4C0KA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one calcium ion (ca-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0kA03
1WP9A 1A82A 1J8MF 1Z6TA 1Z3IX 2WZQA 4P31A 4U00A 4V0NA 4BFZA 1UKEA 5GJVC 4UQOA 5AUOB 4JL8A 1M46A 1FP7A 4TMTA 4TQUS 3C16C 4GFTA 2WWXA 3CNNA 5ER4X 1GRNA 1N6PA 1HT9A 3PN7B 3KXLA 2OPOA 3P26A 5AERA 3PEUA 1CTRA 3EZFA 2NOAA 3SYLA 3THXB 2IYTA 4YGEB 1R6BX 3UG6A 3VR6A 1NPQA 5HKKA 1SW8A 4BRWA 2ONKA 3B2EA 3FFAA 4LX0A 4CEIB 1VIYA 2AXNA 3SBDA 4LSGA 1ZC4A 1XX6A 2F6RA 1K6MA 2JLVA 4PALA 1AQUA 3BUNB 4L4UA 5JFGA 2PVBA 1RW4A 4IEIA 4NYIR 5FPHA 3L82B 1IN4A 2LKCA 1OH6A 4NYMR 5EZ6B 4C30A 4P4TA 1WF3A 4RCZA 1E9RA 2K2FA 2KB0A 1KAGA 1LB1B 4PE1A 1Q3HA 1CJUC 1IG5A 4ORAB 4MUBA 2L98A 1GNPA 2C04A 3P4YA 1I4DD 1UWOA 1U0JA 1RJ9A 1VYVA 2I18A 1DO2A 1KGDA 5D69A 2QA5A 3HJNA 3I4LA 2NIPA 2JIZA 2LAPA 3DEFA 1SKTA 1NX2A 1E32A 2FNAA 2ZE6A 4TT3D 4DDWA 1Z0AA 4JVLA 2KI6D 3H0KA 4XWAA 5JLJA 3W8NA 2IHBA 2JLSA 2NZ0A 4DIRA 1VKJA 3G5UA 4AK9A 1ZU4A 1N6OA 1DG1G 1ZJ6A 3CR5X 3VR4A 1DJXA 2BMEA 4NCHA 4MRYA 3BXKA 1HH4A 1ZD9A 3TLXA 3OHMA 3QKRA 5DI9A 2PT7A 5G3YA 4MRVA 2OM2A 3NEYA 5K8IA 1EG7A 1KFUL 3SBEA 2LLTA 2YWGA 4M2LA 3U6KA 3LLUA 1NUBA 4AURA 4MGYR 2JLWA 4UPGA 4B48A 2JZIA 2Y5IA 1NIJA 5AJXA 2KSQA 4B74A 2GXSA 3M6AA 3ICQB 4N0DA 1A2KC 1T5IA 3L43A 1KMQA 4FN5A 1X86B 2VEDA 2GF9A 4JLMA 2CEAA 1IAQA 5AR1A 4D4KA 4PAQA 1DJZA 4A36A 5JWHA 1X02A 3I5HC 3A58B 3EARA 1BJFA 1TUEA 3PR1A 1E79D 4TTPA 4YLGA 3B7GA 1KCYA 1WDTA 4ESHA 4FI3C 4RZ2A 2VHCA 1CJKC 4IDQA 3QBTA 3VR3A 4O2RA 5I2OA 1DARA 3Q8XB 4AWXA 2VSFA 1XD9A 1BG1A 4RD3A 3RS0A 3KJIA 1PVOA 5EE1A 3GLGA 2H1LA 3DM9B 4KBGA 1DAIA 2Q6TA 1LXFC 2EHBA 2H17A 1OKKA 4I1UA 2FPMA 4W5WA 1VG8A 2WAXA 4M9QA 4JLDA 2QT0A 2RAPA 3GJ8A 2IHYA 1G4AE 1Z08A 4HREE 1CDPA 2ZS9A 2RGCA 3D6TB 1OIVA 3KZ1E 2CCJA 3UMSA 2ZJ8A 1ZUNB 2ZJBA 4RZXA 2P6BB 2P3SA 2EQBA 3RRNA 721PA 2DR3A 3QEJA 3D8BA 3K0AA 2BKIB 1AVSA 3L0PA 2HCBA 2I3BA 1S4QA 2G1JA 2KBEA 2KSPA 2J45A 3FYHA 3LX8A 3EVRA 1H8ED 1OXTA 3T15A 5AFPA 3CF2A 4DDUA 3OEED 2IYLD 4GL2A 4HLDA 5IK2A 2G6BA 3O4YA 3BD9A 3L0OA 2CXXA 5H70A 2P67A 1W0KD 5M04A 3X1ZA 5EZ5A 2FFQA 5HKYA 4B33A 2H2KA 2WV9A 4YGBB 4Q9LA 3W34A 1GKYA 3WP0A 1TF7A 4I5JA 5HKZA 2RGXA 1YTZC 4GOKA 2ZYVX 5EE0A 5KNDA 2HT1A 2AX4A 3KTAA 4JMPA 1QLKA 4RSGA 1W36D 3IUYA 1MO6A 1NBMD 3I5HB 4M53A 1BOCA 2P0EA 1QTXA 4JS0A 1UPTA 3CZTX 3LDAA 4DKXA 4CGZA 4TZ0A 4JWQA 1LKJA 1U81A 2R44A 3VQTA 3PG5A 4P3YA 2FSIA 1CTQA 4TL8A 2M1KB 2OTGC 4ZPXA 2EU8A 3RDPA 2HJVA 1JF2A 4R98A 2O8DA 4V0KA 3L8ZA 1TNDA 3ZGXA 1SZPA 5KO2A 1E4YA 2X2FA 1SXJC 4DIDA 3ND8A 3QG1A 2GHIA 3CGAA 3KFXA 3LD9A 3GFOA 2GAAA 4DJTA 2OXRA 1XP8A 5LD2B 3KQHA 1KHTA 3MSXA 1XFWO 1MQ1A 5G53C 1DMOA 1NBMA 3OIVA 1BO6A 3CH5A 3VR1A 1TCFA 3K70D 3QXCA 1GNRA 1N65A 2OEPA 4O3MA 3AGPA 4DUGD 1G3UA 3CLNA 1KI7A 1QZXA 2HQ8A 1VIAA 4Z54A 4Q4AB 1YZTA 4KFRA 2C99A 1GL7A 1KQVA 4ESVA 1N5KA 4HZUB 1GILA 2KHNA 1CU1A 1F5NA 2I7AA 2PT5A 3FFBA 4LV8B 1Z29A 3FVQA 4NYMQ 3EZ9A 4NYIQ 1QVIZ 1UDXA 3RABA 2CNWA 5FUWA 4ILEA 3O6BA 1OSNA 2BBNA 5AUNB 4V02A 2QU8A 4PC2A 3FWCA 1KSJA 3KJHA 3ZLJA 1Q1BA 3WBKA 3OIYA 2YOHA 3QENA 2CJWA 1UDWA 1FBVA 3SIBA 4KLNA 1F2UA 1JXMA 1L2TA 2A5FA 2GBLA 1XXHB 1JAIA 2FPLA 2YVUA 3RS7A 4P5OE 4BY4A 3O2PA 1S2MA 1G291 3EIEA 3TUYB 2PCLA 4C0LA 2N1BA 2PJZA 5EXPA 3GLHB 4KFTA 1EWQA 3U5ZB 2SCPA 3DF0A 3ICBA 1QG4A 2GZAA 2ZAOA 3T06B 1K94A 5CIQA 1F54A 4UXIA 1XMSA 2FF7A 3U6BA 2LVKA 3AAKA 1DJHA 1AGPA 1R5BA 5BXQC 1M74A 4YXWA 1H4BA 2GEDA 3T5DA 4CEIA 3MSEB 1AM4D 1FL9A 3LCPC 2IYUA 2YOGA 1YQTA 2KQYA 3RS5A 3VRQA 1SVSA 2JLUA 5DE3A 1TADA 2QTFA 4HAWA 2BOVA 1OE9B 3AVYA 3RS4A 2HXSA 3KXIA 3CR8A 3MRSA 4LUCA 5EXXA 4UXJA 1QRAA 1EX6A 1TUIA 2J41A 2ZRDA 3D31A 2KFGA 4Q1AA 3NH9A 1AQYA 4URZR 2WIAA 5DHAA 2BCGY 2FU5C 4Q48A 3CWZA 4D6PA 3HCMA 1MR8A 4QGGA 2IS6A 2OHFA 4LBYA 1KYIA 1XFZO 2C9YA 3F0TA 3NVAA 4M1TA 3IEVA 3FB4A 3RLZA 1FUKA 4DDTA 1EFUA 4A15A 2DB3A 5F9HA 3SEAA 1JFKA 4TMVA 1B8LA 1E2QA 2ZRJA 3CZQA 2G9NA 1OFIA 3I5GC 1E2MA 2PL3A 2R6FA 1NN0A 4BUJA 2OLJA 3PUVA 1L2OC 4BZXA 4N1GA 1ZM7A 1ZUHA 2F43A 2WJIA 4EPRA 2H61A 3KEVA 1NLYA 2B8TA 1OH8A 2QQ0A 2FOTA 1DOAA 1II0A 3BORA 2WVJA 3C14C 4GNKA 5EE3A 3OFND 4PC1A 5FOUA 3RRMA 3TE6A 5CJ2A 3R7WA 2PMDA 3C7KA 1QX5B 1XDBA 3IGFA 5TB5A 5J47A 4Q01A 4CT5A 3K0CC 2F3YA 1YE8A 2P5TB 4HRGA 5JMTA 3GK1A 3EIHA 4MKHA 4JLVA 4QJ3A 5JHHB 1KWOC 4GBAA 1GRQA 4JVMA 2XTMA 5CIWA 3PENA 3TSZA 5ELXA 3GLIA 1S36A 3LLMA 1XZQA 2QN6A 1W7JB 4N5XA 1MO5A 2QMHA 3OF5A 3W3ZB 1E2DA 2AFHE 4L8GA 1AS2A 1AN0A 2ERYA 5CJPA 1TF2A 2FGKA 4EFNA 3LXRA 1SRAA 4YGCB 2FFAA 1QJTA 5IDVA 2JT0A 2IS1A 2JEOA 2K5UA 3LVRE 3SU8A 1IN8A 4DT1B 1E1QD 4AG6A 4YMWA 3FMFA 3KQKA 3DDCA 1CMGA 1ZCAA 1NJFA 1OW3B 1P3JA 2FWRA 3ONWA 4LOAA 4KVGA 2I4IA 5L3QA 1ESMA 1FW4A 2KGRA 1WCV1 4TMWA 2AL7A 4DRZA 2D4HA 2ZREA 3CO5A 2PJRA 1II8A 1Q57A 4KSCA 1OB5A 1CJMA 4MH0R 1ODBA 1SVLA 2BBMA 3DPUA 2ZE5A 4WIAA 4MZKA 3RC8A 1N6IA 5FTMA 4QJ5B 4OKHA 4YI9A 1KDPA 2WOSA 2M7LA 4LBWA 1N6KA 3ASZA 3P4XA 1EGAA 3BJIC 1P2SA 3CR4X 1J1DA 2BKHB 2PX0A 1BYIA 1ZINA 4OI2A 5EQTA 3TRFA 5FOVA 1DAGA 2RB4A 2A78A 4UNPA 1IXSB 4LCBA 3AF3A 1R0ZA 1XMJA 2K8MB 1SKYE 4OI4A 4PR0A 4KYIB 1NJGA 1QHYA 4IVRA 5A0FA 4E07A 4YQFA 1Q80A 1ZM9A 2IXFA 2WCBA 2MSDB 3W6PA 2ZYWX 5I2LA 1W7IB 3TBKA 1SVWA 3AVQA 3NDBB 4OI0A 1R0YA 4F91B 2ODEA 1IJFA 1AZTA 1KJZA 2UZIR 1W5SA 2V8OA 1ZAKA 1E2PA 4URYR 5ANRB 5KHOC 1YR6A 1Z6YA 4P33A 1TQ2A 5LDDC 1UP5A 1R8QA 2CMKA 1NSTA 1QHHB 2WKQA 4PSKA 1XEWY 3KTAB 1UUSA 5C46F 1FTSA 1YJ5A 1W36B 1KO4A 4M0LA 5KYKA 1CB1A 1W0JD 2OXCA 1UBEA 2IYWA 3BH6A 1IY0A 3W6NA 1SCMC 1JR3A 2IL1A 1W47A 3BE4A 3HDTA 1K9KA 3RS3A 2ZJ5A 3GLGE 3PATA 4ZCMA 1AKYA 4HATA 2QPTA 3U2QA 4QGFA 2XGJA 2O8FA 1DJGA 1MABA 3MJRA 3R8FA 5FI0B 4CEHB 1D9ZA 4MYTA 5JRJA 2Y1NA 3UANA 3IHWA 5FYXA 4BZQA 1W1WA 1Z8FA 4EPYA 3PITA 3F3YA 2D06A 4HZIA 2QAGC 4JLKA 4AKIA 1F4OA 1CKEA 1RIFA 1R2QA 4CFRA 1KNQA 3ZJYA 1GRRA 2N46A 2J0SA 1Q12A 1SPYA 2D62A 1G17A 1K8UA 2CTNA 3REFA 1NRJB 1FNNA 2YZ2A 4JT2A 4OL0A 1A2XA 5JSZA 2ASEA 2C5LA 5DKQA 3SC3A 1YUSA 2FE4A 1PRWA 4IEEA 4LPKA 3VU9A 3U7FB 1PUJA 4ZKDA 2IYZA 2B6HA 4M1WA 2IWRA 4BQSA 1X1SA 4JBWA 4V0ME 4QJ4B 2ZRSA 1JEDA 1OFTA 4ZI3A 1QVRA 3I5IC 5E7JA 1II9A 4DLWA 3VROA 4BE7B 3FHOA 1NG1A 1CR4A 2J87A 3GJ7A 1KI6B 3OE7A 1MHOA 1CMFA 4GSYA 2VRGA 4XTCS 1NF3A 1JQJC 1Z0DA 2WC8A 1M34E 2G77B 3IBYA 2QPAA 2VIIA 5GJWC 1NVWQ 3W6OA 4DUQA 4MVFA 4PHFA 2YC4C 5JI3E 2NMVA 1OFUX 3RANA 3BFKA 2ZETA 4YDHB 2B21A 3AEZA 5FFMA 1G8IA 4PHJA 1N25A 1UHKA 1E6CA 4P0TA 1EFTA 2OBLA 1G18A 2AK2A 3CWGA 2ZJZA 3PALA 3CRRA 3EAQA 5J4YA 3OX6A 5FL7A 3V9PA 4RD4A 4MRRA 2C9OA 1RROA 3MWJA 5AUQA 2O5GA 2BE6A 2Y4QA 2QAJA 4CEJA 3DF0B 2WICA 3KKQA 4ZIRA 2VHJA 5J4VA 1UHIA 1KFUS 3A1VA 4DXAA 1G21E 2J0UA 1YR8A 1DVIA 2HT6A 2VRWA 3UWOA 1TU3A 1GOTA 5J4HA 1S3PA 2A9KA 1ZCBA 4TMXA 3EKJA 2WWHA 1DJYA 1P72A 3KL4A 2O8BB 1FNMA 1YVDA 2J5XA 3B82A 2LHIA 4QXAA 3BOWA 2N42A 4ZCIA 1ZNWA 1U8AA 4C0SA 4DHEA 2J3EA 3B13B 5DIFA 4LHXA 1SYMA 4NDBA 1DAFA 1HTWA 2MLFC 1W4AA 3WHKA 2LKDA 2GJ9A 4NCJA 1DAHA 4M2PA 1CS4C 3OESA 2GCOA 1K95A 2LE9B 2CBZA 2OTGB 5AJWA 1Z07A 1X8KA 1XD2A 2YWEA 1XK4C 4ZCVA 1RJVA 4URVR 1XA5A 4TTRA 4Y0VA 1XTJA 4FMBB 4A0GA 1Z0IA 2LMVA 1A1VA 3H4SE 1XTRA 3K0AB 2K7BA 1RJ9B 1GKUB 2C78A 3K70C 2O0JA 4AG5A 1BMOA 3LAWA 4JBYA 1VYUA 2AKAB 4R71A 4KCGA 1M2OB 3CWQA 1KI8A 2GTPA 2EYQA 4IVPA 4D4JA 4PZZA 1AJ5A 3O8CA 1OPXA 3W90A 5E7IA 3JVUA 2BE4A 2PLRA 5DYIA 1R0WA 1S96A 2WHXA 2XZOA 1SR6B 3GLGB 2W6JD 1P4SA 2KJQA 4C0AC 1YRUB 2BBTA 2HYDA 2WJJA 4B73A 2WKRA 3CPHA 2HLDD 2KQ6A 2MA2A 1J70A 2HF8A 1OHHA 4B3GA 5JJIA 1E79A 1KAOA 4OK3A 3FDIA 4E68A 1L4YA 1S5GY 4USLA 3FMIA 4G0NA 1CFFA 4M1SA 5KSPA 3I5YA 3LBNA 3U60B 1KNXA 3Q9LA 3VGOA 1GTVA 1Q1ZA 3PN7C 2WWWA 3R9WA 3VKGA 4B43A 1SVKA 2JCSA 1YR7A 1JALA 2CLDX 2G9BA 2ZR7A 1WRBA 3AKDA 4V03A 1OXUA 4TLDA 1Z28A 2G83A 4JLNA 4HB2A 4TSFA 1A4RA 2REBA 1SULA 1RWYA 3DVEA 3EX7C 2ZN9A 1S1EA 2OV2A 3FPAA 4MGKR 1G33A 2AFIE 5F6TA 1Q22A 2R65A 3FMPB 2ZRBA 2Z83A 4JJKA 3DZ8A 4LYJA 4D0LB 5D7FA 1D2MA 3DKPA 4DUGA 5L3SA 4LJ5A 2WJGA 4PAOA 3B1ZA 4U5XA 5FPSA 2YNMA 2ZRMA 4AY2A 1CEEA 4PANA 1CFCA 4Z8YA 1GDDA 2AD5A 1FZQA 5DYGA 4B6EA 1Z63A 2IC5A 1N2DA 3TQFA 4E09A 3SQXA 1XPUA 4PHTA 3V4RA 1EJ3A 3I5FB 3TW8B 1MR3F 5EE5B 4D0GA 3ZVMA 4WXPA 1PALA 3KKMA 5FBLB 4A1FA 3NEJA 3K0FA 3U61B 4Q03A 2V3CC 4DCSA 1B8RA 5G08A 3C5HA 3ND9A 2VP2A 2IYSA 1GM5A 4B44A 3BS4A 2WMNB 4PC3A 3RC3A 3ZQJA 4B75A 3VTKA 1E8AA 4EJSB 3CM0A 3EW9A 1I2DA 3GEEA 3IQOA 1NG9A 2BCBA 3C15C 4PHMA 3LO5A 3AVTA 2JWWA 1RRPA 1TRFA 1YVLA 4Q4JA 2BL0C 2JXCA 1F70A 2B8WA 2QPOA 5CDFA 2W6JA 3AUYA 2IXGA 4GOJA 1SL8A 1LY1A 3LV8A 4XVQA 3SDZA 4B2PA 3A36A 1A29A 2GESA 1QHSA 2Q0HA 1PLLA 3QVVA 4N0EA 5HKKD 2O8CA 4WA7A 1KI9A 3DVKA 1DGUA 4TN1A 2PMYA 2C77A 1XFAA 4GI7A 3HU3A 4M21A 1G41A 3NWJA 5AJYA 3G82C 4BLQA 2JDIA 2FCDA 2PSRA 4DCKA 4LJ8A 4WZ6A 3SFVA 4X8MA 4A2QA 1KI3A 1PSRA 1F60A 3GD7A 3KB1A 3X2SA 2YWFA 4GBMA 4FCWA 4WXRA 3CNLA 5BYKA 2JJ2A 2EC6C 3KJGA 2CL0X 5DHFA 3QE0A 4AYXA 4B2IA 3K9GA 1JXOA 3A1UA 4D26A 2VF8A 3UPUA 4M9SA 2ZI9A 4I1OA 2VP5A 3CRMA 2FCEA 3RM1A 4KBFA 1KZGB 4A4BA 1E0AA 1JB1A 1TNQA 3EG5A 2OLKA 4K46A 1BKDR 4PO9A 3OP0A 1UKYA 4KSBA 2ZSDA 1COWA 4R9UC 1KO7A 3BUXB 3PJRA 4QBGB 1F2TA 4YGDB 4WQ3A 4HZUA 1BR4B 1KMHA 4D81A 4ZDJA 3LBIA 3ZZTA 1EG4A 1NWDA 1JPNA 3A1WA 3TK1A 3VKWA 2FFBA 4OQXA 1KFXS 1HY3A 1HQCA 5G40A 2KGBC 4AKGA 1Z83A 2GCNA 5KPJA 4BGDA 2M3WA 3HP1A 3BUWB 4ZDIA 1UM8A 4DLUA 3T1OA 4E5UA 4I4LA 2VPPA 1KFXL 3JVVA 3MWKA 3NBFA 3VR2A 4A8JB 3JTDB 4GZMA 3OB2B 2ZE8A 3NKVA 2GJAA 4DVGA 1IY2A 4KAXA 3BBPA 5C2JB 3NIBA 1Z6GA 1R5OA 4K8OA 5JECA 1QDEA 3BRWD 2C8VA 1JFJA 1UF9A 3GLFA 5EXSA 4EAQA 2CNPA 4EQ6B 4NDDA 3CIOA 2O8BA 3ZD7A 3QG5A 3ASYA 1SGWA 1A5TA 3TDUA 4Q1DA 3LVQE 4GFDA 2PMKA 3KUCA 4FXPA 4QGHA 5CB8A 2ODBA 4B2LA 1QS7A 2GRJA 1MUXA 2NG1A 2YHSA 3ZVLA 4EIWA 4PQYA 2VP0A 1RYHA 1UFQA 1J7KA 4MDEA 2VTKA 4KODA 4OHXA 1GJYA 1NSHA 1NX0A 2G2BA 2GJ8A 2ZEJA 3R7WB 4URXR 2FV8A 4M1YA 4WOPA 2YJTD 3NXSA 1SVMA 4UKDA 3TVTA 5KNCA 3FE2A 4P4UA 3AP3A 5AUPB 4L5BA 3NBZC 5K8UA 4HUQA 3EWSA 4U7DA 4OK5A 1SK6D 3NSIA 3KQLA 1OJLA 2JNFA 3EA0A 3LW7A 1VCMA 4G5QA 3FOZA 2AD1A 2ATVA 4AYTA 4R2HA 3IIKA 2LM5A 4PE4A 4OK6A 3GK4X 2F1HA 3GLFE 3AKCA 1U9IA 1C1YA 1OIWA 1XTKA 2FX3A 3QOFA 1CDNA 1OXXK 1F3OA 3TSWA 3I61A 4C0BA 1P6XA 1W49A 3JZMA 3HYRA 3PEYA 2QBYB 1E2LA 1Z2AA 3FWYA 2EFCB 4OVNF 1NIPA 2X8AA 3AF4A 5L3QB 1KJYA 2GAOA 3P27A 2BM0A 2D7CA 1CRPA 3IF7A 4XD7D 4Q7KA 1II8B 1RRFA 1AS0A 2AR7A 1O87A 5CDFE 4ACBA 2REXB 2F8PA 1JEEA 1QIWA 4LYHA 3SR0A 2PEYA 3IBGA 4LJ4A 3AKAA 2FSFA 2PBRA 5IRCD 5L3VA 4G5GA 3HR7A 1XFUO 1CJVC 3SS8A 1K5DA 5A4JA 3GFPA 3TR0A 2M29A 2CCGA 1XEFA 5A5GA 1LA0A 2C96A 3PEWA 1BLQA 4ZI2A 1JJVA 4EPWA 2A3RA 3OAAA 1TNWA 2B1UA 2CHVA 1SHZA 1NMZA 1G4YR 1WA5A 4QHYA 2EGDA 4OJKA 1NLFA 3BYAA 4IRUB 1HE8B 2IA5A 3ECCA 3PFIA 3MMPA 4Q1EA 1N0WA 2Q21A 4RKEA 1E9CA 4XIGS 3UXMA 1H8HA 1NBME 2EFDB 4Z1MD 1LNZA 3DMDA 1GIAA 3IQXA 4HYYA 2M7NA 4LRWA 2AN9A 1DF0A 1F4QA 1TCOB 4G3XA 5FL3A 5IBWA 2FJUB 2EWVA 3EK7A 5CSNA 1R10A 3IIMA 1I4LD 3LNCA 2VSOA 3QBVA 3SI7A 1W2GA 3KPXA 1RKBA 3U7EB 5FTLA 3I32A 1CR0A 1E2EA 1C7WA 3ZNIA 1YHNA 3IQQA 4CFQA 1NN5A 4HAXA 1XCPA 1P75A 2MMGA 1MT0A 2ZUDA 1AKEA 3QSYA 1OV4A 1Z0JA 4WAUA 2DFNA 2D2FA 1YR9A 1KJWA 3PUXA 3QNUA 2MMCA 1B0UA 1MRSA 4M2QA 5IK2D 1S6CA 4US2R 4XSHA 5KU1A 3AP1A 1E1RD 4EJSA 1M8PA 2XXAB 2O8EB 4WZBE 8OHMA 4C2UA 2YOFA 3H84A 2ZFDA 1KKLA 2CXJA 2HLDA 2QQEA 4ICBA 3CRQA 3QF7A 5DN6A 1XVJA 1HQYE 1N5IA 1YZKA 3ADKA 1R2UA 2QP3A 3BAFA 1W0JA 1WQ1R 1K2HA 2QENA 2NZJA 1XEXB 3FTQA 1E9FA 2IYQA 4YMTA 4B34A 3I72A 1K93D 5AWFC 4J0QA 4MN0A 1M1YE 4NQGA 4B76A 1VHTA 1CDMA 2XNSA 3WY9A 5J4LA 5FOXA 1G3QA 2FZ4A 1G8FA 4CIDA 3E5HA 1KOFA 4LJ9A 2WJHA 1ZD8A 2QTVB 3MAAC 1KI4A 2IF2A 3GLHA 5K8LA 2GZDA 4DB2A 2J46A 1A75A 4BLOA 4CEHA 2ZJYA 4NDCA 2G88A 2WPDD 1E2GA 2DBYA 2E9SA 1FMLA 1XCGB 4PPGA 2V53A 1ZNXA 3PLFB 4HDOB 1KY2A 2R9VA 1Q20A 2CK3D 3THWB 2K2AA 2LV7A 1IKUA 3CKLA 4BFTA 4W9MC 3IPXA 4TYYA 3U44A 2NGRA 2HXYA 2A5YB 1QXPA 4GNKB 3B5JA 1G1MA 2YWHA 3Q5DA 2L2EA 2ZR9A 2W6ID 2WSSD 3KKOA 1S5GZ 3OHMB 1EG3A 3QKRB 4L9SA 1V1FA 4POAA 1Z47A 3GCGA 1P7CA 5BN5A 3GLHE 5KOYA 4CRWB 3KO0A 2A5JA 3CZPA 4IOKA 1TX4B 4W7SA 3AVUA 2PZEA 5EP2A 4AC9A 4TLAA 5KSYA 1QHXA 2NCOA 3KQUA 4NYJR 4Q19A 3MWLA 1EL4A 3JVTB 1KO1A 2J0UB 2YINC 3H1TA 4ORBB 3K70B 1KMHB 1CBUA 3WMEA 1JAHA 1E2IA 2MSCB 5JJKA 1L2OB 4PPQA 4DLVA 3Q3JB 1E0JA 1KI6A 1OMRA 2W2TA 3PEVA 4HLUA 2IS4A 4PDZA 2NTYC 3I8XA 4IDHA 4Q04A 4IW3B 4TT3A 1PULA 1QX2A 4A9AA 1NKSA 1DAEA 3I62A 2V1UA 4PHKA 2F1JA 2F3TA 2XTNA 5EP1A 4XJXA 3AKYA 1SVIA 1AK2A 4A0HA 1QBKC 3T1QA 2JLYA 1VMAA 5CPVA 3LL8B 1M7BA 2DPXA 2F2PA 4Q9JA 1KI1A 3CB4A 2DWPA 1NN1A 2B7CA 2RGNA 3CH4B 5FOWA 2SHKA 1M6NA 1XJQA 1SL7A 1XWIA 3H4MA 3MJHA 4JJZA 1NLZA 1YUUA 3U3OA 1Q0UA 4W5JA 4I1SA 1EXRA 1G3RA 2RH5A 2X19A 1WLZA 3A4MA 3EC2A 4D80A 3SNHA 2BV3A 4PE7A 1W5TA 4H1UA 1OYYA 2AK3A 1DO0A 4D25A 2GV5A 3VAAA 3PSRA 1DADA 1KSHA 2JRFA 4OV2A 1JQLB 1T6NA 2BEKA 2BCXA 1QIVA 2R62A 1CIPA 1SHKA 2XJ4A 3NH6A 2HUPA 1H8HD 4Z1MA 4FCVA 2I94A 1DELA 3QKSB 2FN4A 2AMIA 4ZV4A 2GBLC 4KFSA 4M2OA 4LI0A 4PFSA 4PC7A 3TNFA 5KDOA 1E2HA 1EWRA 2LP2A 1I2MA 2Q9BA 2H5EA 1Y0VH 1BOFA 3DO6A 4ASUD 2PZGA 1SR6C 3AV0B 2E6WA 4NP6A 1LVGA 2GEVA 1RFLA 3QEOA 3ICEA 2M97A 1E9DA 4LYAA 3DMNA 4XJKB 2GWHA 4TYQA 4D4MA 4F7WA 5B30A 2L4IA 4LJYA 1LS1A 4IXNA 1LINA 2JQ6A 5DI3B 2COLB 2NO0A 3HYTA 3LX5A 4JL5A 1K9PA 3I5IB 2OILA 4R7ZA 2VP9A 1N6LA 2OG2A 1UHJA 2OCBA 1OOJA 1XFXO 1GVNB 1XNJA 2XAUA 4QOSA 1NI3A 2CE2X 3HX4A 1S9HA 2VF7A 1XTQA 2CLSA 4IL1A 1Q21A 3GMTA 4ON9A 2Q91A 1TEXA 4S35A 4PHGA 1EFRD 3P20A 1U98A 3EPHA 3CPEA 4RFSB 4HSEA 1GP2A 1ZNZA 1DS6A 4I81A 4NH0A 1B7TY 2YKGA 5FTKA 1OQPA 4BLRA 4LZZA 1HUQA 1KIMA 2C03A 2IXEA 1Y3AA 1W4BA 2M49B 1IGVA 1IN7A 1GUAA 2AWOA 2JLRA 2JLZA 2BDTA 3ZQ6A 2BCJQ 1U5IB 3EK8A 1HYQA 1OXVA 2JJ1A 2REOA 4C4PA 1GQMA 4LYFA 3SHFA 3WNDA 4KV9A 4LK2A 2X2EA 3SJSA 1HURA 4NZYA 1X1RA 2H92A 2OT3B 3N2EA 4YMVA 2RGBA 3JVTC 1IY1A 4L9WA 4DLZA 2JASA 1YZUA 4OQFA 3W8RA 4AIIA 3B1XA 3BWDD 4PC6A 2NPFA 3N70A 3DHWC 1G3IA 5GQQC 2AXPA 4Q4AA 3F8TA 1JWDA 5J3XA 1KDRA 3MD0A 3PV0A 2GF0A 5E3HA 4LBZA 1XCMA 2ZR0A 1P2UA 3M1IA 1NX1A 2KFFA 2V7QA 2VO1A 2XNDD 4WZAE 1D6JA 1J7RA 3AAJA 1A7JA 2F2OA 2Y8EA 5L3SB 1MRNA 1RE0A 2KNEA 1AGRA 1QHHA 4JQ0D 4I5LB 3U3MA 5C1BA 1XJCA 2WWFA 1ALVA 4HLCA 5E95A 2R2AA 4B35A 2YYZA 1W2HA 4IOJA 5JHGB 1IN6A 3R9IA 4Q4HA 2LUXA 4OQNA 4QFMA 1FPMA 3IO5A 3BH7A 1QV1A 2B7BA 2LVJA 2JA1A 2WWIA 2GXAA 2O8FB 1HV8A 2ZSBA 2NPIA 1MABB 1KK0A 3K53A 3GEHA 4PX9A 2RMKA 5DLQC 4US0R 4BLTA 4CYMA 2C2HA 3EKHA 4FQOA 1ZIOA 4CZ2A 4QM6A 1G9XA 1SXJE 1PK0D 2UKDA 1V1GA 2M8UA 3VRPA 2GJKA 2D8NA 2GXQA 1KDTA 1J8YF 1XEXA 1XBTA 4GGFA 3LK1A 2EC6B 4MYUA 1AP4A 1M39A 3CBQA 3L2OB 4F4CA 1YU9A 4FWIB 3J81k 2OS8B 1J7PA 4DLRA 1IJ5A 4IDOA 1VG1A 2ZE7A 3K9HA 3U3KA 2A5GA 4XTRA 4BFYA 1NY6A 2W6IA 2WSSA 5KDLA 1ZD1A 3B1VA 4FMCF 2AWNA 1F2TB 4IVQA 4B6FA 2OUKA 1QVAA 4BLPA 3W3AA 1N0UA 3A37A 3BH0A 1KSGA 3TSOA 3BQ3A 1ONBA 2KI4C 4US1R 3OEEA 1AA9A 1HT1E 4QNMA 2PASA 2CDNA 2J9RA 5DSZA 2H16A 1VHLA 5JEEA 1EFCA 1BH2A 4N3NA 2F9MA 1KKMA 1CF4A 1J55A 5JS7A 1YVHA 1IJEA 1A2BA 1H65A 4QNRA 1QASA 4Q18A 4Q1FA 2QUZA 3AUXA 1CDLA 2R2IA 2ZYTX 1HQVA 3MWYW 521PA 3UKDA 4A2PA 1CLUA 1B4CA 1OFHA 1A03A 2QGZA 2ZU6A 1P9WA 2KAVA 3IILA 3TZ1A 4M1MA 2JDID 4QHSA 3T5GA 3U3JA 2QP9X 1ZMZA 1JJ7A 1U94A 1JUOA 1N5LA 2OE2A 3GOFA 1B7TZ 1ZNYA 2GCOB 3WMGA 1W36C 4D1EA 4DB4A 1J90A 3NBXX 3GLFB 2WNDA 1VECA 3CR7A 1G8YA 3D7MA 4TZ6A 1OZOA 4A0FA 3RRYA 2WAYA 4DCNA 4JLPA 3F5FA 1TNXA 3QKTA 5J4KA 3ZIAD 4BEJA 2ZRCA 4XWOA 1UKVY 3ZH9B 4JZKA 4HSZA 3U7GA 4A6XA 4WBSA 1WY9A 3WRYC 4QRHA 2Z4RA 1QV0A 2RGNC 3KJEA 4C2TA 4IOLA 4F38A 1US8B 3QF4B 4BY5A 4PAMA 3CW2A 3E1SA 4HDCA 2DFTA 2VYFA 4RD1A 4G1UC 2ZI7A 3WP1B 3TUZC 2RHDA 3RAPR 5GJBA 2NCPA 2O5VA 4NCKA 4GMDA 1ZM3A 4PXAA 4C9BA 5CYOA 3NC0C 3LK0A 1DEKA 2YC2C 3QY0A 3T61A 1IQPA 3NSOA 4HRHA 3PQCA 4PSVA 2JOJA 3RSOA 1H8BA 2IUTA 3AF2A 2KYFA 4HLUC 4LY6A 3KKPA 3QPWA 5LBIA 2GGZA 3RSLA 4XVRA 3K8YA 4QJ5A 3RS2A 5CM9C 2X77A 1G8HA 1MOZA 3CX8A 4MRSA 1N0VC 2V4ZA 3CF0A 5KNBA 1Z0FA 2ZROA 4IHQA 4BASA 2LWIA 4MZLA 2JJ8A 5TARA 3K0FB 1G7CA 1J7OA 4JYCA 1UKZA 5EXTA 2ZRAA 4Y0AA 3NBYC 1SXJD 2R8RA 5AEQA 1DTLA 2IUSA 2F3ZA 2OFXA 1OF1A 1Y63A 4P2YB 3BB4A 1DVRA 1T9HA 4C7OA 4FMDB 2CL7X 1GZSA 5DN6D 1TTXA 2DYKA 3PXGA 1NN3A 5B58C 1T0HB 5DI3A 1DG3A 4HUQB 3U7HB 1P60A 1LA3A 2MSEB 2ZVPX 1D5CA 1OB2A 1KQMB 1BMFA 5BN3A 3V4FA 1ZACA 2A4JA 4A82A 2W0MA 4IOMA 2EFEB 4B71A 1CR2A 4QM7A 3R9XA 5JI2E 1XB2A 4DLSA 3C1VA 1JPJA 4ACAA 3B78A 1J99A 3TS5B 5FBWB 2OCYC 1YKSA 4WRIA 4GAOA 1G7TA 1YRBA 2GVDC 2GZHA 3A8TA 3EA5A 2GVZC 2RKOA 3FKSA 4DLXA 1M31A 5HR5A 2F3RA 2ZITA 3O8DA 2XXAA 2O8EA 5L8VA 1W48A 1ZBDA 2QE7A 1TU4A 3BUOB 1WDCC 3AVWA 4PHNA 2HCJB 4ZO4A 1ZIPA 3B85A 3VRRA 3SG5A 1VCOA 4QHTA 2J0VA 3C4JA 1NX3A 1O3YA 5D3MA 5PALA 3VR5A 2IX3A 1WDCB 2MHHA 5DKNA 1U8ZA 2NO7A 5KSOA 4MYCA 3AGQA 3KHEA 1PV4A 1T3HA 3EZ7A 5J40A 2BMJA 3LQRA 3IKJA 1K9UA 2Q9CA 3KQNA 1L7ZA 2D74A 1NNEA 1W4RA 5F2EA 3FGNA 3Q7QA 3EASA 1IBRA 3AQ4A 3NSKA 2FA9A 2QRZA 5JWOA 4NYJQ 4EKDA 1N6RA 1IH0A 4YMUA 3T35A 5HTKA 3AM1A 4O0MA 3QIAA 2KOTA 3GFTA 3KB2A 3DM5A 2OFWA 3WNBA 3EK4A 3U4QB 3E70C 3THOA 5H8WA 4HEJA 2FDCA 3SJCA 4RZ3A 1L7VC 1VG0B 1X3SA 2JNXA 2KBFA 4QC2A 3FS7A 1CKKA 1SXJA 4U02A 3SHWA 3MUFA 1RECA 2CVHA 2XOKA 1KSFX 2HQWA 1GAJA 2UVQA 4PCWA 5C4GB 4ABYA 3F45A 4FIDA 1XD8A 1TN4A 5BN4A 3T1VA 2L50A 2ANBA 1UADA 1XMVA 1VG9B 2D2EA 1PLJA 2ZQ5A 3NTUA 5HPYB 1RRGA 4KI0A 1E94E 4ZIRB 2ATXA 2EWWA 2VL7A 3BXZA 4DSUA 1OIXA 1Q1EA 3DVLA 3MCAA 3EPLA 2L0PA 3OX5A 1T8UA 1W46A 1W4CA 4M8NE 3VFDA 1B47A 2OO7A 2A2ZA 2C9CA 2ZRFA 5FUXA 1S3SA 4OYHA 1Y1UA 3TUIC 4A4CA 2CBLA 1TEVA 1NY5A 4ARZB 1CNPA 1M7HA 5HKWA 4JVNA 3SJZA 4CW7A 1RZ3A 2MBXA 2JXLA 2KYCA 1C9KA 1E0SA 1G5RA 3SG4A 3I5XA 1DAMA 2TMKA 2KAXA 1XPRA 3ADBA 4MYHA 2QM8A 2IT1A 4MZJA 1U0LA 1P9RA 3I8SA 3IO3A 5CSJA 4IKEA 2EFHB 1XXHE 4A8JA 4PTLA 4HUTA 2JULA 2MLEC 1LFDB 5TVKA 1DTSA 1NCZA 3A1TA 2K7DA 5UKDA 1XYDA 4DRWA 4C3ZA 2ZI3A 1OYWA 1IQ3A 4HB4A 4BZPA 3SIAA 1Z22A 3LQQA 4TL9A 3AP2A 1N2CE 3NHBA 2GETA 4LJAA 3HWSA 2VQSA 1GSIA 3SYNA 1KK7Z 2PALA 1S6JA 3AH8A 3W9YA 4QGAA 1VCIA 4CVNA 2IF0A 5BW8A 1IOZA 1RC8A 421PA 1Z5ZA 3DOEA 1D2EA 3Q7PA 4FW9A 1BMFD 5D3QA 3NHAA 4F93B 2EFGA 1AJEA 1XFVO 2C95A 3LBHA 1PVBA 3OZXA 3DVMA 4B32A 4PPFA 2JJ1D 4KITB 1E9BA 2JLQA 2V1XA 4AYWA 1LTQA 2KI5A 5I2QA 3TH5A 2KDHA 2ECKA 2CNWD 2VP4A 3A4UB 3QXXA 4TLEA 2Q3MA 4XWKA 4QBIA 4PPNA 1T8TA 4FD2A 4E03A 4MEWA 3B8HA 2GKSA 2KBIA 2IWHA 4B3DA 5K89A 3A6PC 3O8RA 5I8NA 1Q3TA 1P61B 1P5ZB 1CRQA 1CLBA 1D9XA 4ZKEA 2MRDA 1EX7A 2QNRA 1XTIA 1YZQA 4N1FA 4EQ6A 2R6DA 4CLNA 4KFUA 4IDNA 1P73A 2W0SA 1Z6AA 1ZW6A 1P2VA 3SG7A 5JCPA 2MJWB 1NKTA 2W00A 2XITA 2E87A 5FPKA 2F9LA 1T3LA 2FFHA 3A4LA 2IEZA 1P9NA 1X8JA 4NU0A 6Q21A 3THYA 3Q85A 1G4UR 4MITA 2CLCX 1G3MA 2IEYA 3D0YB 2GDJA 1R5NA 3RLFA 2IW3A 5BYJA 2BMDA 1DF0B 2FMXA 4II7A 4YRUA 2IYXA 2ZVQX 4GMXA 3UG7A 1RK9A 1U99A 4IJMA 2BKUA 2O60A 4A0RA 1QHIA 2ZKMX 1N6HA 4F4IA 2ZJ2A 2RGIA 4ASUA 1V43A 3C5CA 1AIPA 5TV2A 1P62B 1TOPA 2Q9AA 4EPXA 4Q7JB 4L9MA 4PQRA 2ZRIA 1FQJA 4URWR 1SY9A 2JC2A 3OE7D 4N1AA 5FR2A 3ADCA 4KYUA 1NIWA 1R8SA 2WKPA 3ZWHA 2LVVA 2OCPA 4RFSA 1WRKA 3QKSA 4TLBA 1SBJA 5HLOA 4G01B 3AB3A 3UK6A 2ORWA 2HETA 5EP4A 3X1XA 3ZYCA 4C7OB 5GVRA 5EUMA 3CTNA 2XJ9A 2HJGA 3QQ5A 5HZHA 2M9GA 1XRJA 2ZRNA 4EJSC 3LRPA 4Q4LA 1YUTA 4L15A 5HE9A 2P6NA 3CUEF 3HR8A 2VHQA 1GGZA 1KO5A 1VDZA 821PA 4TWZA 3CX7A 2VH5R 4Q4JB 5FUVA 1FUUA 5C18A 2P6RA 5H68A 3SQWA 5DO9A 3RRZA 1SNLA 2QEQA 1TNPA 4U8DA 4OCIA 3BFVA 2QG6A 2DWQA 3GJ3A 4IDPA 4R2IA 5CSIA 1G19A 4MBEA 4JLBA 2W83A 5FTJA 3RYTC 1ZP6A 5AK0A 1EXMA 4TL6A 1WRZA 2EW1A 4YBHB 2XEXA 4NONA 3U44B 1CJTC 4GPTA 3M0WA 4D82A 3BB1A 3QJYA 3CPJB 2FJUA 4HI0E 3GEIA 1GL9B 1EESA 2V9PA 3FWBA 1U5IA 2GJSA 2BWJA 4KO8A 4RD2A 5B57C 2V6IA 2QM7A 1YZGA 1XZPA 1XMIA 2WSMA 3HU1A 3OIWA 1JF0A 3E3RA 1KI2A 3KX2A 1DT7B 1NP6A 1XEWX 3LXXA 2GGMA 2XSZD 4X8LA 1CFDA 5FBVB 3VRNA 2X1VA 2J7KA 4QG7A 2JJ2D 1Y1AA 3WNCA 1QATA 1JECA 2ORVA 2ANCA 2JLXA 2QROA 3THWA 4NTZA 4AI6A 2CE7A 5EP3A 1Z06A 3I73A 3HPQA 1ZM2A 4RD6A 3L0IB 2WORA 2ZYUX 4KHZA 2VSXA 3EZ6A 2EVWX 1N3BA 2Q3HA 1KK8C 1XXHA 1UHNA 5JJGA 4G5SA 4GZLA 1COWD 4LBVA 2V7QD 2XNDA 3TKLA 2LANA 1SKYB 1L4UA 1E4VA 4Q4HB 1NL3A 2V54A 3IEUA 3TQCA 5B64A 1Y1XA 2OFOA 3AKBA 2CVFA 3TGPA 4QBHA 4DCVA 1GWNA 1PUIA 3FKSD 2MAZA 4EFMA 1R7RA 4L16A 1NVVQ 5EUQB 5AJVB 3WYFA 3GJ4A 1G20E 1ODFA 1E69A 4Q47A 2A7QA 4ARZA 1KZ7B 5JOLA 2H8KA 1Y6WA 2FEMA 2RCNA 3QF4A 4Q9IA 3KUDA 2QSYA 1IONA 1ZU5A 4PO8A 1LF5A 1K90D 4BFVA 3T34A 2ZSEA 4LHZA 2QE7D 1BU3A 4LJ6A 1E98A 3TIFA 3ZS9A 2RGEA 4XYNA 3I5FC 2H18A 2IK8A 4M1KA 4KXFB 3K21A 2ZI4A 3I1FA 3KFVA 1E3MA 1DE0A 3S1AB 4GGNA 2DHRA 2GA8A 4JSTA 1E9EA 2GK6A 4TTQA 1CM4A 1EFRA 1OLOA 2BM1A 3RWOA 2JTZA 4FINA 4I1VA 2QGNA 4HAVA 1T4GA 4GP7A 4NL4H 4TMKA 3B1YA 3REGA 1JC2A 4MKFA 3PUZA 3C41J 3VMFA 4EFLA 4RFVA 2FSHA 4UNRA 4FMDF 4MUAA 2F1IA 4CPVA 4NCIA 5J5CA 1XFYO 4DEYA 3OAAD 2CK3A 4JPZB 2YV5A 4NHOA 1E2FA 2KFHA 4WQ2A 1XJ0A 4OHZA 4DLYA 1KDOA 1N0YA 3QPUA 3GP8A 1XPOA 3TAHA 4V0LA 4JYBA 2CT9A 2Z43A 2JU0A 1E2NA 4MA4A 2BECA 1BF5A 121PA 4DZZA 2QBYA 4B3CA 3GJ5A 5CITA 1AZSC 2HDNB 5F3WB 2BCAA 2PH1A 4A92A 4DBLC 3GJXC 3I3SR 3EVVA 3GQBA 3TDIA 2VBCA 2PRUA 2ZTSA 1EH2A 1M7GA 1MO4A 2VP6A 2NZ8A 3PVSA 1OSAA 2FOLA 1ZUIA 1U2RA 4ZCLA 1NMXA 4LJ7A 2LLSA 2RGAA 4Q9KA 3WHLA 3N5CA 2LLUA 1CLLA 4GOXA 2JAQA 4PSAA 3NSLA 1UEJA 3P32A 2J7PD 5TDHA 1SVOA 3SYKA 1IN5A 4JLAA 2UZ3A 2QAGA 2WJVA 5FOSA 3UWKA 4P4SA 4TMZA 2OZEA 1OZSA 2BBSA 2G1KA 4DLTA 2P6UA 1I4TD 4IXMA 5G41A 4B3BA 1MXLC 3GJ6A 1NMYA 1VPLA 1ZVQA 4GP6A 3VHLB 1N5JA 2I1QA 2Q3FA 3FHCB 3DD4A 1H8EA 1AK8A 3BGWA 2VHUA 1CR1A 1S0UA 3PM8A 3AF0A 2WJYA 1B1GA 2F33A 1E9SA 4JIMA 4MQBA 2QTHA 4UJ3A 3I5GB 2OCAA 1JBKA 4O25A 1XK4A 3GK2A 3SOPA 3IHLA 4DIEA 4C0JA 4BECA 4B3FX 5TY0A 2PCJA 4LHVA 2FPKA 1Z2CA 2VLIA 4YDSA 3DOFA 2WTUA 4RZUA 3MFYA 4V0MA 4F4JA 4F92B 3WRXC 4QKQA 2ZNDA 2WWYA 5DNYB 3L0SA 4EUNA 1YR5A 3JTDC 1SKQA 2VA8A 2ZANA 1EFHA 3UIEA 2AAOA 2JGNA 2M0RA 2XX3A 1BR1B 2XOKD 5IT5A 5JEDA 3U4QA 2AHOA 3K1JA 1HEIA 3UATA 4GT1A 1TTTA 1G16A 1ESNA 2OAQ1 1GFIA 4GRAA 1VYTA 2H57A 3LH5A 5FBRB 3ZS8A 5GVSA 2H61C 3KDSE 3D3QA 5LPNA 2IS2A 1FI5A 1SXJB 2I1VB 2BKEA 4EPTA 3QI2A 3L8YA 4UJ5A 3EWAA 2ODWA 4KJZA 4YGAA 4XOIA 1GKIA 1IJ6A 1XTSA 4CF7A 1J2JA 1ZUZA 1TPZA 1IWQA 2FGJA 4B3XA 1J7QA 1VRKA 4HB0A 5AJZA 5HYDA 1NVVR 4UNQA 3TS5C 4AOMA 1NVXQ 3SE0A 2J1LA 1T91A 2BVNA 1K8RA 3P1JA 4XD7A 3RHFA 3WBJA 3IIJA 3LY5A 4HB3A 3SJBA 1UEIA 1F6BA 2ZS8A 5KTYA 5CLLA 2P65A 1PVAA 2FEOA 1IRJA 3LFUA 4OKSA 4WW0A 1A75B 1BYUA 3AVXA 1OT3A 2CCMA 4Q7LA 2O52A 1NYAA 2QT1A 4LDJA 4RD0A 4EDHA 2D7DA 2DFKB 4Q00A 1SMGA 1RTP1 2B92A 2GCPA 3BC1A 5HZKA 5FPTA 2HF9A 4OJQA 3BOSA 3ZZ0A 3ZD6A 1YRTB 2ZJAA 1U90A 1YZNA 2JIZD 4X8HA 2HF5A 2A30A 3AVPA 1E1QA 3HPRA 4MGIR 1FX0B 3RVBA 1BT6A 3UMFA 2JPTA 1PZNA 4XH9B 1ETUA 1D8TA 621PA 4ORCB 5CB6A 3B1WA 4BEBA 2NXQA 5FUYA 4P32A 4Q21A 5FPYA 2ZNEA 2LP3A 1D2NA 4URUR 1C7VA 1WRLA 1W44A 2LVIA 2QI9C 4M4SA 4BFWA 1IHUA 1FQKA 1UHHA 1FTNA 3SN6A 2JT3A 4OQMA 1LVCD 1N6NA 1UJ2A 1R6PA 1WB9A 3GPLA 2LHLA 5CK4A 3ZIAA 3OIUA 5B2ZA 1G64A 4KVAA 4YMSA 2K7OA 4M9ZA 5JS8A 1DPFA 2BBWA 4JKIA 4LC0A 2O0HA 4DSTA 2ZRGA 2KBMA 1NSFA 1EK0A 3PUYA 4PZLA 4LPSA 1LF0A 2ZU0C 4V0OA 2ZXUA 1B9AA 4CEJB 1QHGA 4X8OA 4DSOA 1X8LA 3CS1A 3KF9A 2KE5A 1RVDA 2RHMA 3V00A 2DOQA 4QJ3B 4UXHA 3U3RA 2V55B 2PLFA 1MWNA 2TN4A 5BQ5A 3SZRA 1WBDA 5H1YA 4OR9B 1FMJA 5LD2C 4I99A 3EVUA 4JKYA 5EJEA 4A2WA 2W2XA 5FTNA 3MGCA 3EZ2A 2XSZA 1TL7C 4AD8A 4DC9A 4JL6A 3O8BA 4FCTA 4TYWA 3BFXA 5SZHB 3QRXA 2BJWA 2CCKA 3SG6A 3VX3A 2R6AA 3Q5EA 5G3ZA 2K61A 1GITA 3AVVA 2CHGA 2ERXA 3K0CA 5LB2A 1KTVA 3FKQA 2PEZA 2WPDA 2L5XB 4A4DA 4TNCA 1FOEB 4MGZR 2DY1A 2EYUA 3THYB 4OI1A 4BPBA 1KK7Y 4MLWA 4KLZA 1HT2E 4NKRA 4H1VA 3UMRA 3FHTA 5CK5A 5AXIA 1P2TA 5P21A 3S1AA 2W58A 2OSBA 1G8PA 1VTKA 1JSAA 4ERNA 1MH1A 2NO1A 3ADDA 4M22A 4NPHA 1RYFA 1UBGA 1KK8B 2Q4UA 1K96A 3R20A 2GEUA 4XJKA 1S8FA 3ZDQA 2Z4SA 1PLKA 1S1CA 3BB3A 4MKIA 1IM2A 2GK7A 2IS9A 5ER5A 1T5LA 1ELOA 2XZPA 2BHRA 1KK2A 4I5KA 4I5NB 4D4LA 1B23P 2KAYA 3LLEA 4TL7A 3BK7A 4TSFD 1KO8A 1AUIB 3CNOA 3B6EA 4NE2A 1G7RA 1JR3E 2NLNA 3A1SA 1WBBA 1OH5A 1F71A 4GGFC 1JNYA 2Z0MA 1MV5A 1WLMA 2WOJA 4UNNA 1LS6A 2WMOB 5FBQB 1TIZA 2ZAMA 2QMUA 4GPLB 5D3MB 2IYYA 1ZC3A 2QL6A 1L8QA 4C0HA 5IHPA 1FFHA 4PQFA 3VHXA 4PO1A 1TAGA 5E4FA 1S1MA 1A4PA 4TYNA 1C07A 2G3YA 2FG5A 2P5SA 5DKRA 4LHWA 1CM1A 3QXHA 4ITRC 5FR1A 2IUUA 2ZIAA 2L51A 4RJLA 4JLJA 1RPZA 4MRXA 1OKKD 2BIFA 2HEIA 2IYRA 5JWRA 3EPKA 2NO9A 3WXAA 2QP4A 4NCNA 4UNSA 1ZM4A 5JBQA 2QAGB 4F0ZB 3T12A 2XZLA 3WHTB 4MRNA 4QL3A 2FZLA 4HAZA 3M4YA 3O47A 1Z6XA 3EC1A 1C4OA 4A8JC 2BC9A 4AQJA 1G6HA 4HLQB 1DJIA 3CONA 2LCPA 2WBLC 1PSBA 2GILA 2G0TA 4JVSB 3ZZUA 1R0XA 1S9DA 4Q5IA 3NDPA 3QXSA 4XVUA 1S26D 1WE2A 2J0QA 2BBOA 4Z51A 1ALWA 1JBAA 3NG1A 4IFBA 4DWJA 1W7AA 4WVFA 4ZCUA 3IDQA 4S2EA 4DCTA 1XU4A 1V5WA 4FMCB 4O2LA 3E2IA 2W2VA 4HDQB 1ZOTB 2DFLA 2BMFA 3TMKA 2ZUCA 3IPYA 1TQ4A 2G0NA 3A4NA 1QX7A 5CSFA 2ORIA 5CLQA 4Q66C 2JTTA 1OMVA 1CXZA 4NMMA 3N2IA 5JRZA 5K8TA 5B8IB 1QF9A 1XO5A 2ZSFA 2WCFA 2F7SA 3KXKA 4LC1A 2ZI5A 1NCXA 2LMUA 4DEXA 4CDGA 4BFXA 5LB4A 1NVUQ 2KI6C 3TDZA 2OAP1 1CP2A 1KK1A 4PHHA 1M45A 1ZRHA 3PIRA 5SZJA 4G5RA 4Q7MB 2ISDA 2F55A 1FF1A 2HYIC 3W5IA 1D1OA 3THXA 4BWYA 4C0KA 5JJLA 3NC1C 4HAUA 3LA6A 1ANKA 3G0HA 3RNLA 4NBSA 1XF9A 4MDFA 3FIAA 1NCYA 2QRNA 2I2RE 1G8GA 2OBNA 2R6GA 3M0EA 4TYPA 5FI1B 1CLMA 4XSGA 2AUCA 3TUYC 2WM9B 5KDDA 3SJAA 2O8CB 2M1UA 1SCVA 2FH5B 1E2KA 3BIFA 3ETLA 1T0JB 2OS8C 1ZFSA 1KSOA 2CJWB 1SL9A 5JSZB 2LMTA 2Z5FA 5AANA 4BLSA 1DBSA 4EPVA 3H2YA 4JLOA 1GG2A 4YXWD 3TJZA 1YX8A 2QMEA 5F9FA 1U9IC 2DCUA 4E22A 2QZ4A 5F98A 5L3RA 1MO3A 1Q44A 2ZRTA 2XB2A 2ODNA 3CLVA 1RRCA 2K7CA 2ZM5A 3IQWA 1OHHD 2J7PA 3WMFA 1G7SA 1LV7A 3SG3A 3WYGA 4OQLA 2J59A 2FSGA 2ZJOA 1UURA 1IXZA 2F43B 1BIFA 1QHNA 1DJWA 1FP6A 3AVOA 1OE0A 1Z0KA 1TMKA 1FX0A 4ETOA 4JT4A 1OH7A 1TQDA 1YURA 3KKNA 3WXMA 2ZI6A 2L0XA 3VKHA 3R8CA 3QPVA 3HU2A 5TNCA 4NDZA 2ZN8A 1TQ6A 1F2UB 1XD2B 1GGWA 4OBEA 4Q9HA 4W5HA 4D0NA 3T1TA 3VU9B 4MKGA 2BL0B 3A8RA 4OHVA 3K0EA 4QJ4A 4LHYA 5IF9A 3NXAA 1U8YA 1OMDA 2ZPTX 3TAUA 5TMPA 4B47A 5GJCA 3QKUA 4LWZA 4KU4A 1NP8A 3LWNA 1MXEA 3MG9A 3BOWB 2ZUBA 3FMOB 3Q72A 3AKEA 3OFNA 4DDVA 2HV8A 5SZIA 4DT1A 5EE9A 2JT8A 1QVIY 1JR6A 5KSZA 3BERA 4RY2A 2L4HA 4TQAA 3SG2A 4YI8A 1PJRA 2O0KA 1US8A 3TR5A 3TW4A 3RWMB 1WXQA 3WNXB 1F8HA 1YZLA 2CHQA 2IYVA 3DKVA 4GUKA 4HAYA 3D0YA 3SFZA 3ZVRA 4OHYA 2QY9A 2AKYA 1SQ5A 3EXAA 1G5PA 5HE8A 1DAKA 4LV5B 2VHTA 1S3GA 3O78A 3I92A 1KQMC 3D10A 4YC7A 4RVCA 3X1DA 5E7MA 2C98A 3DL0A 1KK3A 1U0HC 2KI4B 1AS3A 1Q1QA 2ZRPA 3B60A 1QG2A 2QACA 1GL6A 3K09A 2A5DA 3GLIB 2WCEA 4QBFA 1HA3A 2V6JA 3AF1A 5KUTA 2WIBA 5JZVA 4G5OA 3GLIE 1J1EA 3LW8A 3OEHA 1UBFA 4LGMA 5JCZA 3ZVNA 3VX4A 5BWMA 3B9PA 1GNQA 1R4AA 2WOOA 3K9NA 4RKFA 5DH9A 5FL7D 2ONJA 4AKEA 2H7VA 2ZSAA 1HE1C 4R1EA 2PZFA 4OHWA 4P4SB 2E1RA 1E0KA 2OESA 2QORA 2XB4A 1KY3A 1IQ5A 3MLEA 2HPSA 4M9XA 5CM8B 3VNVA 5HLVA 1QLSA 4FTGA 1K5GA 3EPJA 3TVDA 3EIQA 2GXUA 1FI6A 2LC5A 4YONB 2P2LA 3PUWA 3W5JA 2OBMA 3QUSA 5GADl 1BS1A 1RFJA 2RGGA 1ZYUA 1G6OA 5CYPA 5DGXA 5HCIA 5FOTA 1VCNA 4DSNA 2GNOA 4FWTA 1W0KA 2ZS7A 3QVUA 4ZDKA 1TF5A 4M1OA 3CX6A 3JZAA 3WYAA 1CFPA 2E30A 1F48A 4TQ9A 5DISB 3OB1B 2NO6A 2F1RA 4RCYA 4MRPA 5TXGA 1IXRC 4DS7A 2CL6X 2SASA 1MKYA 4AKHA 3X1YA 1E99A 1G5TA 1UBCA 1M63B 3C8UA 2NQ2C 221PA 5BPJA 1YX7A 2K0JA 4PE0A 4BFSA 2QMOA 2LNKA 4A6PA 4BRUA 4GDFA 4C0QC 4Q1BA 5FH9A 5SZKB 3CRW1 4BFUA 5C4MA 3OEHD 4Q02A 4TLCA 5HCNA 1MF8B 1X6VA 2O8DB 4Q1CA 2Y1MA 4H9GA 1SCMB 3DVJA 3K9LA 5KPDA 4JSYA 3WHUB 1E2JA 3H86A 1UAAA 4DCUA 1KWOB 2PX3A 2D3WA 2ZRHA 1OXSC 3BUMB 4PZYA 3PCRB 1AHRA 1JI0A 1T3SA 2XTZA 1AJ4A 3PFVA 3K09C 1E96A 3CF6R 1JR3D 1YRAA 4D2IA 1F55A 3GJ0A 2R6CA 4IFEA 4Z8XA 2JATA 2Z6VA 2IBMA 3CRVA 1FW6A 2BJVA 1E9AA 2BEJA 2QSZA 4LV6A 1FPWA 1LW7A 3B9QA 2RGDA 3K0SA 1KSMA 3TUJC 3QXJA 4JBXA 4AQIA 2DWOA 3VNUA 1DGVA 2KWIA 2ZRKA 1BODA 1E1RA 1S6IA 3DZDA 4MSPA 2LCFA 4ZDWA 1B8CA 1WMSA 4CT4B 3X1WA 3CR2A 2WWGA 2ZRLA 1ZMXA 2LUCA 4K81B 1CULC
chains in the Genus database with same CATH superfamily
1WP9A 3VPCA 1U3VA 4OQZA 4P92A 2R2GA 4ZC1A 1JA0A 4JT8A 5HRAA 3M8KA 3ZWPA 5EKXA 1NUQA 3PSAA 5GJVC 2WA1A 4CKWB 1WY5A 2OZPA 3GC6A 2Q07A 3LGXA 4JL8A 4UQOA 1FP7A 2HGSA 4WLUA 2R5NA 2Y0CA 3CNNA 3G0GA 4TQUS 2X8LA 4ALIA 3PN7B 1FJXA 2JCYA 1L4MA 3AEYA 3HKCB 3P26A 4KGXA 5EERA 3ZDZB 1CTRA 4P0QB 3THXB 4DJ5X 2GSDA 3UG6A 3GH1A 1YULA 4CUJA 4IGFA 1MB3A 2VPQA 2QRHA 2QMQA 1N9GA 1VIYA 1C7FA 4LSGA 3ZYZA 2F6RA 1JUDA 3STYA 1K6MA 2IXDA 3K0KA 1AQUA 4PSDA 2A86A 3OCWA 4YRMA 4BO6A 3BUNB 2XEDA 2ZZMA 4TT8A 1JVNA 1Q0QA 4NYIR 3L82B 1RI4A 3T95A 3ZZNA 2VSQA 4C30A 2P9TA 1SCBA 1RXWA 1V5GA 4QTUB 2BTQA 2H1RA 3D4LA 4BP8A 4I5FA 1IG5A 3VO9A 1OILA 3NGMA 2L98A 3RQIA 1RMTA 1I4DD 1UWOA 1U0JA 5A4IS 3ZIDA 1DO2A 5IM4A 1ABFA 5D69A 2WD9A 3JVDA 4Y2SA 3K2EA 4RM3A 3DEFA 4JHXA 3PHHA 3UJAA 2YUTA 2ZE6A 4H0NA 3FTCA 4LXHA 4XVHA 4RAQA 3WSVA 4BN5A 2KI6D 1GUBA 3H0KA 4C1BA 5AW0A 2FRXA 3CF4G 3SZOA 4DIRA 3VC2A 3HCBA 4WKGA 2BEVB 4INXA 1RYZA 2AS0A 3MS2A 1X80B 3O2SB 3QM1A 1N6OA 3KSBC 2NUBA 1DJXA 2BMEA 3WGGA 3NHWA 1IK6A 1HH4A 1QK3A 4IDCA 4A6EA 3ZEAA 3BFPA 1DSSG 3A9TA 3B7AA 4M1EA 1OC2A 2OM2A 2PU5A 1EG7A 1L5WA 2NSLA 3OZDA 4O1HA 1GTG1 4IIGA 3SBEA 3UJ3X 4BC0A 5LMNB 2RHBA 1RRVA 4YLYA 2Y5IA 1NIJA 5FV4A 3HKEB 2NUTB 4CQMA 3S2EA 3L43A 4JLMA 4TZKA 1MAVA 1X86B 5AVQA 5AR1A 3SPXA 2CEAA 2F3UA 1G55A 1OA0A 4D4KA 5FWYA 3P45A 2UZ1A 4YK7A 1Y9DA 2HK9A 5AOAA 3PSHA 1Z82A 3UK7A 3CQ9A 3GDHA 1BN7A 3ER6A 1AC5A 3KAKA 3TFOA 4FDVA 1XC7A 1MX1A 1TUEA 3ETDA 3SIRA 3MMNA 1RKXA 3HO6A 1VIMA 2H0AA 4YT2A 4RY0A 3ETCA 1WDTA 5DW0A 3PNMA 5DOVA 4IDQA 4GNRA 5KINB 3WMRA 4QDXA 4JQCA 1DARA 2VSFA 3OCJA 4RD3A 3ZBPA 8ATCA 1IIRA 1DV2A 2H1LA 2NVUA 3EOZA 3QV2A 5HKLA 1DAIA 1OKKA 2OQIA 2FPMA 4W5WA 2NXEA 2OXEA 1VG8A 3CLSD 3DR5A 2RAPA 3OU7A 3W9SA 2VDQB 3GJ8A 4Q7QA 5I4IA 4BNNA 4XWTA 1FXWA 4BU1A 3EPPA 3Q6IA 3BTUA 3DZFA 2FSUA 3G17A 3KZ1E 1XYGA 1TZCA 2VDNB 3LXMA 4GQIA 1ZKMA 2P6BB 1OROA 4LNUB 1CUAA 2P3SA 2R8YA 3AHHA 3QEJA 1AOXA 3EF1A 3RTBA 3T99A 3R5TA 5I7OA 5C52B 2O5RA 2HCBA 2P0YA 1S4QA 1E63A 2G1JA 2KBEA 1Z5OA 5AI0A 1Z9BA 3EVRA 2DQSA 2IBTA 4CQNA 1USVA 3II6X 1WZNA 2IYLD 3M2TA 3OEED 5BQPA 4BO4A 1ZI9A 3DOHA 3GYBA 4EF6A 4PVCA 4CTJA 1GDHA 3RYFB 2IRWA 3N2ZB 4N7JA 2R47A 4HVTA 3NKLA 3ZDEA 2P67A 4I4TB 4BB9A 1J5EB 4UM9D 4XR9A 3WFIA 2A84A 5M04A 3EULA 1BCRA 1XCBA 4G1FA 4O4LA 2FFQA 1BN6A 1NQUA 2M1ZA 4HH3C 3WLJA 3ENVA 4YGBB 2C58A 3OQIA 3W34A 1AF4A 4N3GA 4ZYUA 3JARA 5AW3A 2ZYVX 5FLYA 2HT1A 1TA9A 1RR6A 1NBMD 2XKBA 4G0ZA 3INTA 4FX2A 4QU8A 2TMDA 3ELDA 4KWIA 5DEIA 4EUFA 1BOCA 1QTXA 2ZP1A 1UPTA 3GBVA 3LDAA 4DKXA 3DMPA 3DCIA 1MLDA 5E9AA 1J9GA 1LKJA 3ZDAA 2R44A 5E6UA 1OXMA 2X42A 3PG5A 4Q37A 4QTZA 3VQTA 3WK9A 4P3YA 3PVCA 2GN8A 4R81A 4UDXX 2NV0A 2X86A 4M87A 3WQBA 3ITDA 3H11B 1JDBC 3QPDA 1CEQA 1GARA 3E48A 1JF2A 3INRA 1CUJA 1XKLA 1WXGA 3JCZA 1E4OA 1E4YA 2X2FA 3NT2A 1T6YA 1ZH0A 2GHIA 3S55A 2GAAA 5B6IA 4XR4A 3UC5A 1NUUA 3U7IA 1XP8A 3L7OA 3R4VA 4JT9A 1RLOA 1MQ1A 1NBMA 4KQJA 1DJPA 4F2GA 3IAS1 1ISHA 3I3OA 4IKOA 2I9PA 3K70D 1NP7A 1OQAA 4OXYA 2PRZA 2OEPA 4HL6A 1GFWA 3AGPA 3I2GA 2JF0A 3GBSA 3JQBC 3GRKA 5L4NA 3O2NA 4FS8A 4G9EA 1VIAA 2F62A 4H0CA 5CPFA 3NALA 3WLTA 1JSXA 1DC1A 2F3PA 4WXHA 5B7GA 3G7SA 1OLSB 5F7OA 1GL7A 4HZUB 3EEOA 3K4PA 3STWA 1GPBA 3C7DB 1F5NA 4LV8B 1H2YA 3W8EA 3GX1A 2JIBA 2FPRA 5T6MA 1EHYA 4Z3OA 3IP7A 3SJUA 1ICEA 2WHRA 2CNWA 2RHLA 3RABA 2J5RA 3SK0A 1GCUA 2ECFA 1QIGA 5FUWA 5JANA 3O6BA 1U8UA 4ARAA 5C37A 2QU8A 1MW9X 2C5SA 1ZXBA 1V4VA 5HF8A 2MTBA 3ZLJA 3MTBA 2RHGB 3D75A 4OO3A 4DWVA 2ZWIA 4KLNA 1P18A 2AMVA 1ZX1A 4HP8A 2QQFA 4BMOB 1G6KA 4EY3A 1XXHB 1R88A 2FPLA 2YVUA 4P5OE 1B3BA 1F8YA 1S2MA 1G291 4C0LA 2PJZA 5AHWA 1MZVA 5EVCA 3RBAA 3GLHB 4KFTA 3FGZA 4OPMA 2WTMA 4X90A 3EIWA 2GRUA 1QG4A 3T5TA 1ZJWA 2HI0A 1C0IA 1V7PC 3EPRA 3GPDG 4UXIA 2FF7A 2LVKA 3AAKA 1A77A 3O4RA 1OMOA 3OEWA 5ADHA 1KZ1A 1XDDA 3IURA 2JAHA 5F35A 4YXWA 1ACMA 4B45A 4ZO6A 2W4MA 1L5GB 1QLWA 3DDNA 4WBNF 2KQYA 1PJ2A 3DQPA 1ZICA 4WZZA 3QVMA 2JLUA 1GCGA 1TADA 4M89A 1WU8A 3R9KA 1KZHA 4XEUA 1OE9B 2GT1A 3AVYA 3RS4A 1QWVA 2HXSA 3KXIA 4J7CA 5H8WA 3MRSA 5L7WA 5JRDS 5EXXA 1FSZA 2MIIA 2Y4NA 3C70A 3RBXA 3SVZA 2ZRDA 4Q1AA 4RDXA 2O23A 5DHAA 4NENB 2FU5C 3M9XA 4L51A 4BO8A 5FUBA 3CNHA 4MR9A 4KYNA 5I94A 3EDQA 4QGGA 4S2UA 1AQ6A 4XDGA 2WDZA 2C9YA 2B37A 1H2BA 1NC3A 1ZI8A 5IVDA 3MUEA 1G0OA 1U0EA 2ZIGA 3FB4A 5CA1B 4K9DA 3D6VA 4A15A 5JCOC 1AF7A 2QEHA 2V7WA 4TXJA 4TMVA 1B8LA 3CZQA 1NI4A 1CWUA 1OFIA 1Z2PX 2PL3A 2R6FA 3CKKA 4QPJC 4U9IS 4L02A 1LQTA 5HDBB 2FR0A 2WJIA 4B9AA 4EPRA 2H61A 3KEVA 4G1BA 1CNFA 3NDRA 2QQ0A 5FOUA 3UBMA 1UXKA 2WVJA 2R7NA 1F8GA 2F1KA 1ML3A 3H99A 3L46A 3LNTA 3OFND 4TXNA 2PMDA 5AKYA 3C7KA 1QX5B 5TB5A 3IGFA 5J2UB 3TCNA 5J47A 5JNVA 1RLTA 4IQ8A 1EH5A 3DT9A 3GVXA 3NDIA 4FSDA 4PSCA 1SKAA 1XOIA 2AEEA 4MKHA 3RJ5A 3G9XA 1KWOC 4GBAA 2UZ1B 4P3XA 1MC1A 3GLIA 4IJWA 1A88A 2Y1XA 1JIVA 1XZQA 4N5XA 4P3KA 1MO5A 1N78A 3W4KA 3GQVA 2AFHE 1AS2A 3A70A 1J1UA 3A2KA 1UXJA 2EHJA 3D8NA 4EFNA 4YALA 3UKJA 1JA1A 1Y9AA 1SRAA 2FFAA 1QJTA 2JT0A 1RWMA 1LDBA 1IN8A 3H4VA 3HCAA 4AG6A 3O91A 1TCUA 3FMFA 7GPBA 1WMDA 3N0WA 4EY6A 1P3JA 1Q7RA 2ZIXB 2GAFA 4ME6A 2C5GA 5L3QA 1LBHA 4DRZA 5K20A 3FHJA 1VP9A 3LOQA 4MB6A 5AMXA 4PN7A 1V48A 2J4FA 4GR9A 4KSCA 2PJRA 2ONZA 3VJMA 3BXXA 1YJQA 1SVLA 1JFVA 2DM6A 4I9NA 3F9CA 1DB3A 2P91A 1K66A 4E46A 2M7LA 2DVMA 2F2TA 2JH9A 2QF7A 3ASZA 3P4XA 3O3CA 2B1GA 4HWKA 4MB0A 4GRDA 5EQTA 4DQLA 2ILVA 2PX0A 3IESA 3O82A 5ESWA 4RIHA 2XMGA 2O7VA 4Z7OB 2RB4A 1SUCA 3CFYA 3LLVA 4LCBA 2B1IA 1N2EA 1IQRA 1R0ZA 1WXIA 2MOKA 1SKYE 3H42B 3QPAA 4PZAA 4YQFA 4QARA 2JI9A 3DJYA 1WHSB 2IXFA 3SKVA 2OSVA 3X43A 3I6MA 3TBKA 2A0UA 1SVWA 2FX2A 3AJDA 3AVQA 5IMSA 5K6RA 2X0JA 1GTZA 2ODEA 1IJFA 2IP2A 2OV6A 3PXAA 3B7WA 1QQBA 1J39A 3LY7A 3C87A 2QN1A 3ZQUA 4DSAA 4IIDA 3F67A 3DE2X 2XDAA 1QIIA 1W94A 3D6FA 1K8QA 1QHHB 2NPOA 2WKQA 2HSWA 4FX5A 2WWRA 1UUSA 4S1TA 4GE3A 2C54A 1M2VA 2GI4A 4D44A 3FW1A 4MQ6A 1NPYA 4AN1A 3W6NA 1PK8A 5BR4A 4FEYA 1D6SA 2IL1A 3BE4A 4HGRA 5DNEA 2YJ6A 2ZJ5A 2B25A 2H52A 4HATA 2O8FA 2ACWA 4QGFA 3U2QA 3UK1A 3SSMA 5DW3A 4AB1A 1F9EA 1ZMOA 1D9ZA 1H6DA 4FFSA 1ONSA 1WKCA 3LMKA 3GLRA 2CWDA 5IUKC 3E9NA 4LHSA 4OAOA 3QTLA 4Q82A 2JFZA 4JLKA 5CLHA 1R2QA 4CFRA 5LYJA 1RU3A 2N46A 5K3DA 3ML1A 2HCRA 2IEAA 3WL6A 4ZYYA 4NEHB 3N7AA 1DWUA 1JN0A 1IVYA 4HDAA 3CURA 2CTNA 5KVAA 1P0CA 4A2CA 1FNNA 2CMGA 3EMKA 4JEIA 1V25A 5EIBD 1DIHA 2FE4A 2UZ4A 2BM9A 3I2FA 1NI5A 1ZW1A 1C7RA 2PQLA 3TI9A 3IHKA 2G8LA 1YBAA 3FI9A 1DCMA 4LQDA 4V0ME 4QJ4B 4AUKA 2ZRSA 1JEDA 4ALMA 1A5BB 4DRYA 3R6DA 3H9GA 4KPYA 4QJ3A 4M6WA 4PG5A 2BR5A 4HX5A 3AETB 3FCOA 1A8QA 3WISA 5KJFA 2J87A 4XTCS 1H2HA 2QEVA 2VRGA 1Z0DA 5HBGA 1VKRA 2ODPA 2P3OA 5GJWC 3TZQA 4DUQA 2XUZA 3MS7A 2NMVA 1YQUA 2BJHA 1OFUX 1ZK2A 4AJ1A 3AEZA 2RI1A 1G8IA 4PHJA 2IIPA 5LA6A 3GRUA 3ZWMA 1PZMA 5ADUS 3H5LA 1EFTA 3TZBA 3TRDA 1G18A 3ZQKA 3EAQA 3PALA 5HJ7A 4M88A 4N9WA 5J4YA 3I01A 1FZTA 1NBAA 3A7EA 4B7AA 1U3UA 2JH3A 5JYEA 2BE6A 3ETGA 4UE3S 1QF7A 2WICA 5EZSA 3SD7A 4ZIRA 1FDOA 2FXIA 5I8PA 4ENSA 1KAEA 1SZDA 3BXPA 3NHYA 2ZQZA 3KFLA 4UTOA 4OKNA 1G21E 4AMVA 1M83A 1DVIA 1YR8A 1XG5A 2RKBA 1TYZA 1OLXA 1TU3A 4WFJA 3UWOA 3NTXA 1S3PA 1WZIA 1ZCBA 3F5QA 1DJYA 3U7QA 3NEAA 2O8BB 2C4UA 2EZUA 5T57A 3B82A 3QVGA 2LHIA 1RCFA 1Q7BA 3BOWA 3KO8A 4J94A 1B26A 4DHEA 5AK4A 3B13B 1UBUS 3CLRD 4LHXA 5E4JA 1DAFA 7MDHA 1R6UA 4A03A 5AW1A 2IU3A 3B2NA 2LKDA 1TC2A 2PGXA 2J9FA 4WGFA 4Y2JA 3C3CA 3SYRA 2HK8A 1GRVA 1DLIA 3OESA 2ZWAA 2VNHA 2J9ZB 2OTGB 1RDFA 5AJWA 3E7PA 3EZLA 4DR5B 1XLWA 1IQUA 2WYOA 2YWEA 5A9SA 3Q3IA 1RJVA 3QY9A 2C4TA 4Y0VA 2PHZA 3W3AH 1OCEA 2FHSA 4Y2GA 2LMVA 5EPOA 3H4SE 4MO9A 3ZXYA 4A0GA 4CTOA 2BGLA 1U1DA 5JH7B 1H9AA 5CEFA 5H9WA 1F7VA 1J42A 2C78A 3KWFA 2O0JA 4E5DA 4R71A 2AKAB 2NU9A 1WOMA 2H4WA 3F6RA 4KCGA 3MJDA 4MPPA 3ISTA 1KI8A 2J5QA 1XAHA 2GTPA 1JTVA 4N6GA 1OPXA 4LRQA 4O2BB 1UQTA 1XHLA 2ZVDA 4H59A 4PNHA 3FJYA 4JUFA 4NAUA 4XM0A 4RELA 1S96A 2WHXA 4P4GA 3BHJA 1SR6B 1XVLA 5EOVA 2FVYA 1CUIA 2BFDB 2KJQA 2NVUB 1K27A 2A0WA 2IHTA 1YRUB 4FOOA 2BBTA 1O5IA 2QMYA 1U7UA 2PV7A 2PGDA 2KQ6A 2PBLA 2WC1A 3O1HB 1OHHA 4EO7A 4B3GA 4OBBA 2PZMA 2ZCVA 4USLA 4FYWA 1G5FA 1CFFA 2VDWB 3JQAD 3LBNA 3U60B 3Q9LA 3FB1A 1Q1ZA 2EEZA 5FPPA 1JGTA 2PQ2A 2Z08A 4UD2A 3I2JA 1SVKA 2H9AA 3N86A 1YQXA 3R7FA 2XUAA 3KVVA 1D2HA 4HB2A 4TSFA 2NZXA 2X0NA 3U4DA 1UC9A 1EWKA 3VAZA 4ZYXA 1RWYA 3TL2A 1LW6E 3JQCA 2JFOA 2OV2A 4MGKR 5F6TA 5BV2P 2IBSA 3FMPB 4M9RA 2DY0A 5BR1A 2WDPA 4NJMA 1AHIA 1C0LA 3EYWA 3GG2A 3IB6A 3PRJA 4A8PA 2RAVA 2VI5A 3EEIA 5DK4A 1DRJA 1PF7E 1QC5B 2DBRA 3DE7X 3ETEA 4G09A 4MS3B 3O92A 3TOZA 3RREA 2Q6KA 3B8EA 1ZR2A 3B1ZA 4U5XA 5KYWB 1U7HA 3FIJA 2WE8A 4AY2A 2C20A 1CEEA 2OO3A 1FRQA 1QS0A 4IFIA 1MOQA 4LI3X 5DYGA 2HMSA 5AKEA 4B6EA 2INGX 1N2DA 1TTTA 2EZTA 5BY2A 3RRFA 1EJ3A 2X5NA 3WDKA 1DHTA 3UXHA 4D0GA 1LJUA 3DVSX 4PZDA 2Y2VA 2C57A 4I4CA 3RC2A 5JARA 2DKOA 3S0AA 1FW8A 1AXGA 2E82A 5JPCA 3U61B 4Q03A 4BKMA 3KPWA 3TFQA 3IMEA 4KXVA 2WZCA 3TLEA 1V1RB 3WL5A 5KWIA 1YR2A 3U80A 1D0IA 4A1OA 2VP2A 1KEKA 2PMBA 2WMNB 4PC3A 4EI7A 4HVLA 1D4ZA 3BGVA 3TLMA 2I7CA 3HRKA 3QWIA 3PPIA 3VTKA 2PX5A 2CZCA 3V1NA 1I2DA 3GEEA 3I42A 3AL2A 1NG9A 2BCBA 1T43A 4MLDA 1B4DA 3X3HA 2JWWA 3NR2A 2BL0C 1DEXA 2QPOA 4MEAA 4MIYA 4EO9A 2Q3BA 5CDFA 1NJ8A 5IC4A 2W6JA 3AUYA 2PGAA 3KAPA 4XVQA 5IP5A 3GJSA 5CVVA 2YWBA 1BMQA 1X7XA 3SDZA 1OXKB 3PHGA 1QO0A 4E94A 5C32A 2ZUEA 2Q0HA 4TXMA 2O8CA 4IJ7A 1KI9A 3JQFA 4IGAA 4ISBA 4P4NA 3T4XA 3IMKA 3M83A 1I14A 2C77A 1L7QA 1UP7A 3TZLA 3NWJA 1YHZA 1YASA 2ZBFA 4L78A 5K4GA 1GG8A 1UAGA 2B83A 2DHQA 2FCDA 4DCKA 1R12A 3ZDXB 5F2KA 3EVAA 4B09A 3X2SA 3KB1A 1Y4SA 1P4JA 2CXOA 2NZYA 4JR0A 3WWPA 1NXTA 3CNLA 4CF6A 3KJGA 5DHFA 4RPKA 4JKOA 3K9GA 2OAGA 2X9LA 1JXOA 3PFFA 1IBLB 4G8JA 1Y1QA 2JHPA 1Y34E 4I1OA 2VP5A 1VSQA 5BN4B 2PE5A 4M76B 4WXMA 4H3SA 5A4KA 4KBFA 3OO0A 4C88A 3ZGZA 2QK4A 4C4OA 4LZJA 4EHFA 2E4YA 2NU7A 2QUKA 3ZCXA 1IQ0A 1K8ZB 4PO9A 2ZTLA 4C2AA 4E2WA 5A4MS 2W6PA 4ZVQA 2J3QA 2CZQA 3WJ7A 2Q99A 3JZDA 3FOBA 1KO7A 1U8XX 3WOVA 4DAOA 4ZYTA 2KLBA 4QBGB 4D56A 5ALWA 4PG8A 5FEMA 1I4EB 1PQYA 2BSXA 4ZEWA 3TK1A 4R2WA 3CLHA 4D41A 2UUBB 2MINA 4HFNA 4V0SA 4JI6B 2C5BA 3B12A 2FFBA 3RTGA 3OLZA 1VKNA 2YXBA 4G63A 1M34A 3PPYA 3RUDA 3TB4A 2NADA 4RTNA 2TYSB 2KGBC 3OO1A 8ABPA 1NXVA 1SEVA 3MYYA 2H11A 1ENZA 1ID8A 1S89A 1Y4ZA 4DLUA 1KAQA 4I4LA 1K2WA 3TM5A 4CQMD 4BMXA 3JVVA 4W4TA 4Y6OA 4YAJA 3BULA 3NBFA 2X1LA 3VR2A 1IATA 2Q8QA 3IC5A 4J0HA 3V97A 4DBLE 5C5IA 5IJWA 2IHNA 1MJGM 3OX1A 4IILA 5ALFA 1D1TA 1EP9A 1IY2A 2PVSA 1TT5A 2XRYA 4KAXA 3HKEA 5B2FA 3NIBA 1Z6GA 1R5OA 4IXDA 1RWOA 5JECA 2GKOA 1GCAA 2C8VA 1UF9A 4DM3A 4LE1A 4LXQA 3PGXA 4M46A 2G72A 4HV4A 1XNQB 4EQ6B 2O8BA 1KDZA 4P7BA 4LF6B 1O08A 2VJMA 1A5TA 1VPVA 2FN3A 3OLWA 4I8XA 2GJ4A 2J67A 2PMKA 4EBBA 3D4BA 9ABPA 5CB8A 1X7WA 2ODBA 2XRFA 3JSAA 1Y6RA 2NG1A 3SLRA 3B3QA 2WTXA 3O94A 4PQYA 2VP0A 1SCAA 4CM1A 5KWJA 3TXYA 1I24A 5HS4A 3FWZA 2VTKA 3BBLA 2WP0A 3M6XA 5DB4A 3I4FA 4ZEMA 2ZEJA 4RXMA 2ABWA 3R7WB 3TQOA 1P2DA 3U49A 3JD1A 3NNNA 4E5VA 2FV8A 3TVTA 1T5DX 2YJTD 4QWWA 1SCKA 1SVMA 4YR7A 3EK2A 1NF8A 1QNFA 4EHIA 4P4UA 3I6YA 4F21A 3DYVA 5AUPB 1I7QB 2E4WA 4XUDA 5LZ9A 3NBZC 4MUYA 4U7DA 3O83A 1IZYA 2QJWA 5AVXA 4OK5A 1SK6D 2H5LA 4X63A 3SXUB 2JNFA 1Z8HA 3LW7A 4G5QA 1R15A 1N5RA 3BIWA 1DQRA 4N7MA 5HQTA 1Y8QA 2NYUA 2IUYA 3A0RB 3RC9A 3GK4X 2AOUA 4U7GA 2W8ZA 3QOFA 2HEGA 2FI1A 1POWA 1OXXK 1F3OA 1J56A 4QELA 1K88A 3DDHA 1XTPA 4C0BA 3HYRA 3KDAA 4ILKA 4YJ3F 3I04A 4BQFA 4CU2A 1QTQA 3BZUA 1ZD4A 2EFCB 4I3FA 5KHAA 2GBGA 3ANTA 4G2NA 4BZWA 4EGQA 5AOVA 3I0ZA 1GFSA 2P2DA 3JY6A 4Q7KA 1Z4JA 3DAYA 1D2CA 6YASA 5CDYA 4HEHA 3ZHXA 2W2KA 1AS0A 3GPBA 5FXMA 1I8TA 3VGPA 4EO4A 3I6ZA 3WZ2A 5CDFE 2F8PA 1JAZA 5F78A 1JEEA 3E5NA 3RKRA 1GV1A 3IBGA 2HBZA 3LYHA 3AKAA 4DIKA 1TT7A 4G5GA 3HR7A 1XFUO 5A4JA 5GZ3A 1TTHA 5ALDA 3KQQA 1OZFA 4U2EA 4JI1B 1U6KA 1XEFA 2AUNA 2PWBA 3D4OA 2C92A 1NW4A 4WOJA 2A3RA 1OI2A 2RH8A 2B1UA 2EIXA 2ZSHA 4FYPA 3JWEA 4K6GA 3MXTA 5KQSA 1WA5A 3H9QA 4TS1A 1NLFA 1GPAA 4W82A 4EG7A 2IA5A 4UU8A 2O7QA 4FGUA 3NV7A 4Q1EA 4XIGS 3DMFA 4K28A 4YCAA 3ICPA 3NWEA 5DSTA 3IQXA 4LRWA 5EJ9A 1V8OA 5T8KA 4DZRA 4CTKA 1DJNA 3H0CA 4WX2B 1M2WA 2F00A 3PJRA 3U7EB 2VSOA 3C3KA 3E27A 3KPXA 4YCMA 5DRYA 3G5AA 1JLLA 1CR0A 4WK2B 2CD9A 3BL8A 3ZNIA 5F3DA 1YHNA 5FPQA 4YRPA 1GG9A 2W6NA 2X23A 4HAXA 4OBWA 2F8TA 1EK2A 1MT0A 2MMGA 2ZUDA 4GVPA 3QSYA 1OV4A 5IZCC 4I9HA 1SVUA 3O4IA 2DFNA 2PMEA 3PM2A 1YR9A 5EA2A 2VK1A 3JWHA 4W9NA 1LZKA 1D07A 1JT9A 1MRSA 3BSSA 1ORHA 3AY7A 5BT9A 1W19A 3DBVO 4UATA 2XXAB 1YI8A 3OP4A 4WZBE