZA 3C15C 4JLKA 4Q4JB 3FOZA 2BWJA 2QP4A 2QT1A 3SHWA 1EFRA 3LK0A 1KZGB 4FWTA 4RCZA 1M7GA 1YURA 3NBYC 4DLUA 2DBYA 2WTUA 1N0YA 2KNEA 1KI9A 2EC6B 3I5IC 1XCMA 2IK8A 2F2OA 2W0SA 1P7CA 2YC2C 4R7ZA 2JTTA 2VF8A 4QJ3A 2YWHA 2KQ6A 1K5GA 2KOTA 3W8NA 1NCXA 5I2QA 5JRJA 4DIDA 5KYKA 2OS8B 4PALA 4Q4JA 4F4CA 3SFZA 3CR8A 3TUZC 1Z08A 1XTJA 2OBLA 3P26A 2DY1A 4C0QC 4HAZA 1M31A 3LW8A 3SJSA 1CRPA 3GFTA 4WXRA 1MKYA 4URVR 3O4YA 2ZJ8A 5IDVA 3ADKA 3WYGA 3BH6A 5CDFA 3THOA 1QJTA 2ODEA 3BAFA 3BK7A 1ZNXA 4EFLA 4BGDA 1G9XA 2FE4A 3H86A 3SBDA 1R0XA 1FPMA 2CVHA 5HKKD 3EX7C 4DDWA 1SVIA 1ZMXA 1H8BA 1K8UA 2ZR0A 4PC1A 1E9EA 2QM8A 3WRYC 3NSKA 5EQTA 3FFBA 4XTRA 4QNRA 4AURA 4V0LA 5E95A 3WNCA 2GCOA 3AF3A 5EE3A 4QXAA 1U5IA 2QNRA 1KMHB 1IXZA 1NVVR 2MSEB 2PMKA 2YJTD 4BWYA 5LD2C 5DNYB 5KSPA 1TU3A 1WRZA 3K0AA 1JXOA 1N5IA 4B6FA 3ASYA 3ND8A 1DAKA 2ZRDA 3WBJA 3OHMA 1T3HA 4YGAA 4KCGA 4E68A 2XXAB 5J4KA 3AVOA 5ANRB 3C1VA 1YHNA 4JT2A 2OO7A 3PLFB 3RWMB 5SZJA 2NOAA 2ZU6A 4A1FA 5AJVB 3R8FA 3VKHA 3NEYA 1NLYA 1RZ3A 1VECA 4YGCB 3DOFA 1ZM9A 2W58A 1N6KA 1BU3A 1YKSA 1CLMA 4PQYA 1NP6A 2OCBA 4M1OA 3BUWB 5JSZA 1XF9A 1GNQA 1L7ZA 1RE0A 4G5OA 2DWPA 2WC8A 1KZ7B 2OILA 4ASUA 5F9FA 4FCWA 1E2DA 1OYYA 3WHKA 1NL3A 3AH8A 1EX6A 2NO6A 1JALA 5A0FA 3OEEA 4M1TA 1XBTA 2GV5A 2L0XA 1OXUA 3A4MA 4DUGA 2CJWB 1P75A 4TQUS 4BRWA 4BFUA 1ZFSA 1G3IA 4WW0A 1N65A 2EYUA 4II7A 4M1MA 4ZKDA 1EL4A 2C04A 1MF8B 3M0EA 3BWDD 4D2IA 1P5ZB 5DN6D 4I1UA 4ZCVA 1G5TA 3OESA 4L16A 4DCKA 4KI0A 3ZGXA 4E22A 1IJ6A 4QBGB 4AWXA 4BLOA 2ZSAA 4JWQA 5FL7D 3HX4A 4HDOB 5E7MA 1XTKA 2P5SA 3KPXA 2XNSA 2R44A 3IUYA 4NKRA 3WHTB 3EARA 2EWWA 3H0KA 1XFZO 4LSGA 8OHMA 2BBSA 1ZRHA 1SCMC 3P1JA 5CYOA 3TMKA 4C4PA 2FU5C 2N42A 3I92A 4G5GA 4NYJR 4LOAA 1MO5A 2BJVA 2V8OA 3ADDA 1WRKA 2K7OA 1LY1A 1JFKA 5FOXA 3IF7A 2SASA 2W0MA 4MUAA 1R2QA 3H4SE 4BZXA 2ZM5A 2LMUA 4GFTA 3AVUA 1W4BA 4BLQA 2GF0A 1JR3D 2RHMA 3JZAA 5L8VA 1KFXS 3BERA 5CIWA 5DI3A 2GKSA 4TYNA 3AM1A 2KBEA 1KK7Z 721PA 1N25A 3GQBA 3IO5A 4TMWA 1EWRA 2QACA 4XJKB 1U9IC 1H8EA 1WLZA 1DAHA 2BJWA 2DCUA 4YC7A 5SZKB 4XJKA 1RRGA 4JT4A 1O3YA 1KY3A 4QGFA 4LC0A 1PSRA 3O47A 4PZZA 4UNQA 1ALWA 2M0RA 2KI4B 4NMMA 1E9RA 1OIWA 2AMIA 1G3RA 3WHLA 1SVMA 4OI1A 2XJ9A 2VHQA 1D5CA 1W1WA 1AKYA 2QBYB 4JL6A 4Z51A 3CR4X 1IQ5A 2ZJ2A 4Q7JB 5J4VA 4V0ME 4PZLA 4YI8A 4HSZA 2JPTA 2WJGA 2DR3A 2FGKA 4DCUA 2LVKA 1N0UA 2LLSA 4W5JA 1XNJA 3CW2A 2XNDA 1XJ0A 4MRPA 4ON9A 1GKYA 2QENA 1VRKA 3V4FA 3I8XA 1GSIA 1DJYA 1UKZA 3KXLA 4WXPA 1WXQA 3SI7A 2DFNA 1M39A 1S3SA 1TQ4A 3O8CA 1OXXK 3CRVA 1S5GY 3R7WA 5K8UA 2FEMA 2R9VA 2ZRPA 4PHKA 4DUQA 3AAJA 1GNRA 1HURA 1TEVA 1Z6YA 2W6ID 1PRWA 1IN4A 5DH9A 4BFZA 1E2GA 4YMSA 2AWOA 3H4MA 3K09A 3NXAA 3K0AB 1XWIA 2JGNA 3B5JA 3QRXA 2GNOA 4LX0A 5EXTA 4AG6A 2G1KA 2XB2A 2R8RA 3DF0A 4R2IA 5FUXA 4DS7A 1IQPA 4X8HA 1PVAA 2KI6C 2HXSA 1Z6TA 2YYZA 4HYYA 4QJ4B 4PO8A 2CJWA 4GOKA 1LKJA 4XVRA 4OV2A 2VP2A 2JQ6A 2P65A 4BFVA 4Q04A 1Z29A 5IF9A 3D8BA 1U0HC 4CT4B 3SE0A 1TQ2A 2FA9A 3C8UA 3HWSA 1TL7C 4NPHA 2O0JA 1DO0A 1L2TA 2JDID 4Q4AA 1G8HA 3BH0A 1NN1A 5CK4A 3RRZA 5L3SB 2PZEA 1CIPA 2YOGA 1G5RA 5AK0A 4CZ2A 2FJUB 3ASZA 3GD7A 2PX3A 2P5TB 4TMVA 1Z83A 4OKHA 1PLJA 4HAWA 4IXMA 2AKYA 2Y5IA 5FR2A 5H68A 3UXMA 3LW7A 3RANA 1XFXO 2C99A 1CTRA 5FFMA 3L0IB 3MLEA 3GLGB 1HH4A 3CWZA 2XOKD 1WCV1 2JDIA 2Q3HA 1UKEA 2QTFA 1CM4A 2GXUA 3AUXA 2PJZA 2NZ0A 2GVDC 1ZJ6A 1YVHA 3EK4A 2C95A 2BC9A 3RRYA 1Y0VH 1HT1E 3EKHA 1G3QA 1FUKA 1ZUNB 1T4GA 3NKVA 2K0JA 3CZQA 1R8QA 1ZNYA 3QF4A 4PAQA 2GAOA 3CR5X 3THYA 3MSXA 1NX2A 3TE6A 4YONB 5LDDC 2OM2A 1LFDB 1VMAA 2WIBA 1R0WA 3C16C 4TLBA 2CCKA 3TVDA 2FF7A 1AJ4A 1BS1A 2JAQA 3AKEA 5HCNA 4BASA 1GGZA 2BCBA 2CLCX 3FMPB 4CF7A 4B3BA 2MMGA 1SL8A 1XXHB 2MLFC 5HKZA 4M1YA 4MGKR 2C9YA 3DEFA 2MLEC 3T15A 3ZZUA 1B9AA 3L8YA 3O8RA 1E2KA 2DFTA 2FN4A 2YOFA 1DO2A 1C07A 4Y0AA 3GLIB 5HE8A 4ORCB 3K8YA 2XZLA 3F45A 1IY2A 1A4RA 2IYLD 1GL9B 4BLRA 4UNSA 2LNKA 2V4ZA 2F1RA 1Y1AA 3IIKA 4TMZA 3CWQA 2IEYA 3VR3A 1ZM3A 2J7KA 3DZ8A 4HAYA 3QXSA 1FP7A 3EZ2A 4PHTA 1UHHA 1DJGA 3LXXA 1KDOA 3WMFA 1JI0A 2KAVA 1J90A 1SKTA 4IFBA 4KBGA 4Q4HB 1RC8A 1TX4B 1QIVA 1M2OB 1XMVA 1IN5A 3VU9A 1P3JA 3VX4A 2K2FA 2HV8A 1ZC3A 1ANKA 4B71A 4XWKA 3KFXA 5L3QA 3K0CC 1RTP1 4NCJA 1KI6B 5B57C 4QGAA 4QJ5B 1QS7A 2BKIB 3A1WA 4C7OB 1KI6A 1TADA 4HLQB 1F48A 1M7BA 2YVUA 1TCFA 2ONJA 5I2OA 3E3RA 3FHCB 4L4UA 3MWYW 4MYCA 4XWAA 3KKMA 4CIDA 2WORA 1S6CA 4RZ3A 2A3RA 3EZ9A 3ZZ0A 2WWYA 5FYXA 4Q1BA 1JWDA 3EIQA 1G21E 5DI9A 2BOVA 3EWSA 4OI4A 4RKFA 4FMBB 2H1LA 3GJXC 1E94E 2LMTA 1G19A 3AGPA 1E1RA 4KO8A 4OQMA 1XFUO 4MKFA 4M4SA 2KYFA 4P4TA 5D3MA 2JLSA 1N2DA 2H17A 1AS3A 1GQMA 1TUEA 3CB4A 2VP6A 5GQQC 4HZUA 3TSWA 3X1ZA 4DDVA 4QBIA 2ERYA 2GXQA 1A29A 2WZQA 1XEWX 2KDHA 2IYSA 2K7DA 2ZNEA 4A92A 5EXSA 3LV8A 1TNWA 5IHPA 1JQLB 2YWFA 1RFLA 3QNUA 1G8IA 3BFXA 1B47A 2CVFA 2IEZA 3CNNA 5TB5A 1CJMA 1O87A 2QQ0A 2WWWA 2M1UA 2O0KA 4FMCB 5E7IA 4BFXA 1FI6A 4ERNA 5JI3E 1VCIA 3IIJA 1EFUA 4MDFA 1U5IB 1P62B 2V6IA 2WMNB 3CIOA 4Q21A 4U7DA 2P0EA 3MAAC 1F60A 2ZRCA 4EFMA 2EFCB 1OSAA 2G2BA 1OXTA 1T8TA 3QKSA 2AL7A 4AYXA 3SG7A 1G17A 4PC2A 3W5IA 2XZPA 1IQ3A 3FFAA 1OSNA 4NE2A 2J0QA 1IAQA 4DLWA 4GI7A 3AQ4A 4YXWA 1AHRA 1NVXQ 4JJZA 5DIFA 2ZE5A 1XCPA 1G4UR 1II8B 1G16A 2QBYA 2ZRAA 3OIVA 4TN1A 3CF6R 1KK8C 2QTVB 3ZS9A 3A1TA 1J2JA 4O0MA 5FUWA 3UATA 3K9NA 2KBMA 1T91A 2LLTA 4R9UC 2F2PA 3MCAA 1U98A 4LYFA 5HZHA 1D8TA 1KJWA 4DIEA 1JBKA 1ONBA 5BN3A 3TS5C 1SVLA 2GJAA 3N70A 3RS3A 1JEEA 2R6FA 3GJ5A 4NU0A 4PSAA 5DLQC 3X1XA 5IT5A 4OVNF 4QC2A 3BFVA 2QPOA 1FX0A 4DCVA 4NH0A 4UKDA 1NNEA 2PEZA 4RZ2A 4B48A 2HQ8A 3PITA 4HUQB 3U60B 3PUVA 4KV9A 1G7SA 1BH2A 2VP9A 4RKEA 4LJ6A 5AUOB 3PEYA 3NSIA 4FMDF 1TN4A 2OEPA 3U3RA 3KFVA 5AUNB 5BN5A 5K8IA 1OB2A 3TBKA 4PO1A 2IWHA 2HT1A 3I4LA 4JJKA 2PH1A 3BGWA 4LBVA 2QORA 2DB3A 3TUYC 2A5YB 5A5GA 4Q9IA 1M6NA 4JL5A 2ZNDA 3UPUA 1CB1A 1C7WA 1DTSA 3X1DA 2TMKA 3SQXA 1A5TA 3REGA 1LTQA 4MVFA 4UNPA 3BOWB 1FL9A 2BCGY 4JLDA 4CFRA 3AF1A 2KAXA 5C18A 1W47A 4TL6A 2NZ8A 2MSCB 1LF5A 4BFTA 1SKYB 1KO7A 1CKEA 3AUYA 4RZXA 2WJJA 4HB3A 4V0NA 5EP4A 2FDCA 1EFRD 4PQFA 2RGNC 3SG6A 3W3AA 4D0GA 1GRRA 1GJYA 2IYXA 3EG5A 5BN4A 2PALA 2LCPA 2ZJYA 3IHWA 4HEJA 2O8EB 1ZUHA 2RGBA 1JF0A 5CK5A 3GJ8A 4MRYA 2C8VA 3A36A 4M1WA 1UAAA 1W4CA 3SEAA 2R2AA 3MWKA 3VR6A 4IVRA 1G7TA 5E7JA 1EWQA 1A75A 3E5HA 1K9UA 4XH9B 1UJ2A 1A75B 3D10A 1FFHA 3RVBA 5JRZA 1OKKA 4EJSA 4B43A 5JWOA 5TY0A 1GOTA 4JYBA 5JHHB 3DHWC 5CLQA 4U02A 3K09C 3ZQ6A 5D3MB 1KI4A 3MRSA 3TRFA 2H92A 3GJ7A 2IYWA 2BKHB 4KLNA 3N5CA 2QMEA 3D7MA 2BBNA 1DAFA 1E0KA 1SXJC 5HLVA 1NKTA 3DM5A 1J8YF 2QE7A 4AOMA 3PUZA 4TMKA 4L9SA 4DLVA 4HSEA 3EC1A 3CZTX 3HCMA 2IT1A 2M3WA 5CM8B 1F2UA 1ALVA 1J55A 3NSLA 1AK2A 1IH0A 3QF4B 2ZRIA 2KI4C 2ANCA 5FBVB 3RRNA 4LRWA 3SIAA 2BBMA 4OCIA 1E9AA 1GG2A 2WKQA 2RB4A 1UADA 1Z07A 3QKSB 1F71A 4LDJA 4ZI2A 2IS2A 4YLGA 3TAHA 2OBMA 1K5DA 2PT7A 1UKVY 1ZD9A 3HU1A 2F43B 4IOJA 1TNQA 3RDPA 1OH5A 5CPVA 3FHTA 4K8OA 5GJWC 3U7GA 5M04A 2FOTA 1KY2A 2WOOA 2BMFA 1E2NA 1EJ3A 2E9SA 2MMCA 4LJ5A 1KHTA 4YMVA 2JCSA 3KXKA 1H65A 1SHZA 2O5GA 2KJQA 3A58B 2FX3A 1KNQA 1NIWA 2WPDD 3QY0A 4IHQA 2IXEA 4OK3A 5BYKA 5C4MA 4PE7A 3FMOB 1EK0A 4O2LA 1M8PA 1S2MA 2W83A 3B1WA 2CHQA 1CR1A 1S1EA 4YXWD 4FI3C 1NSHA 2NGRA 3Q8XB 1AS2A 4BQSA 5H1YA 2AWNA 4ITRC 1B1GA 1CMFA 3TNFA 1COWA 2XNDD 3AKDA 5E3HA 4E5UA 1JB1A 4IDHA 2ERXA 3FKSD 3KZ1E 4QHSA 1AZTA 2Y1NA 3SS8A 1OH6A 2GILA 3PV0A 1KQMB 4FMDB 2WPDA 5AFPA 2HEIA 3ZIAA 1Y3AA 1OHHA 2OCPA 1AJEA 3JZMA 1RRCA 1FQKA 4V03A 5FPSA 3W5JA 2AR7A 1S9HA 2CMKA 1TQDA 4PPFA 4KFTA 2J87A 1MABA 4JLBA 1IM2A 1B8RA 1YR5A 1P2UA 1YRBA 4YDHB 2QGZA 4KU4A 4TLCA 4Q9KA 2KI6D 2JTZA 4P4UA 1EESA 5HE9A 1CJVC 2BMJA 3GPLA 4HRGA 1X1SA 3ECCA 1C1YA 3W90A 2CL7X 5GVRA 1ZU4A 4HDQB 3I32A 4P32A 4C0HA 1RPZA 2GCNA 3QVVA 2BCAA 4NCIA 2QA5A 3PUYA 5F98A 3RSLA 3LBHA 1LF0A 3QOFA 3GOFA 1T3SA 1NMYA 4GAOA 4PDZA 1FOEB 2HYDA 1TCOB 1OYWA 1W5TA 2VSXA 3G5UA 3TUJC 4FIDA 1NN3A 3WBKA 1W0KD 5BYJA 3VX3A 3B6EA 2MSDB 3JVTC 1XU4A 4MZLA 1KIMA 1TQ6A 2Q21A 2O0HA 3LVRE 2H57A 2LUXA 4MGZR 1PSBA 3GFPA 1J7KA 4TZ0A 3TQCA 2JA1A 1GM5A 4GZMA 3RLZA 3OEHD 1KK7Y 4B2IA 4EUNA 2JLYA 1SXJD 2VO1A 1JAHA 3QXHA 3IO3A 3MJRA 3WY9A 2XJ4A 2QSYA 1IJ5A 1N6NA 1E79A 3M0WA 2AXNA 4NHOA 2AAOA 2WWGA 3LH5A 3EVRA 1G7RA 5K8LA 1E2MA 2CXJA 3RM1A 2CEAA 2ZJ5A 4LYJA 2LLUA 1TF7A 4PHMA 1TNDA 4UJ3A 4Q9HA 1T9HA 1CM1A 3CWGA 2VYFA 1QG2A 3FHOA 1KOFA 1S1MA 3WNDA 1Q57A 4QGGA 2BMEA 1MT0A 3MJHA 4EPRA 1Z63A 1N6PA 3BS4A 1Z0FA 2L98A 4PCWA 2ZEJA 4OJKA 4L9MA 4JLNA 1N5KA 5J4LA 5K89A 1VG1A 5J3XA 1KI1A 2ZITA 2KSQA 5DYIA 3PSRA 3KJEA 3V00A 2PEYA 2ZI5A 3W9YA 2JLRA 4IOKA 1S6IA 1XPRA 1QVIY 1WDCC 2X19A 2VP0A 1J70A 1QLKA 1ZVQA 1IG5A 2MA2A 2Q3FA 3KB2A 4IJMA 4LV8B 1NP8A 3T1OA 5CITA 4DDTA 2P6RA 2V7QA 2KGBC 1A7JA 3NBZC 4IXNA 2VQSA 3OF5A 4LHZA 2PT5A 2GK6A 2LVIA 1DGVA 3JVVA 3UMFA 5JECA 2JLQA 4LHWA 1DJWA 1N5JA 3KTAA 4JIMA 2KHNA 3QKRB 4BPBA 2FV8A 2JLXA 2WJHA 2GCPA 1NPQA 3BE4A 3GK1A 2O8DB 5B2ZA 4M1SA 4US2R 1KSOA 1OJLA 3MD0A 1ODBA 1VG0B 1XD9A 3QXXA 2J0VA 4M9XA 3ZLJA 1KSHA 3IEVA 2J5XA 2XXAA 4I5LB 2ZR7A 3MFYA 4QJ4A 2WBLC 4Q5IA 1OF1A 1QTXA 2QAJA 4PE1A 1ETUA 4OQXA 5C1BA 2G9BA 3CX7A 4JQ0D 4JZKA 4BFSA 1S96A 1I4DD 3P20A 1FBVA 1G8FA 3K70B 4JLOA 2CL0X 2VLIA 3FPAA 3KUDA 2QP9X 4W5WA 4EPWA 5EE9A 5FBLB 3RSOA 5GADl 2SHKA 3ICBA 5C46F 3I61A 1NCZA 3QEJA 4FTGA 1AUIB 1W46A 2WMOB 4GFDA 4DRZA 2AUCA 4URXR 1AVSA 4GUKA 4V02A 3AVTA 4B3XA 1CJTC 3TUIC 5DGXA 4JPZB 5F6TA 1XP8A 5JMTA 2BL0B 1V43A 1BO6A 2LV7A 2LP2A 2XZOA 3VTKA 4QNMA 5DISB 1LW7A 3FKQA 1UPTA 2Z4SA 1SXJB 3KKPA 4PZYA 2KFHA 1L7VC 4I99A 2GGMA 4XSHA 1UKYA 4TT3D 3ZWHA 3KKQA 2ZREA 3DL0A 2RAPA 4F93B 2ZI3A 2WVJA 5KDDA 3ZNIA 1ZM2A 2W2VA 5KSOA 3ZYCA 2V53A 1N6LA 1K8RA 2D7DA 5ELXA 4ZI3A 2JLZA 2ZRSA 4MH0R 2R2IA 2WWIA 3H2YA 3GCGA 4H9GA 4CGZA 2PL3A 1UHKA 2I18A 4WAUA 1XTIA 3THYB 5BXQC 4W9MC 4TSFD 3FMIA 4B32A 3DVLA 1EG3A 3HU3A 4N5XA 3AVVA 1F55A 1J1EA 3I5FB 3WXAA 1P4SA 2GJSA 2ZR9A 5J47A 4M21A 1GL6A 2EFDB 1S4QA 4XOIA 1PUJA 1V5WA 4KXFB 3RWOA 3V4RA 1QIWA 1JXMA 4LYAA 4A4BA 4JL8A 3PEWA 4M8NE 1G20E 2JLVA 2H18A 4KSCA 3THWB 3T06B 1Z0JA 1FUUA 1RYHA 4QJ5A 2ZRNA 1B7TY 4P4SB 1R10A 3P4XA 3OX5A 1VG9B 2WAYA 3CPEA 3EA0A 1WMSA 1DF0A 3EPLA 2QAGC 2HF9A 3I5FC 1CDNA 3ADCA 5JBQA 4URZR 3U4QB 2FSGA 4Q1FA 1D6JA 1LVCD 4POAA 4OYHA 3OAAD 2GZAA 2BKUA 1ESNA 4E09A 1X3SA 4IDPA 1WRBA 4M53A 5CB8A 1VDZA 2JIZA 4NONA 1IN7A 1F2TA 4B6EA 4BFWA 3CKLA 2IXGA 2VRGA 2I7AA 1Q12A 2G1JA 1DOAA 2Q9CA 3BUXB 1OMVA 2D3WA 4PO9A 2CT9A 1Q3HA 2LCFA 4HZIA 3QKUA 2PCLA 4F92B 2LP3A 4A2PA 3TJZA 2W6IA 2ZJOA 1ZW6A 4MGIR 1Z6GA 1XX6A 4PFSA 4XJXA 3BOWA 2BBOA 4A0FA 5JCZA 1W7AA 4Q4LA 4LGMA 4CEJB 2JNXA 1JSAA 5FL7A 2B6HA 3QJYA 4F4IA 5TVKA 2AD5A 2BHRA 221PA 4MN0A 2HUPA 2GDJA 3T34A 1IOZA 1NJGA 4AKEA 5JOLA 1KDRA 3T5DA 2NO1A 1KI2A 4ACAA 1ODFA 4DB2A 4GPLB 2M29A 1XB2A 4LPSA 1N6IA 1U90A 2QY9A 1K95A 4RD6A 4DCSA 1GITA 3QVUA 1SBJA 2QMOA 4EPXA 1BMFD 1K9KA 2B8WA 5KNDA 5EE1A 4WVFA 5FR1A 1JQJC 3QKTA 4DBLC 1FNMA 3EASA 5KSYA 2X77A 3OE7D 2ZSEA 1PULA 3DVKA 4OK5A 3WRXC 1G291 1MR8A 3X1YA 4WZ6A 1NBMD 3PENA 4A8JB 4A15A 2CE7A 3GK2A 4LJ9A 3KO0A 3SG5A 4MRXA 3HPQA 1PUIA 1ZIPA 2ZRMA 3ZH9B 2QGNA 2OCYC 2YNMA 2HJGA 2RGEA 5DKNA 3AEZA 4HDCA 4P33A 4TTRA 2A30A 1KKMA 5FOVA 3TQFA 3ICQB 1BLQA 3FB4A 4PE0A 5B64A 4HUTA 4RCYA 1NF3A 4HB2A 2A4JA 2HCJB 2OSBA 3LA6A 4PR0A 3SJCA 4LBYA 3AF0A 4B2LA 4PXAA 3OFNA 5B58C 2ZXUA 3HR7A 5CM9C 2KYCA 4YBHB 3EWAA 3KHEA 1MUXA 2IYUA 4BZPA 2NZJA 2ZSBA 3BB3A 4G01B 2M8UA 3QPUA 3ETLA 1JPNA 4FCTA 5JWHA 1T5LA 4LY6A 3QE0A 3UG7A 1JNYA 3JTDB 3CZPA 1T5IA 1F8HA 2TN4A 2NO0A 4W7SA 5KPJA 4Q7KA 2DFKB 4TLEA 4P5OE 2WSMA 1XEXA 1CJUC 2EC6C 5DN6A 1NMZA 5EXPA 5FOUA 1VHLA 1QASA 2OCAA 4OHWA 4TYQA 2V3CC 3OHMB 1XVJA 4JVLA 3B13B 4JVMA 2BEKA 4XWOA 2IWRA 1T8UA 4CDGA 2LHLA 1XD8A 4PQRA 2ZSDA 1COWD 2OLJA 4C2UA 2FCDA 1A82A 1XK4A 2H61C 1BMOA 2GXAA 5FL3A 3ONWA 2AX4A 4MKIA 4NBSA 4LPKA 1R0ZA 1GAJA 1CMGA 2XTNA 1N3BA 3I5HB 3IIMA 3QI2A 1NSTA 1OFUX 1R7RA 1KFUL 5GJBA 1N6OA 3O78A 3JVTB 2FFAA 1XFYO 4N1GA 5A4JA 2O8DA 1S6JA 1E0AA 2WWXA 1OOJA 3KTAB 1XEWY 1MRSA 1KJYA 3A1UA 2D2EA 5L3SA 1NBME 3LY5A 2A5GA 4OBEA 1DT7B 3U3JA 1IY0A 3QG1A 4ZDWA 3Q9LA 3W34A 3CS1A 3L82B 3Q72A 4D0NA 1E79D 2C77A 2OPOA 4LHVA 2ZJAA 3RS2A 4OQNA 4GGNA 2OESA 2VP4A 3GJ0A 1GWNA 1JFJA 2RGGA 3SIBA 3BB1A 1SK6D 1R5NA 2CK3D 4RSGA 1KO8A 1RYFA 1YZQA 4HZUB 1E98A 1AS0A 2JJ2D 5JJKA 3VAAA 1NBMA 1KO1A 4G5QA 1UDXA 4ZV4A 4DT1A 4LJAA 1YQTA 2F1IA 3OE7A 1YRUB 1GRNA 1UF9A 2ORVA 3AVQA 3Q85A 2QRZA 1YX8A 1ZUIA 5FTLA 1E9FA 2OAQ1 1CNPA 1RJ9A 4Z54A 4GOJA 3QF7A 1Y63A 2RGNA 4EQ6A 2AKAB 2M1KB 3PR1A 4TYWA 4DSNA 2JJ2A 3SG2A 3SZRA 2WAXA 1DARA 1P2SA 3LLUA 5CSIA 4F4JA 4NQGA 2GETA 4Z8XA 2IW3A 3PXGA 2Y4QA 1YZLA 2ZJZA 1AGRA 1HE1C 1OXVA 1QHNA 3Q7QA 1A2BA 2A5JA 1E8AA 3LDAA 5IK2A 4QKQA 3VR2A 2M97A 1LB1B 1ZM4A 4WZAE 4HAXA 1KI7A 2QU8A 3M1IA 1SR6B 4RD1A 3LCPC 4CEIB 4URUR 1SRAA 4QJ3B 1BMFA 3NG1A 3PEVA 2L50A 2Q4UA 3VFDA 1OKKD 5G3YA 4HAVA 1W5SA 2PX0A 4OL0A 1P73A 4EDHA 1NKSA 4B3FX 4AC9A 4LI0A 4G1UC 4ZO4A 4HAUA 2NPFA 1SL9A 1W4RA 1YZKA 1G8PA 4B3DA 1P72A 2VIIA 4LBZA 4HRHA 1BOCA 5EZ5A 2YWEA 1IGVA 1Z6AA 2G3YA 2HXYA 3NVAA 4C9BA 4L15A 3TH5A 1UBEA 3SU8A 4B74A 1MV5A 5CLLA 1RFJA 1JPJA 4IFEA 1VG8A 3DVJA 4ACBA 1DF0B 4DJTA 5KPDA 3QQ5A 3WNXB 4MYHA 4P4SA 3LVQE 4B44A 1NUBA 1G1MA 1CLUA 3EPHA 4ZCMA 3ZJYA 4G5RA 3I5GC 1W0KA 4LCBA 4X8MA 1Q1BA 3TK1A 2WSSD 5H8WA 1CXZA 4DLTA 5FTNA 2WWFA 2OG2A 5F2EA 3DKPA 3BH7A 2A7QA 4MKHA 5AWFC 1Y1XA 3PCRB 2R62A 3VQTA 3AKAA 3M6AA 521PA 4WQ2A 3EK7A 2VEDA 1S3GA 2G83A 3CLVA 3DO6A 4DZZA 2ZYVX 4WQ3A 1DAIA 2MBXA 1DBSA 1XD2B 1CKKA 2R6DA 4R98A 5FUVA 4URWR 3KQLA 1MRNA 2ZRFA 3RS5A 1GTVA 2G0TA 3K70C 4E03A 1N6RA 1OFIA 2J46A 2FFHA 2QQEA 3L0SA 4S35A 1EH2A 2PJRA 4TQAA 4FWIB 4CEHA 1HT2E 1UBCA 3CRQA 4L9WA 1SL7A 1AKEA 3IDQA 4NCHA 4PHGA 4ABYA 2J0SA 1QHIA 2QRNA 4Z1MA 1HY3A 4MRSA 4A4CA 1JC2A 2GHIA 1AQUA 2L51A 3QXJA 3TLXA 2YC4C 4KBFA 4IDNA 5JWRA 4JSYA 3DVMA 3FTQA 2L5XB 621PA 2LC5A 1ZD8A 4P3YA 3A4UB 1E3MA 1D9XA 2EW1A 4QRHA 2GBLC 2JJ1D 1RJVA 2DYKA 2F43A 4RZUA 4CYMA 3KXIA 4BLTA 2ZPTX 1NG9A 1PVBA 5CSFA 2OBNA 2F7SA 4Q66C 3NIBA 2HETA 3M4YA 2CTNA 5AEQA 2DHRA 1TTTA 5LB4A 4CRWB 3R9XA 2GXSA 4TYPA 1E0JA 1Z3IX 2PASA 5HPYB 1OZSA 5DKQA 2X1VA 4M1KA 4CEIA 4QM6A 3T35A 1S1CA 3K0EA 3HJNA 2MJWB 5HTKA 4PE4A 4YI9A 1WB9A 2C03A 3AVPA 1QHSA 3NWJA 1IY1A 4NTZA 2N1BA 4BY5A 4L8GA 2JU0A 4URYR 3IPXA 1G41A 3TUYB 2CNWD 1F4QA 1OXSC 3N2IA 4KFRA 3PQCA 2O8FB 1DG1G 2BV3A 3B78A 4N0DA 1AZSC 4NCNA 3KB1A 4XD7D 2ONKA 5JFGA 3NSOA 1KO4A 3KL4A 4Z1MD 3I5YA 1R8SA 1E2EA 2IYTA 1S5GZ 2K7BA 2J7PD 3TDIA 1DJIA 3CTNA 1I4LD 1K96A 2P3SA 2XX3A 1LS6A 3GEIA 2B21A 5JS8A 1N5LA 4CLNA 2JASA 4MITA 1FX0B 3LX8A 1ZCAA 2WOSA 1NIPA 2AN9A 3EXAA 1KGDA 3MGCA 4ZPXA 2IS4A 2O8BB 4A6PA 3H84A 2YV5A 3L0OA 2K2AA 1U81A 4V0MA 3AKYA 4DDUA 4MSPA 1W36B 4IW3B 1NYAA 3D0YB 2ZRKA 3B8HA 1CBUA 4BRUA 2F9LA 3VRNA 1IXSB 2LVJA 2WV9A 4JSTA 1J99A 2O8FA 3LLMA 1E9BA 4DSUA 2KSPA 1OIXA 2FPLA 1XRJA 2WSSA 4QFMA 3EZFA 1LVGA 3B9PA 1I2MA 2P6BB 1IKUA 3VRRA 1N6HA 3TDZA 2OAP1 4Q7MB 1P9WA 2L0PA 5AJWA 2R6GA 1IONA 1ZYUA 5FI1B 1LINA 2GESA 1YX7A 4DLXA 2CNWA 1YUUA 2BCXA 1DGUA 1NLZA 3R7WB 4F7WA 4C0KA 3HP1A 4ZCLA 3EZ6A 2AXPA 3O8BA 5FBQB 3DDCA 1CP2A 1XDBA 4TL8A 4XSGA 5FPHA 1KWOB 1ESMA 2JC2A 2GWHA 4DCNA 3K0SA 2M49B 1ZMZA 2VHJA 3JVUA 4OI2A 5G08A 4MZJA 1GL7A 1US8B 2VPPA 1B8LA 1VYTA 2V54A 2ZVQX 2GVZC 2ZYUX 3R8CA 3WYFA 4DB4A 3SG3A 4TTQA 1CU1A 3EKJA 1QDEA 2EFEB 2Q9BA 4JKIA 3RAPR 2NO7A 5EP2A 3PATA 2IUTA 2JJ1A 2O60A 4AKHA 3HYTA 2ZN9A 5FOWA 1AQYA 2OFXA 4M2QA 2BDTA 2VSFA 2GAAA 2IHBA 4MRNA 1UP5A 3PN7C 2P6UA 5F9HA 2VBCA 4ZDJA 1R6PA 4PPNA 2H8KA 2OFOA 2MHHA 1U94A 4WBSA 1VIYA 1S3PA 1SCVA 1YRTB 4MGYR 2FMXA 2LM5A 3HDTA 1YVLA 2RHDA 2KI5A 5I2LA 2KBIA 1K2HA 2QE7D 4PAMA 2IUUA 3ZVNA 4DVGA 4PHHA 3RS4A 2K7CA 1E0SA 2I4IA 4R2HA 3CM0A 3PFVA 1QXPA 5E4FA 3AV0B 1M7HA 2IC5A 4YRUA 1CF4A 2XB4A 2VP5A 1KSMA 1UEJA 3UK6A 1CFFA 2WOJA 4RFSA 5L3RA 2DPXA 2J7PA 1AJ5A 3IHLA 2IYQA 1XFVO 1GKUB 1GP2A 3RLFA 3PVSA 3K0FA 1U8ZA 1W2GA 4Q18A 1ZUZA 3THWA 1M46A 2WWHA 1WDCB 1S26D 3T1VA 1E9CA 1TU4A 1DG3A 2CK3A 4XTCS 3GLFB 2GRJA 1D9ZA 3QXCA 1XEXB 2I94A 2KFGA 4IRUB 1FF1A 3SBEA 4XIGS 1FTNA 4AKIA 2NXQA 3BUNB 1GDDA 2G88A 1PZNA 1DEKA 1U2RA 2RMKA 2IYYA 4BY4A 4NL4H 1MO4A 2JJ8A 1WY9A 4PTLA 4WZBE 1OIVA 1OFTA 2CDNA 4GT1A 1IN6A 1YRAA 1HA3A 1RWYA 3GLIA 3HPRA 3VR4A 1GZSA 2ASEA 1WBDA 4TQ9A 2C96A 2QPAA 3U61B 1OMRA 3KQKA 1SVOA 3Q7PA 4NYMQ 4US1R 3BJIC 3A8RA 2IBMA 2QEQA 1W49A 3BBPA 3AGQA 3GLFA 2GZDA 3SJAA 2LHIA 2QMUA 3LFUA 1II0A 2ZYWX 1TMKA 2LE9B 2QN6A 1UHIA 3KX2A 1Z2CA 3BRWD 3B2EA 4JMPA 3AF4A 3EPKA 4LUCA 3ZS8A 4YQFA 1KAGA 1EG7A 2ZRJA 3P32A 3FWBA 1FW4A 3WXMA 3ZVRA 1P9RA 3NH6A 1BOFA 5FOTA 1B23P 4TMTA 1H8HA 3W8RA 2BE6A 2XEXA 1L2OB 1YTZC 3VR1A 2JXLA 3LBIA 4MYTA 4V0KA 421PA 2ZAOA 5HYDA 1E9SA 2OTGB 3LRPA 3P4YA 4JS0A 4RD3A 3KQUA 4NDDA 1RECA 1DVIA 1ZAKA 3K9LA 2ZFDA 2I3BA 3CR2A 1YJ5A 2CXXA 3GLHB 4PC6A 3SYNA 4DT1B 1SKQA 4BZQA 1A2XA 2I1QA 2IYVA 1QHXA 4FCVA 1BR1B 4DLRA 2J41A 4GRAA 4Q1CA 5CJ2A 2ZUBA 5B30A 3MMPA 3TGPA 2WKRA 1ZCBA 4U00A 3U7HB 5EP1A 2F9MA 3LK1A 1Z06A 3KF9A 1D2EA 4EJSB 2NLNA 3EIHA 2HF5A 4LC1A 5KSZA 2PLRA 4Q9LA 2XGJA 4JLMA 4LV5B 2YKGA 1NY6A 4C0JA 2M7NA 3OB1B 1CFCA 3G82C 1Q1QA 2KE5A 1DELA 4JLAA 4BECA 1UHJA 1NI3A 4PC3A 3OB2B 4DKXA 2FEOA 1VTKA 2HF8A 2BE4A 2J1LA 1RKBA 2EWVA 5JZVA 3EZ7A 2ZETA 1R5OA 2LVVA 2OHFA 3BQ3A 2V55B 2VRWA 2ZUDA 4D4JA 1H8HD 2VA8A 4G5SA 3ZD7A 2GEUA 3UWKA 3I5GB 3CNOA 1SNLA 3MWJA 1W36D 3ZDQA 1T3LA 4JLVA 4XD7A 2AD1A 4EJSC 5JI2E 3VKGA 3C5HA 3D31A 3CGAA 1KWOC 4Q7LA 4DWJA 1E1QA 1E4VA 3QBVA 4JVNA 3SJBA 4WA7A 1KDPA 2V1XA 2ORIA 1E2PA 4JBWA 3WYAA 1TRFA 1KJZA 3B1VA 3CPJB 3UMRA 4I1SA 2Y8EA 2ZANA 1XPOA 4A4DA 5UKDA 3I5HC 1ZC4A 4Q1AA 5DE3A 4B33A 1R4AA 1Z0AA 3T1TA 3EAQA 1K94A 3L2OB 5G3ZA 5TV2A 4A0RA 4TZ6A 3L0PA 4TT3A 2JWWA 4ORBB 1SYMA 2J0UB 2QG6A 3W6PA 3G0HA 3GEHA 2HQWA 3QUSA 1HV8A 2COLB 2VL7A 4NDZA 4W5HA 3I3SR 1SKYE 4H1VA 4LHYA 1LA3A 2JNFA 2F3YA 1DE0A 1BT6A 3NDBB 1G64A 2W00A 2REXB 3A4LA 4EPTA 2AK2A 4Y0VA 5LD2B 4OHYA 4GBMA 4MZKA 2ZS8A 5EUQB 1UURA 1M34E 1QG4A 2NTYC 4N0EA 5FTJA 4YMUA 1RRPA 4BFYA 4C0BA 3SQWA 2HYIC 1M1YE 3BORA 4EPVA 1KSFX 4GL2A 2SCPA 2OV2A 2DOQA 2BEJA 3LO5A 4NYIQ 2QTHA 2QZ4A 1H8ED 2GZHA 1G4YR 2F8PA 5LBIA 3CUEF 2OFWA 1Z5ZA 2ZSFA 2P6NA 3ADBA 4KHZA 4JVSB 1CFDA 1QLSA 3LXRA 4C7OA 1F6BA 2R6CA 1Y6WA 1QX2A 4C2TA 1MO6A 3QKRA 1RROA 1X8KA 2ZRTA 4PSKA 3R20A 4A8JC 4C3ZA 4GGFA 1MH1A 3ICEA 3KUCA 4ARZB 1UWOA 3QEOA 4M9ZA 5TNCA 5AERA 3DKVA 4RD0A 2ATXA 5HCIA 3LL8B 1VYUA 1TF2A 2IXFA 2O8EA 3KJHA 4LJ7A 2YINC 4QHTA 4U8DA 2H5EA 4ZIRA 2ODNA 3CO5A 3L43A 1SVKA 1U0LA 4LJYA 1OZOA 5EP3A 1RJ9B 1HUQA 1K90D 1DS6A 3IQOA 2Q3MA 3CRRA 3IBGA 4YDSA 1Z0KA 1HYQA 1EG4A 2R65A 4OJQA 1J7PA 5KDOA 3IQXA 4FXPA 1XJCA 2KBFA 3TW8B 3TW4A 2KAYA 1E99A 1T6NA 2PLFA 4HLUC 1TF5A 3DZDA 2VH5R 3I1FA 4US0R 3VNVA 4X8OA 4GP6A 4K81B 3ZQJA 1QHGA 2Z43A 3K9GA 1B4CA 5D3QA 4IVPA 4QOSA 3WP0A 3WHUB 1G8YA 2JIZD 1F5NA 1ZACA 1A03A 2K8MB 2FJUA 3D3QA 3DMNA 1SQ5A 1GRQA 1CS4C 2EU8A 4TWZA 4UNNA 1AN0A 2LWIA 1II8A 4A6XA 5B8IB 5G53C 1Q1ZA 3LQRA 2X8AA 3BYAA 3TR5A 1FNNA 4M2LA 4YGDB 1S9DA 1Q22A 1KK1A 2ANBA 1HQVA 2IL1A 2RGDA 5EJEA 1HQCA 2V6JA 4I81A 3VHXA 3OEHA 2O52A 5TDHA 1EFHA 2LKCA 4MQBA 4M2PA 2B1UA 2ATVA 2WJYA 3DMDA 2Y1MA 2GTPA 1NX3A 1YVDA 1OFHA 4Q02A 3U6BA 2FFQA 2JXCA 5IBWA 2C9CA 1EX7A 3EA5A 1K93D 1MXEA 5C4GB 4DLYA 2JLUA 2GK7A 4WRIA 2IS1A 1P6XA 1E4YA 2FGJA 3BB4A 3N2EA 3NTUA 4GPTA 4OHVA 1ZOTB 3UIEA 3OIUA 1OH7A 4H1UA 2CLDX 2ORWA 1EGAA 1NVWQ 4AG5A 2KQYA 1W7IB 2WNDA 4Q03A 1KSGA 3OZXA 5KTYA 2KWIA 1HT9A 2UZ3A 4IOMA 4RVCA 2O5VA 3D6TB 1T0HB 2A2ZA 2FZLA 3I8SA 3UWOA 3CR7A 1YE8A 1JF2A 1VKJA 3VU9B 3LWNA 1CLLA 2CBLA 4GMDA 3PG5A 5IRCD 1PK0D 3C4JA 2H7VA 1KK0A 1XTRA 4NCKA 3CRMA 4PANA 2JLWA 2GA8A 1KCYA 2QT0A 2Z83A 1X8LA 1Q80A 1QATA 2ZJBA 3R9WA 4AD8A 3OX6A 2M9GA 5D69A 4ZKEA 5KHOC 5JSZB 1SW8A 3KQHA 4IL1A 3BFKA 3B9QA 2IF0A 3BC1A 3VGOA 2LANA 2QAGB 2X2EA 2RGCA 2RGXA 1FW6A 1ZD1A 2BCJQ 4C0AC 3PALA 1XMJA 3PUXA 2K61A 1TOPA 2BM1A 4TL7A 1W7JB 1FP6A 3CF0A 2G77B 1VYVA 1GUAA 3E2IA 3SFVA 4RD4A 5AUPB 3Q5EA 3TS5B 1DTLA 1E1QD 4B35A 5DO9A 2NCOA 4MLWA 1D2NA 2IA5A 3KJIA 5SZIA 4DRWA 1KQVA 3K53A 4LK2A 1RVDA 4ZDIA 4F91B 4LJ4A 1YZGA 3OEED 5JCPA 2WICA 2E30A 3VROA 2DWOA 1DAEA 1P61B 1WDTA 3ZZTA 1MWNA 1NX1A 1CRQA 4E07A 4IEEA 4A36A 1VPLA 2E87A 4KSBA 3T61A 2PBRA 3SHFA 5KO2A 4QHYA 1SXJE 3RABA 4AIIA 5KNBA 1CTQA 2ZRBA 2BBWA 4MRVA 3CLNA 1NN5A 1A4PA 3F0TA 1FTSA 4PPQA 4CW7A 2J59A 2RKOA 3PEUA 4DHEA 4AQJA 2GJ8A 4FMCF 3EPJA 3B7GA 2ZIAA 3IEUA 1KO5A 5JLJA 4MA4A 1P60A 2AFHE 3BOSA 5CJPA 2V7QD 4EKDA 3LQQA 1F2UB 4NZYA 3BUMB 2FSFA 4X8LA 2FPMA 2PVBA 2F1JA 3OFND 2DFLA 1SHKA 2CE2X 1K9PA 3IQQA 1B7TZ 4KVGA 4LYHA 2PCJA 5EZ6B 5P21A 4A0HA 1OH8A 1XFAA 2YZ2A 5FPTA 3GLHE 3I5XA 1E1RD 3S1AA 3BXKA 3CPHA 1AA9A 1X8JA 5BWMA 3QIAA 2IS9A 3U4QA 1QVIZ 1U8YA 3P27A 2BVNA 3SC3A 4USLA 3WNBA 2PMYA 1XMSA 3RS0A 1A1VA 5HKWA 4MRRA 1OT3A 1CDPA 3FKSA 2ZE8A 1Z22A 3NXSA 2GJKA 4LHXA 3GJ6A 2H61A 1GNPA 1IJEA 1F2TB 5TARA 4FW9A 3PUWA 1OHHD 4FD2A 1B8CA 4B3GA 2FCEA 5TXGA 5FPYA 3FS7A 3GLHA 2AHOA 4ASUD 2QP3A 1DPFA 3CRW1 3QENA 1R5BA 2D7CA 3JTDC 2CBZA 3O8DA 1VCMA 1ZM7A 4M9QA 1NSFA 3DOEA 3QG5A 2N46A 2QM7A 4IOLA 1KK2A 4B34A 5EE0A 3KJGA 2QUZA 3A8TA 3RC3A 2OS8C 1G7CA 3F5FA 1CR0A 3TVTA 4MYUA 1J7OA 5TMPA 3MSEB 3LD9A 1L2OC 4DSOA 1F4OA 4LV6A 3TIFA 4PX9A 1IBRA 4NDBA 4L5BA 4QG7A 3SR0A 3IQWA 3BIFA 3NH9A 2OTGC 5KNCA 3VNUA 4OKSA 1JJ7A 2B8TA 1OW3B 1U99A 2FNAA 1E2IA 4B3CA 1E96A 2QAGA 2B7CA 2XITA 1CJKC 2A78A 3U3KA 4C0LA 1RK9A 3DF0B 1G6HA 3J81k 3ZVMA 2D8NA 3AKBA 2E1RA 3FGNA 3K1JA 5CYPA 4CEHB 4HB0A 3D0YA 2ZROA 3WMGA 3O2PA 2YWGA 2JRFA 2HCBA 5AUQA 4ESVA 3WMEA 5SZHB 121PA 3VRQA 2CHGA 4A9AA 2OXRA 2XSZD 2KGRA 4GP7A 1P2VA 5KDLA 1NWDA 2B7BA 2VTKA 3EIEA 2WCBA 5HZKA 1UDWA 2RCNA 5HR5A 1QX7A 3AP1A 2Z0MA 2D06A 1E9DA 1OE0A 4UXIA 1QHYA 1X86B 4QL3A 2ZVPX 4D1EA 1WRLA 3AVYA 2M7LA 3E1SA 4O2RA 1E2FA 2HDNB 5DHFA 4XVUA 2J45A 2Z6VA 4ARZA 1N2CE 3CF2A 1TNPA 4Q48A 1E2JA 2ZYTX 3BD9A 4KVAA 4A8JA 4CEJA 1YR7A 3EW9A 3SG4A 4GBAA 4R71A 1SVSA 3SJZA 4FN5A 1II9A 3TSZA 2LKDA 3UG6A 3KDSE 2D74A 5DSZA 4CPVA 1JAIA 2C2HA 4AI6A 3LBNA 2BKEA 4DLZA 2IS6A 1NN0A 5AR1A 3FMFA 1BYIA 3RC8A 2V9PA 1HTWA 4P31A 1FPWA 1JECA 2C5LA 2JOJA 2JT8A 1YU9A 2JEOA 4D4KA 5K8TA 3DVEA 3W3ZB 1Q44A 2J3EA 4G3XA 3U6KA 3TDUA 1WQ1R 2PSRA 4BLPA 3K0CA 3RRMA 1OB5A 1QHHA 3VRPA 4PHNA 2V1UA 1G18A 3IKJA 3T1QA 1J8MF 4D26A 3LX5A 1TIZA 1V1FA 1EFCA 1JBAA 1TPZA 2NQ2C 2Q6TA 2FOLA 1XJQA 2G0NA 4MKGA 1L8QA 1F54A 2IHYA 2ZQ5A 3VKWA 4B73A 1S0UA 1W2HA 2LUCA 1YZNA 2EVWX 4FINA 3SN6A 1G8GA 3OIWA 4OHZA 4ETOA 3I62A 1UFQA 5L3QB 5IK2D 1Z28A 4DXAA 4A2WA 1SGWA 2HLDD 2REBA 4XVQA 3SNHA 4M0LA 1P2TA 4GZLA 3F8TA 1PLLA 2ODWA 1IRJA 3A6PC 1Q1EA 2REOA 4NYMR 1LS1A 2KFFA 1VIAA 4AYTA 3FWYA 2WCEA 4Q1DA 5CIQA 4Q19A 2GBLA 2IUSA 4PHJA 2XSZA 1LV7A 2GEVA 3HR8A 1QF9A 1YZTA 4DEXA 2AFIE 4I4LA 3FDIA 2F3TA 3K21A 4LZZA 1JEDA 2D2FA 2WCFA 4OK6A 4RJLA 5J40A 1GVNB 1JUOA 1Q0UA 1Z6XA 3U7FB 2HPSA 3PN7B 3FYHA 1U0JA 4WIAA 4ICBA 2AK3A 2F55A 4NDCA 2OE2A 2QROA 1Z0DA 2W6JD 3B60A 4HUQA 2MAZA 2D62A 2F3RA 3IBYA 4B75A 1S8FA 5DI3B 2FSHA 4PC7A 1QZXA 5CSJA 4WOPA 1D1OA 1E2QA 3PFIA 1OQPA 5FTKA 4K46A 2W2XA 4IDQA 2NCPA 3NHAA 1NVUQ 1E2LA 2CCGA 2FG5A 3SYKA 3UMSA 4MBEA 2IYRA 3U3MA 3K9HA 1XEFA 5D7FA 1CR2A 5J4YA 2IYZA 5KU1A 4EQ6B 4RY2A 3B1YA 1OV4A 2JT0A 1UBFA 3X1WA 3IILA 2UVQA 1YR8A 2GJ9A 4BEJA 2EHBA 4ORAB 3PIRA 1W0JD 4GOXA 1B0UA 1NJFA 1QBKC 3HU2A 5ER4X 4ESHA 4HLUA 4M9SA 5BPJA 1N0VC 3CONA 5J4HA 2EYQA 1AP4A 1BYUA 1NMXA 2DWQA 1RW4A 2QMHA 1Z47A 4OHXA 1MHOA 1Z2AA 4CT5A 2WIAA 2ZAMA 2ZI9A 1V1GA 4Q47A 2CCMA 2ZTSA 1HE8B 2I1VB 1OMDA 1W0JA 4AK9A 2WKPA 4IDOA 1D2MA 1MR3F 3UANA 2O8CB 4GGFC 4AYWA 3S1AB 5J5CA 4EAQA 3NC0C 2O8BA 3VHLB 3GLFE 1KQMC 4TTPA 1GFIA 5BW8A 1BKDR 1E32A 1Q3TA 1M63B 2UZIR 5AJZA 3C5CA 4P2YB 2D4HA 4HLCA 2XOKA 1PVOA 5CSNA 3L8ZA 3B82A 5DHAA 5FUYA 1DJZA 1G4AE 3CX6A 2BECA 2J9RA 2PMDA 2P2LA 4JLJA 1XO5A 1KFUS 2Z4RA 1AIPA 2BBTA 4GMXA 1XCGB 3AVXA 4I1OA 2C9OA 1FMJA 1DMOA 3THXB 1NG1A 1VHTA 3REFA 1KDTA 1W48A 2C98A 1YZUA 2F3ZA 1BODA 4KYIB 1LNZA 4O3MA 1X02A 2CLSA 3MG9A 1OE9B 5JJGA 1E6CA 4KJZA 1S36A 3IGFA 3GLGE 1MOZA 1SY9A 2B92A 1EXMA 4DCTA 4JKYA 4D6PA 4TSFA 4HI0E 1JJVA 1YR9A 3AP3A 1JR6A 1CEEA 4PSVA 1MABB 1J7RA 2ZI6A 2JATA 3CX8A 1QV0A 1W44A 1IJFA 4Q1EA 1ZNWA 1PALA 5AJYA 4PHFA 3LNCA 3ZIAD 4A0GA 5EE5B 4UXHA 2Q9AA 6Q21A 1IWQA 4HLDA 3NHBA 2BL0C 1RRFA 1XTQA 3A37A 1VCNA 4MUBA 3HYRA 4DSTA 2KB0A 4TLDA 4D80A 5AJXA 5CB6A 5KOYA 1C7VA 3K70D 2ZI7A 3ND9A 4GNKB 3GMTA 2A9KA 1YUTA 2L4HA 4N1AA 2HT6A 2FSIA 2H16A 3A1VA 1UEIA 4B47A 2EFGA 2EFHB 5EUMA 4KODA 3T12A 3EK8A 1FI5A 2PZFA 5JEDA 4QM7A 4F0ZB 1NY5A 1E2HA 4A82A 4YMTA 3CH4B 4HATA 2QL6A 3RHFA 1W4AA 3EVVA 4D82A 4D81A 2ZE6A 3U2QA 4OI0A 4R1EA 2ZRGA 4D4LA 2L2EA 4YGBB 3BXZA 1HQYE 4Q4AB 3ZVLA 4ZCUA 4N3NA 2FPKA 2P67A 4CVNA 3FWCA 4F38A 1UM8A 1IHUA 4ZDKA 1SZPA 1FQJA 3GK4X 4OQFA 4PPGA 4KLZA 1K6MA 4D4MA 4KITB 1XYDA 3PM8A 1NRJB 1WLMA 1KTVA 4PAOA 1XK4C 2XTZA 3CBQA 4TL9A 2IF2A 1W36C 4TLAA 1KYIA 4M2OA 4HREE 1H4BA 1F3OA 4NYJQ 1SXJA 3AAKA 4I5JA 1BIFA 3R9IA 2NG1A 4O25A 5DKRA 2I2RE 2NPIA 3AP2A 4GDFA 2ODBA 1IXRC 3A1SA 1KMHA 1CDMA 1JR3A 2R6AA 2ZS7A 3TR0A 1RIFA 5KUTA 3DM9B 1SVWA 1IN8A 2RGAA 3VMFA 4DC9A 1DJXA 3TKLA 4BUJA 1Y1UA 4I5NB 2UKDA 3VR5A 2EGDA 1C4OA 3FVQA 1CR4A 2ECKA 1CFPA 2XAUA 1MO3A 1ZP6A 1R2UA 5FI0B 5BQ5A 5HKYA 1SULA 4YMWA 4D0LB 2H2KA 1SMGA 5EXXA 1TNXA 1ZBDA 3LAWA
chains in the Genus database with same CATH superfamily
1TUIA 4MVJD 2ZU0C 1FYXA 3MTGA 4IVNA 1RKUA 2BUCA 3R41A 4E0BA 5IDQA 4LWZA 1O0BA 3LIPA 1ZU5A 5FO0A 4XB2A 5COBA 1G3UA 3BN3A 2VQ6A 3AB3A 1OLOA 1RR6A 4LHEA 1ELOA 2X5XA 2YWXA 4OFZA 2MCFA 1VKHA 3IULA 3BGDA 2OXCA 2BSAA 2FDRA 4KFUA 3SXJA 4G0WA 4Z8YA 4KYUA 2GA9A 4TNCA 1Z8FA 1LA2A 1YR6A 1K08A 2O2YA 1F8FA 3C7KA 1A4XA 5G41A 2DTXA 2NIPA 1SR6C 4JWTA 3HV0A 3ZEAA 3JQBC 3UNXA 1QHHB 2C58A 1WE2A 4MDEA 3B51X 2E6WA 3VOSA 1JWAB 3HB0A 3Q4GA 4N0PA 4F9GA 4KAAA 4Y2TA 4QDOA 2IGTA 1EHIA 1Z0IA 1V5IA 3DOJA 4X0EA 4J0GA 1JEYA 1XD2A 5F3WB 2DFPA 2DKFA 1KNXA 3QLEA 3QYFA 2IYFA 3IVCA 4IVQA 4RULA 3AXSA 5EIFA 1QYRA 3DPUA 3GJQA 3ZWMA 6PFKA 4TWBA 2FH5B 1G8JA 4J76A 3GVPA 1TEXA 2K5UA 3MUFA 3P9IA 4FOOA 2X4IA 2X0KA 3NNNA 5JY6A 1Y1SA 1WJGA 3ILYA 6ABPA 1JFLA 2QI9C 1GPDG 3JS5A 3PHGA 4JI3B 1RDFA 1I4TD 3SZUA 4DQXA 2C7OA 4D1YA 3CH5A 2GF9A 4EFNA 4EATA 3NAQA 3KKLA 3SDZA 1D1QA 1W30A 2OT3B 2Q1SA 3ZDFA 3DLPX 2HWXA 2G6BA 4CQLA 1NRIA 1Q16A 3NEJA 3WLSA 3H6KA 3WK6A 3LFHA 5AM2A 4D8VA 3D43A 4QGHA 2X0EA 4H7DA 3SSOA 1G6OA 4LMPA 4BEBA 1XDZA 2FN3A 2X8WA 1GGWA 1FP4B 1X1CA 2OLKA 2WFMA 3AUTA 5A62A 2OBFA 2VK1A 3ZWOA 4AKGA 4FZRA 4KWTA 4NZ9A 4YALA 2QI9F 4ZIRB 1UWVA 1QV1A 1C7EA 3ZGYA 2R96A 1Z8DA 2C5HA 3N7HA 4M22A 2Y77A 1EFTA 2NO9A 2L4IA 3FM9A 3U5ZB 4OR9B 1YB4A 2BHLA 3DA8A 2CNPA 1TT5B 3G2KA 4G0MA 5BMVF 1ZGCA 2I76A 1T1JA 1C0KA 3PQFA 1OH5A 4NCBA 1DJNA 2ZRHA 3LHKA 3F3YA 4HKTA 3R5FA 1YBMA 5EMLA 1PJBA 4KAXA 3X2SA 3K8ZA 1JIKA 5PALA 3ZJTA 3GBPA 4H7IA 5JECA 5JJLA 2F33A 3KC2A 1R0YA 4DIRA 3SBXA 2E0IA 2Q4BA 4Q9JA 1KAOA 1JVBA 3BSFA 4EB3A 2B34A 4FKBA 4UEJA 3FBGA 3K0FB 5IX8A 1IRIA 1K89A 1MQSA 1FMCA 3LGAA 4TMXA 5DLDA 4ZT3A 1HR0B 2AYXA 1A2OA 3ROKA 3WLLA 2OYSA 4X54A 4F2GA 2QW8A 1DEHA 4B2PA 3NC1C 3ZVMA 2GN2A 2O4CA 1C0IA 5FDFA 2GLTA 3MGBA 3VBCA 5L3VA 3A6GA 3U44A 4BKQA 3U44B 4LZWA 3H9BA 4IMRA 1VE1A 1U7WA 1Z39A 3RS7A 3SS3A 3JQ9C 1FLVA 2Q62A 3BCHA 3ZD6A 5FLEX 3LLEA 1IWBB 1MPTA 2AGVA 3JQAB 2TMYA 3JTEA 4HQRA 3NANA 4M7RA 3Q6IA 3OQVA 1ZIOA 4PYKA 1XA5A 1LQUA 4JCCA 4I08A 3COJA 2B7LA 1ZAYA 3P9XA 3A9RA 3AF5A 1P28A 1KSJA 1E3DA 1XTSA 3KM0A 2B2CA 1TTHA 2I3GA 4HNQA 2I4OA 4WFKA 3SYLA 3TBFA 2YZMA 3LQKA 1JR3E 1T1EA 4YI3A 1Y3DE 1IY8A 2C0PA 2OUKA 5AOAA 2FCAA 5KJEA 3ZWKA 5JJCA 3FIAA 1H3FA 3AB7A 3AEQA 2D0OB 2YR0A 2BIFA 2R5FA 1MXLC 1C9KA 2A1IA 4UU7A 4REQB 2WD7A 5FOSA 5MN4A 1IXYA 2VHCA 2V5AA 1I5OA 5CTJA 1WKBA 4ILEA 2FZ4A 3U7EB 2ILVA 3M8KA 4JBXA 4KQXA 3GUYA 1B3RA 2V0GA 4NV1A 2QR5A 1YFKA 1KI8A 3BWEA 3ZCPA 2OZEA 3FNRA 5EXEA 4PNPA 5K0LA 5HOQA 3HM9A 1VHWA 3GEEA 4PZEA 4RMIA 4FMPA 1WF3A 4NH4A 2VAVA 2J0UA 3AFGA 2ZK7A 4RDHA 2BFWA 1LLFA 3GZNA 1OWNA 2EKDA 4GO1A 5LKRA 4AQIA 5L6LB 4AUNA 3QSYA 1MB0A 2B2NA 1GQ2A 4HWRA 3W2TA 5DICA 2LDXA 1BJFA 2D1TA 2EJVA 2FEAA 3I9FA 1OUMA 2QG9A 2W48A 2W43A 2HPZA 2ZDHA 2BM0A 5A7GA 3MF4A 3QU2A 1QVRA 2P0YA 4OHYA 3D7LA 2J07A 4JQSA 4E1AA 3OICA 4EELA 5A3QA 3O9MA 3FOZA 2C4HA 4JUCA 4RGQA 2QP4A 3OCVA 3EW7A 3TLCA 2X22A 3TRHA 3N6XA 4RCZA 3U56A 4LOLA 1PFVA 3IPAA 3NBYC 2JGJA 5TGZA 4NABA 3MT9A 4NESA 5AVUA 2KNEA 4XQCA 4KMOA 4P1ZA 3SMQA 5K05A 5KYYA 4LF6B 2PGNA 4LRTB 4R7ZA 3P19A 3O3CA 4ITUA 3T7DA 1K5GA 4FNOA 3W8NA 1T5OA 2CN1A 4D41A 4DIDA 2NYUA 3OZBA 4ABTA 3AT1A 1NOKA 5C8DA 3UN1A 2EJBA 1IEQA 3CR8A 3TUZC 1Z08A 5EZYA 4C0QC 2Q4OA 5DNUA 4HAZA 1Z26A 4FOTA 1M31A 4NEHB 3A06A 2MYPA 1CRPA 3NUZA 3GFTA 1KAMA 1ZXBA 1MKYA 1MFPA 1CV2A 3TN7A 2OM6A 2I54A 3R6DA 5EFZA 4YREA 4ANFA 3I45A 5CDFA 3M6LA 4WY2A 1WSBA 1UOEA 3BK7A 1ZNXA 4BBZA 3MWDB 5KNCH 3CUUA 1FPMA 1ZMBA 4FSHA 3EX7C 3R1OA 1ZMXA 1H8BA 3G3EA 3B9RA 4F3NA 1IOVA 3HN6A 2DHCA 3I01A 1R88A 4CLRA 3IDAA 4XTRA 5AIBA 1NR7A 1LQTA 3C3BA 5EE3A 5IDYA 4PXYA 1XLUA 1W94A 2VG8A 2W2MA 4GUAA 2QNRA 4LYYA 4QXAA 3RHSA 1JQ3A 2YJTD 3KNZA 3WV5A 4RETA 2RAFA 4GEKA 3CZMA 3EIUA 4HS4A 5I9MA 4D56A 3SICE 5DNYB 1D7AA 4D5GA 1GT91 2X15A 2Y6UA 4MJ3A 3PVCA 4BX3A 3TSAA 2GR9A 1ZCJA 3WBJA 1VMKA 5KSWB 3H1AA 3RYIB 4B3GA 1J9ZA 1YHNA 4JT2A 3A32A 2NUAB 4TRNA 1VJGA 3R8FA 4K5QA 4RANA 2D1FA 1CJBA 3GR6A 4H15A 3O93A 4O08A 2G7MC 5IKOA 5AI6A 5E38A 1IH8A 1XF9A 4NNOA 4QFBA 1CUAA 2DWPA 3MCUA 3S0GA 1ZONA 4JNKA 3HJAA 3A1FA 4OV6B 2AOTB 4Y2QA 3LY9A 5FLKA 4EBFA 5BOVA 3WHKA 5F9FA 1NL3A 2V7BA 5LP6A 1EX6A 3E5RA 3W4KA 1GGNA 4K87A 3GUHA 3OEEA 3TD2A 2GV5A 2A9JA 1CY4A 2H0QA 2XMDA 4UD2A 2NP6A 2CJWB 4ENUA 4ZAGA 1G3IA 4WW0A 3OTGA 3M3DA 2IZZA 3NIFB 4JYPA 4CMEC 1JHZA 4W9RA 3DLTA 2X4DA 3PNBA 1MF8B 1J0CA 1E3JA 3EIFA 4DIKA 3BWDD 3TLJA 1P5ZB 1ECCA 1G5TA 2QUHA 4L16A 3AINA 4ZVMA 2XLBA 4BLOA 3W1EA 1WV0A 1WXIA 5AVQA 3FE9A 4JWQA 1K68A 1WSAA 3HX4A 2QIPA 2HSEA 5HBGA 3N53A 3K0HA 1FS4A 1WW2A 1UK9A 1WHSA 3KPXA 4OAOA 2R44A 2E5WA 2PX8A 3CY6A 3H0KA 1C8KA 2EWWA 4NKRA 1EFDN 4LSGA 3WL8A 3UMGA 4EI7A 2BBSA 8OHMA 1DKQA 5LYYA 3B2NA 4G5GA 1L4MA 4NYJR 5SY9A 1MO5A 4CL3A 3K73O 1EBUA 1LY1A 3TOSA 1KZYC 1EJ2A 1XV5A 3P4UA 5F5LA 4CR6A 1XZLA 3WGYA 2W0MA 3F98A 3TQQA 5JH7F 3VYRB 1Z35A 5IBQA 2PKXA 3LKZA 2YBEA 1L5KA 1JQAA 1W4BA 1RQRA 2O20A 3RCBA 5EQDA 5M29A 4WESA 2EOAA 3RJ5A 1KYTA 1U2EA 5CIWA 1PJAA 2CNOA 5DI3A 2C1EA 4B7CA 721PA 3AM1A 1DGQA 3CH7A 4YRNA 3KT8A 1RPTA 3PHHA 3U0VA 1CUDA 1EWRA 3ZI7A 1H8EA 1WLZA 1KFCB 2BJWA 2PDAA 1QGUA 3DAPA 2JH3A 3UCFA 2DRIA 1WCIB 1J33A 1ZESA 1MOSA 3HLTA 1WUHS 3WHLA 2Z58A 1E9RA 2AMIA 3ZZNA 2ZSKA 3RRFA 2QBYB 1D5CA 2WJ6A 3DE3X 3KYCA 3D6AA 4M99A 4DXDA 3CIFA 2BFBA 2QG4A 3JYHA 2JPTA 3QBEA 1A7UA 2BGNA 2DR3A 2FGKA 1N0UA 4IEFB 1U0RA 3G7UA 4PLYA 1ZEJA 4W5JA 5CEJA 3CW2A 1G8SA 2VNKA 4ON9A 2QENA 1H42A 3T5AA 2LDBA 1SBZA 4ZAWA 1DJYA 2B5OA 1WXQA 4WXPA 2IEGA 4O2BF 3BWMA 4ZALA 3R7WA 3URMA 4PQGA 2X0FA 2SECE 1GNRA 1HURA 1TEVA 2FUG6 1ZDMA 2W6ID 3HSSA 4YGXB 1IN4A 3WYAA 4GI5A 5FF9A 1CRWG 3K09A 3LPAA 1LC3A 2F64A 1XWIA 2V58A 3PX3A 2JGNA 4HDSB 4MWOA 3UJ7A 3CZRA 1I0ZA 2GNOA 3EVCA 3H8VA 1NYRA 4GZ6A 3RFTA 4AG6A 1IQPA 4X8HA 3ROQA 3ACDA 4R3UC 2CXUA 1PVAA 2KI6C 4F9TA 1Z6TA 2G40A 4QJ4B 2CJWA 1KWGA 2J67A 5FUMA 1UMCA 4IUDS 2WB2A 4QTXA 2FWPA 1JLMA 4OV2A 2VP2A 3DNFA 4Q3CA 3ZY5A 3FPHA 1VBNA 4Q04A 1KMIY 3PUHA 3D8BA 5F7OA 5IF9A 1F7VA 2QQFA 4K86A 3SE0A 2HFJA 4Y9UA 4WJZA 2P9BA 3FETA 3QOWA 5DOZA 2JFVA 2BF7A 3E9ZA 4JUFA 1IATA 4BFLA 1NOIA 1L2TA 3BWXA 3FUVA 2JDID 4R8MA 5CH8A 3BH0A 1V1MB 1NN1A 5G1NA 5U9CA 4WFIA 5CCEA 1FZTA 4WKOA 4HBGA 4OHRA 4LWQA 4CZ2A 3GD7A 2P5TB 1YB6A 1YS6A 4RCVA 1Z83A 4UTZA 4DMLA 3LW7A 4BAUA 2BEWA 1XFXO 4OH1A 3IRVA 3K32A 4IYJA 4JBGA 2B1GA 3MLEA 2BDUA 3GLGB 1M76A 2ZJ3A 3AEYA 1ZD2P 1GR0A 2JDIA 1ISJA 3JQGA 1UKEA 2YDYA 4MPPA 2XZTA 5JZMA 2CXTA 1ZD4A 4PBSA 3HDJA 2NZ0A 4Y6LA 5HM6A 5KOJB 2D00A 3NV7A 4MK4A 4YJKA 2HK9A 2ZB7A 3L7OA 1QDUA 1EFVA 2BC9A 3OCWA 1J2TA 4MULA 4H0NA 4EABA 4E7PA 4FHEA 3DLCA 3K4QA 3OUTA 1FW8A 1G3QA 1O8BA 1ZUNB 1T4GA 3QF4A 3WGIA 2JGFA 1XHLA 4FBMA 4EKNB 1NX2A 1O95D 2JS7A 1LFDB 2H0AA 2Y1WA 3EEYA 2AN5A 3BIJA 3PICA 4O2AF 4W6QA 1AJ4A 3AKEA 1MJFA 1EIZA 3B52X 1E7RA 2EZ4A 2MMGA 1CF9A 4ARSA 3VJLA 4FC6A 3AO0B 4MGKR 4M1YA 2OA0A 3L1IA 3NYRA 2MLEC 2BFFB 3ANYB 3GU3A 1IQRA 1U2SA 3DMFA 1JDNA 1U1CA 1T25A 2HPHA 1DO2A 5B1DA 5BURA 2I6SA 4Y0AA 4CM1A 1NASA 3AIOA 1A97A 4JUDX 2J6BA 4MAAA 2IYLD 1GL9B 4BLRA 1C30B 2J33A 3RQIA 3L7JA 2TMGA 2VDPB 4PQEA 2P7HA 3STXA 3BZUA 1TXGA 1APBA 3ZCUA 4KIFA 5KYWB 2JAXA 4YT5A 3QTBA 1DJGA 2R47A 3GLRA 4IV0A 2OXEA 4Z1OA 5KTOA 4Q4HB 1XNGA 2RHOA 4CNQA 2OORA 1TX4B 1XMVA 3FTFA 1O89A 3RAFC 3VX4A 3Q8MA 1E5XA 1CY2A 5AI8A 5L3QA 3D2BA 1X38A 1VSQA 4LQLA 4YAWA 5ALEA 2IUFA 1I7LA 5COQA 4NCJA 1K7SN 1XN1A 4QJ5B 1QS7A 4CPDA 2ILTA 3A1WA 4FQ7A 1I13A 3QNMA 5K8JB 2OO5C 3R5JA 5A0VA 3H1PA 4QOJA 2WNIA 3N76A 2XODA 4WLFA 5I2OA 3I4FA 4KPFC 3R9KA 2XR1A 4KX3A 2C3UA 2ZB2A 2V7GA 3N7TA 1U8FO 1W35A 2BCEA 2RGUA 4QXOA 4PN3A 4BB6A 3ZZ0A 2WWYA 3HFGA 1YOBA 2O2XA 4OX9Y 2QRJA 5B3KA 2B83A 2BOVA 3H4TA 4RKFA 1WCXA 4FMBB 4MLCA 1I0LA 3C3YA 3RB8A 2NTNA 4X3PA 1A8SA 4OQMA 4MKFA 1EU1A 2JI9A 2KYFA 1JSRA 4M4SA 3K05A 4P4TA 5D3MA 1K8YB 1GQMA 1TUEA 2H9IA 2JAUA 3JQFA 2MR6A 4HAIA 5GQQC 3K9WA 4JENA 1LGYA 2IXDA 3O8QB 3G2LA 4Y6QA 4R54A 1MO2A 2JGRA 2GXQA 3UAOA 4RHTA 2ZYIA 3CINA 4JP3A 2AF4C 2IYSA 4P4NA 2ZNEA 1VE6A 1QO7A 4PNHA 3V1NA 1MAWA 1I6WA 5I5EA 3QNUA 1PSZA 4JX9A 2FPIA 4RIFA 5IPFA 4Z3OA 2SCUB 5TB5A 1HFJA 1RWPA 4EFKA 4W5NA 5CXUA 4JEMA 1JI3A 4UUQA 5JI3E 3CR3C 3PJIA 3QKIA 2A3NA 2KPHA 3CO0S 4YDQA 4AZTA 2BP7A 1F60A 4CJXA 4CU5A 5K3AA 3MB5A 2AL7A 2QRLA 2EP8A 4CMAA 2EP7A 1TZCA 2XZPA 2FR8A 3FFAA 2BL4A 5GV7A 3V7FA 1OSNA 4B1FA 3INYA 1UOPA 1TCVA 2CXRA 3FDXA 4YJGB 5H02A 4RK5A 3IERA 1JZSA 4YXWA 1NVXQ 4JJZA 4MTLA 1JMYA 1FA9A 3C87A 3M7IA 3MJEA 4P5DA 2JFXA 1QYDA 2VUSA 1WUKS 4AN4A 1II8B 5HKLA 4F6RB 5EJ4A 5HQ3A 1XNQB 4BCDA 2ZBVA 2BGGA 3A1TA 2GPJA 2GBFA 1N3IA 4HMOA 5B36A 3DO5A 5FUWA 3E8XA 4DYDA 3TOZA 1T91A 2CJXA 4R9UC 2YZGA 3FSGA 2V4MA 4ZVSA 1ZNQO 2FPXA 1NUTA 1YMUA 3NETA 4CM4B 5HZHA 4MI6A 1N2CB 2YBDA 2C7BA 3X1XA 3S1SA 1OW4A 2G04A 1MEEA 5DLQC 5DGIA 4CT0A 5IZCC 4YBRA 4OVNF 3C1OA 3MGKA 4QC2A 4IKPA 5AI9A 5GGXA 1ETHA 2F9FA 4M87A 3S28A 1XP5A 2O2JA 1DOHA 2VH2A 3DPIA 5AM1A 4B48A 3PITA 4ZVTA 2NU7A 4S04A 4KV9A 4RKEA 5ALVA 3QEMB 1ZA2A 2XH8A 1O2DA 3DDNA 4BV3A 3RBXA 5BN5A 5AXDA 3FX2A 1QR6A 4HFMA 4PO1A 2WMYA 1BDMA 3IBTA 2RJ3A 3QW2A 5A5GA 3I76A 3HKDB 4LK3A 4Q9IA 3UPUA 4YMIA 3KWJA 4CCWA 1C7WA 2O0MA 5CA0A 5LQRA 1LBQA 1Q83A 1YIOA 4PCVA 4UNPA 5FADA 2G67A 2OY0A 4CFRA 2YCLA 3HB5X 2C3PA 4JLDA 1LPBB 2RHWA 5F7JA 1C0EA 3T3IA 4CUZA 5LYJB 2XUDA 3FMGA 1W47A 4TL6A 3K15A 2NZ8A 1YFLA 1LBEA 1SKYB 3ZHSA 3KSBC 4RZXA 1UPXA 3HEBA 4V0NA 5EP4A 1B76A 4Y6GB 4GRDA 5DNCA 3VYUB 4PQFA 3C48A 3SG6A 1FU8A 2ZSIA 4MINA 5IDWA 4H3VA 5JH7B 1PJZA 1T13A 4DLNA 2LCPA 3EUAA 4GX2A 2Z04A 4TMYA 2AMLA 3IHWA 4HEJA 4WTOA 5GV8A 5J59A 3OT5A 3OWHA 2ZAGA 1ZUHA 2VJQA 3OM9A 2OFPA 1FFGA 2RGBA 5HFNA 3T7IA 3PPWA 4MRYA 2C8VA 3DZGA 4J1TC 1Z75A 4M1WA 3IRUA 4G63A 3SEAA 1HLFA 2R2AA 3OJEA 3Q7TA 3VR6A 5DKFA 5CAEA 1V16A 3OLZA 4ZRNA 1ONOA 3DVQX 4LZLA 1AMOA 4EJSA 4B43A 5TY0A 3OMLA 4PAWA 4CQLB 5JHHB 2RI6A 3IAS6 3ZQ6A 3EY4A 1R0LA 4X20A 3HEAA 2IHZA 4IJVA 3HI4A 3SC2A 3JD3A 3GJ7A 2BKHB 4KLNA 1CWUA 3NV9A 4V2IA 3LHIA 1PK7A 3D7MA 1DAFA 1GTL1 3H2BA 1CY0A 1NKTA 3DMTA 4WN9A 5A4FS 2UDPA 1CF2O 3JWHA 3PUZA 1GTG1 4HSEA 1VQ1A 3CZTX 2CUZA 2IT1A 2XPCA 5M34A 5CM8B 3N7UA 1FCJA 3V46A 3U9TA 3M2TA 2P9QA 4NAHA 4DIUA 5FBVB 3RRNA 5AW2A 1LI5A 4IIGA 4NMXB 1IZ7A 2RB4A 1M6EX 3GZ4A 1UADA 4D46A 2INGX 2RB5A 5IT4A 3ZVKA 2IS2A 4M1EA 2OBMA 2PT7A 2DTEA 2WTXA 5TGDA 4UEKA 4ZFNA 1PR3A 1TNQA 4L8YA 1XRRA 4Z86A 4C05A 2OYRA 4V3BA 5HSGA 3H97A 4Q3BA 4K8OA 1OOIX 2JH8A 3ED5A 2FOTA 3Q10A 3OUZA 3TB6A 1ISMA 1VJ0A 3I28A 3ORHA 3AL2A 1E2NA 1T9DA 3UAYA 4YMVA 2JCSA 3KXKA 4PX5A 3VAZA 4DPLA 2CVOA 4QQKA 4JA0A 5KNDD 4AO7A 3H05A 1PKXA 4NMHA 5DN9A 4OK3A 1JLKA 1XNRB 4IRXA 3P2KA 4P84A 4PE7A 3FMOB 1ZK2A 1EK0A 3OPQA 2V3VA 3OQBA 4O2LA 4TOIA 5HJ2A 1NQ5A 3B1WA 2PRKA 2CHQA 1CR1A 3HVRA 1Z13A 1YS1X 2F1KA 4EL5A 2HO4A 3VZSA 2HMYB 4ITRC 1B1GA 1DX9A 3TNFA 1OI3A 3UJAA 1I10A 4EHLA 5CLJA 4NXNB 4ND8B 5DU2A 5E3HA 3SVZA 2YRFA 3RVRA 3G89A 4C6HA 2B4AA 1JB1A 4WLVA 4IDHA 3FKSD 1IWOA 3DFZA 4L95C 3IMKA 1JFFA 4QHSA 3TX2A 2BRUC 1VI2A 3S7ZA 3SS8A 1QSGA 3RODA 1DJQA 2FZKA 2IOFK 1ZH4A 1KQMB 1F0YA 2HEIA 5LFAA 2PGLA 4QGSA 1W29A 2TS1A 4QT0A 3VI4B 1E8DA 5L95A 1CZKA 5BSHA 2A57A 2BSXA 4JJEA 3A9WA 2CNNA 4OHKA 3ZLBA 4JLBA 4QFCA 2WB4A 1B8RA 1P2UA 2FJPA 2Q9UA 4YDHB 2Q7DA 4TLCA 4WLUA 1DFGA 5BSTA 3C6BA 5CCDA 2XMQA 1U1IA 2ABWA 2VQDA 3ZWVA 1TCUA 1KC3A 4ECEA 2IPMA 3CXRA 1CJVC 3G0CA 4GQIA 2BMJA 1LJLA 4JXKA 1NFFA 2C2ZA 4KVFA 3ZHRA 5I9LA 3GPLA 1F14A 3C3MA 3ECCA 1BTOA 3G2OA 1QJCA 3KOWA 3P0JA 3DONA 4GPZA 4YUAA 4NK4A 4NQZA 4KMMA 5E9WA 3PFBA 3PUYA 3ZNQA 1YZYA 1OZHA 4I1IA 1MEOA 1RI3A 3LBHA 1KH1A 2I80A 3GOFA 1O4VA 4GAOA 4PDZA 1TCOB 2VSXA 1DBQA 2R86A 3AU9A 5T41A 1QGYA 3PTZA 1NN3A 9LDTA 1W0KD 4V3CA 5BYJA 3KUKA 4A6EA 4AO8A 5JNWA 2MSDB 2QMZA 2WA1A 2YVQA 3R40A 1PU2A 4I5IA 1RBQA 1TQ6A 1U2DA 4AS3A 4ER3A 5C51B 2M1XA 2HO5A 2H57A 1GZVA 3LVRE 4RABA 2AQHA 3L7NA 3OQJA 4B2IA 2IP2A 1KK7Y 3D3JA 3OEHD 2Z2YA 2HM7A 2JLYA 2DQYA 2VJCA 5TLSA 2VO1A 1AO0A 4S12A 2QV7A 3H18A 3WY9A 3SQNA 1F06A 1E79A 1QRSA 5DDIP 1QVWA 5B7GA 3L79A 3EVRA 5IASA 3HVJA 5K8LA 3ZGZA 2CXJA 3RM1A 2CEAA 2ZJ5A 4LYJA 3T5CA 1TF7A 4MIYA 2I6GA 4BO2A 3S2FA 4UJ3A 4Q9HA 5DLYA 5DNVA 5EIAA 3CWGA 1BCSB 5CM2Z 2ZT6A 1S1MA 1Z2NX 1HKHA 1BE0A 1XDDA 1XKTA 3DC7A 3MJHA 3R24A 2HHAA 4EPRA 1N6PA 4KREA 1Z0FA 1VHDA 4PCWA 1DEXA 1EVYA 2EDAA 1RHJA 2OZLB 2ZEJA 4OJKA 1E7SA 2O7NA 4E2WA 1VG1A 2I4MA 4NE7A 2AFHB 2AUMA 2GAFA 1KI1A 2ZITA 3MLBA 4W1SA 3H13A 3PSRA 4U5QA 5DYIA 3ZUGA 1L5SA 4AKTA 2ZI5A 5JCOC 4LZPA 5IXSA 2H7CA 5A05A 1XA0A 1J70A