4C0KA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one calcium ion (ca-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0kA03
3IIMA 4MRPA 1PALA 1Z29A 3BUOB 1PK0D 5E7MA 4DCSA 2L0PA 2ZRSA 3WHTB 1I4TD 1QHHA 4ZDJA 5IHPA 4XJKA 2O8CB 1NN3A 4I5JA 1OMDA 2ZN8A 1UJ2A 2ZSEA 2MMCA 3SJZA 3GJ5A 4I1UA 1FQKA 5GQQC 1D9XA 5EP4A 3RWMB 4C3ZA 8OHMA 2VTKA 3E2IA 4JL6A 2XOKA 2BECA 3KXLA 3WYFA 1IY0A 3IPYA 2L2EA 1RWYA 3OE7A 2ZFDA 4TYWA 2GZDA 4F92B 3DF0B 1X86B 3L82B 3I5IC 4PPNA 2NO9A 2MSDB 5LPNA 2KE5A 1DF0B 2QP3A 1JWDA 5EE5B 4UXHA 4DLVA 2FE4A 2XZOA 3NWJA 5CIWA 1J7PA 1Z5ZA 2WAYA 1L8QA 5PALA 2HF8A 2VSFA 5EXXA 3IQXA 4ZDKA 2NOAA 4MZJA 1EFRA 4GAOA 4MLWA 1NN1A 3AVXA 4XWAA 1JR3A 3KKOA 2IHYA 3FS7A 1E2IA 3DZDA 4US2R 3NXAA 1B8LA 4AOMA 3HDTA 3OIVA 1KI6B 1ZMXA 4B3FX 1B7TY 1AKYA 2WOJA 3OAAD 4JIMA 1P7CA 2QAGC 2J87A 3KUCA 3QE0A 2I2RE 5LD2C 2FSFA 1DO2A 5KTYA 4J0QA 3TUYC 1R6BX 2WJYA 4Q4AA 2C95A 1HT1E 2VHJA 3K70C 4GUKA 2GJ9A 4Q4HA 1GKIA 2H8KA 4PPQA 3R7WB 1TADA 4US1R 1F71A 5KDLA 4I5KA 4MRXA 2FGKA 3H0KA 3NKVA 2GXAA 4AYTA 1W4CA 4E07A 1XF9A 4XSHA 5BN5A 3TDIA 1WRBA 3B1XA 3W8RA 2V7QA 4Q02A 4KODA 3ZS9A 2SHKA 3EK8A 1XP8A 4RZ2A 5M04A 4Q47A 2QUZA 2QGNA 2LLUA 2NO1A 1EJ3A 4LJ7A 3RLFA 2FCEA 3IBGA 4Q4JB 1QXPA 1P60A 2C99A 3LLUA 1YUTA 1LB1B 3BUMB 2G1JA 3NEYA 1XA5A 1N65A 4HZUA 4NCIA 1OE9B 3P4XA 3LA6A 5AWFC 3GLIB 4JSTA 2QMOA 3K09A 1II8B 3IF7A 1RRPA 2QTFA 2J46A 3GK2A 3AAJA 1XRJA 5H70A 3JVTB 4G1UC 3QXJA 1G9XA 5I2LA 2CHGA 2TMKA 2QQ0A 1PVAA 3EA5A 4GI7A 4GZMA 4OHXA 4WXRA 3TUJC 4B3XA 3U5ZB 4KU4A 2J0SA 1DJWA 4QNMA 3PEVA 3ZQ6A 2Q91A 1CR1A 4MUBA 5C4GB 1E9EA 5CLLA 1RC8A 2MMGA 3K0FB 1GRQA 3LBHA 2DWQA 3CRRA 2OFXA 2JXLA 1H8HA 1NWDA 2BMJA 1T5IA 3KJIA 1G5TA 1VHLA 1KFXL 2JTZA 2GJSA 5AEQA 2HJVA 4HAYA 3MJHA 1RPZA 1DF0A 2LV7A 4RD6A 2LUXA 2M29A 1W0JD 1JAHA 2PX3A 3MD0A 5FL7A 6Q21A 3FHCB 3M1IA 4PC2A 2ZUDA 4V0ME 2MBXA 1W5SA 2SCPA 2QRZA 2OO7A 2CE2X 5DI3A 3SHWA 3A36A 3E5HA 3NIBA 4D25A 3U44A 2ZQ5A 2GK6A 1SVIA 1QHNA 3LXXA 3CRW1 3OESA 2FX3A 4L9SA 4D0LB 3GPLA 4Q1CA 3K70D 1US8B 4O2RA 3B82A 3LH5A 1JR6A 1VMAA 1GRRA 3BC1A 3F3YA 2H17A 4C0QC 1KQVA 1S4QA 2H61A 4B34A 3D0YA 2JRFA 5AUNB 1ZVQA 2EHBA 3BERA 1E94E 2RMKA 4DLUA 4TYYA 1H8EA 3A1SA 2NG1A 4QBHA 2KYFA 4LGMA 3TW4A 2Q0HA 5SZKB 1NBMA 5B58C 2IS1A 1XMJA 2GF0A 3L43A 4XIGS 4JLVA 5DNYB 3CW2A 1GILA 5AANA 3EIEA 3MUFA 2IEYA 4M1KA 4JYCA 1KI6A 3RS5A 4B6EA 4C0HA 2IS6A 2VHUA 3VNUA 1S9HA 4DJTA 5JBQA 2ECKA 1QASA 2HCJB 3NXSA 4L4UA 3U3RA 3UIEA 1Z0IA 3VRPA 3CX6A 2EFCB 2X2EA 3I62A 2Z4SA 1N3BA 5F3WB 1FL9A 2ZN9A 5KPJA 3VMFA 4L9WA 2XZPA 2CT9A 1YUUA 5AUQA 5G41A 3H4SE 1JEDA 2RGEA 2A5FA 1EXMA 1SQ5A 2AK2A 3THYB 5TDHA 4H9GA 3D7MA 3TUIC 1QS7A 2AAOA 1R8QA 3T5GA 1J8YF 1WBDA 4LJYA 4OQLA 5JECA 2DWPA 2QACA 4G0NA 4XVRA 3VAAA 3C1VA 2VF7A 2QTHA 3DZ8A 4CZ2A 5D7FA 2C04A 2G88A 2RHDA 3GEHA 4MQBA 1GTVA 3R8CA 5KO2A 2IW3A 3THOA 5E7IA 4JJKA 2RH5A 1K8RA 2PRUA 4Q1DA 5DSZA 1RYFA 4AYWA 1SGWA 1TNXA 4RJLA 3LW7A 4TYPA 2HYDA 4NZYA 4IFBA 2B92A 2YWEA 3DHWC 1IN7A 3CB4A 4TMWA 5C4MA 3PUZA 2WJJA 1XK4A 2ZSBA 4Q1BA 2I18A 3A4LA 3FB4A 2DR3A 4MDEA 3BS4A 5J40A 2QAGA 4OI4A 5BYKA 2JULA 2C5LA 3I8SA 4JBWA 4JJZA 4NL4H 1JF2A 3TQFA 1P5ZB 2ZYWX 3NBYC 2ERXA 5FOXA 4HAUA 2JATA 3H4MA 3E70C 2MSEB 1VG8A 4QNRA 2WMOB 3S1AA 4L16A 2QRNA 4PPGA 5JWOA 2WKQA 3CGAA 4PE0A 1N6IA 1G5PA 3IQOA 1ESNA 1Y3AA 4YGEB 3TUYB 3R8FA 4URUR 1Q1ZA 1BU3A 1DGVA 1NSHA 1UHNA 4WIAA 1HTWA 2CDNA 1D2NA 3K0CA 5EE3A 1R7RA 2V3CC 1YZTA 1KI4A 1YZNA 2X2FA 3LQQA 4PTLA 2D2FA 3RS3A 4RY2A 1SVLA 3CWZA 2LLTA 1QX5B 3DVEA 2ZRIA 3PEWA 2A5YB 3KEVA 2JASA 4QBFA 1AHRA 1YRTB 3D0YB 3SJSA 3LQRA 4XD7D 3W6PA 1BKDR 1KFUL 5J4YA 3K9GA 3O6BA 2O0KA 1ANKA 2KWIA 2J0QA 1T9HA 1DJGA 3OAAA 3RLZA 5EZ5A 4BUJA 1BOCA 3LK0A 2GEDA 1FFHA 4P4SB 3PV0A 3KO0A 1MT0A 1TOPA 2VP0A 4F7WA 2CLDX 3G0HA 4ASUD 2OCAA 5KSPA 2PX0A 3MAAC 4KVAA 1A4RA 4TMVA 2KI4C 1XPOA 1M7BA 1EH2A 2QGZA 1BOFA 1CR0A 4BRUA 4C9BA 1RVDA 3GQBA 1G18A 3JVUA 2QN6A 2FEOA 4DEXA 2LVVA 2M9GA 2BBSA 2BIFA 1M45A 4ZCVA 4MKGA 5EP3A 1AS2A 4QJ3A 4V03A 3DMNA 1W44A 1IM2A 1CDLA 4GFTA 4LYHA 1KSHA 4N3NA 1W2GA 3ZH9B 1Y1XA 4B2PA 3PR1A 1W2HA 5CK4A 4B32A 5C18A 3GJXC 1NVVR 2QENA 2DY1A 4WZAE 3P32A 3AKYA 2CXXA 1P72A 4CT5A 2I7AA 3V00A 1MO5A 3C8UA 3X2SA 2EFEB 3TMKA 2IA5A 1CU1A 2N1BA 5JS8A 4KO8A 2QL6A 4PHJA 5IK2D 3A37A 1G3MA 2FNAA 4Q7KA 3CNNA 3QKRB 2BL0B 3CLNA 2E6WA 1MOZA 2ATXA 4JLKA 1E2QA 5K8LA 1DJYA 2Y1MA 3ZVMA 2LVIA 2XNDA 1E2MA 3SE0A 4MYTA 4IDHA 3ZD7A 2IXEA 1X8KA 4YGAA 2AUCA 1QIVA 1MO6A 1AS3A 4C0BA 4I4LA 1V5WA 3K0AB 1Z07A 2R8RA 1F2UA 2FWRA 2LHIA 1AJ4A 2HLDA 2WOSA 1A82A 1KJWA 3AVQA 1I4DD 3WMGA 4AG5A 1GZSA 3U60B 4NYJR 3W34A 2FEMA 2JIZA 3QSYA 2IT1A 3KFVA 4LJ9A 2OLKA 1CNPA 1DE0A 3LCPC 2XX3A 1E2NA 1CB1A 1DELA 2P3SA 2PCLA 2ZROA 1SXJC 2ZEJA 3QVVA 3U2QA 2W6IA 1Q1QA 5GADl 1L2TA 3OP0A 2JLWA 2ZS8A 2WCEA 2F2OA 3MG9A 2IUSA 2OEPA 5JRZA 1GSIA 3OX5A 1NN0A 2GVZC 2LCPA 2VO1A 3KXKA 1KGDA 3WHUB 1B0UA 2FSHA 3CKLA 4MZLA 1KDPA 3QPUA 1ZMZA 2GCOB 3AVYA 5SZJA 2W83A 1RKBA 2FPKA 2BE6A 2JT0A 2QI9C 4AQJA 4EPYA 5FPKA 5KNCA 1AK2A 3SJCA 1Y6WA 3A8RA 4DIDA 4URXR 3TUZC 1SL9A 4JSYA 1G3QA 1L4UA 1LINA 2OESA 4TZ0A 4R2IA 5HKWA 3ONWA 1P75A 2ZI7A 4A0HA 4QKQA 1D1OA 4I5NB 4Q18A 4DBLC 3T5DA 2NCOA 3RS4A 2AD5A 1ZYUA 4L9MA 2LMVA 4K81B 2ZSFA 2HT1A 3CM0A 2J9RA 3UANA 2YZ2A 3CPHA 1S6CA 2AHOA 2F33A 4M8NE 3KF9A 2KSQA 121PA 3A58B 1IJFA 4JL5A 1LVGA 2IS9A 2MJWB 1IXSB 3PUWA 1QVAA 1W5TA 4LJ6A 1LV7A 1SKTA 1RE0A 4JL8A 3T1VA 4BEJA 2HDNB 1OKKA 3GJ3A 3F45A 1G1MA 4PZZA 2VRWA 3IO5A 5FPTA 3BYAA 2KOTA 2DCUA 1S2MA 3A4NA 1GGZA 3LLEA 2G9NA 2LKDA 1PSBA 4QFMA 5E4FA 2V54A 5J4LA 1TCOB 1AS0A 1CJMA 1DO0A 4QJ4A 1VKJA 5L3SB 1NF3A 1JALA 4FMBB 4A6XA 3BUWB 1E79D 4HYYA 3DVKA 3Q85A 1PLJA 4LV5B 5CDFA 4DCNA 4Q04A 4WQ3A 4OHZA 3HU2A 3VKWA 1KY3A 5AJWA 4ZCMA 2J7PA 3SYNA 5CPVA 5UKDA 5JCPA 4IVRA 5FH9A 1F4QA 4QC2A 1OYYA 1QVIY 1C7WA 4JMPA 4CGZA 2GGMA 4BGDA 1IN8A 3CR4X 5JRJA 1QV0A 3LV8A 2VPPA 4FINA 1BS1A 5J3XA 1D5CA 4YDSA 3JVTC 5K8UA 1N6KA 2ZRDA 2AK3A 1JUOA 2GTPA 2OXCA 3N70A 1T91A 4B2LA 1WP9A 3LBNA 4A8JC 3O4YA 3VKGA 4IDQA 5EP2A 3ADCA 3BOSA 3QPWA 1RFJA 3AB3A 3F0TA 3SIBA 1CJVC 1G7RA 1A7JA 2C9CA 1OOJA 4PO9A 3L0SA 2R62A 2FU5C 1IN5A 4RD0A 4V0MA 5KSOA 1XMIA 4D4MA 1DS6A 4EPVA 2ZYVX 3BXKA 2FSIA 3T12A 4OK6A 3NTUA 2XXAA 1KK0A 1P6XA 3HPRA 3EC1A 4F4IA 3AV0B 4PE1A 2WWIA 1FUKA 1NN5A 3BBPA 1CFFA 3CRMA 1CTRA 3JTDC 3QPVA 3LW8A 1CM1A 1NRJB 1ZW6A 3BGWA 3I5FB 4YMSA 3U4QA 2JZIA 1X02A 1IG5A 4ZKDA 2OFWA 1R5OA 3MJRA 1VRKA 4TMZA 5FOTA 4TWZA 2WCBA 1CULC 4ZDWA 2D2EA 3SC3A 4D2IA 5DI9A 2ZRGA 1SYMA 4OQXA 4A9AA 1KK1A 3LDAA 4A2PA 1Z83A 1XTSA 3EKJA 2ATVA 4JLNA 1AZSC 2QEQA 4JLPA 2RGNA 4JS0A 3TRFA 1MABA 4PC1A 3A4UB 1IY1A 2XSZD 4OBEA 3Q5DA 2M1UA 3EPLA 1P4SA 1YTZC 5B8IB 4KLNA 3UK6A 1GKUB 4ABYA 1C4OA 1G7TA 1IQ3A 1JXMA 2OCYC 2IWHA 3VTKA 4URVR 1D8TA 4B48A 5J47A 1J8MF 2KGBC 3BK7A 1N0WA 4R1EA 1F48A 4U7DA 2NZJA 3EW9A 3LRPA 4XVUA 5FTLA 3PALA 5A4JA 5IRCD 4CEIB 4A0RA 3IKJA 3NH9A 3KQKA 2JJ1A 3OE7D 4G5RA 1N5KA 5EP1A 3FWCA 1ZUNB 2BJVA 3C16C 4QXAA 4ZCLA 1RJVA 1CFDA 4BLTA 4GNKB 5F2EA 2EYUA 4Q1FA 4GGFC 4ZO4A 2B7BA 2QAJA 3BUNB 1K5GA 3LK1A 1MRSA 3TK1A 1ZACA 3BOWB 1J99A 4Q7MB 2FFBA 2PVBA 5DO9A 3I4LA 3QKSB 1XK4C 4MRVA 4BLQA 5FR1A 3CZPA 3BFKA 1SVWA 1S8FA 3IHLA 1MHOA 2UZIR 3GJ8A 4LBYA 2YVUA 4JQ0D 4ETOA 3HWSA 4B3DA 4D26A 1IJ6A 1JI0A 1HA3A 1DEKA 4NCNA 3J81k 4HRGA 5EXSA 1G7SA 1TF7A 1EFCA 1L7VC 3ZJYA 3RVBA 3KX2A 4KAXA 1EG4A 4MKIA 2WTUA 1XFYO 1OF1A 1N6HA 2F3YA 1CIPA 5JHHB 1GGWA 2KSPA 4WZBE 1NCYA 1Z6YA 3SG7A 1LY1A 2VQSA 2HF9A 1OZSA 4CT4B 3D3QA 2M3WA 2R6GA 4B44A 2V1UA 2FZLA 4PHNA 3BORA 2EWVA 3SEAA 5B2ZA 3BE4A 1SMGA 1B1GA 3ZYCA 2JU0A 4FWTA 1TU3A 2QP9X 1G21E 2XTZA 4M1TA 4EPTA 4D0NA 4NMMA 2KFGA 2DWOA 2OAQ1 2A9KA 3GLFB 1QHXA 1KSOA 2F43A 2FDCA 3BAFA 1OKKD 4C2UA 1KI3A 3OEED 2W6JA 5GJVC 1QHIA 1CDMA 3VR4A 4Q7JB 3GJ7A 2NLNA 4LK2A 3W5JA 1KZGB 3EXAA 4A8JB 3LFUA 3D8BA 4JPZB 5HE9A 1XXHE 4LY6A 5AERA 1LTQA 3OIUA 1CLBA 5CK5A 1G20E 2FF7A 3VR1A 1G291 1YU9A 1G3RA 2A3RA 4HLUC 4MYHA 1L7ZA 4R71A 2O5GA 5FBQB 4HRHA 1NUBA 2GETA 3X1XA 3KB1A 4A0FA 2ZI3A 4C0SA 3ICBA 621PA 2WCFA 1WF3A 5DE3A 1ZIOA 1ZCAA 4UJ3A 1E0SA 2BDTA 3LX5A 1MQ1A 2GILA 1SVSA 4MH0R 4ORCB 5CSNA 4KFUA 3TNFA 1CMFA 2RGIA 1XMVA 3DKPA 3K0AA 4BLSA 5HKKA 2PZGA 3EWAA 1YRBA 2XITA 2C96A 1F6BA 4D80A 2JLQA 1JSAA 4ORAB 1GOTA 1XEXB 1COWA 2FSGA 1G4AE 3O8DA 1BYUA 1OPXA 2RGDA 4OHWA 5H8WA 4JT4A 3NHBA 4XH9B 3AEZA 2OS8C 4OL0A 3CLVA 3E3RA 2BKIB 4H1VA 3ZS8A 4JWQA 4LSGA 4DWJA 4M4SA 3OX6A 1RRGA 4ACAA 1G5RA 1KI1A 2R9VA 3DL0A 4II7A 1GITA 5AJVB 2QBYA 3U7HB 2BC9A 4RCZA 4RSGA 4PCWA 1IHUA 2IYRA 3B60A 4HAWA 3P20A 4P0TA 3REGA 4CLNA 2PJRA 2PEYA 1II8A 4AD8A 2BKUA 4MN0A 3AP1A 4ICBA 1YR9A 2ZE7A 3NVAA 2CNWA 1JPJA 1VCIA 4EQ6A 3FHOA 3KKPA 1JF0A 2HV8A 4UNQA 2O8EB 1Z6AA 4I1SA 1DAMA 5DGXA 4OHVA 4HDOB 3AKEA 2OSBA 2UKDA 3CNOA 3SBDA 3I5FC 4PC6A 3RNLA 2K7OA 3W9YA 2OZEA 4TQUS 4G01B 1T3SA 2CVHA 2YKGA 2ZRMA 4US0R 2Y4QA 1OSNA 1HE1C 4CW7A 1QX7A 2KGRA 1T4GA 1U5IA 2A5JA 4NCHA 4AK9A 4N0EA 2ZR0A 2L98A 2OBMA 1NCZA 4A4BA 2IYTA 4HLCA 1TX4B 1SVKA 4Z54A 1FPMA 4A1FA 1W7IB 1F70A 5K8TA 2EVWX 3MLEA 3H84A 4FIDA 2PT7A 1SXJB 2V7QD 3AGQA 5GVRA 2ZNEA 2KFHA 5F9HA 2V53A 2OT3B 4Q00A 1XCMA 2LUCA 4V0NA 4BZXA 1FP6A 1WCV1 1SR6B 2G83A 5CJPA 1GAJA 2RB4A 5HE8A 1CLMA 1WRZA 1KYIA 1KO5A 1P61B 2OAP1 4HAVA 1AA9A 4TSFD 1A03A 4HDQB 2PALA 4D81A 2JPTA 3M0WA 1ZCBA 2LHLA 1PULA 4Q9JA 2K2AA 1LVCD 2VF8A 4LOAA 1WB9A 1OXXK 1OFTA 4QGGA 2W6ID 4JLMA 4RD3A 5FPYA 5BQ5A 1CF4A 3KJEA 1G41A 2EYQA 2KBEA 1NSTA 3PFVA 1Z8FA 2B8TA 2XNSA 1KNXA 3EZ2A 3P26A 1ESMA 4PO1A 1MR3F 1U81A 2RGNC 3N2EA 2YWFA 4CIDA 2Z6VA 1JECA 1LF5A 3ZVRA 2CLSA 1IN4A 2QAGB 1WXQA 3C41J 2XZLA 1ODFA 4KFRA 5BXQC 5LD2B 3SIAA 1ZIPA 1GNRA 3BB3A 4HUTA 3PSRA 1K96A 1QLKA 4USLA 3EC2A 1LA0A 4TMTA 1OFIA 1MWNA 1NJGA 3EASA 3FMIA 2IUTA 1HURA 3GLHE 2YINC 4H1UA 1H8ED 821PA 2P5SA 3IQWA 1F55A 4CEJB 2VRGA 4TL7A 2Y5IA 1G3UA 3TJZA 3O78A 3BFVA 4LJ8A 1W47A 2QP4A 4YGDB 2AFIE 1IBRA 3UATA 4LV8B 4DRWA 3MGCA 4YRUA 3L0PA 4MUAA 1A2BA 4NYJQ 4MEWA 5HKZA 4OI1A 4NPHA 4QG7A 1QZXA 2JEOA 4OJQA 5TY0A 4TL8A 4TNCA 4A6PA 4ARZA 3QKRA 1EESA 3WNBA 1A75B 2Q3HA 1FF1A 4P33A 4C4PA 4ZCUA 4TLCA 4O25A 1U8YA 1CJKC 4U00A 2OILA 4PHMA 1NL3A 3WBJA 2E87A 1YZLA 1HUQA 3KKMA 2DFLA 4WAUA 4BLOA 1KKLA 1BMFA 1VCMA 2J0UA 1UBFA 2XB2A 1ZD8A 2HLDD 1HV8A 4OKSA 3OIYA 5JEEA 1TNWA 1NX0A 3PITA 1XFWO 2BBWA 2J7KA 2D3WA 5DN6A 1UKVY 4FMCF 4W5WA 1UKYA 4LJAA 3TH5A 2JJ8A 2JWWA 3X1ZA 1XU4A 5G08A 3I5GC 2R6CA 4YMUA 3CPEA 3WRYC 4KHZA 4QJ3B 1GIAA 4XJXA 2ODEA 3QF7A 3I1FA 1UEJA 2NQ2C 3GEEA 4P32A 4QHTA 4BFYA 1H4BA 1R4AA 5L3RA 4IJMA 3BQ3A 2A5DA 4P4UA 2XTNA 3RRZA 4MKFA 1VG1A 4MYCA 1J55A 4CPVA 4M1WA 2D62A 2ZJZA 2YHSA 1EGAA 2R2AA 4N0DA 4TSFA 4Y0VA 1BR1B 5ER4X 1H8BA 1FQJA 1Q0UA 4FMDB 4KYUA 1YZKA 221PA 5KU1A 3AVPA 4F0ZB 1RK9A 4LV6A 3CIOA 1HYQA 2AR7A 1UBCA 1R0YA 4NH0A 5TNCA 4DVGA 1PJRA 3R9WA 5DN6D 1ELOA 1TRFA 4YI8A 3A4MA 4M2OA 4WXPA 1NX1A 4YI9A 2I3BA 1SKQA 3VROA 1FW4A 2R6DA 2VSOA 2ZKMX 3VR6A 1YR6A 4M22A 2MHHA 2BE4A 2ANCA 1RJ9B 4AIIA 1SCMC 5AXIA 1G8YA 3QXCA 3RABA 2BCAA 2F3TA 5L3QB 1Z0JA 2ZVPX 4B47A 3ZZUA 2XB4A 2ZRJA 3TGPA 1IAQA 4GDFA 4JVLA 3S1AB 1WRLA 421PA 1JFKA 1NX2A 1KTVA 1NBME 4ON9A 3TBKA 4A36A 3ZWHA 1T8TA 5K89A 2AL7A 1DVIA 2P6NA 4GPTA 3K8YA 4BE7B 5JMTA 1A1VA 3IPXA 3LBIA 2LP2A 3AKBA 3OB1B 3AGPA 1OV4A 3JZMA 3K0FA 4JT2A 3NSOA 2CCGA 2AKAB 2OFOA 2YC4C 2CJWB 1WDCB 3CX7A 5J4VA 2W0SA 4BZPA 2VP5A 1QHYA 1GJYA 5KSZA 4ZI2A 1UF9A 3TVDA 4JLDA 1DARA 1ZD9A 2BEJA 3IHWA 3ICQB 1QG2A 1DAEA 4LBWA 1OT3A 2IYSA 1WE2A 4NP6A 4JLBA 3B7GA 1P2VA 3NSIA 1ZNWA 1UDXA 2X77A 2RAPA 1HH4A 2D74A 5JJLA 1XJ0A 2JLVA 1B9AA 2ZUCA 1NG9A 1XWIA 1TQ2A 2NCPA 4D0GA 3EZ6A 5I2OA 1OJLA 5JLJA 1E6CA 4S2EA 4EJSA 4F91B 1KQMB 2E1RA 2IF0A 3OIWA 3PQCA 4FXPA 4GP6A 5FUWA 2BCXA 5KPDA 3I61A 1N6RA 3TSWA 1ZUIA 1U9IC 1DPFA 2RKOA 1M39A 4DCUA 1UKZA 1TF2A 1F54A 2C98A 4GNKA 1YRUB 4MA4A 3I92A 3EPJA 2CL0X 3U7GA 5D69A 3WP0A 1SR6C 4GOXA 4MBEA 4AWXA 1GNQA 1SL7A 3AKCA 3BOWA 2O8EA 4KI0A 4YMTA 1U94A 3DOFA 2GZHA 4S35A 1B8RA 4DT1A 1GDDA 2GV5A 2ISDA 2OCBA 4NCKA 2JJ2A 3KL4A 2A2ZA 4YLGA 1XJCA 3CZTX 2IYXA 3O47A 3VU9B 4MRNA 3U61B 3CRQA 2NO7A 2BKEA 4DB4A 1YURA 1CR4A 5B57C 2AKYA 2D7CA 5CM9C 1XZQA 2IYYA 3ZD6A 1HT9A 1KDRA 4KBFA 3RRMA 4EKDA 1SHKA 1Z6TA 2BBNA 2QMEA 4PR0A 2LLSA 2K7BA 2PCJA 2F8PA 1WY9A 4A4CA 3L2OB 1IXRC 1SKYE 3QJYA 3GK4X 1XBTA 4QBGB 2FN4A 3ASZA 2CL7X 1GWNA 3PXGA 4NDZA 3W8NA 2GHIA 1R5NA 2IXGA 1J7OA 1EWRA 2DFTA 1CS4C 3RSLA 3K0SA 2GEUA 3Q7PA 5AJXA 2MA2A 3TS5C 3CNLA 2CHVA 2ZANA 3A6PC 4NDCA 4HB4A 4RKFA 1AM4D 3REFA 4QHSA 1M74A 3SG3A 4I99A 2GXSA 3H86A 1N2CE 1PUIA 4JLJA 3LD9A 4YXWA 1NX3A 5AUOB 2O8BB 4DIEA 3KQHA 1GFIA 3KKQA 4TT3D 2KDHA 3I3SR 2F3ZA 1IQPA 1KMQA 4UQOA 2GWHA 3X1DA 3PEYA 4XJKB 1ZINA 1XD9A 2WIBA 3FTQA 4KSBA 1VYVA 3SDZA 3AM1A 2ZU0C 1G33A 1ONBA 1JEEA 2JT3A 3DDCA 2H16A 1I2DA 1LNZA 2VSXA 3NBZC 3AVWA 1XNJA 3CF6R 2IYVA 1GNPA 2XEXA 2O60A 1SCMB 4MRSA 2Q6TA 3AF0A 4IEIA 3VNVA 1TQ6A 2ZI5A 4GL2A 2VHQA 2WKRA 3HCMA 2WMNB 1U2RA 3B2EA 2LP3A 3O8BA 4M9QA 2OPOA 1KO8A 4HLQB 2G3YA 3UMSA 1OXSC 3TZ1A 2DB3A 5FFMA 3GFPA 3K53A 3HU1A 3QBVA 1E9RA 1DJZA 2F3RA 4QHYA 2ZRBA 2IX3A 3B78A 4CEHA 2N42A 3RM1A 1NSFA 4P3YA 1E9SA 1J7KA 3TE6A 1XTQA 4LYJA 4X8HA 3UXMA 4Q9HA 3PIRA 2GEVA 2BL0C 4V0OA 1JNYA 2YOFA 2F1JA 3THWB 1Q57A 2R44A 2XAUA 1EWQA 2NZ0A 3A1VA 2C03A 3TLXA 1V1GA 2FOTA 2UVQA 2R6AA 1UHKA 5KSYA 2V4ZA 1TPZA 3NH6A 1AZTA 1Y1UA 2GVDC 5CJ2A 4GBAA 1G8HA 2F1RA 1VG9B 1M8PA 3WP1B 3VKHA 2FCDA 4URZR 3EARA 3MWJA 1N0UA 1OXVA 3R7WA 4ILEA 3WBKA 4W5HA 1GG2A 4O0MA 4C0LA 3GD7A 4JVNA 5G40A 1UADA 1NLFA 2A30A 4ESHA 4MSPA 1BIFA 2QT1A 1F2TB 1O3YA 4GT1A 2OHFA 2CNWD 1KI7A 3L8ZA 2GAAA 4RZUA 1KMHB 4AKEA 1EFHA 4A0GA 3KJHA 2WZQA 4Q4LA 4DLSA 2WAXA 4O2LA 1II9A 2CNPA 4LWZA 2ORVA 1KO4A 1NKSA 1AUIB 1RFLA 1E1QA 3DEFA 4P4TA 4QOSA 1P2UA 3AH8A 5DIFA 4ESVA 1SBJA 4M1SA 3SOPA 1J1EA 3UWKA 2I1VB 3K9NA 3EK7A 3L0OA 4N1AA 1J2JA 2ERYA 2O8FB 3ND9A 4WBSA 1JQJC 3ZIAA 3GLIE 1PSRA 1DMOA 2IC5A 5TARA 4KSCA 1LS1A 4IXMA 4PQRA 1JAIA 2LVKA 1S6JA 1X1RA 1QF9A 2OXRA 3AF3A 2CCMA 2QM7A 2CBLA 4NDDA 2BMDA 4WZ6A 2WSSA 4OQNA 1AQYA 5KOYA 3TAHA 2RHMA 1DBSA 1CDPA 1KQMC 3BFXA 4A2QA 2ZJ8A 3TSOA 1RYHA 5CYPA 2CCKA 1YX7A 5IK2A 3DMDA 5F98A 3EVUA 2YV5A 4B35A 1YRAA 4GMXA 3SU8A 1AKEA 5FTJA 2W2XA 4CYMA 4DCKA 2XJ4A 3FKSA 4KVGA 1W4RA 5ER5A 2IL1A 4HAZA 1OB5A 2H7VA 1TTXA 5JZVA 1PVBA 2Q21A 1RTP1 5BWMA 2ZAMA 3Q72A 4CVNA 2WHXA 2ZE5A 1S6IA 2OV2A 2ANBA 2GK7A 5CM8B 1FMLA 2YC2C 2M7NA 1G8PA 2HYIC 3DOEA 1NVWQ 3LX8A 2YWHA 2CTNA 1FTSA 2BCBA 2QPOA 3B13B 5J5CA 4EUNA 1SULA 2IF2A 3THXA 4CEHB 1RZ3A 3FPAA 4EQ6B 4F4JA 2WOOA 1E9CA 2QU8A 1AK8A 4FMDF 2PMYA 1IJEA 1XJQA 2ORIA 2L5XB 3NDPA 3T15A 4DSOA 1BJFA 3KTAA 1CFCA 4O3MA 1E1RD 1EG7A 3TKLA 2CMKA 3MMPA 2QBYB 2GA8A 2EW1A 4G3XA 1KOFA 2E30A 1T3HA 4EFMA 2J0VA 2D8NA 2GRJA 3PATA 3TS5B 1FPWA 1E8AA 2KBMA 1CTQA 1K95A 1OHHD 1P9NA 1XXHA 1YX8A 2VA8A 4K46A 5L3VA 1R2UA 4RFSA 4MYUA 3SNHA 2EC6C 3PCRB 1TUIA 2OCPA 3NSLA 2YOHA 1LXFC 3I5GB 5EJEA 4TZ6A 3AAKA 1UFQA 2LKCA 1R6PA 1ALWA 4DUQA 4UJ5A 2W2TA 1SHZA 1H8HD 2XTMA 1K94A 1O87A 1E2DA 1YZQA 4BQSA 1NI3A 2FA9A 2IYUA 4I81A 3W5IA 4UXJA 4QM7A 4HZUB 3I5YA 3V9PA 2PEZA 3EPKA 1K9UA 3O2PA 3U3OA 1E1RA 4CFQA 1GUAA 3QF4B 3W90A 4LC1A 5AR1A 1JPNA 4Q19A 3R9IA 2ZS7A 3EA0A 1WLMA 3B85A 4RZ3A 1IH0A 3FMPB 2ZIAA 1AJEA 1TIZA 2GJ8A 4B2IA 1LKJA 1VTKA 5EXPA 2BM1A 2V8OA 3I72A 1K2HA 3I5XA 1DT7B 4I1VA 1XTIA 1XB2A 4Q03A 4V0KA 2MLEC 2K61A 2O8FA 2BHRA 2ZRFA 3TDZA 1CBUA 1ZD1A 1KK7Z 1Q21A 1Q44A 4UXIA 5B64A 5CB6A 3K0CC 1E96A 1KZ7B 1BYIA 1SXJD 2Y8EA 2ZI4A 5TB5A 4AURA 5HCNA 4P2YB 2KBIA 3UPUA 4NCJA 4QJ5B 2P6RA 3AF2A 4FCWA 1TEXA 4C30A 3FGNA 5EUQB 2Z0MA 4RD4A 2JLUA 3VU9A 3U3MA 2H5EA 1KI2A 1QJTA 1E2PA 1MR8A 2BWJA 2W0MA 4PXAA 4BZQA 5JWRA 4AI6A 3V4RA 1F2TA 3IGFA 1IWQA 3QXHA 4LZZA 1Q1EA 4B43A 1NVVQ 2JA1A 4HSEA 3SN6A 3AVTA 1J1DA 1N6PA 4D6PA 1J90A 1TAGA 1WDCC 1XTRA 4M1YA 1AN0A 3B9PA 3AUYA 2BJWA 1E3MA 2VIIA 2KB0A 1W49A 2AXPA 2V9PA 1DJXA 1HQYE 2ZJYA 5H1YA 4KFSA 1K93D 1U5IB 5CSJA 2QM8A 1S26D 5K8IA 4POAA 2EFGA 2Q9CA 4URYR 3SHFA 3SQWA 4W9MC 2KI5A 3BB1A 3NG1A 1ZU5A 4G5SA 1EX6A 1G8GA 1EX7A 1TL7C 1DADA 1BT6A 4BFSA 2BVNA 2KJQA 3AP3A 2ZU6A 2HETA 4AG6A 3GLGA 2HQ8A 2CBZA 1G8FA 5BPJA 1E69A 4QGFA 1M7GA 1KK7Y 1E1QD 1OIXA 1Q20A 1UBGA 1ZUHA 5AJZA 3MSXA 3QOFA 1ZNZA 2RCNA 2ZE6A 3I32A 1SL8A 4M0LA 5L8VA 1SZPA 1IGVA 2MSCB 1L2OB 2GKSA 3C5CA 1OFHA 5TXGA 4NYIR 4NKRA 3UG7A 4RFVA 5C46F 2DYKA 5JI3E 2HJGA 4BLPA 2N46A 3MFYA 4IOJA 2JLYA 3ICEA 3TIFA 2ZUBA 2OM2A 3N5CA 1DOAA 4QJ5A 2D4HA 3ZNIA 4NONA 4PC3A 3AKAA 1MUXA 4AY2A 1B8CA 3MRSA 1W1WA 1GL9B 1C7VA 2LVJA 1TMKA 4OCIA 4HSZA 4WA7A 4Y0AA 2ZS9A 3RRYA 4QRHA 3ZLJA 1EXRA 1G19A 3NBFA 1ZU4A 1A5TA 1MRNA 1U0HC 1XZPA 1E2LA 1SVOA 3FDIA 4UKDA 5E7JA 1OXUA 1T5LA 1RRCA 4C2TA 4M9XA 3W3AA 1NVXQ 2I1QA 1TNQA 5EQTA 2EC6B 2VL7A 1MKYA 4BFVA 1OIVA 5DYGA 1VIAA 1QX2A 3RSOA 3W3ZB 2LC5A 1Z3IX 3HU3A 4E22A 1XFXO 5FBRB 721PA 2D7DA 3RC3A 3QI2A 4ARZB 3PUXA 2FGJA 3RC8A 1OFUX 4NQGA 5EE0A 2KQYA 5G53C 1B23P 4P4SA 1KO1A 1BO6A 1W0JA 3KJGA 4AKIA 5FOSA 2I94A 2VP4A 2WWGA 4HB0A 5HZHA 2WWFA 1F4OA 1XEWX 4TQAA 1XMSA 2BCJQ 2REBA 4UNSA 5FPSA 3L8YA 4FTGA 1JJVA 2GBLC 4HATA 2BBOA 1UKEA 3KZ1E 2KQ6A 2IS4A 4BFXA 1SKYB 3QEOA 2B21A 4PHGA 2ZYTX 3GMTA 5AFPA 1NJFA 4M1MA 1KSFX 3VRNA 4DDWA 3WNDA 1IY2A 2B1UA 2BCGY 4FW9A 3SG4A 3MCAA 1LA3A 3SG6A 2V55B 521PA 4DSTA 4DSUA 4LHZA 3LVRE 4PAMA 1J7QA 2OS8B 1E2HA 2EWWA 2WJGA 4ZV4A 2HUPA 4FN5A 3T1TA 5JJKA 2Z83A 1TNDA 1CKEA 2J0UB 1ALVA 5IDVA 3O8RA 1N0VC 3RYTC 3WHKA 3GLIA 1A4PA 4PSVA 5JJIA 5FUVA 1A75A 1KO7A 4MRRA 3RHFA 2PL3A 4XTRA 5KHOC 2ORWA 3F5FA 3GJ0A 2P2LA 1B7TZ 4MGIR 4TTQA 1FW6A 2NO6A 2P67A 2NZ8A 3EIQA 4XSGA 4CEJA 1X3SA 1JR3E 2JDID 4EPXA 1FBVA 3ASYA 1OIWA 1EFRD 3FFBA 4Q9LA 5E3HA 4EJSC 1EFUA 2F1IA 4Q4JA 2FMXA 3T61A 3U6BA 2K7DA 3FMOB 4B74A 2VH5R 4Q4AB 1QV1A 1VCOA 2ZSAA 3PUVA 1ZUZA 1QVIZ 3BIFA 1OXTA 2ZJAA 3EWSA 2CK3D 4IOLA 1A29A 4E5UA 1X8LA 5SZIA 3VRRA 4TMKA 3EVVA 2QMUA 3PENA 1IOZA 4DZZA 2RGXA 5G3ZA 1RECA 1AGRA 1Z47A 1SPYA 4TYQA 4EFNA 2ZRLA 1MO4A 1S3SA 1M31A 1VYUA 1IJ5A 1UEIA 2C78A 2JLSA 1NNEA 1UHHA 3QKUA 4DCVA 2Q4UA 2IWRA 3Q3JB 2WWXA 4LHVA 3DVMA 4A4DA 2J45A 1CRPA 1G7CA 4K8OA 1TTTA 4PAQA 5SZHB 2J5XA 5EE9A 4ZPXA 2PASA 3QXXA 1F5NA 2JOJA 5FTMA 3T06B 1QDEA 3G82C 1DVRA 5DHAA 1N5LA 2QTVB 1Z0AA 4QL3A 4KXFB 5DKNA 4KCGA 1EL4A 4LDJA 1YQTA 1JBAA 5BYJA 3Q7QA 4DLRA 4YGCB 1KDOA 3IEVA 2GCOA 4EAQA 1FTNA 3MWLA 1IQ5A 1E98A 2WVJA 2Z4RA 3LAWA 3FWBA 5JCZA 2HXSA 3GEIA 1I2MA 4OKHA 3TQCA 2WWHA 5FTNA 1W36D 4M21A 1EFTA 3GFTA 3QEJA 4LHWA 4Q9IA 4B71A 2G0NA 4GFDA 1RRFA 2LNKA 1M63B 5KUTA 2IYLD 1Z0FA 2NPFA 2FV8A 5LBIA 4MDFA 3QKTA 2GGZA 2C9YA 2O8BA 4EPWA 4UNRA 1CEEA 4LX0A 1RIFA 3B8HA 4C7OA 1ZFSA 2FJUA 5P21A 4XD7A 1Z0KA 3FYHA 1DJHA 4XTCS 2GF9A 2QQEA 3PJRA 4GP7A 4MGYR 4RD2A 3ADBA 2NGRA 2GXQA 2FPMA 3X1WA 1Q3HA 4RFSB 3WYAA 1DAFA 2P0EA 4ASUA 2OBLA 1BG1A 5GVSA 2G0TA 4WQ2A 1XFVO 2WM9B 2AN9A 2YWGA 2JC2A 3NHAA 2NMVA 1II0A 3QUSA 4KJZA 1NIPA 2W2VA 3IBYA 1YE8A 4XVQA 5CYOA 5GJBA 1NIJA 4OJKA 3TR0A 3MSEB 5F9FA 2ZXUA 3IO3A 1DG1G 1D9ZA 4FI3C 4LJ4A 1QRAA 2K2FA 4R9UC 1NG1A 2JLXA 1Q22A 3R20A 2WBLC 3HPQA 3Q5EA 4JVSB 2ZRNA 4Q66C 5TMPA 2F9LA 1AQUA 2J3EA 5AUPB 3HP1A 5JJGA 5FBVB 3THXB 3U4QB 3A1UA 1G3IA 4PZYA 1XD8A 3I5HC 1L4YA 4HB2A 3OHMA 4HLDA 1E0AA 3A8TA 1T3LA 3TAUA 3VR2A 5L3SA 2H61C 1PV4A 2B8WA 4U8DA 1TQ4A 2JLRA 1YR7A 4PZLA 1XFAA 5ANRB 3GLGB 4OQFA 5BN4A 1JC2A 2X1VA 2OE2A 4LC0A 4Q1AA 4YBHB 1BMOA 1QHGA 2TN4A 2ZTSA 1U98A 4DLXA 1KHTA 5DI3B 1KFUS 3EK4A 1T6NA 2AWOA 2QPAA 2PZEA 5FBWB 5A0FA 1P3JA 1E32A 3OHMB 2JT8A 3TW8B 3WXMA 5FR2A 3FVQA 3IILA 5A5GA 1ZJ6A 5KNBA 1E0KA 1ZC3A 4Z51A 1DAGA 4CFRA 3QKSA 2LMUA 1E4VA 4KFTA 2VHCA 5EZ6B 4OHYA 1TF5A 2WSSD 4PDZA 4XYNA 3KQLA 2BV3A 4RVCA 1SVMA 2ZRAA 1M7HA 4KV9A 2J59A 3U7FB 1MV5A 2KFFA 1KI8A 4HLUA 3UG6A 1W4AA 4UNNA 3QQ5A 2LCFA 3OFND 5DHFA 4JLOA 2WJIA 3RDPA 4F38A 3IQQA 4OVNF 1AGPA 2O5VA 2VHTA 3AP2A 3CUEF 2QG6A 4TLDA 5FI1B 1QG4A 5FL7D 5C2JB 5DLQC 2IXFA 1BR4B 1GKYA 1VPLA 4LPKA 4LRWA 3CF0A 1CJUC 3L0IB 1XCPA 4DHEA 2JJ2D 1IXZA 3OEHA 3CS1A 4EFLA 1OH7A 1JJ7A 1DAKA 1GVNB 2L4HA 2J1LA 5LB2A 1XX6A 1ZBDA 4JLAA 1FNMA 2R2IA 4Q5IA 3OB2B 4DLTA 3O8CA 4TLEA 2EGDA 2IUUA 3LXRA 1I4LD 2OBNA 2XOKD 4X8MA 4DDVA 2EFDB 3BUXB 3V4FA 4Q1EA 1U9IA 3LNCA 3QNUA 2KAYA 2HT6A 4DLWA 4YGBB 5JOLA 1W48A 2RGGA 4EDHA 1W7JB 4MGKR 1GL6A 4WRIA 1W4BA 3KUDA 1ZC4A 2BEKA 3DM9B 1UHIA 2NO0A 4OK3A 5D3MB 4QJ4B 2J41A 1KK8C 3PUYA 4DLYA 1AVSA 5HTKA 2RGAA 4V0LA 5HCIA 2CEAA 3QVUA 1FX0B 3P1JA 1QHSA 3Q8XB 2SASA 2BM0A 2ZI9A 1R10A 3GCGA 4B75A 1U99A 1UURA 3PM8A 2KNEA 1Z2CA 2CHQA 2BMFA 1KDTA 1FMJA 1Z06A 1U0JA 3PN7C 5IBWA 1NCXA 1B4CA 4L8GA 4CEIA 4GGFA 4NU0A 4TLBA 4BRWA 3KFXA 3OF5A 3KTAB 1RROA 2V1XA 2ZJBA 4JZKA 5TVKA 3B1VA 4DDTA 4E03A 2QNRA 4RKEA 1YVHA 1N0YA 1XDBA 2Q3FA 4BLRA 1N25A 1E2EA 1G8IA 5KDOA 3QBTA 3TSZA 2JLZA 1JXOA 1NBMD 1QTXA 1TEVA 2V6IA 3K21A 3HR8A 4PHTA 4B73A 2ZRCA 4NYMQ 1TCFA 3FOZA 2AXNA 4OV2A 2OG2A 4HDCA 2GJKA 4E09A 5FUYA 4G5GA 2D06A 4TTPA 3FHTA 2A7QA 2ZPTX 3QENA 1S36A 1Q1BA 4IW3B 4JBXA 4PHHA 4ACBA 2B6HA 4DKXA 2CL6X 2CXJA 1YR8A 1A2XA 1SY9A 2IHBA 3EAQA 2JNFA 1BMFD 1V1FA 2W6JD 5GJWC 2KHNA 3U6KA 4MGZR 1HQVA 5DISB 5FTKA 1D2MA 4IDPA 1Z2AA 3KHEA 1S9DA 1YKSA 3VX4A 1NLYA 1XYDA 1ETUA 3QF4A 3EPHA 2JXCA 2R65A 3BH0A 1CMGA 3I8XA 4FWIB 3GJ6A 4XWOA 2UZ3A 1ZP6A 4DC9A 2YOGA 3LLMA 4BPBA 1ZNXA 3THWA 5BN3A 4KBGA 3RS0A 3K1JA 4BFUA 4D4LA 4Q01A 4AKHA 3DD4A 1F2UB 3G5UA 2LAPA 1OB2A 2QE7D 4DSNA 3T34A 3ZIAD 3GLHA 1K90D 3B9QA 3GLFA 4L5BA 3HJNA 3M4YA 3SG2A 1WA5A 2IYQA 1TUEA 4YMWA 4MZKA 5HZKA 3ZDQA 4B33A 3CTNA 1N6OA 3EG5A 1R0WA 3ADDA 1ZM7A 1OMRA 2ODBA 4P31A 2P6UA 3NSKA 3EX7C 1S5GZ 3C7KA 4IHQA 4ITRC 2WSMA 2K5UA 4EPRA 1ZM3A 1S1MA 2GXUA 2GDJA 1OZOA 3A1TA 2EFHB 3D31A 1AP4A 4WVFA 1W36C 1YVLA 1K9KA 4BY5A 4LHYA 4BFZA 1SXJE 5JFGA 2IEZA 1T8UA 1E2JA 3DKVA 3N2IA 4G5OA 4M2LA 4YXWD 1M6NA 2PLRA 4C0KA 2H57A 4JYBA 4TYNA 1A2KC 4D4JA 1N5JA 5I8NA 2PZFA 2GCNA 1TQDA 1IRJA 1TU4A 2YYZA 3EZFA 4YC7A 2PSRA 1Q12A 4IXNA 5H68A 1FX0A 3ND8A 3ZZ0A 3LWNA 1T0HB 4YONB 3CF2A 3VHXA 2ZNDA 2Z43A 1NMYA 2O8DA 5D3MA 1KKMA 1M2OB 3VQTA 1W0KD 2FJUB 3B1ZA 1ODBA 4LYAA 3BB4A 1WRKA 3CR8A 2QROA 1SK6D 1VCNA 3ETLA 3QXSA 2H2KA 4JVMA 3RS7A 2IYWA 5KYKA 4HREE 5C1BA 5LDDC 4B3GA 1G6HA 2GESA 2O52A 2XJ9A 5DYIA 1JR3D 1XPUA 1U90A 1K6MA 1GQMA 3M6AA 1HE8B 3IEUA 2MAZA 4C0AC 4V02A 4EJSB 1D2EA 3CZQA 4FCTA 2WJVA 5D3QA 3WY9A 2OTGB 3K0EA 4BECA 5AJYA 2HPSA 1IONA 1DJIA 1DG3A 5JWHA 4HEJA 4Q4HB 1Z63A 2CE7A 4PSAA 3VR5A 1K9PA 3AF4A 1P9WA 3ZQJA 1CFPA 4QGAA 4PQYA 3W6NA 4B6FA 4BY4A 2ZE8A 1ZRHA 2FOLA 3AVVA 4IOMA 5CIQA 2PH1A 2DFKB 4HAXA 1FZQA 1NMZA 1XD2B 3MWKA 3UWOA 1WLZA 1KCYA 1G6OA 2JIZD 1YR5A 3F8TA 3WHLA 4ZDIA 3DM5A 3SG5A 2BMEA 3GOFA 4TTRA 1PRWA 3GJ4A 4M9ZA 1VYTA 1OH6A 4Z1MD 3D10A 1N6LA 4IOKA 2LE9B 1MH1A 2VEDA 1MF8B 3LO5A 5CSFA 1UP5A 1U8ZA 4BFTA 2AD1A 3CWGA 4PHKA 4GRAA 1IN6A 1E2GA 1Y63A 2G6BA 3EZ7A 1CLLA 1KMHA 4ZCIA 3NDBB 1E2FA 1KK8B 1UM8A 2ZVQX 3DF0A 1P2TA 3T1QA 3WXAA 4ZIRA 2K8MB 1F60A 3MWYW 3KXIA 1NP8A 3IDQA 4MRYA 3NC1C 4XWKA 2ZRTA 2WWYA 4LCBA 1UWOA 1N6NA 4DIRA 1KI9A 3DVLA 1QVRA 1VG0B 3BWDD 3PEUA 5EE1A 2KAVA 4TMXA 5HR5A 4I5LB 1OH8A 5HLVA 4W7SA 2QSZA 5JEDA 4N1FA 1E9BA 1CM4A 3CR2A 1C07A 2RGBA 2WPDA 1OLOA 4PO8A 4WOPA 5F6TA 1UUSA 2ZRKA 3GLFE 3PN7B 4RCYA 4A15A 2MLFC 1PLLA 1XO5A 4OR9B 4F4CA 4DB2A 1JB1A 2JNXA 4Q21A 4R7ZA 4NE2A 3H2YA 4DLZA 3ZVNA 1PZNA 2JCSA 1OSAA 2LANA 1VECA 2HEIA 5IT5A 1SW8A 2WJHA 2F2PA 1XXHB 2X8AA 1V43A 1W0KA 2A5GA 4U5XA 1FI5A 2PMKA 3VR3A 3WMEA 1BODA 2C8VA 4DUGD 2F43B 2ZI6A 2WWWA 4GSYA 1Z6XA 1E9DA 5FOWA 2CVFA 4DEYA 4DDUA 4QM6A 4Q7LA 1U8AA 1Q3TA 1MXEA 3CRVA 1NP6A 1KK2A 4HI0E 4URWR 2GBLA 4LHXA 5FPHA 2PMDA 2REXB 1KFXS 2REOA 1C9KA 4FD2A 4NYMR 2WPDD 1YVDA 2WNDA 1S0UA 2C9OA 2CK3A 2PLFA 2C77A 3EIHA 2ASEA 4GZLA 4PPFA 1KJZA 2OLJA 1DTLA 2K7CA 1OW3B 1S5GY 1SCVA 2HF5A 4E68A 5DKQA 3C14C 4D1EA 2H18A 2IBMA 3BH7A 1Z0DA 2ZRPA 4IKEA 5DH9A 3VHLB 4GPLB 3RANA 2M1KB 5KNDA 4EIWA 4ZIRB 3WRXC 3I5HB 4LUCA 1FOEB 3K09C 2BBMA 4AYXA 2F1HA 2KI6C 1KIMA 3RRNA 1J7RA 1NPQA 3GK1A 2F6RA 3I5IB 1BF5A 3U3JA 2Z5FA 4BASA 4YQFA 2XXAB 5DKRA 4PQFA 3CR7A 1R0XA 4AQIA 4PAOA 4KLZA 4Z1MA 3B1WA 1EG3A 1QBKC 4IVPA 2FH5B 4I1OA 2WORA 5FUXA 1RW4A 1TNPA 5BW8A 4ORBB 1JBKA 3GP8A 3BD9A 3THYA 4OI2A 2VYFA 4A82A 3CO5A 4NYIQ 2EQBA 1LFDB 1HT2E 2PJZA 3Q9LA 3ZGXA 2L50A 1CR2A 3P4YA 2QPTA 1BLQA 3FKSD 2ZREA 2NXQA 1FNNA 3M0EA 5HPYB 3GLGE 4MKHA 1KAOA 1XVJA 1MO3A 2ZM5A 1GL7A 3WNXB 3JZAA 2ZJ2A 1IKUA 3QG1A 4JBYA 4D4KA 2GJAA 2DPXA 3SYLA 3T35A 3K70B 4B3BA 1AJ5A 3HX4A 1J70A 1KNQA 1MABB 1X6VA 3IIKA 2AMIA 5E95A 4PANA 1ZAKA 4PX9A 5EUMA 1LF0A 2KYCA 2BBTA 2C2HA 5JS7A 2BOVA 1GP2A 2ZETA 3BH6A 1FI6A 4QBIA 5FYXA 1NLZA 4TQ9A 4LJ5A 4DT1B 4IDOA 4DUGA 1E0JA 3SFVA 4PE4A 1G16A 1OYWA 1OHHA 1XEFA 3C15C 2DOQA 3PLFB 2PBRA 1G64A 2ODNA 1OE0A 4NDBA 1R5BA 3KQNA 1WMSA 2ZITA 4IFEA 4LBVA 2BKHB 1QHHB 4BEBA 2AX4A 2WICA 3SBEA 1VHTA 2G9BA 3TDUA 1LW7A 3GFOA 4HZIA 3FE2A 4TN1A 1G4UR 4CF7A 3SFZA 2P65A 5CB8A 3CBQA 3PFIA 1AIPA 2QZ4A 1Z6GA 3CR5X 1P2SA 1ZOTB 3CX8A 1L2OC 3PG5A 4GOKA 1KSJA 2HQWA 3CONA 4A92A 3SZRA 1CLUA 1QLSA 1XCGB 3NEJA 1FUUA 2B7CA 3JVVA 1KWOB 2PT5A 3B5JA 1B47A 1UAAA 2QORA 1NYAA 5FBLB 1N5IA 4TL9A 4JKYA 5J4KA 2M97A 1WDTA 2WV9A 1XFUO 1VDZA 4YMVA 3EKHA 4FCVA 4UNPA 1EK0A 5L3QA 3GLHB 3P27A 2DHRA 2QT0A 2VP2A 1T0JB 4Q48A 1UBEA 2H1LA 5HKKD 1NY5A 1JFJA 2W00A 3EVRA 2IYZA 3E1SA 2L4IA 1R0ZA 3DVJA 1N2DA 1P62B 1W46A 1XEXA 2LWIA 5CLQA 4F93B 5JSZB 4OK5A 2G2BA 4GBMA 5FOVA 1COWD 4DS7A 2QA5A 3DPUA 3FWYA 5HYDA 2QSYA 2WC8A 4FQOA 3QIAA 4LPSA 5GJCA 1Y0VH 2O0JA 1CP2A 3RAPR 1E79A 3SJAA 2AFHE 1CKKA 2K0JA 4AC9A 2HCBA 5HKYA 3JTDB 3C4JA 3CH5A 3RWOA 2EU8A 3PVSA 4RD1A 3WMFA 2FPLA 1DTSA 3ECCA 4N5XA 4KYIB 1NVUQ 3FIAA 1US8A 1KJYA 2W58A 3VFDA 2KBFA 3IUYA 3TR5A 4P5OE 3CWQA 4LYFA 3KPXA 3RS2A 3AVUA 3SQXA 1M1YE 2L51A 3K9LA 3OEEA 4X8LA 1SRAA 1VIYA 4UPGA 2GZAA 3H1TA 2COLB 4LI0A 2ZJ5A 1R8SA 5LB4A 1KK3A 2JDIA 4HUQB 1PLKA 2O8CA 1Y1AA 1ZM2A 3NBXX 1M46A 1QATA 4B76A 4A8JA 4TL6A 3CH4B 1S1EA 4NTZA 3X1YA 4B3CA 4CDGA 4YDHB 1HY3A 2ZR9A 1DAHA 4IEEA 3QY0A 5JI2E 4PFSA 1FP7A 1C1YA 3D6TB 4XOIA 2O0HA 1CRQA 1CXZA 1XTJA 1Z22A 4C0JA 1F3OA 1S3GA 2FG5A 2ZR7A 1XD2A 4PALA 1P73A 2A4JA 2ZAOA 4R98A 4W5JA 5AK0A 5FL3A 2GCPA 1XPRA 3ZVLA 2NTYC 4PHFA 3FFAA 2YJTD 4PSKA 2LMTA 4ZKEA 2JTTA 2QE7A 3HYTA 1W36B 3U7EB 1G4YR 4IVQA 3K9HA 2F9MA 1YHNA 2FFAA 1WQ1R 2CLCX 1UHJA 4OI0A 2ZRHA 3C5HA 5ELXA 1UDWA 3LVQE 1HEIA 3NC0C 2QY9A 5HLOA 3VGOA 3DO6A 1KSGA 4HB3A 3UKDA 3ZZTA 3U3KA 4A2WA 4GGNA 1XEWY 1BH2A 1DGUA 3KKNA 3KB2A 4LBZA 4KITB 5JHGB 2VLIA 2QMHA 1K5DA 2XSZA 3LY5A 2IS2A 3WNCA 3UMFA 5TV2A 1M34E 1LS6A 1DAIA 1XTKA 1H65A 2M8UA 1YJ5A 2AWNA 2Q9AA 3BJIC 1CDNA 2A78A 2FZ4A 3HYRA 1Q80A 4M9SA 5IF9A 2XGJA 1D6JA 1QIWA 5CDFE 2LM5A 2MRDA 3KDSE 4GOJA 2YNMA 1OQPA 1HQCA 4PE7A 1S96A 5FOUA 1NY6A 2DBYA 2OTGC 2JJ1D 2CJWA 4OYHA 5I2QA 3FMFA 5FI0B 3SI7A 4DXAA 1WBBA 5G3YA 4MITA 3AUXA 1NIWA 1ZM4A 3FKQA 2M49B 2F55A 2KAXA 4MVFA 1KWOC 4WW0A 2X19A 2NPIA 2ONKA 2JGNA 1K8UA 1R2QA 3AF1A 3KQUA 5J4HA 4NBSA 2GAOA 3VX3A 1OH5A 4AKGA 1JQLB 3LL8B 3QRXA 1PUJA 1KY2A 1X8JA 2RGCA 3A1WA 2FFQA 3AQ4A 1SNLA 2Q9BA 1U0LA 5B30A 4HUQA 1RJ9A 1ZM9A 2HXYA 3T1OA 1YUSA 3EZ9A 4G5QA 4NHOA 1S1CA 1NMXA 3AKDA 4ZI3A 1E2KA 2VP9A 2F7SA 4Q9KA 4Z8YA 2E9SA 2Y1NA 1SXJA 3OZXA 2WKPA 4IDNA 1Z08A 1E9AA 4R2HA 3QG5A 1ZNYA 1X1SA 3UMRA 2KI4B 4CRWB 2DFNA 3W6OA 3U44B 2GNOA 2Q3MA 3CPJB 2O8DB 2JQ6A 2L0XA 4OQMA 5EXTA 3TVTA 2R6FA 2H92A 1CJTC 4QGHA 4L15A 4TLAA 3SYKA 4DRZA 3R9XA 3B6EA 3OFNA 4M1OA 4IRUB 3VRQA 1F8HA 2V6JA 1XFZO 2VBCA 1GM5A 5CITA 1GRNA 1Z28A 1S3PA 5JSZA 1P9RA 2ZYUX 1YZUA 4IL1A 1YZGA 2XNDD 1MXLC 2P5TB 4X8OA 2G1KA 2M7LA 1KSMA 4FMCB 1NKTA 3SS8A 2I4IA 4ERNA 4TT3A 1W7AA 3OEHD 4JKIA 4U02A 3SR0A 1UPTA 3SJBA 2JAQA 4DCTA 1PVOA 2ONJA 3AVOA 4RZXA 4GMDA 2FFHA 1KAGA 2NIPA 3IIJA 2WIAA 3BRWD 3BXZA 4M2PA 2OUKA 4N1GA 4Z8XA 2IK8A 1E4YA 3WYGA 2M0RA 1G17A 2CCJA 1OMVA 2P6BB 4D82A 3ADKA 1E9FA 3I73A 4M2QA 2VP6A 5CSIA 1TN4A 2ODWA 3B1YA 3HR7A 5KDDA 2KI6D 4BFWA 2J7PD 4PC7A 4BWYA 1E99A 4C7OB 4M53A 2ZJOA 2G77B 2ZSDA
chains in the Genus database with same CATH superfamily
3IIMA 1XLTC 2GZRA 1FUYB 1CDDA 3BUOB 1PK0D 3M1YA 4YJ2F 2TMGA 3V55A 4YMGA 2ZRSA 5B58T 4XJKA 1BU8A 2J5KA 1BS2A 2ZN8A 3WSWA 3AHHA 2NLOA 3SJZA 4RTNA 3EOZA 4W9RA 1HYBA 1PDOA 1U9ZA 1FQKA 4LHSA 8OHMA 3S2IA 1FU8A 2CLOB 3EVBA 4W7HA 3E2IA 3RV4A 1RE1A 4V0QA 3TLCA 2WMYA 2XOKA 4KPYA 3CZ5A 3WYFA 3K5WA 2F17A 3DF0B 3I6ZA 3L82B 2NVBA 1A04A 4PNPA 5JAZA 5LQJA 3LDHA 2I33A 4LNUA 4J0HA 5EE5B 5KC8A 2A9JA 3IMEA 4KTTE 1YA8A 1K66A 1Q15A 3AOEC 4IHAA 3JZFA 3NWJA 3PDIB 1VLVA 2WAYA 1J49A 2HF8A 2LDBA 2VSFA 3AEXA 3QV1A 4JFAA 3P2IA 4O4LB 4P0QB 2WYOA 4RQUA 2NOAA 4AQ7A 4MZJA 1VSQA 2ZIFA 4QU9A 1EFRA 4MLWA 3RT7A 3DTVA 2IHYA 1KXJA 3FS7A 3DZDA 4US2R 1B8LA 3E81A 1ND6A 1JWLA 4CQLB 4B3FX 2WOJA 4DLLA 4EW3A 1ID1A 1P7CA 3EQ2A 3FCEA 3UAWA 3KUCA 3W9SA 2C9BA 2Z1MA 3R6GA 4KPGA 5C0OE 1DKQA 4J0QA 2RDMA 3VNBA 2WJYA 2VHJA 1HT1E 5KC9A 1KETA 2JIPA 1AH2A 3G1TA 4QEKA 1JLMA 1FS6A 1LPAB 4PPQA 4K3UA 3N2GA 2PA0A 3KVRA 4I5KA 1NXWA 4MRXA 3H0KA 4KRGA 3D8TA 4BJ5A 4CR7A 2FQ1A 2R5FA 3FOCA 1PS9A 2ZYSA 5A3RA 3WKBA 1JG1A 2SHKA 1PNTA 3A6FA 3IP7A 2QUZA 4Y2SA 9ATCA 2NO1A 4MVJA 3FOWA 4DV4B 3EGDB 3RLFA 3STHA 3IBGA 4QVGA 1GEEA 4D57A 4QM6A 1QXPA 1P60A 3LLUA 1YUTA 1DL5A 1ZO8A 1ZXXA 4QZVA 3EVEA 2G1JA 2P27A 3NEYA 1XA5A 4HZUA 3OCXA 3LA6A 4TZKA 3GLIB 4JSTA 1QCZA 3PYMA 2BSXA 3K8QA 3BIOA 1OC2A 2KLHA 2X1HA 1GG8A 4UOQA 3IF7A 1FFAA 1RRPA 2ETVA 5HYVA 1CQWA 4FP9A 1EUYA 2J46A 3I83A 1R5JA 2V5VA 3H5IA 1NKVA 4G1BA 4IZOA 3M6UA 3AINA 5I2LA 4HCJA 1PVAA 1IH8A 1P7VA 4WXRA 3F1LA 3CKKA 3H1FA 2FJPA 3OQIB 1H3NA 1NUUA 5C4GB 1JBEA 5INTA 4RF5A 4KDCA 5CLLA 4N49A 3T8YA 3IODA 3RI3A 4QTUB 2A1TS 1ZD2P 2DWQA 2AMYA 2FB9A 3M6WA 1FSFA 2OFXA 5LSAA 2V6BA 3C3JA 2BMJA 4J3FA 4H1HA 3C0KA 4O5AA 4R2KA 4KDEA 3NRCA 1S2NA 1Q92A 5IABA 2GJSA 4N5DA 3OC0A 2OFPA 3DCYA 4X3PA 2FPPA 3CGWA 3FRIA 3ZWMA 1TCVA 1DF0A 2LNDA 3ICPA 4XCQA 5HJ5A 4BNVA 1W0JD 1WETA 1JAHA 2PX3A 4E14A 5FUQA 1H6AA 3SHQA 4V0ME 1WQ3A 2ZUDA 1W5SA 3GG2A 3R4VA 2QRZA 3ELDA 2CE2X 3W3AH 2H00A 1IZ8A 3E5HA 3NIBA 3C4VA 1VKHA 4YK7A 2GK6A 1ZN8A 1P0IA 1SG0A 3LXXA 3CRW1 3OESA 3K3PA 4D0LB 5LJLA 3DLHA 5K0EA 4OMCA 3B82A 1H66A 1PFYA 3DHYA 3BRSA 4TV9A 4XXHA 2XUQA 3CY6A 1L5KA 4WXEA 3F3YA 1AHNA 2NTEA 3W3AD 1I7QB 1KU6A 4ZQCB 1ORHA 4C0QC 1UIRA 1S4QA 4PR3A 3VPAA 5LWQA 1VRVA 3D2BA 3R5SA 4EKEA 4HQFA 5AUNB 3FMVA 1ZVJA 3WWPA 3DBHB 1QBGA 1NW6A 1UBNA 2QTCA 3IMCA 3VJRA 1Z2DA 1ZD5A 3D1VA 2D1SA 4N6NA 5C8XA 2KYFA 3TW4A 4RY8A 3TI9A 5SZKB 3NIWA 5FORA 3SZMA 3HM9A 3L43A 2GF0A 1C2TA 4Q3NA 1D0IA 2MR5A 5AANA 1NDHA 1UFKA 3MUFA 4FNAA 2ZIVB 1KI6A 3E8SA 3I5AA 4B6EA 1ZG3A 4TWBA 4XLTA 4DN6A 4DNXA 3OOHA 5JBQA 5JUWA 2ECKA 5CTJA 4EI9A 3L93A 2HCJB 3K8ZA 4A6EA 4S1TA 3UIEA 4CLRA 1S5PA 3ZWYA 3VRPA 3GP5A 3BD8A 2ZP1A 2XGSA 4BV9A 5GZ1A 2X2EA 3UVEA 1EBUA 2IITA 4MWBA 1YR3A 3H1PA 4OV6B 2LD4A 5IAGA 1PBTA 5KNBH 4ID9A 5LQMA 1U2SA 3H6GA 1NBWB 4N39A 4L9WA 1JX6A 1THZA 2Q5HA 1JDPA 3H4SE 1YCGA 2B20A 1H2AS 2A5FA 3HZHA 1EXMA 1USGA 2AK2A 3NHKA 3PQ7A 4GO1A 4H9GA 1RXVA 2YW9A 1QQ6A 1YBHA 1QS7A 2AAOA 1CP3A 1JWAB 1I30A 2CC2A 1QYDA 3T7AA 4WV3A 1MBZA 4ZVOA 1EVLA 1ZGZA 4IFTA 1DJMA 4XVRA 1DIRA 1NRXA 3C1VA 1RWKA 5KS2A 1M75A 1XVAA 2QTHA 1WW3A 3CF4G 5BUCA 1QYCA 2C04A 1J8VA 3GEHA 3LVBA 4DAOA 2RONA 2Q27A 4ZAXA 2PHZA 1OTHA 4X6YA 4JJKA 3ISTA 2DFPA 3K5HA 1K8RA 2QLTA 4TV8B 3STUA 3WO0A 4FE7A 3U4DA 3Q7TA 2E82A 4KREA 4WNIA 1XCOA 2WINI 2C57A 2B92A 1RQ2A 1K9VF 1NW9B 3DV0B 4QAJA 2IP2A 2ZSBA 4Q1BA 3FI9A 4D46A 2V0GA 3QE3A 4C3VA 4DMLA 4YMIA 3K32A 1QFSA 4JJZA 4KL8S 5F76A 4TKUB 3X1KA 2ZTHA 1VPDA 4EATA 3H0CA 1DJPA 1DRJA 1EVYA 3NPMA 4CMGA 1I4WA 3NAQA 1VG8A 3AJAA 4GZ6A 4KWEA 5ICMA 3UAGA 3CGAA 1YK0A 3RUPA 3Q7IA 3RBZA 1Y6ZA 2I22A 1P3Y1 1U9CA 4FBGA 4FD3A 3R6LA 2FR8A 4URUR 1V8BA 4HGQA 2WNIA 1PI3A 2WNSA 2JD2A 3GX1A 5IAKA 5ITZB 4I4IA 5K05A 1MB3A 1Z4LA 4D56A 3IIIA 1E3IA 1YZTA 1YZNA 2C0PA 3LQQA 2VZLA 3B3FA 4I6EA 3ETCA 1KJQA 2IQ5A 4GYKA 1JQAA 5C7YA 3S2FA 3KWMA 1P5RA 2V4MA 1SVLA 1UM9A 3CWZA 3EDCA 4R5MA 2LLTA 5DX0A 3PEWA 2ZRIA 3GU3A 4WLOA 1ADFA 2A5YB 2R7NA 5JXJA 2JASA 1GYRA 3IUJA 4AZ0A 5LU8A 1KFUL 5IZ4A 2CVQA 2AIRA 3KQQA 3O6BA 2DBVO 4PYLA 3RK0A 2O0KA 3UNXA 4DA0A 1O9BA 1VDMA 4BUJA 3SMQA 8MHTA 4UD6A 2R84A 1DWQA 3FBTA 1FFHA 1BSVA 1W5AA 4F7WA 2HF7A 5HQ3B 4UVGA 1I7LA 2CLDX 1WHSB 2QJFA 2OCAA 4TKZA 4ZT4A 2PX0A 4KVAA 1A4RA 2WP8J 3LX6A 1CZOA 5B7NA 5KWEA 4C9BA 3RYIB 3GQBA 1N3LA 2AW3A 1KQNA 1ZONA 1M45A 1OFGA 3A9CA 4EYGA 3L8FA 1V5EA 4M87A 2FCAA 3MAJA 2IOYA 4V03A 1LW6E 1YQ9A 1Q2XA 1RQLA 3I0MA 2GEFA 1KSHA 3O2SB 1RPAA 2AOTA 2FPRA 3MLBA 3OETA 4R9SA 4CM9A 2P9TA 2P2NA 3ACBA 3ZH9B 3T3IA 4HMQA 3CLRC 3BMOB 1KEUA 4B3HA 2HHHB 1W2HA 2DH6A 3IURA 1ZD3A 3LUGA 3BTVA 3GJXC 1AK9A 1NVVR 4HX9A 4K9DA 2DY1A 3GMSA 1IIBA 3FTPA 4ZYZA 1KYZA 2RD2A 2I7AA 1E3WB 4JOCA 1MO5A 5KYGA 1AGXA 2GBIA 1KE1A 3L7IA 4PHJA 1LDYA 1T43A 3TQSA 4OSEA 3S2YA 4O2AB 1JDBB 4A03A 2BL0B 2ATXA 1NXXA 3S8YA 1E2QA 3EH2A 3N7UA 4K5QA 3WV5A 1DJYA 2Y1MA 1ISGA 2LVIA 1Z56C 1E2MA 2VH1A 4LYDA 4MYTA 1AV6A 3ZD7A 3TSYA 2W6ZA 2UXDB 3S7TA 5ER9A 1AS3A 1N9GA 1XOIA 2B8EA 3HY4A 3LT5A 4BMXA 4C0BA 5HVNA 3C8HA 2MYNA 2XQJA 2FWRA 1N34B 2LHIA 4Q9AA 3T7JA 3HKEB 1CC1S 1E61A 4LZPA 3EGDA 3WADA 4P3PA 5AHOA 4YP7A 1CWUA 4I5IA 1AO3A 1QQ7A 1WY5A 3H13A 3KFVA 1OTXA 2ENWA 4F72A 3NCTA 3LCPC 3DE5X 1KZ9A 1LLDA 1PVDA 2P3SA 1M34A 3EVZA 2FUG1 1QANA 3ORYA 5EZYB 2FZ5A 2G17A 1K08A 2VT7A 3OP0A 2P2YA 2YFKA 3SX0A 1WUJS 3DE2X 3UAOA 3D5EA 5F4ZA 1WD7A 4CR8A 4EKYA 5FPPA 2XUGA 5JRZA 1NN0A 2WC1A 3H11A 2LCPA 5H81A 1EPUA 1KGDA 1SBTA 4DV6B 1E3MA 1A3CA 3NDJA 4X1IA 2IGTA 4R1OA 5C8ZA 3PQ5A 4LECA 4I8XA 1RKBA 4Q93A 2BE6A 2JT0A 4EPYA 4AQJA 1YBAA 4ML3A 3DTVB 1AK2A 4URXR 3QE4A 3TUZC 1P7WA 3D59A 1HQDA 4MS1B 4TZ0A 4I5GA 5HKWA 1IZYA 3ONWA 2OBFA 2ZI7A 1K86A 1D1OA 3L9WA 2GPAA 2AQHA 2Y1WA 2AD5A 3NNNA 4M98A 4L9MA 1JMVA 1VL0A 2XUIA 4KPUA 1Z2OX 2FVYA 4ZU1X 1MGPA 2J9RA 2PANA 3RSGA 2ZGVA 2VN8A 1QO9A 2BZ0A 3L6DA 4OU5A 1J2TA 5L95A 4LVNA 3L4EA 1HDXA 4JSRA 1BKYA 2ZAIA 3M70A 5EJIA 2V1UA 3DYBA 1QVAA 1W5TA 3GWGA 1QIIA 4LJ6A 4YJFA 3SVZA 3TW8A 1XHLA 2HDNB 1A95A 3BILA 1YUNA 3BYAA 3KSAC 4BP8A 1HDIA 2CVOA 2EERA 2LKDA 4RETA 5E4FA 1TVKA 1PEKE 4F4HA 4M46A 1M2GA 1EFVA 1CJMA 3CUSA 4QJ4A 4YRCA 1AN9A 1T35A 1NF3A 1JALA 2HFKA 4A6XA 1DAOA 4KC0A 1RM5A 3DVKA 4N40A 5CDFA 5WRFA 2BSQA 4PGGA 4XDYA 3ANLA 3LUJA 2AG5A 3UPTA 1KY3A 4G0WA 1LTHR 2Y0DA 3MJCA 5CPVA 5LN1A 1TO2E 2ZIGA 3HYLA 4G26A 4IVRA 1C3LA 1RLUA 3JU3A 2BFEA 2HPHA 3RB8A 5BW4A 3OQ1A 2ZJ0A 1OYYA 1QVIY 2XRYA 4NU5A 2GGMA 2OKGA 1IN8A 4GXQA 4D9IA 1J9GA 5LLDA 3LV8A 1Y37A 4FINA 3EYWA 5JBIA 4YDSA 2JB9A 1N6KA 2ZSUA 3JZDA 3CWCA 2XKBA 4B3GA 3NWBA 2AK3A 3T9BA 4C5AA 4U2CA 4B2LA 5EJ7A 3CH7A 3LBNA 1EBBA 3O4YA 2V97A 2QG4A 4L3OA 2ZW9A 1OI2A 4GYWA 3BOSA 3OPMA 1RXSA 3QPWA 1HE5A 5CVUA 4BBPA 1CJVC 3V4LA 3C3EA 4P7BA 1YL6A 2C9CA 5C5IA 1OOJA 2WJ3A 4PO9A 4MQMA 2R62A 2KW5A 2QTZA 4RHXA 1BEEA 1XMIA 2WCKA 1AKQA 1DS6A 1MX3A 2OZPA 4KQCA 3ETNA 2FSIA 4MWOA 2RHCA 3NTUA 5DHUA 4AUKA 1XDWA 4F4IA 3AUTA 2XXAA 3FWHA 4YRDA 2WWIA 1FUKA 1NN5A 1PDWA 3OJOA 1CFFA 3CRMA 3QYPA 3O4FA 3JTDC 3LOPA 3P5BA 5CVCA 4RA9A 1CM1A 1H5UA 4UQPA 1WP4A 2BEVA 2R86A 2FQXA 4NU8X 3U4QA 1O97C 2JZIA 3N2GB 1MQ9A 4TV9B 3ZY2A 2FPPB 4DMRA 1R5OA 3MJRA 4BNJA 4E15A 2WTXA 1YUBA 1Q19A 4L51A 1CULC 1UANA 3HUDA 1CQIB 2YWCA 3SC3A 4EYKA 1GLVA 2ZR8A 1U0NA 3DOOA 1SYMA 1RKQA 3IDOA 3V4SA 2NP7A 3FNEA 1KK1A 2FEWB 3GGGA 4GL4A 1AZSC 2QEQA 2ZK7A 4XEUA 3TKAA 5B4TA 4P0PB 4PC1A 3A4UB 3QWBA 4ZU3A 5FAKA 3Q5DA 1BXKA 5CYFA 1GCIA 4WX2B 2RI6A 5FJIA 1G7TA 1JXMA 2OCYC 3NP9A 3KLOA 2IWHA 1OA1A 1ZZGA 2AI3A 2ZBVA 3EUAA 3VTKA 4B48A 3ZJ4A 2AOUA 3A1CA 3SIXA 3PM2A 3K1YA 4Y1RA 1F48A 3OUZA 4M6WB 4YACA 2NZJA 4B4DA 1Q7EA 3LRPA 1K68A 3OM9A 4XVUA 3ABQB 1ABBA 3NH9A 2JJ1A 3BTSA 3HYSA 4C06A 2BJVA 4ZCLA 4BLTA 4EJ2A 1CFDA 2VQ3A 3PC8A 4LS3A 1IEVA 1ZN7A 3OLZA 2OQ2A 2BAPA 2BGTA 4UBJA 4PNEA 1RAFA 3KQYA 4GGFC 2H1VA 1P8AA 3O2NA 3SNKA 2B7BA 2QAJA 3DW3X 3DYVA 3MWDA 5K8VA 1MRSA 1T8SA 3TK1A 2BFPA 2O7SA 4MV4A 4QTZA 5AQEA 5J5VA 1Z7WA 5K0ZA 3TG8A 1KL7A 1J99A 2V6MA 4Q7MB 5I9MA 3UWDA 3NJ4A 1ZJZA 3MXTA 2OSVA 1E3TA 5FR1A 3CZPA 3BFKA 1SVWA 1S8FA 4Z9FA 3IHLA 1X1EA 5I9IA 2UZIR 3BHNA 1EDDA 5LP6A 4M7PA 2FG7C 2W90A 1IJ6A 3T3GA 1DEKA 3S2UA 3PHHA 2IZ1A 5CFQA 5AIBA 1L7VC 1YDMA 3ZJYA 4JI2B 2HMVA 1NJ1A 2ZSJA 3FGPA 4H17A 4KAXA 3RUDA 2HMAA 3EGOA 1P0FA 3UMJA 1OF1A 4BKQA 1YO6A 1ORGA 1H2WA 1T5BA 3HRKA 4YJ3F 1D5WA 2C2GA 5AM3A 5JHHB 2O7NA 1GGWA 3FZYA 5CB4F 1NCYA 4YFYA 2BT4A 1LY1A 1ATZA 1K7YA 2VJQA 1YVEI 1F38A 2HF9A 3QBDA 3IRVA 2G07A 4IDAA 4WUTA 1GL3A 3SZGA 1NF8A 3LXMA 2IHJA 3TFQA 4HNRA 4PYNA 1FFBA 4HGRA 4YCNA 1E7WA 2AXEA 3VMMA 1SMGA 3E53A 1B1GA 2MTBA 4FWTA 3ZNOA 1TU3A 5JCJD 4M1TA 1H3FA 5EUBA 4NMMA 3EQ8A 4TS1A 3T7RA 3IUQA 2ISQA 1KSOA 3HO6A 3UM9A 3IAM6 3A11A 4GLLA 4AQYB 3VOAA 3SJ7A 4JCCA 2W6JA 4GS5A 5GJVC 1ZSVA 1I1NA 4RTQA 3E58A 4WCFB 3UMYA 1MAUA 4Q7JB 3VR4A 4EI7A 3CEJA 5I7EA 1KZGB 4UHFA 2DTXA 1CY1A 1EB9A 2OCIA 2L17A 2Y1LA 3BJEA 4TYMA 1EXVA 5DNCA 1YC5A 2BEUB 2A3RA 4MYHA 1BXRA 4CMIA 1L7ZA 2X9QA 4R1UA 4FFBB 1LNQA 3K1ZA 3F3MA 3TXXA 4EOGA 4EEXA 4TVKA 4O2AF 4XQGA 3MJFA 5FRDA 3JQEA 3Q3HA 3LX5A 4D7AA 5FWNA 4RLHA 1MQ1A 4MH0R 1CUZA 4KFUA 3TNFA 5HKKA 4B3MB 1KS2A 2XITA 2DKNA 4X24A 4CXMA 1SU6A 3VBCA 4F56A 1Q0QA 1FVXA 3CQ9A 3B53X 1LUAA 3L0BA 2XADA 2ZXFA 2RGDA 4OHWA 4MPRA 5H8WA 1T9CA 3UAZA 2XMZA 1T5HX 1Z18A 3AEZA 3JD4A 4QXPA 4XH9B 2D1RA 2JFYA 1RT9A 4O2BF 1UWKA 5FLYA 2PS1A 1G5RA 1AHHA 3HP4A 3WLEA 1K0FA 4MROA 2P41A 4RSGA 1U0TA 3HU5A 4OQPA 4N47A 4GR9A 3VJLA 1CEQA 2D5LA 4NE9A 3VISA 3VU8A 2FDRA 3KBBA 4BNDB 3PR3A 4YRMA 3T99A 1QNLA 1II8A 2BKUA 4MN0A 3AP1A 4FT2A 5A9SB 1LQTA 2ZE7A 3AUUA 1Y4SA 4ALJA 1H9BA 3NVAA 4E32A 2DR2A 1FNBA 1VCIA 1YS6A 3ZH2A 5IDQA 4CM9D 2O8EB 1Z6AA 1IPEA 4IZHA 2QYOA 1V5FA 5IFLA 1A9OA 3AM5A 3AB8A 3ESXA 1U2EA 1RP1A 4FFLA 3KKZA 3QPAA 2XIJA 4DQVA 2QM0A 3HHPA 5CHYA 3WBFA 1SUWA 2XF8A 2EKQA 2ZRMA 3C97A 3PNBA 4RADA 3HFJA 5ALDA 3WGTA 4AF7A 4CW7A 5KTPA 1U5IA 4NCHA 3PWSA 3GAZA 3HB0A 2OBMA 5EN4A 1IVNA 3PE6A 3DEHA 3UMCA 4N5HX 1NAIA 2FR8C 3BUSA 1E3QA 1ESEA 3O3MB 4YB8A 1SOMA 2EVWX 3MLEA 3B88A 2H1OA 3OUUA 5CW1A 2V53A 1OLUA 1XCMA 4BZXA 1KEEB 5KSWB 1D7OA 3V8RA 1U0RA 1XTBA 5LXTA 1GD1O 1ZH6A 5HE8A 3AU8A 1P61B 3HKBB 2AMFA 5KHAA 3T1HB 1HL3A 5BN1A 3BICA 4OIMA 1L5OA 1NSYA 2JPTA 3OGNA 2YL2A 1L7XA 1XN4A 5DBHX 2QJOA 5K0LA 3ZDEA 4IDCA 2YVQA 1UK9A 2VDMB 3LL4A 2QX6A 5EI5A 2BPOA 1GUFA 4JLMA 4PZEA 4RD3A 2X9NA 5BQ5A 3RIHA 3PFHA 1RWBA 5AKZA 2XNSA 1NW5A 2HK8A 4MUMA 4XB6B 4JJ4A 3WOHA 2AYYA 2UUAB 4LZOA 1LF5A 3LZ6A 1EDBA 2QAGB 1V16B 3GB9A 3C41J 3CUKA 1QU3A 4KFRA 5CFMA 3SIAA 1GNRA 2BHLA 2J08A 3PSRA 1O89A 2GI4A 4G07A 4JK3A 5GWXA 4USLA 3EC2A 4IJKA 4KV7A 4TMTA 2J48A 1TYBE 3Q88A 4G4IA 4K8RB 4TN5A 3TL3A 3TSCA 4P7FA 5DHRA 3VHQA 2IUTA 1HURA 2R25B 1PJQA 3K2EA 4X3OA 1H8ED 1NZJA 2P5SA 3WMRA 2MU1A 3IQWA 3LRXA 4I3FA 4YR9A 821PA 2Y5IA 3ETGA 3L8DA 2PRKA 3BFVA 3TJZA 3EHDA 5C7LO 1A9PA 1W47A 2QP4A 4GBJA 2C3OA 4YGDB 3QOYA 1IBRA 2EJUA 5E8JA 3JQRA 2O2IA 3D3NA 1AO0A 1A2BA 3JQ7B 4MEWA 4WNAA 3KZKA 5E0OA 4OI1A 5DU2A 4JD5A 3OJ0A 4A3SA 3L7BA 1VJGA 2VOJA 3IP8A 4EY3A 5L9AA 4CCWA 3G85A 2UV8A 5JNTA 5LBTA 4WJLA 1C50A 3BSFA 1B6TA 2RHHA 4MJ7A 2BFCB 4QOJA 1NJSA 2O2HA 4U00A 1SQSA 2XUDA 3AERB 4YT4A 3QELA 1YZLA 2DFLA 3MMXA 4PTYA 3D6JA 4GKVA 3RBXA 3P9XA 3LWZA 1E58A 4YX9A 1NZFA 1XAGA 1ZD8A 2PL9A 1MOQA 2JF0A 2RARA 3B6JA 3O83A 3OIYA 4RANA 5ENVA 4BNDA 5JEEA 1XFWO 5JO0A 4J1NA 2GUGA 4WXMA 1ST2A 1P1RA 2GOYA 5BUQA 5DJ5A 3TH5A 4CMKA 4DLNA 2JWWA 4DYDA 3HO8A 1TLLA 1I2BA 1XMPA 1AG9A 1SHTX 2II6A 2UZ1B 2R6CA 4G1VA 1Y1SA 4W6QA 4DR2B 1JLLB 4RPIA 4LF8B 3RVSA 3I1FA 4DIOA 3B87A 1Y7HA 1UEJA 3A6GA 2NQ2C 5TPWA 2ZOSA 4QHTA 5IF3A 5IHPA 1SO8A 5DXJA 1EE1A 1P81A 5G4KB 3Q8LA 1A9XB 2XTNA 2GLTA 4X6UA 3VBEA 4UBOA 2WILA 1VG1A 2DR0A 1FLDA 4MYCA 1J55A 4CPVA 2PR2A 2ZJZA 4N0DA 1IOWA 4R2JA 4YCJA 3D4BA 5ER4X 4V1CA 4YDQA 2ENUA 3KZOA 1Q0UA 3CX3A 2R8PA 4FMDB 4KYUA 4MWGA 4PFJA 1YZKA 1YOVA 5KU1A 2E4AA 4F0ZB 2P40A 3K15A 3FJOA 3O9ZA 3CCFA 3CIOA 4ZZ0A 4WRRA 4FLMA 5DMXA 5TNCA 1UKBA 4BNYA 1W5EA 5DN6D 3SF8B 4KOEC 5K8CA 1GAQA 2PQ6A 2PGLA 3EDMA 1CZKA 5HIJA 4WXPA 5LMZA 1OD6A 1FP1D 1UP7A 1NX1A 1D04A 1HDRA 2Y4NA 2BCEA 4FOTA 2ZKMX 4YDRA 3VR6A 2B4QA 4ZQFA 4M22A 4Q15A 2MHHA 4YAUA 1HPLA 4D98A 1LV8A 1RJ9B 5FPQA 2PUEA 3RABA 1G8YA 3QXCA 2EZ8A 4D6XA 2F3TA 3AI2A 1ZGCA 2ZVPX 3HO1A 5JR3A 1YZFA 3TBFA 4JASB 4MV5A 3FDXA 3OSUA 4HH1A 2LPMA 4UTXA 2QX7A 3ITNA 4JVLA 3WNQA 3EQ7A 1NX2A 4TTTS 2PG3A 1Z7YA 4LOJA 3K8YA 4QDKA 3CISA 6PFKA 3IPXA 3LBIA 1V9CA 4PINA 4GVPA 4MDYA 3OB1B 3AGPA 3ECSA 1VQ1A 3K0FA 3EGVA