4C0KA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one calcium ion (ca-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0kA03
1BKDR 1CJKC 5D3QA 1TU3A 3EA5A 2GAAA 5CJPA 4QFMA 3MD0A 1M63B 1B8RA 4GGNA 4I1UA 4TLDA 2ANBA 1N0VC 1W0KD 3HYTA 5KSOA 1VPLA 2H92A 2JIZD 2PZEA 1KY2A 3RLZA 1T3LA 1MQ1A 2C04A 2ZEJA 4DS7A 1OJLA 3CONA 4QGGA 3W8NA 4BFTA 2VSOA 4CLNA 4BEBA 4MZKA 3BE4A 1OSAA 4R9UC 2WPDD 4GRAA 3TSZA 3A4MA 1FZQA 2COLB 1EG3A 1QLSA 3KX2A 4LV5B 1MT0A 2KFHA 2WCEA 4V0ME 3I5YA 2IYWA 1E79A 2X2FA 3B5JA 5DGXA 1P9RA 3KUDA 1KDRA 1RTP1 2PL3A 3DPUA 4LYAA 2QAJA 4NDZA 1ZU5A 4NP6A 1TNXA 1ZUNB 3RS5A 5JJIA 1BOCA 3HU2A 4MZJA 1K90D 1XJCA 1P2UA 2FGJA 2BBWA 3WBKA 4AWXA 2GJAA 4TMVA 1Z0KA 2ZI9A 2Y8EA 2OS8B 3GP8A 1VYUA 1E32A 4PAQA 4PHMA 3AGQA 4Q9JA 2ZRKA 4CW7A 4TYNA 3E3RA 1HT1E 1E9EA 1A82A 1MO6A 2BVNA 4L9MA 1CF4A 3B6EA 4NU0A 1SVOA 2VL7A 3PSRA 2VP2A 3DOEA 3R9XA 4RKFA 1QHGA 4TQUS 4URXR 2BBSA 4PANA 1F48A 1II8A 721PA 1R6BX 2QQ0A 3DKVA 3QPVA 2ZR7A 1PLJA 1QIVA 2MMCA 4TTQA 4NCJA 2CCMA 1A5TA 3Q9LA 1Z2AA 3F3YA 1KK0A 2OV2A 5IT5A 2PMDA 5HKZA 5DISB 2AK3A 3K0FB 3SC3A 2MJWB 2BJVA 1C1YA 4XJKA 2ZPTX 1ZUHA 3UWOA 2QZ4A 4KFRA 5CB8A 2RHDA 1S6JA 2H1LA 3FWBA 2WWFA 4Q9IA 4TLAA 3LAWA 5FTJA 3KQLA 1ZMZA 1UP5A 2OCPA 5G40A 4ACAA 1JEEA 3L0PA 3ZGXA 3U4QB 1G33A 2H57A 5FYXA 1Z63A 3I5FB 4YBHB 2VHCA 3O8DA 3D6TB 4LRWA 4RD2A 3VKWA 3C5HA 3PUYA 2ZI5A 5F2EA 1Z6XA 1HE8B 1KI6A 3SIBA 4BASA 4F92B 3D31A 1VMAA 4Q9HA 2PBRA 3TBKA 1DJXA 2JT3A 1GILA 4MRXA 4OJQA 1CLLA 1GSIA 1L8QA 1R0ZA 2BKIB 1WRKA 2Q0HA 4DIEA 2H18A 4BLOA 1VKJA 4EJSB 2J59A 2ZS7A 5F6TA 2BBTA 3LXRA 1SL7A 3LBNA 3WYGA 1P5ZB 1ZC4A 2GK7A 3NSKA 4N1FA 1DAMA 2ZTSA 2VA8A 3OX5A 3QRXA 4WXRA 5FPHA 1QG2A 1MO4A 2QBYB 1E2LA 2IHBA 3ICQB 4C7OA 2BECA 3EA0A 3LRPA 1HA3A 1IKUA 3LFUA 3I61A 4ORBB 1TCFA 1TQ2A 3BFVA 1ONBA 3BB3A 4BLRA 3CX8A 1KSFX 3THYA 4Z1MD 2XZPA 4HI0E 3WHTB 2RKOA 1L7VC 3FB4A 2GTPA 2P6UA 3IQOA 1I4LD 2WCFA 4YGAA 1U99A 3M6AA 1GL9B 2Z6VA 3MJRA 2PZGA 4F93B 2CBZA 4PX9A 1U9IC 4B47A 1S1EA 2K61A 3CNLA 1YZTA 1AGRA 1YRAA 3A1SA 1KOFA 3TJZA 3WNXB 1UM8A 1E1QA 4Q4HA 2Y1NA 4UNSA 1K95A 4Q00A 3C5CA 2JLWA 4IVQA 3CPJB 4TLBA 2CCJA 3U2QA 1J8MF 1G6HA 4Q7JB 3Q85A 2GJ9A 3VU9A 4UXIA 4MQBA 1GKUB 4QM7A 1C4OA 2XOKA 4ZCIA 1LY1A 2WHXA 1MKYA 4ERNA 1II8B 2JLRA 1K9KA 4ZO4A 3QG5A 3SBEA 4DEXA 1NL3A 2BBOA 1IN6A 1E2JA 1W4CA 2PRUA 2QROA 2GK6A 2K5UA 4HLDA 4YMSA 4OI4A 1OT3A 2KSQA 3SG2A 1ESMA 2BMEA 3AVOA 3KXLA 3W6OA 2JJ8A 3WMFA 3GLGE 5FUVA 4AYWA 2BL0B 1S1CA 4JVSB 3ADBA 3LLEA 2ZRFA 2UZIR 1T5LA 2LLUA 4JQ0D 1KO8A 2IBMA 1E2QA 3KXKA 5EJEA 4PE7A 4ICBA 1EFCA 5IK2D 2EYQA 4YXWA 1FQKA 4BFSA 4UJ5A 4US1R 4GPTA 4ACBA 1V43A 1N6HA 3K9LA 4FMBB 4KFSA 3CKLA 4KFUA 4RCYA 3TVTA 1QV1A 5TARA 4M0LA 2CLDX 2FX3A 1SR6B 2LLSA 3QG1A 1KNXA 2IK8A 4MEWA 3EPKA 2F3ZA 1IJFA 1KI6B 1C9KA 5EE1A 4RY2A 3BOWA 3O47A 1DTLA 1NVWQ 3B1WA 1BYIA 2ZNEA 2PX3A 5I2QA 3CNOA 3LDAA 3QBVA 4JLAA 4KLNA 4WW0A 2RGGA 4ORAB 4HLUA 1N5KA 1P4SA 3H2YA 3UG6A 1XCGB 5DHFA 4QHTA 4YMTA 5LD2B 1YR6A 2BE6A 1G8HA 2V4ZA 1I4DD 4MRPA 5SZHB 4F4IA 4TMZA 1NYAA 1IXZA 2WWIA 5FTKA 1G8IA 1CJVC 2ZYVX 2A5JA 3ND8A 4Q9KA 4LV6A 3RSLA 2OCAA 1V5WA 2GEUA 2VHUA 4C7OB 4HAUA 3CRMA 4ASUD 5K8LA 3GJ0A 3RLFA 1WE2A 3ZQJA 3QKTA 2R8RA 4BFUA 1G17A 1KYIA 1KY3A 2MSDB 5JWOA 4C2TA 1B7TZ 1HT2E 2ZUCA 3GLHE 3P26A 4A92A 2D4HA 3THYB 4TYYA 1JR6A 1L7ZA 2L50A 2LV7A 1Q21A 3P1JA 2IS2A 1J90A 2EFHB 4XD7D 1JFJA 1GRQA 3U3RA 3IHLA 1KKLA 5GJVC 1SKQA 1OHHD 2JQ6A 1FF1A 4EAQA 1G41A 4Q7MB 1JR3E 1SULA 1NCYA 4Q9LA 4Q19A 4Q4HB 1AZTA 3GFOA 1CFDA 5KNDA 2ZVPX 5CDFE 4U7DA 4LPSA 5HKYA 3N5CA 2KFGA 1Q80A 1TUEA 4BECA 1MXEA 4ZKDA 2XAUA 3I73A 3DVLA 2W83A 2QUZA 2BE4A 3A4NA 3B8HA 2XB2A 3LVRE 3THOA 5DYIA 2QI9C 1W7IB 1RRFA 3M1IA 2B6HA 2RGAA 2CK3D 2JJ2A 3O2PA 5IF9A 2IEYA 2D06A 1YUTA 1FUUA 3A37A 4LJ6A 1JPNA 1JALA 5KNCA 4FW9A 4LGMA 3P32A 1XJ0A 1QRAA 2OFOA 1DJZA 1YUSA 3L82B 4JL8A 4XTRA 1TOPA 3LL8B 4YGEB 2R6CA 2HEIA 1KAGA 1G21E 4Q4AA 5TY0A 4FCVA 3K70B 5FTNA 4ESVA 2NO9A 3E5HA 4TMKA 2W6JD 2O0JA 3GK2A 1BS1A 4HSEA 3SYLA 1AGPA 4PALA 1P6XA 1AQUA 2KE5A 2WM9B 1ZRHA 1Q22A 2R6GA 2X77A 4P4UA 1YU9A 2VP5A 2W00A 4PPQA 2F55A 5J3XA 5DI3A 5CITA 1L4UA 3TS5C 5AJYA 4MSPA 4ZCLA 1CBUA 2E1RA 4MYTA 5EZ5A 4AKGA 2A30A 1E4VA 2ZE7A 2DWOA 3LA6A 3SJSA 3M4YA 2QL6A 4FWIB 4V0NA 3UXMA 1TNPA 4MH0R 5HKKA 3DO6A 1G3QA 2JTTA 1BIFA 4MA4A 2F2OA 1G4YR 3A58B 5TV2A 4I5KA 1P2SA 4LBZA 2IXFA 4Q18A 5DE3A 3SR0A 1DE0A 2VP6A 2P0EA 2YYZA 1SRAA 1VG9B 4LJ8A 4PO1A 1MRNA 3R9IA 4DUQA 1BMFD 1XTQA 1E6CA 1TQ6A 2NIPA 4QNMA 4LHXA 1UBGA 1K9UA 5JWHA 1DS6A 4DEYA 3OIWA 1ZP6A 4D81A 1HE1C 1CLMA 1HH4A 1W2HA 2GF0A 2NQ2C 2ODNA 3N2EA 1E3MA 3K1JA 3W8RA 4B48A 2E6WA 2WOSA 2BC9A 3DHWC 3SYNA 3BUWB 2QE7D 3FMOB 1NJGA 3OAAA 5JJKA 2HT6A 3Q7QA 1GFIA 4JYBA 4XWOA 5I8NA 1ZD8A 1J7RA 2AWNA 1Q3HA 2FGKA 2LCFA 4JBXA 5AJXA 3FGNA 1MR3F 3CRQA 1VYTA 2MMGA 4QHSA 4DLZA 4URYR 1OXTA 2VRWA 1MHOA 3AVVA 3OHMA 1SYMA 1R5OA 1FP7A 2CNWD 4PAOA 4V02A 1U9IA 1UDXA 3WHKA 1SL8A 1ZIOA 5GJWC 4DLRA 2M3WA 4HRHA 4BRWA 1PUJA 1R8SA 4PHGA 5FPKA 3N2IA 2RGEA 3T15A 1GVNB 2AD1A 5CIQA 2XITA 4KSCA 2GEDA 3D7MA 4AKEA 2C99A 2ZR9A 1OKKA 2EQBA 3BYAA 4Q66C 1BG1A 3VKGA 3IEVA 4MGZR 5HE8A 2OPOA 2JAQA 2KDHA 2WMNB 2ZJZA 4OK6A 5EXXA 4D82A 1KFXS 4D26A 1UKEA 3RABA 1COWD 2HETA 1KK1A 2QRNA 4ON9A 2WWHA 3LX8A 1DO2A 1Z6YA 4LOAA 2E30A 1WA5A 2DOQA 1LVGA 4KO8A 3UIEA 4IFBA 1PLLA 1W36C 2P6NA 4Q5IA 1XEXA 1DVRA 1TQDA 1R5NA 1ZC3A 4Q4AB 2D7CA 3WY9A 3W3AA 4MGIR 3SIAA 2G0TA 5FL7D 2M7NA 1YRTB 1JWDA 1RECA 4E22A 4N1GA 2CLSA 1SVMA 1TEVA 1CDNA 2CVFA 5JS8A 2ZRDA 2WAYA 2ZUDA 4OKSA 1Z6AA 1TIZA 4KVAA 2GNOA 5DI3B 2ZXUA 1R0WA 2P6BB 1FPWA 1GTVA 4FCTA 4JLVA 3VR6A 5L8VA 4PC7A 1YRUB 1CFFA 1CJUC 1SHKA 4GBMA 2QM8A 4OVNF 1IONA 3EZ6A 4MRVA 1QJTA 1SNLA 3IIJA 4GT1A 3RAPR 1KSMA 1R7RA 2R6AA 4OQLA 3Q5DA 1W49A 4ITRC 4JYCA 3R8CA 1SGWA 1XZPA 2FCDA 4PTLA 1AVSA 3KUCA 5J40A 2JLZA 3QVUA 2NPFA 1KSOA 2EFDB 1EWQA 2C95A 4Q1EA 4K8OA 1SVSA 2LKCA 2ZRNA 1E9BA 2EVWX 5C4MA 3VHXA 1U2RA 4TL6A 5HKWA 4K46A 4KAXA 1CDPA 3PR1A 4KYIB 2ZAOA 4PZZA 4CEJB 3SN6A 3DL0A 1B9AA 1I2DA 2KJQA 4GUKA 2ZRLA 4I1SA 1GKIA 1JQLB 1KDPA 5AXIA 2X19A 3IIMA 3LD9A 3O8RA 4WZAE 4B2LA 2NO6A 1JJVA 3A8TA 1OMVA 1JR3D 1QZXA 4CGZA 1TCOB 3H4SE 3VX3A 1KJWA 1S3PA 4A8JA 3T1OA 3OHMB 2J0QA 1ZM7A 2WAXA 5JCPA 2RGDA 5BXQC 1QHNA 3AKAA 1A2BA 4F7WA 2PALA 1VYVA 4G0NA 3WNDA 3THXA 1J7QA 1CR0A 3I62A 4C9BA 1PULA 2MHHA 2CLCX 2FEOA 5KSPA 3LVQE 1E9FA 3NXSA 3AP1A 4JLDA 1IGVA 1QTXA 4DLXA 1BLQA 1E9CA 2GGZA 4D4MA 5CSJA 1WXQA 4AK9A 2CJWA 1FPMA 3K09C 2WKQA 4LI0A 4Q1FA 3QKRA 4QOSA 3RSOA 3HDTA 4YMVA 1B47A 4YI9A 5KO2A 1SCVA 2DPXA 3QNUA 5JEDA 2F33A 2C2HA 5DHAA 1TF2A 2DBYA 3K9HA 1AM4D 2J0VA 3ICBA 1EWRA 4PC3A 4Q04A 2VIIA 5LDDC 4MYUA 2ZYWX 1SXJA 3NVAA 1U81A 4PFSA 2CL0X 2GBLC 3AVYA 5KHOC 3GLFB 3EPLA 2IS6A 1GGZA 2YWHA 4LC1A 4MKFA 5CK5A 2IWRA 3WNBA 4GPLB 5CB6A 1WBDA 2WNDA 5E3HA 1XJQA 1C7WA 1W5SA 4RFVA 4A0GA 4O3MA 1EFHA 1YHNA 4BLQA 4Z1MA 2IC5A 5AANA 3BIFA 3SBDA 1FTNA 4DSUA 5FBQB 2ZM5A 4GL2A 4KYUA 4P33A 2JZIA 1WLZA 1P2VA 4RZXA 3HX4A 1AQYA 2XTNA 2LKDA 2OM2A 3MMPA 3GJ4A 4R7ZA 1NSFA 4DZZA 2PCLA 2O8DA 2KOTA 3TDZA 1B1GA 5JRJA 3X1DA 1NUBA 2YNMA 1TTTA 3OE7D 5DSZA 3IILA 3KQHA 3BUNB 1LA0A 3GEHA 2IUUA 1YVHA 4GOXA 3SG5A 1OXUA 1S26D 5JCZA 1IOZA 5LB4A 3CX7A 3CUEF 3SG7A 2H61A 3WYFA 2WBLC 4NCKA 1Y0VH 5AWFC 1E0JA 3SE0A 2OT3B 2FZ4A 4JSYA 1KK8B 1F2UA 1NP6A 1KO7A 2QG6A 4HEJA 4YRUA 4KXFB 4TMXA 4MRYA 1T3SA 3CNNA 4Q21A 2IUSA 3B1XA 5TMPA 5C2JB 5EQTA 4M2QA 3NBYC 1ZCAA 4L4UA 4ZV4A 3LCPC 2CCKA 4S35A 1Q1BA 2AMIA 3RWOA 5HE9A 2J46A 1M46A 2QMOA 2ZU6A 5AERA 1XFYO 3DMNA 3KHEA 4U02A 4Q1BA 3BH6A 4HB4A 3VR1A 3WP1B 2KBMA 5HPYB 2FJUA 3L43A 5KDDA 3AF2A 2QT0A 2OTGB 2IEZA 4BEJA 2E9SA 3QPUA 4JT2A 3G82C 1KDTA 2X1VA 2IA5A 3PFIA 4AY2A 2ZSAA 1YUUA 2GJKA 3MGCA 1X3SA 2FOLA 3ZS9A 4CFRA 4GSYA 4LYFA 4EIWA 1E8AA 2GF9A 1UADA 1T3HA 2R9VA 1XF9A 2OHFA 5H1YA 1DAFA 1W7JB 5HZKA 3QKRB 1L2TA 1KQMC 1RJ9A 2F7SA 1VDZA 2F43A 3CX6A 4LY6A 4Q7LA 4EPRA 2MRDA 1F8HA 4DLUA 2CE7A 2MBXA 1Q1QA 1SKYB 3AKEA 3MUFA 1SXJB 1GOTA 1M7HA 4YDHB 5FI1B 3J81k 4LJ7A 1GL7A 5H68A 2JU0A 3BS4A 2XGJA 3NKVA 2D74A 2KGRA 4V0MA 2KNEA 2LHIA 4Q4LA 3TAUA 2F1HA 5AEQA 2CHVA 2N1BA 1U0JA 8OHMA 4HZUB 1AK2A 1CIPA 2ZNDA 2QAGC 1Q1ZA 5CSIA 2AKYA 1SPYA 1WMSA 2G0NA 5C46F 2FA9A 3TS5B 2EC6C 3ZVLA 5DO9A 2JLYA 1XXHB 1P9NA 3A1TA 5DN6D 2IHYA 3LQQA 4B43A 5BN3A 4I4LA 5E7MA 3O8CA 1DJIA 1OXXK 2Y1MA 2WSSA 1M74A 3BGWA 1R4AA 1BR1B 1X1RA 3CBQA 2PEZA 1N6RA 4M1TA 2O8DB 1BH2A 3VR2A 3ZJYA 2ORWA 4PE1A 1GQMA 2V6JA 5DNYB 5EXSA 3ZZUA 1EFTA 4NDBA 3GLIE 1KIMA 2RMKA 2LE9B 1NKSA 3UPUA 1DMOA 3JZAA 1FNMA 3GCGA 3NWJA 3OEED 3EVVA 5DKNA 1DJGA 4FWTA 4HYYA 4YONB 4TQ9A 2CK3A 3LXXA 5D7FA 4U8DA 4JT4A 1P2TA 2KGBC 2AFHE 5HYDA 4OHXA 3K0EA 2GCPA 3IKJA 4OHVA 4PPNA 2BCAA 4HREE 2DHRA 3QF7A 4HLQB 1FW4A 3K53A 4MGKR 3GD7A 3QXHA 5DI9A 1NVUQ 2HF8A 4JVNA 4PO9A 5HLVA 4UXHA 4DBLC 1E2NA 2FJUB 4LC0A 3ZIAA 4NTZA 4B71A 3A4LA 2OILA 3AEZA 2NG1A 4FN5A 3BOSA 1ZUZA 3F45A 4HAWA 1VCOA 4L9SA 5KDOA 1G8FA 1SVKA 1X6VA 1VG1A 3EIEA 1N5JA 1CLUA 3GEEA 2V6IA 2RGCA 1OFUX 3CRW1 1G16A 3L0IB 4D0LB 4R1EA 4DCKA 3HR8A 3NIBA 3NBXX 4TWZA 1GRNA 1E9RA 1YR9A 1S6IA 1U5IA 3FMIA 1SHZA 1AS3A 1DG1G 3T1VA 1NCXA 1RJ9B 2O5VA 1KK3A 2CCGA 2VSXA 1XPOA 3X1WA 3SNHA 1RVDA 4A6PA 1BO6A 1IN5A 1Y1XA 2IYQA 4DC9A 4NCNA 1F5NA 3GJXC 2CT9A 3TUJC 4WVFA 1AHRA 5DH9A 5H70A 4YGDB 2JGNA 4MUAA 3HU1A 2C77A 5G3YA 1G1MA 2XXAA 4DUGD 3K0CA 1NI3A 2IF0A 1ZNWA 4EJSA 3PM8A 4CT5A 5FOSA 5ELXA 2J7PA 2HXSA 2N46A 4A1FA 3DMDA 2QBYA 3ZLJA 1FMJA 3KO0A 2ZAMA 3I5GC 1NLYA 4JZKA 2B7BA 3FWCA 3D0YA 1LA3A 1JAIA 1NKTA 3O6BA 1YR7A 3QQ5A 5J5CA 1AP4A 4F0ZB 1XTKA 1R6PA 2I1QA 4PPGA 2LUXA 3EX7C 2W6ID 2MSEB 4WAUA 1E2HA 1KFUS 2CNWA 3AAJA 1JXOA 4OR9B 2BV3A 3D10A 4LHYA 3SJBA 5LPNA 2ZJ2A 3T5DA 2WTUA 2ZRMA 1KK7Y 4D1EA 3B9QA 1IN7A 2X2EA 1FW6A 4B6FA 1OSNA 5GQQC 4CEIB 1Q20A 1VIAA 4DVGA 4AQJA 1NBME 1LVCD 2DY1A 3LNCA 1CP2A 4W5HA 4AI6A 1RWYA 1NG1A 1T4GA 1CXZA 4UKDA 3RS2A 1NP8A 2V7QA 4P4SA 3TR0A 3PCRB 5FI0B 4U5XA 1AS0A 2LM5A 4QG7A 1COWA 1XNJA 3SG3A 4QXAA 4JBYA 4HAZA 1K8RA 4RKEA 4BLSA 3L0OA 1NMYA 5KNBA 3KQKA 3IO5A 2BM1A 2ZE5A 3V4RA 2QTHA 3FHTA 1ZU4A 3B1VA 4IHQA 3VRRA 1P60A 1ZW6A 3H1TA 3BD9A 3MAAC 2DFLA 1BF5A 1OYWA 2L0PA 4PSKA 4A4CA 2NZ8A 2ZANA 3PFVA 1BODA 1Z06A 2LCPA 2OUKA 4F4JA 2XX3A 4IEIA 1IQPA 1OB2A 2V55B 2WWGA 4NYJQ 3AF3A 4WZ6A 1OH6A 5C4GB 4NH0A 3QENA 5B64A 3NXAA 2M1KB 3T35A 2KBEA 1EXRA 3OESA 2LLTA 3R8FA 2VHJA 1DT7B 3LK1A 4KVGA 4MITA 2NO7A 5FFMA 3WP0A 1D2NA 1UKVY 2B8WA 5AUQA 1U5IB 4B6EA 2O60A 3L8ZA 3SG6A 2WJHA 3U7HB 3ADDA 4IDOA 1CTQA 3U7GA 4RFSA 2AK2A 5EE0A 2OO7A 3ZQ6A 1AK8A 4D25A 2YVUA 4HATA 3EXAA 4A4BA 4ZPXA 3U60B 3A4UB 2N42A 4P31A 4YGCB 2GETA 3VTKA 1JFKA 3NTUA 2W2VA 3CRVA 2JPTA 1XFUO 1U94A 2XXAB 2ISDA 3PALA 2F9LA 4NCIA 2CE2X 2D62A 4JWQA 1VCIA 5FOTA 2BMFA 2I2RE 3OB2B 1ALVA 1NF3A 5JS7A 2H16A 1JBKA 3C14C 3QIAA 4LUCA 5E4FA 3THWB 1UHNA 3K0SA 1DOAA 1MABA 1E2FA 1Z29A 5CM9C 3D0YB 3E2IA 4LV8B 1J8YF 4B75A 4QJ4B 1Z3IX 3CGAA 1NN3A 1DELA 2QP3A 1YR5A 5CDFA 2LHLA 2WV9A 4EKDA 4C0AC 4Q01A 5CM8B 1KFUL 4DB2A 4IOLA 1RZ3A 3BUMB 3QE0A 3KQNA 2FEMA 3B9PA 4B76A 4OI0A 1IJ6A 4M1WA 2ORVA 1GM5A 2PJRA 1MR8A 4TTPA 3JZMA 5JZVA 1JQJC 4C0JA 3NDPA 1K5GA 5FBRB 4I5JA 2GJ8A 4C0LA 5BYKA 1N0YA 2AXPA 3RANA 3GLGB 3OIUA 4P4SB 2QPOA 4AQIA 4OI1A 1Z0IA 2JJ1D 3TDUA 4XWAA 3FYHA 1QX5B 5ER5A 1CMGA 1BR4B 5BQ5A 2G3YA 1CEEA 2JCSA 4Z8XA 4ZCUA 1SCMC 3GJ3A 1GGWA 4HZIA 4E68A 5EP3A 1JPJA 4MKGA 4DDVA 1MH1A 3U7FB 2ECKA 5CIWA 4B3GA 4JPZB 1J99A 2EFCB 4DT1A 1OQPA 1WQ1R 4PAMA 4D2IA 2FNAA 5GADl 4RJLA 1OZSA 2B8TA 2HLDD 4DXAA 5KSYA 3JTDC 2ZS8A 1NRJB 4JSTA 5GJCA 1RKBA 2CDNA 1Y6WA 5IBWA 5UKDA 3U7EB 4GDFA 2FSHA 4JLOA 1G7TA 1KI1A 4ZCVA 3CZTX 1GRRA 1K5DA 1Z08A 4PHJA 5C18A 1W0JD 3FS7A 1EGAA 1IN8A 5FBWB 5FTMA 3SZRA 4RCZA 3WRYC 1EK0A 1NLFA 4PE0A 3CTNA 2WJYA 2XNDA 1UFQA 2KI6D 4M8NE 1H65A 4B3XA 1ZINA 5FOUA 2GA8A 4TN1A 5I2OA 4UNQA 4RFSB 2DFKB 2ZRAA 5F9FA 3IQQA 2ZROA 3LX5A 2QMEA 1KQMB 4BLTA 1NCZA 2A5GA 1FUKA 1U0LA 1N6PA 5K8IA 1SZPA 1G20E 1G5TA 2A5DA 3EWAA 1HQVA 3NHAA 5BYJA 5HR5A 3E70C 2Q3HA 1GP2A 3GLHB 3TUYC 1G9XA 4KFTA 4XSGA 3IBYA 2GXUA 1KJYA 4YMWA 1H8HA 1S2MA 2GWHA 2NZJA 2QEQA 2WOJA 4TTRA 2LMTA 4XSHA 2M8UA 1WRLA 4B3DA 1G7SA 3L8YA 5BWMA 2C9CA 4D4JA 1TAGA 1HT9A 5KOYA 4CIDA 2UVQA 2ZR0A 2ZRGA 1MABB 4PHTA 3A8RA 1A7JA 2EC6B 2VP9A 3EK8A 1AJ4A 1Z22A 3NEJA 4I1VA 3EZ2A 1LF5A 2G77B 2QTFA 4M53A 2FH5B 2VEDA 3NEYA 1CR2A 1G7RA 4XTCS 4D4KA 1NY5A 1I2MA 1ANKA 3CPHA 5TXGA 2C03A 3GMTA 1NBMD 4OQNA 2ZYUX 1XP8A 2OCYC 4RD1A 3EIHA 4R71A 2WKPA 2PLRA 1B23P 1MWNA 1XDBA 2C78A 2ORIA 4S2EA 4C4PA 1Z83A 1WRZA 1FTSA 1OIXA 4M1MA 3TSWA 4DIDA 3WNCA 4AC9A 3X1XA 2ZE6A 1QHXA 2ODBA 1Q12A 1Q57A 2V8OA 2XSZD 5FUYA 1S5GY 2ZJAA 1ESNA 4YLGA 2F8PA 2BEKA 2FFBA 2IS1A 1G4UR 1P73A 2F3YA 4DSOA 3PQCA 4Q47A 2HYIC 2Q3MA 1QS7A 4Z51A 4LCBA 1A29A 4DDWA 3A1VA 2QTVB 5G3ZA 2QY9A 3RRNA 4A2PA 1JXMA 4OHYA 2LVVA 2AD5A 3FE2A 4DT1B 2FSIA 1NIWA 3QXSA 1DJHA 4NHOA 3AUXA 5I2LA 2J0UA 2WIBA 3BH0A 2VBCA 4LYJA 4TSFD 3SU8A 5JMTA 3BORA 4URZR 1IH0A 2NOAA 2K7CA 2NCPA 1LNZA 1FQJA 3K8YA 1QV0A 3T5GA 5AUPB 1S96A 4UNRA 3WHUB 2W58A 2Z4RA 1D9ZA 1G3IA 2OXRA 4N5XA 3UMSA 1R5BA 1SL9A 1DVIA 4V0OA 1N5LA 4PZYA 2NO0A 3VROA 5JHGB 3AVWA 4B74A 1EFRD 4WBSA 1M34E 3EIQA 3FIAA 3RHFA 2DYKA 3AVTA 4Q48A 1Z2CA 1GG2A 2RGBA 5KSZA 4FCWA 3WXAA 1J1EA 1E2EA 4A9AA 3C1VA 2ATVA 1H4BA 2H7VA 3KFVA 4RZUA 1W46A 3GJ8A 2LWIA 5IDVA 2WC8A 1XFVO 5D69A 1RRCA 2KAVA 3PUXA 1LKJA 3UANA 4C3ZA 3VGOA 3VX4A 1KI3A 1W36D 3ZNIA 3P20A 1DAKA 3OFNA 5AJZA 2JATA 2C8VA 3JVUA 1XD2B 3B60A 3LLMA 4QNRA 2REBA 4PR0A 1KSHA 3I5GB 1GWNA 3HP1A 1KSJA 1EG4A 4ETOA 2EW1A 3GFPA 4XWKA 4CEJA 1RROA 2RCNA 2RB4A 1KWOC 5KTYA 2TN4A 1CTRA 1PK0D 1GIAA 3A1WA 4MKIA 4XVQA 4GP6A 4A0RA 3T06B 2J41A 4ZDKA 1CU1A 421PA 1E2IA 2IXEA 1AJ5A 4P4TA 2OLJA 4A0FA 3AF0A 1XTSA 2G2BA 1SBJA 4P2YB 4AYXA 1EJ3A 1TADA 3OEHD 1SY9A 2KI6C 1KK2A 3QXXA 3U44A 1AZSC 4NONA 4BZPA 3FVQA 2ZN9A 3BQ3A 4HUTA 2XB4A 1B8LA 2VHQA 5SZIA 3V4FA 1XEFA 4D6PA 5CPVA 4A15A 4PPFA 1GJYA 5G08A 1ETUA 3RS3A 2DWPA 1Y1UA 5L3RA 2FZLA 2VF8A 2YOGA 4F4CA 2GZAA 2ZI3A 4LBYA 1OFTA 1E1RD 1BYUA 2WIAA 2Y5IA 3P4XA 5DLQC 3VQTA 4BE7B 1G7CA 3C7KA 2WWWA 3T34A 5EP2A 2FN4A 3SFVA 2VH5R 1Q44A 1A1VA 2Z4SA 2J0UB 3B1YA 3FKSD 4CEHA 4WIAA 1ALWA 1XMJA 1W0KA 4DLWA 1CB1A 1RRGA 2JIZA 1DEKA 4QHYA 2AWOA 2XJ4A 2RGXA 5BN5A 1RK9A 1S1MA 3GJ7A 1N25A 1TF7A 1UJ2A 1NWDA 1NPQA 1RJVA 1CS4C 1TMKA 1MUXA 2HUPA 2NO1A 4TYWA 1IN4A 5PALA 4URVR 4WQ2A 2ZFDA 1XPRA 2FDCA 3WRXC 1DAGA 3GLFA 1XEWY 1KI2A 4DJTA 3AVPA 4CT4B 1E9AA 2WPDA 3RRYA 1L2OC 4V0LA 1UHHA 3DKPA 621PA 2W6IA 5FBVB 1P9WA 3B78A 1NX0A 4MDEA 1M39A 4TMWA 4GP7A 3PN7C 1IY2A 4G5GA 1OFHA 2LANA 4JLMA 3QSYA 3EK4A 5KDLA 3IDQA 3CB4A 3SJCA 2ZRHA 1VIYA 1U98A 2FSFA 2GILA 3BFKA 3ND9A 1E4YA 4GFDA 5FR2A 1VRKA 2AR7A 1S3SA 4CRWB 5J4LA 2SHKA 4KITB 2JLVA 2P65A 2LUCA 3H0KA 4UNPA 4URUR 1KMHB 3TUZC 4A36A 4B2PA 1MXLC 4HSZA 2B92A 4QGAA 2AHOA 3R20A 4MZLA 4GI7A 1M45A 2K8MB 1A2KC 1N2CE 2ERYA 4IDNA 1XCMA 4E07A 1JBAA 3LW7A 1UKYA 1QX2A 1Z6GA 5HCNA 5B30A 3KDSE 3KEVA 5HLOA 1R0YA 4KJZA 2JASA 5E7IA 1TEXA 4QKQA 1D6JA 1HTWA 3TLXA 3UWKA 2MLFC 3EVUA 4Q02A 2O8CA 1VECA 3VRNA 3QY0A 5C1BA 1M31A 1WY9A 5B57C 4KSBA 1ZCBA 1F60A 2C9YA 1NLZA 5FPYA 1OOJA 1NN1A 3WHLA 1G8PA 1NX2A 2BWJA 5E7JA 2G9NA 2AFIE 5L3QB 2EWVA 2VO1A 2VHTA 3TVDA 2CNPA 4NZYA 1IHUA 1CKEA 1A4PA 1X8LA 3QPWA 2M7LA 1D5CA 3I72A 3TH5A 2A9KA 2D2EA 3W6NA 1ZAKA 3U44B 4LWZA 5TDHA 4XVRA 1I4TD 4Z54A 3M0WA 3CW2A 5FPSA 4DLVA 4ARZB 4PHHA 1ZIPA 2GAOA 2XJ9A 2LNKA 1L4YA 2D7DA 2XZOA 3OZXA 3W6PA 1ZNZA 1K6MA 3F8TA 1G4AE 4HDOB 2GGMA 3SJAA 4TYPA 4DLYA 3ZD6A 3H84A 1SCMB 2FWRA 2P2LA 2K2AA 1HEIA 2YZ2A 3E1SA 4LJ9A 4NE2A 3CWGA 2NTYC 4NYIQ 5FOVA 3EPJA 1DARA 2FFAA 2JDID 3LQRA 2ZE8A 4D0NA 2CEAA 2G83A 3KPXA 2QMUA 3DEFA 2X8AA 1QHIA 3FHOA 3KJHA 4LBVA 4B3CA 4JVMA 4QGHA 4CEHB 3RC8A 3IQWA 2M9GA 3WYAA 1BU3A 1IQ3A 4EPWA 2VYFA 5FUWA 3JTDB 1LW7A 1N6IA 4JIMA 4WXPA 5FPTA 5P21A 1ZUIA 4CDGA 4IJMA 2F3RA 3QOFA 3UMRA 2ZKMX 2VRGA 1DAIA 1G5RA 2GCNA 4XH9B 2KI4C 2QMHA 3Q3JB 4BRUA 1II9A 4X8LA 4HZUA 1NVVQ 3U5ZB 1E1QD 2KAXA 3I5FC 1X1SA 1GNQA 1M1YE 4KBGA 2O8BA 1XXHA 3RNLA 3IGFA 4TNCA 3AVQA 3VHLB 3WMEA 2ZVQX 5JSZB 2XOKD 2PZFA 1II0A 3IPYA 4ZI2A 1N0UA 1AA9A 4M21A 3SYKA 3AKDA 2DFNA 2FE4A 2LVJA 4MRSA 4QBIA 1ZD1A 4PDZA 1NMXA 2IT1A 2Q21A 2Q9CA 3K0AA 2ZS9A 3TUYB 2PT5A 4HUQA 4IKEA 1KK7Z 3NH6A 3OX6A 1N6NA 2FPMA 1PSRA 3PJRA 3W5IA 5J4YA 4CZ2A 1QVAA 4JS0A 2R2AA 4JLPA 1ZM2A 3ZDQA 3AB3A 4BFYA 2WZQA 2JTZA 4HDQB 3IO3A 1DJWA 3SI7A 821PA 4WA7A 1LXFC 3EG5A 4YXWD 1JUOA 1PVAA 3R9WA 4BFVA 2O8CB 3U3KA 3EPHA 2IS4A 4X8OA 4L9WA 1Z0FA 5EUQB 2ONKA 2ONJA 1S4QA 1PZNA 1WRBA 3PEUA 3SS8A 4A82A 1Z0JA 2HLDA 3HR7A 2ZU0C 1G8YA 2Y4QA 2G6BA 2GV5A 2V54A 3RM1A 1XB2A 3ZZTA 4D80A 1AKYA 4W9MC 3MSEB 1PVBA 3NHBA 2NMVA 3G0HA 5JHHB 4TL7A 4JKYA 3PVSA 1K2HA 3B2EA 4EUNA 4E5UA 2HDNB 4BWYA 5K8UA 3ASZA 1JB1A 1XVJA 5CLLA 1DADA 1RFLA 3CR5X 4CVNA 2ZSDA 5JJGA 4C0HA 2CXJA 1CLBA 1H8ED 4P5OE 2VF7A 4OQXA 2OEPA 2PLFA 3AKYA 1SVWA 5IK2A 4Y0AA 4TZ6A 2HF9A 4ZDJA 4G5RA 1JC2A 1ZD9A 2JLSA 2QGZA 2AN9A 3VRPA 4UQOA 4CYMA 2YJTD 2K7BA 2ZQ5A 3AQ4A 4IVPA 4EDHA 4O0MA 3TW8B 1E96A 1XU4A 4JJZA 2PASA 5J4KA 3QJYA 3U3MA 3CLNA 5TVKA 1TN4A 1XWIA 3C15C 4B3BA 2BL0C 3VNUA 4AYTA 1Z07A 3QXJA 1GUAA 2GCOA 2PMKA 3REGA 1YURA 4OHZA 3SOPA 3UKDA 4ASUA 4N0EA 3BJIC 2ZI4A 4RSGA 3FDIA 4EQ6B 1F3OA 5A4JA 2QQEA 3BERA 4PCWA 1KI7A 5EZ6B 4MN0A 3PEWA 3GLIB 3NG1A 4ORCB 1Y1AA 2QT1A 5BPJA 3ZS8A 3ZYCA 2O8BB 1WDTA 4DCSA 1WLMA 2QN6A 1KKMA 5JLJA 1US8A 2RH5A 2W2XA 4XD7A 1XFWO 1CMFA 3CZPA 4Q03A 4HRGA 2AKAB 2XZLA 5FOWA 5K8TA 4QM6A 1OHHA 3TKLA 3EVRA 3BB4A 3K0AB 3MRSA 4HUQB 4B44A 2GESA 2JJ2D 3SHFA 2JT8A 4M1SA 2Z43A 2A2ZA 3LK0A 2F1JA 3F0TA 4PQFA 3F5FA 2GXQA 2EYUA 2JLQA 5KUTA 3BXKA 2XTZA 4I1OA 4QJ3A 1EX6A 2PH1A 3NSIA 4CEIA 3LBHA 2L98A 1OIWA 3AP2A 4L16A 5KYKA 4OL0A 2OG2A 4OQFA 2I1VB 4Q4JA 3RS7A 1IJEA 2BKUA 5AK0A 2BDTA 2P6RA 1OLOA 2QPAA 1SVIA 1UKZA 5FL3A 1KWOB 2Q9BA 5IHPA 4LX0A 1TL7C 2HYDA 1S9HA 4TSFA 2Q4UA 4CFQA 4WZBE 1ZOTB 4RD3A 4LYHA 4EPXA 2I3BA 1Y63A 3NDBB 2HCJB 1XCPA 4W5WA 5L3SA 1DG3A 1CULC 3VRQA 3DM5A 2BBMA 2QU8A 2QP9X 5JJLA 5HKKD 4TL9A 2W6JA 4NBSA 4C30A 4P32A 4BFWA 2AUCA 2JT0A 1Y3AA 2GZDA 5FH9A 2H17A 1CM1A 4LHWA 3CF6R 4BFXA 5CLQA 4F38A 4MYHA 3L2OB 3T61A 4OKHA 1E69A 3LW8A 3UATA 4M9SA 4DDTA 3W34A 1H8BA 1VCMA 3Q5EA 5JI2E 4QGFA 2PX0A 1QDEA 4JLKA 2YWFA 3I3SR 1KCYA 1GKYA 3NBZC 4OBEA 4B34A 4ZDWA 1SW8A 3ZVMA 3IBGA 1Z0AA 2JXCA 1VHTA 2JEOA 2AXNA 3WBJA 3RDPA 4IXMA 3K09A 1CRQA 4DCTA 2RGIA 1HQCA 3BRWD 1MRSA 1U8YA 3G5UA 4MRNA 1CFCA 3K9NA 1BMFA 2LVKA 2C5LA 4DCUA 1HUQA 2M1UA 1PVOA 1P7CA 5AFPA 2ZRIA 3TAHA 4IXNA 2L2EA 2GCOB 2WJGA 4L8GA 4M9XA 1NIPA 2M97A 5FR1A 2OFXA 1D2EA 3C16C 3PEYA 2GXSA 2GBLA 1J2JA 3C4JA 3I32A 3BXZA 5K89A 2IYZA 3B1ZA 2PJZA 1PJRA 3LY5A 1KTVA 1L2OB 2IXGA 2QE7A 4M2OA 1OXVA 3HYRA 1DGVA 2D3WA 3THWA 4M4SA 1YZUA 2VSFA 1BJFA 3PN7B 1US8B 4JL6A 4PZLA 4XIGS 1EFUA 2R6FA 5A5GA 5JRZA 3KL4A 5FBLB 3QUSA 1UF9A 1OKKD 1D8TA 5FUXA 2V1UA 1QVIY 2IUTA 2BOVA 4HDCA 4P0TA 4QJ4A 4EFNA 1MO3A 3OEHA 1LV7A 1V1FA 4I5LB 2BBNA 1IXSB 1YZLA 4IDPA 2JWWA 3DVJA 3FKQA 3KFXA 3GPLA 3QI2A 1DF0A 3BBPA 1FI5A 1RFJA 4LK2A 3O8BA 4L5BA 2ZJYA 4QJ3B 1KGDA 3FWYA 1KZ7B 1LB1B 1M7GA 2IL1A 2YWGA 1YX7A 1UUSA 1UDWA 2ASEA 2OAQ1 2R6DA 1S5GZ 2W0MA 3LH5A 1NSTA 1YZNA 2V1XA 4USLA 2BHRA 4O2LA 1E1RA 3GLGA 4Q4JB 3AGPA 1K9PA 2OXCA 1YVDA 1CDMA 3EZFA 4MLWA 4DRWA 1XMIA 4DCVA 4DLTA 4F91B 1TX4B 2LC5A 3BC1A 1S0UA 4RZ2A 3DZ8A 2LP3A 3FKSA 3M0EA 3PG5A 1WP9A 4GMXA 2IS9A 3AH8A 1EL4A 2PVBA 1OXSC 1TNWA 2QRZA 4PSVA 1FNNA 1R2QA 2DWQA 1SK6D 2FFQA 4HB3A 4QBHA 2IWHA 5L3SB 3JVTC 5FL7A 4NYMR 4PC1A 1NJFA 1QATA 1LTQA 2DCUA 1NIJA 1QLKA 1UBCA 1UEIA 2CMKA 4E03A 4IW3B 5F3WB 1R0XA 1DPFA 4B73A 3IQXA 4BZXA 4UNNA 3BK7A 3SEAA 1CJMA 3QVVA 4MYCA 2AX4A 3DZDA 3EC2A 3O4YA 2I18A 1F6BA 3ETLA 2KAYA 4BGDA 4FTGA 1E98A 3PENA 5JOLA 5B8IB 3CR7A 1YJ5A 4AIIA 3D3QA 1J55A 4KLZA 5EE9A 4OHWA 1N5IA 1T91A 2J5XA 2ZYTX 1W36B 3KQUA 4EFLA 3OP0A 5EUMA 2WICA 2L4HA 3KXIA 1F2TB 4GNKB 1J7KA 1Z5ZA 2LMUA 2OBNA 3OF5A 5DKQA 2REXB 3GLHA 2ANCA 5G53C 3U61B 2O52A 2KI4B 4C0KA 1E2GA 1P62B 1X86B 3V00A 5EXTA 3IPXA 3QF4A 1IJ5A 2QAGA 4PSAA 1OPXA 1N6OA 4PXAA 1GNPA 3PITA 2CHQA 1KDOA 1JR3A 4XYNA 2UZ3A 5JI3E 3GK4X 1TNQA 3TDIA 1QHSA 1OE9B 3LBIA 3NBFA 4N0DA 1O87A 3A36A 4GOKA 1BOFA 1WF3A 4G5OA 5JEEA 3TRFA 4GFTA 2YOFA 2M29A 2GEVA 1DF0B 1SMGA 1XO5A 2WORA 2A5FA 1XEWX 2L5XB 1JECA 1KAOA 2IYSA 2QSYA 2REOA 1OF1A 2KFFA 3VAAA 2IYTA 4ZIRA 1XX6A 4PHNA 1SVLA 2B7CA 4POAA 4URWR 3W90A 1SXJD 1YZGA 1N0WA 2C9OA 3CO5A 3I5HC 2LVIA 2RGNC 3HWSA 1ODFA 2JDIA 2C98A 2NPIA 3PEVA 5LBIA 3LWNA 4M1KA 1EH2A 1JEDA 3ONWA 2GRJA 4V03A 2C96A 3U3OA 1OIVA 4GZLA 3BH7A 3BWDD 4IOJA 1NSHA 4YI8A 2XTMA 3ZWHA 3EK7A 1N65A 3C41J 2ZSFA 5CJ2A 5AJVB 2QNRA 4B32A 2D8NA 1J7PA 2KYCA 2OE2A 1W5TA 1ZMXA 4UXJA 3T12A 3NSOA 3BAFA 5HTKA 2B21A 4YQFA 1E9SA 1IY1A 4JL5A 2P67A 6Q21A 2BJWA 3U6KA 1J1DA 3EKJA 2ZRTA 4Q1AA 1UEJA 1VG0B 2IYRA 2F1IA 1QIWA 4FINA 4I5NB 1S3GA 1T5IA 1ELOA 2YOHA 3B13B 1OB5A 4HB0A 3BUOB 4AURA 4FI3C 4GOJA 3GEIA 2ZIAA 1U90A 1CJTC 4G1UC 1KI4A 1XRJA 1F71A 3TW4A 4NYJR 2HCBA 1P72A 4IVRA 5JSZA 4R2IA 3OE7A 3H86A 4OQMA 4ESHA 3KKPA 4XJKB 3MWYW 5J4VA 1MO5A 1YZKA 2EWWA 3DVKA 2BM0A 3BUXB 2FCEA 2IF2A 2OBLA 5CYOA 1G8GA 2HQWA 2MLEC 2J9RA 3HU3A 4KCGA 1NVXQ 3QF4B 3QXCA 3T1QA 2QAGB 3CH4B 2A78A 4TLEA 2Q3FA 4Q1CA 1N6LA 1WCV1 2PT7A 1XD2A 2O8FA 1Q0UA 3MLEA 2MA2A 1W47A 3AKCA 4LPKA 4M1YA 2WCBA 2RAPA 1PV4A 4CPVA 4A0HA 2G1KA 4RD4A 3AVUA 3VR3A 1G3UA 2FPLA 1JNYA 1OMDA 4TT3D 3SQXA 4W5JA 1YVLA 4M2LA 3Q7PA 2HPSA 1E0AA 4MGYR 3VFDA 1U8ZA 2FOTA 1H8EA 1XTJA 4LJYA 4ZIRB 1W48A 5EE5B 4PE4A 1FI6A 4E09A 1TF5A 1M6NA 3KKMA 1OV4A 3KKOA 4MDFA 121PA 4DHEA 1XPUA 4YMUA 2K2FA 4EFMA 4MUBA 1YX8A 2BKHB 2K7DA 2HXYA 2CXXA 1Q3TA 1DO0A 1VG8A 1AN0A 1ZNXA 4LHZA 1KMQA 1YZQA 1KK8C 1LINA 1N2DA 4K81B 1JSAA 3QEOA 4Q7KA 4OI2A 3FFAA 1OH7A 1ZJ6A 5TB5A 4D0GA 2EU8A 4NMMA 1D9XA 2WKRA 2ZRPA 1XD8A 3EWSA 3FMPB 4NPHA 4OK3A 3ZD7A 2J87A 3KB1A 1F54A 2YHSA 2WSSD 2VPPA 3QKSA 2WMOB 3RRMA 4A8JC 4B35A 2ATXA 1IBRA 2YINC 3AKBA 2OTGC 2SCPA 2VP4A 5FTLA 4PHFA 4TYQA 1AKEA 2OESA 1OFIA 3PUWA 3TSOA 1OH5A 3O78A 1XMSA 4HB2A 2ZJ8A 2H2KA 1DBSA 3VU9B 1RYFA 5DN6A 4MBEA 3X1YA 2I94A 1Z47A 3SG4A 3I5IC 4DRZA 2FPKA 2HJGA 1WBBA 1CR4A 3AM1A 4G5SA 4AG5A 4GGFC 4J0QA 5EE3A 1E94E 1NN5A 1X8KA 3IHWA 4BFZA 2WJIA 1OZOA 2KQYA 1OH8A 2HV8A 4NDDA 3MWKA 3CF0A 4RZ3A 1G64A 1FP6A 4NKRA 2LAPA 5AJWA 1JJ7A 2JLXA 2G9BA 2O0KA 4H1UA 1PSBA 2F6RA 2PCJA 4PHKA 3EW9A 2FFHA 5ANRB 1GL6A 1KHTA 3NC1C 1UBEA 4BPBA 2PEYA 1BT6A 1P3JA 1SXJC 1TUIA 1XFAA 3H4MA 3OEEA 3A6PC 3CZQA 1QASA 1A4RA 1KMHA 1WDCC 4AKIA 5J47A 1DGUA 5B2ZA 3ZIAD 3CIOA 4IOKA 5EXPA 4JMPA 2V53A 1SKTA 3DVEA 3AF4A 2F1RA 1F4QA 4HLCA 1UPTA 4PO8A 4PC6A 2BEJA 2JNXA 3GJ6A 2GJSA 3IIKA 2O8FB 2KI5A 2KWIA 3BOWB 4QBGB 1S8FA 3CH5A 1QXPA 3EZ7A 1E2PA 2KYFA 2BCJQ 2ZRJA 3LLUA 2ZUBA 1XK4C 2O5GA 1PRWA 2GHIA 3K9GA 4OK5A 1U8AA 3MWLA 4XOIA 3TR5A 5L3QA 3ZVNA 2IX3A 1EXMA 2BKEA 1EX7A 2ZSEA 2M49B 3DOFA 4R2HA 2JLUA 1IG5A 2OZEA 1M2OB 4DSTA 1SQ5A 1T9HA 1Z0DA 3FFBA 1AUIB 2H61C 1XFZO 3N70A 2ZITA 3AVXA 1YTZC 2Q6TA 2P5TB 4L15A 2RGNA 2BIFA 1JF2A 5A0FA 4BZQA 2DFTA 5F9HA 1UHIA 3NH9A 2QPTA 3OIVA 2D2FA 4M1OA 3B82A 2MSCB 4FMDF 2J7PD 3ZZ0A 4A2QA 1OW3B 3DD4A 1B4CA 5AUOB 2Z5FA 2ZI6A 4BY4A 4ZDIA 2ERXA 2GVDC 5SZJA 4AD8A 3PV0A 3L0SA 4HAVA 4II7A 3REFA 3JVTB 2L4IA 3GOFA 2FV8A 2VLIA 5J4HA 3VKHA 2ZRBA 3QKSB 2ZN8A 1EG7A 2FU5C 4DUGA 3P4YA 3Q72A 1IRJA 2BMJA 2R44A 4QRHA 4A4DA 4BY5A 2B1UA 4QJ5A 1E79D 3PXGA 1T0JB 1FL9A 1FOEB 1T8UA 1DAEA 1X8JA 1NX3A 2KB0A 3FPAA 4M9QA 3CLVA 3S1AA 1XMVA 5GJBA 3U6BA 1QHYA 5JWRA 2JNFA 3P27A 1RIFA 1UHJA 1MOZA 1R10A 2H5EA 4US0R 3HCMA 1RYHA 2A5YB 4FQOA 5B58C 2V7QD 2GVZC 2ZI7A 4GZMA 4RVCA 4TQAA 2WJJA 3I5XA 2YKGA 1D1OA 2JXLA 2JC2A 4DIRA 1HV8A 1PALA 1F55A 1UWOA 1KO5A 3SQWA 1K93D 1R2UA 2CVHA 4TZ0A 2CTNA 4WQ3A 2H8KA 3MWJA 1ZNYA 2P3SA 1TTXA 1RW4A 1PUIA 3RWMB 2A7QA 1D2MA 2AAOA 3SJZA 2DB3A 2MAZA 3GJ5A 3U3JA 3X1ZA 3AF1A 3HPQA 3AUYA 2GXAA 3HJNA 4ABYA 4U00A 3VR5A 4Z8YA 1G3RA 2EGDA 1ZM3A 2GZHA 3BB1A 1K94A 3DF0A 4BUJA 4A6XA 2CBLA 5AUNB 1ZM9A 1XD9A 2HJVA 3DM9B 3NSLA 4X8HA 4B2IA 4FIDA 1IQ5A 2OLKA 3KJIA 1NNEA 3KF9A 1QHHA 1TRFA 2OSBA 3CWQA 4KHZA 4V0KA 3RRZA 4C0QC 1A75A 5CSNA 3MJHA 3AP3A 4DWJA 2DR3A 3CR8A 3SHWA 1W7AA 3PUVA 1ZFSA 3SDZA 1HURA 4R98A 4ZKEA 1HY3A 4BLPA 2OAP1 3MCAA 1W4RA 4QL3A 4FXPA 2BCGY 1NG9A 3W3ZB 3A1UA 4KU4A 1KO4A 4D4LA 3LV8A 3I4LA 2O0HA 3GFTA 3ECCA 3EKHA 1K8UA 1XTRA 1S36A 4JBWA 5DKRA 4JLNA 2OS8C 1E0SA 3I5HB 4XVUA 4W7SA 2QA5A 4PQRA 1GITA 2EFGA 2BCXA 1J7OA 1W44A 2L0XA 1J70A 5JFGA 2KQ6A 3ADKA 1RE0A 1UHKA 3T1TA 1B7TY 5M04A 2FSGA 1OYYA 4MKHA 2L51A 2NXQA 4EPVA 3CS1A 2IW3A 2HQ8A 4M2PA 4IDQA 2TMKA 3PATA 3EZ9A 4FMCF 2Q9AA 1M8PA 1R8QA 2W2TA 2JA1A 3KKNA 3EAQA 5E95A 1IXRC 4TLCA 4QJ5B 3RS4A 4EPYA 4G01B 1E2DA 2QM7A 3KJGA 2NLNA 3S1AB 2KHNA 1RC8A 1NY6A 1CNPA 1G6OA 2IYUA 4EQ6A 2YC2C 2HT1A 4IL1A 1PLKA 1IY0A 1KZGB 1NN0A 1F4OA 2ZETA 4G3XA 4GGFA 2PSRA 3K70D 1XA5A 3MSXA 3W9YA 5EP4A 3GLIA 5FOXA 1S6CA 4FMDB 1KFXL 4MVFA 4OCIA 2G88A 5LB2A 3R7WA 4O25A 1QBKC 1QVIZ 1OMRA 4OYHA 2YC4C 1M7BA 3QKUA 2FG5A 4QC2A 1RPZA 1XEXB 4KBFA 3PLFB 4Q1DA 3HPRA 2ODEA 2VTKA 2I4IA 2WOOA 1A03A 1MV5A 5DYGA 3CR4X 3K21A 1Q1EA 5L3VA 3TZ1A 1ZBDA 5BW8A 3K0CC 4JLBA 1E99A 1W2GA 1DTSA 2JJ1A 2ZREA 4TMTA 4C0BA 3FMFA 4EJSC 5D3MA 4IDHA 3TIFA 1ZACA 1CR1A 3DF0B 4DDUA 5DIFA 4UPGA 2VP0A 2F9MA 5HZHA 1XZQA 1A2XA 1BMOA 2G1JA 2R65A 3PIRA 1CRPA 3CF2A 1NX1A 2EFEB 1G291 5TNCA 1QHHB 1B0UA 3OB1B 1AIPA 1QF9A 2GKSA 1KNQA 1FMLA 4JKIA 1A75B 1QG4A 2PMYA 2O8EA 2XNDD 5KPJA 3DVMA 1IM2A 1ZVQA 1DAHA 4BQSA 3I1FA 1N6KA 3OIYA 3TUIC 1XK4A 5CSFA 3VMFA 2JULA 3Q8XB 4IEEA 1LFDB 4O2RA 1OE0A 3GLFE 4GBAA 1VTKA 1WB9A 2WJVA 1KSGA 4US2R 4ZI3A 3GK1A 4NL4H 3QEJA 1W0JA 1JAHA 2F2PA 1E2KA 1JI0A 1K96A 2CL6X 1TQ4A 2ZSBA 3KJEA 3MG9A 4LJAA 2NZ0A 2K7OA 5GVRA 3FHCB 4NCHA 4KI0A 1H8HD 2IYYA 3TE6A 3CRRA 2V3CC 3AV0B 1G3MA 4OJKA 4KV9A 4DLSA 1KO1A 1QX7A 4I99A 2R62A 1GDDA 2LMVA 4X8MA 5CYPA 2OFWA 4ZCMA 4OV2A 1X02A 3TNFA 1UAAA 2XNSA 1ZYUA 2P5SA 4FD2A 4PC2A 4P3YA 2W0SA 4M9ZA 4LDJA 4M22A 1N3BA 3TQCA 1C7VA 1W1WA 1G18A 1O3YA 1P61B 2QSZA 1T0HB 1YKSA 1UURA 2JOJA 2E87A 1LF0A 3RYTC 3C8UA 4A8JB 4EPTA 5G41A 2ZJBA 3ASYA 3LO5A 1CDLA 2EHBA 3EC1A 3AAKA 2WVJA 2NCOA 2A4JA 1T6NA 2J1LA 2RHMA 2QENA 4QBFA 4G5QA 3KTAA 3IF7A 1GNRA 5GVSA 3WMGA 1W4BA 3THXB 4NYIR 1RRPA 2KSPA 5KU1A 3NC0C 3B7GA 1FX0A 3I5IB 2IYXA 2M0RA 1E2MA 3VR4A 4AOMA 4HAXA 1VCNA 1YR8A 2I7AA 4YDSA 1SR6C 1V1GA 4NQGA 2CJWB 2F3TA 2UKDA 2BCBA 1NBMA 3I8SA 3I92A 4TT3A 3RVBA 3WXMA 3R7WB 4N1AA 1IAQA 2LP2A 4N3NA 1LS6A 2BMDA 4H9GA 1XFXO 5ER4X 2KBFA 4DSNA 3RC3A 1KI8A 2WWYA 5IRCD 1TU4A 4RD0A 2J45A 5SZKB 2KBIA 2XSZA 3W5JA 4NDCA 4FMCB 3FTQA 3ZH9B 5LD2C 1WDCB 1NVVR 1G5PA 2IYLD 4MRRA 1GAJA 2NGRA 2Z83A 5D3MB 5CK4A 4GMDA 4TL8A 3UK6A 3ADCA 3CR2A 1ZM4A 3EARA 5F98A 3TMKA 1CKKA 1CFPA 1F70A 2V9PA 4C2UA 4H1VA 4AG6A 1LS1A 3D8BA 1EESA 1YE8A 2O8EB 1KJZA 3SFZA 521PA 2WSMA 3EASA 3FOZA 1SKYE 1S9DA 4ILEA 4B3FX 1B8CA 1SXJE 3QBTA 4RD6A 3VNVA 4UJ3A 3IEUA 2HF5A 2YV5A 1QVRA 5HCIA 3RS0A 2Q91A 1U0HC 4CF7A 2VQSA 1XBTA 3PUZA 4ARZA 2Z0MA 2OCBA 1KI9A 2XEXA 4AKHA 1GZSA 3B85A 2SASA 1Z6TA 3ZVRA 1XYDA 4LJ5A 4B33A 221PA 4IFEA 4LZZA 3JVVA 1XXHE 3UG7A 5BN4A 2K0JA 1MF8B 1FFHA 4HAYA 4NYMQ 4DKXA 1TPZA 1P75A 4YC7A 5AR1A 5JBQA 1C07A 2J0SA 1CM4A 2YWEA 1F2UB 3KB2A 2ZJOA 3IUYA 2IYVA 1EFRA 3KZ1E 2J7KA 1W4AA 2QGNA 2FF7A 3OFND 5EP1A 2CL7X 2FMXA 1G19A 1VHLA 4LJ4A 1XTIA 1HQYE 4C0SA 3CPEA 2A3RA 4WOPA 1FBVA 4JJKA 3BFXA 5JECA 3MFYA 5H8WA 2AL7A 2R2IA 2OBMA 3OAAD 1DJYA 3KTAB 4LBWA 3K0FA 3TQFA 2QACA 4WRIA 2QORA 4LHVA 1Z8FA 2CHGA 1ODBA 4XJXA 2ZRCA 1F2TA 2ZJ5A 4GNKA 3CWZA 3K70C 3GQBA 1E9DA 4PQYA 1FX0B 1AJEA 2JRFA 4DB4A 1UBFA 1YRBA 1HYQA 3UMFA 4GAOA 1IWQA 3I8XA 1KQVA 1E0KA 1T8TA 1YQTA 3CM0A 4JVLA 3U4QA 2WWXA 3DDCA 4JLJA 3TK1A 4A2WA 4I81A 3V9PA 4Y0VA 2J3EA 3TGPA 2F43B 5KPDA 3ICEA 1NMZA 3KKQA 1Z28A 4LSGA 4YGBB 2QP4A 3X2SA 4DCNA 1AS2A 4HLUC 2ZRSA 2GDJA 4IOMA 1JF0A 2ODWA 1TNDA 4IRUB 4KODA
chains in the Genus database with same CATH superfamily
2CFIA 3VR4H 2R66A 4I1UA 4K2HA 2OB1A 4Y1RA 1W5BA 1N0VC 2OHIA 4R9VA 1NGSA 4DS7A 4BEBA 1R6DA 4BP9A 3LQKA 4RC9A 4G2NA 3ETEA 4Y8VA 1NBAA 3GLTA 4QLBA 3PVZA 1NYQA 2PBZA 5J4YA 4EJ0A 2QAJA 1C0LA 1BOCA 5LJIA 4OLFA 2FGJA 5TMEA 3LP5A 5JXHA 4ZVRA 4KDEA 4PBTA 1P80A 4RKFA 5E4TA 3H5TA 1R6BX 1PLJA 5B7QA 3F6PA 6GPBA 1Q1NA 3ZLTA 5CLHA 1UKAA 3EEBA 2XLBA 4HP8A 1DRUA 4HWGA 4D6XA 4ACAA 3LLCA 2OR3A 3ZK7A 2PPLA 2VUUA 1EQUA 2D1FA 3DNPA 2G67A 3A1DA 2HK6A 2KYRA 5KJ1A 4OQEA 2GK7A 1OOHA 3ICQB 4CMIA 3TGWA 3LRPA 2AN3A 3KC2A 1ONBA 2X6QA 2AE2A 2QUBA 3ZHUA 1VSVA 1JG1A 1NJ8A 1L7VC 2PXHA 5KJCA 2IUEA 1ZRSA 1LSSA 1V8ZA 1UOOA 2G9RA 3P9XA 2HQRA 1M54A 1U9IC 3N1UA 1YQEA 4UNSA 3Q7EA 2XOKA 3DWGA 1UXIA 1K9KA 3QG5A 3EF1A 1MOPA 4OI4A 2KSQA 2C00A 1ESMA 3W1EA 1RRKA 2PU7A 2VNAA 3OOEA 2E3JA 3KG2A 1ILEA 4WMLA 3KXKA 5FWYB 5KWIA 4AY5A 4Y2PA 4KFSA 5LBUA 4M0LA 3OQBA 1KEPA 8GPBA 1KQ3A 2DQYA 1YD7A 1GNLA 4QHTA 4Y6LA 5FTKA 3V7FA 2YMQA 3EZLA 2NU8B 1KF0A 3P2JA 3V4ZA 2BFMA 2R8RA 1KYIA 3LUFA 3CISA 4UTXA 2YVQA 3EGCA 2L50A 2AC7A 1E2UA 5GJVC 1OHHD 1MVOA 3IP7A 5IN4A 4UHFA 1JR3E 2H11A 1NU8A 1P1CA 4LPSA 1ZSVA 1DEOA 1LDNA 5DHPA 5DYIA 1EUZA 2IOYA 1N2CA 2VPQA 2VNJA 3KOWA 5HP4A 3H9EO 4LJ6A 5T5QA 5KNCA 4OLBA 1N2XA 2IY9A 4DLAA 4XTRA 1TOPA 1KAGA 4I9HA 3WSWA 1P6XA 1MJNA 1XLVA 4UUQA 1DG9A 1YU9A 1LKZA 1ZCJA 2CXPA 4IIEA 1I3MA 4MYTA 1DIGA 3LFTA 4CG0A 2QL6A 4GOOD 1C2TA 5DE3A 4AMUA 4Q18A 2WR8A 1MRNA 4OHOA 4S1NA 4QNMA 4EL5A 1EM8A 2JC3A 1GUBA 1DRWA 3S29A 1IEWA 3GT3A 2KLBA 2AZTA 5CVUA 3OAAA 2B2NA 2CXRA 4EABA 5I8NA 1CUHA 5CD1A 2CV2A 3AYZB 4PG6A 3WHKA 5AKLA 4DLRA 4HRHA 3DZKA 4N76A 1BG1A 1LK7A 2NVOA 2WMNB 2ZJZA 1UKEA 1OLXB 2VJAA 3E4DA 3MCTA 3GEGA 1TQDA 5FL7D 1JWDA 2CLSA 2CXHA 1P17A 4X85A 1G98A 1ORHA 2IEGA 3GPIA 2R6AA 3KUCA 2JFQA 4JWKA 2ZRNA 4MS3B 2XYHA 3NOOA 4REQB 1PX0A 4HBZA 2FW1A 2HRDA 3IXMA 5BMVB 1QB7A 5K0GA 3PE3A 3O8RA 1N1MA 3ZU6A 1N2GA 1TRHA 3DXFA 5JCPA 1JHMA 3ZDBA 4J4HA 3AP1A 1I4OA 2EJVA 4XLLA 1H2BA 3L7BA 2CXOA 5AJUA 2NACA 2I3DA 4OB6A 3AY6A 2XKJE 1M73E 4A0GA 1NNUA 3UOGA 4Q39A 3BJHA 4YBRA 2IC5A 5AANA 2WQZA 1X77A 5K0EA 2QQFA 4R7ZA 1W85B 2RKBA 1NUBA 3OE7D 3Q3IA 3T9EA 2ZIUB 1T1JA 2X7XA 5B58T 1RJFA 3ER9A 5HOQA 1A97A 4YRUA 1SG6A 2XI4A 4EEZA 4M2QA 3TQIA 4L4UA 3UK0A 1Q1BA 1XELA 4PRLA 4D43A 5AERA 2XVYA 4XGRA 5BPHA 4O4JF 4L22A 4CFRA 4LYFA 4EIWA 1E8AA 3FSGA 4EZEA 3KAPA 1FVOA 4EA8A 1XLTA 4S24A 1V8FA 3MUFA 2VPXA 5AMXA 2I78A 1CZKA 2SBTA 1KS2A 1J09A 3NS7A 3ONFA 2GEFA 2A0UA 2B0JA 3QVGA 1BH2A 3MWFA 1EFTA 1F8XA 1DC4A 4MIOA 3UPUA 1TB4A 2RGWA 1ZSYA 4KV7A 1WB4A 1O0CA 2GO1A 4U8DA 4JT4A 1AQLA 1VGQA 2WF8A 4BVAA 2ZIWB 4NXNB 4UZSA 4MUEA 4MUFA 3DVRX 4L9SA 2OXEA 3G8DA 2V6IA 1U4NA 3OPVA 2P35A 3J7AC 4EB0A 5TQ2A 2JH8A 4WJZA 4R84A 2VA9A 2ZDHA 1XPOA 1RVDA 1K75A 1Y8CA 2IYQA 3QU7A 3BL5A 3GJXC 4HTAA 1P1FA 1G1MA 3H42B 3PT5A 2ZBVA 3DMDA 3UJDA 2QBYA 1CFJA 3FWCA 5JH7A 1R6PA 1M2HA 3I5MA 4JFAA 1QS0A 4OUKX 5B6PA 1M5UA 5GQQC 3VPDA 5L6MB 5CDUA 3LGSA 1AKQA 4FDAA 2A33A 1NMYA 4LS3A 4QTYA 4JUCA 5CT4A 3GFGA 2QVXX 5IPFA 4A4CA 2QRKA 1Z06A 3DVQX 4P2GA 2OUKA 1LNQA 4CM7A 2C4UA 4A5OA 3IDOA 2NO7A 4JB8A 1HDCA 3P9PA 5GGYA 1MC5A 1XCJA 3EXAA 3HI4A 1SB9A 3IDSA 4DSZA 4CF6A 1A8HA 3R77A 3NTUA 3JV7A 1EG2A 2JPTA 3PALA 3WLFA 4E51A 4P58A 1NF3A 1RQ2A 2CHEA 4JMLA 3THWB 4JUAA 3BX1A 5HJ5A 5B1IA 3CLTC 3VO9A 4HQKA 3G2PA 4DB2A 2FEMA 4I6EA 5JD4A 1IJ6A 4OATA 1TM7E 1Y82A 3RVMA 2QN8A 1E3SA 2GJ8A 1ZIDA 1YQQA 3WSVA 3OIUA 3UOWA 2UYCA 3U4GA 2WUGA 2WIFA 2JCSA 3TNDA 4KPEC 4I9GA 4IIFA 5IBQA 5CIWA 1J99A 3SF8A 1XNRB 4RJLA 2B8TA 1KIAA 5UKDA 1P1HA 4JLOA 2CEKA 5KNBH 3IAUA 4EUNA 5CFRA 1SCIA 3MPOA 4CKBA 5FOUA 1T26A 4GYJA 4MV0A 1RBZA 4M54A 2Q27A 3QNWA 3WGZA 2FMFA 4LJRA 3AL0C 1KJYA 2WOJA 1XYYA 2DF8A 1V5GA 2KLDA 1MABB 3NEJA 5CVEA 3NEYA 3UKJA 3BMCA 1TZMA 1H2FA 3UB4A 3QNMA 1WRZA 1PWXA 1BDJA 1D3AA 4DQVA 1KDYA 3ORFA 3BL6A 2Q3MA 1RDFA 2HIGA 2QTVB 2B1GA 1C7FA 1GPKA 1UC4B 1Q7BA 3IB6A 4W7IA 2XCTB 5ELLA 1QTNA 2C57A 3G0IA 3HVKA 2NOAA 2K7CA 2ORYA 2OXFA 3MB8A 3MBOA 3UMSA 4V0OA 4S04A 5CFZA 3EIQA 1QP4A 3WXAA 2ATVA 1XZDA 5DIZA 1I6LA 2KAVA 1FJGB 3NXKA 3ROPA 2JATA 3UJ6A 3ZQ4A 1G6KA 1X80A 2Q4EA 5KTYA 2DHEA 1MX5A 2J9XB 3D2LA 3DE2X 3KR1A 2CF5A 1PWZA 2A92A 1IZ7A 4MUMA 5I8PA 4BZPA 3M5CA 1GQRA 1PQUA 2H1FA 2DTDA 2A3NA 4F4CA 1WZ2A 4IV0A 4PAWA 1JXQA 3B1KA 1ALWA 2O1EA 1DEKA 4M1ZA 2RGXA 4H7FA 5D6NA 4EG8A 3GJ7A 1X7YB 4TYWA 1SCDA 5DKFA 3QEAZ 2NYUA 1XEWY 2I99A 3QWHA 4WFQA 1E5TA 4QOJA 2LANA 3EK4A 3SJCA 1Z2CB 1YL6A 2XRZA 3A1CA 4E07A 1A2KC 1XCMA 4ZANA 1DTWB 3WDLA 1P31A 3LCMA 4KJZA 3UK7A 2VWGA 5KX5B 3VRNA 4IHKA 1FFAA 1LI7A 2GMWA 2AFIE 3TVDA 2R97A 5IULC 1NC1A 4RF4A 3OCVA 1ZAKA 3VZRA 4LWZA 4PHHA 2XNJA 1Z5WA 3IAM1 4NYIQ 4K9OA 2TSYB 1J2UA 2G4LA 4LF4B 1JDTA 3RC8A 2IDKA 3IQWA 4EPWA 4X0EA 3DDWA 1L1QA 5LU8A 5C8DA 3BQNB 3TRDA 3I5FC 3CZ0A 2AXQA 5I7UA 3AWIA 5BV8A 1H2ZA 3DTTA 1GKKA 2DFNA 3E84A 2IT1A 4PDZA 4ITVA 3VDXA 3FNIA 4G09A 4LZAA 4BNLA 1JUOA 3K2IA 2BISA 3PXXA 2PUCA 3ITNA 1HZZC 3PEUA 1PZNA 1TVMA 4J2HA 1G8YA 1P6UA 1J9GA 1PVBA 1OOGA 3ZZNA 3G1TA 2ZSDA 2WWVD 2HPHA 4C0HA 4X3OA 3DAPA 3DPIA 4ZDJA 1OLSB 2C2OA 5BSTA 1B15A 1F6DA 2BTEA 1E96A 3NP9A 3ZW9A 1O57A 4B3BA 1RWQA 3PPYA 2BFCB 5KYUB 2IH5A 4WDQA 4PCWA 5EZ6B 2WQ7A 4O2BB 5FDFA 3OX4A 3MRSA 2F1JA 3R3XA 1W76A 4U7PB 4DJAA 1EFDN 2C4NA 4IYRA 2JBWA 4H0CA 2QZJA 1NAIA 3TOCA 4WHMA 4DV0B 1CLEA 3QV1A 3DVSX 4IRXA 4TL9A 4CLHA 1KZ9A 1Y3AA 4P5EA 3VOAA 2AMVA 4LVNA 4QGFA 4NJOA 5DGCA 3I3SR 5J9FA 4RPLA 1XVLA 3H8VA 5HG0A 1G8JA 1K97A 5E4YA 3K09A 3LUHA 3BRWD 1U8YA 5A1JA 4D3XA 2C5LA 5AFPA 2DETA 4OHBA 1TYAE 2WJGA 1SIWA 3C85A 1GFZA 1J2JA 1FVFA 2IYZA 4EARA 5A4FS 5AK4A 3KB6A 5A4MS 1HETA 3K1YA 1BJFA 1HC7A 4LKOA 2ZFUA 2JWWA 1FI5A 1RFJA 2YW9A 4WKOA 1N9GB 3FDFA 2YZNA 2OC4A 2GZ2A 2FP4B 1H2AS 2OXCA 3RUFA 4DLTA 1QZZA 2EXXA 4GMXA 4YECA 1RQPA 2HHLA 3IVMA 4ZCSA 1QATA 1UBCA 1MNQA 5EKXA 4BCBA 3MBIA 4KGDA 2UXBB 2H48A 1WWKA 3SEAA 2AN1A 3RS8A 2MU1A 3CUKA 1A3CA 3D3QA 3SIXA 4FEAA 3DSRA 1V2HE 2GN2A 6NULA 1XA0A 4M55A 3VKUA 2L4HA 1J7KA 3PFKA 1Z5ZA 2REXB 2QRUA 1PFUA 3E7PA 1Z75A 3EOAI 2VQDA 4MI6A 4CIVA 3D7RA 3HS3A 1WF3A 4DIUA 4IIJA 4TV9B 4R9RA 2KFFA 2NADA 1XX6A 3LF1A 4POAA 1KMNA 1BU5A 2EJCA 1ADYA 3UMYA 2LVIA 2HJRA 4QTXA 5LBIA 4F2GA 4V03A 5BNTA 4YI8A 2ATEA 2GHTA 4GR4A 1KH2A 2GM9A 2ZSFA 4X95A 1J7PA 1LH0A 3NSOA 1BHSA 1G20B 3DLPX 4YQFA 3HUDA 3FPBA 4LN1A 1NE7A 1QIWA 3ZLVA 4RZSA 1U90A 3KKPA 2Q3CA 2P4UA 3OD1A 1SUPA 5CT8A 3V34A 2BM0A 3C3EA 2FCEA 2H0AA 4KDRA 1CUXA 3FUVA 4RPIA 5DYTA 4DMMA 2ZYRA 3ZHCA 3V46A 3MLEA 1G8MA 3KSAC 4OQPA 3PRKE 2O2HA 4P5PA 4REMA 4Q0MA 2H5IA 1W48A 5C8YA 4KQXA 3V80A 3N2YA 3NBMA 4KXQA 4MUBA 2XA9A 3HDJA 3OX2A 1CDEA 4IX1A 1VG8A 1S8AA 4E6EA 3KWLA 1ZJ6A 5TB5A 2ZUTA 4ZODA 5IUKC 2WKRA 5MFPA 1SWWA 1TKRA 1X19A 2APJA 1T1EA 1IBRA 3A05A 4MV1A 3DPSA 3G5LA 2HJGA 2Y0DA 1CR4A 3GEBA 3IHWA 1OH8A 4NDDA 1F9AA 1JLKA 2F6RA 2XUDA 3ESRA 2FFHA 4GZ3A 1Y7LA 1KMHA 2AFIA 2NYVA 4JMPA 4B4OA 4QX6A 3DVEA 5DDIP 4Q9NA 3ML1A 3DCJA 2QTTA 1E66A 2ZRJA 3D3JA 4E3ZA 3PSHA 4L73A 1K7CA 4BQRA 4P0PB 4NZOA 3IALA 2P9CA 4FR5A 1AUIB 5DTMA 1TI7A 1YZ3A 5F9HA 3B51X 1JF2A 2H1OA 3OIVA 2J7PD 1VM6A 1WAMA 4DMCA 3D0QA 3LY9A 2FV8A 2ZRBA 2ZN8A 4N3GA 1EK6A 3Q72A 4KQWA 3HVIA 4WPGA 4Q15A 4A4DA 3A4VA 5SYMA 3PXGA 4DR7B 2V6GA 1YMVA 1YKGA 3E9EA 5KYXA 3NONA 1KFJB 1P5JA 3EYWA 2GVZC 3RTAA 2YKGA 2JC2A 1PALA 3ICVA 5LSAA 1QGYA 5TNXA 4DXHA 4BNXA 3BG5A 2WLTA 3U3JA 3V1KA 1ZK2A 2CBLA 1FYXA 5AUNB 1JTFA 3W5HA 2OSBA 3IOEA 2VPZA 2D1YA 4ZKEA 1MRZA 4FXPA 3W3ZB 1L4FA 2W22A 4JJIA 4CKEA 4FR2A 4MUJA 1JH8A 3PJDA 2P4EA 2I2AA 1RYNA 5J5VA 4BJHB 3K2EA 4G0UA 4M2PA 4YAUA 1G60A 4TLCA 4BEVA 3WGJA 1DDGA 1NATA 3FUWA 4IL1A 3AEKA 5B4UA 2VZ8A 3HB7A 4GQBA 3PGMA 5EQFA 3GLIA 3AFMA 4JI0B 4G1EB 1OASA 3MTGA 4G23A 3PLFB 1EZZA 3LQ2A 1ZBDA 1NW6A 4IQ0A 2XNKA 3FFXA 1D07A 4WJKB 2PT6A 1QHHB 1KNQA 1FMLA 2IP4A 1QG4A 2B78A 2I8CA 2XNDD 3DVMA 4HD8A 4IJKA 1QSGA 3Q8XB 4O2RA 1MB9A 4PM4A 1CNEA 1BCSA 5GZ6A 5GVRA 4ISBA 1T8WA 4OV2A 1TAHA 1ZYUA 3FRJA 4DIFA 2IE8A 5FYQA 4A8JB 4PINA 2IQ5A 4EPTA 5IFKA 3L8EA 1F4VA 1FX0A 2H9AA 3WRXA 3GD5A 2EKDA 3I30X 4BE9A 4HX9A 2Z6UA 1QCDA 4NFSA 3LCJA 2Z8ZA 1XFXO 1KI8A 2AOXA 1L7QA 1ABBA 4BV3A 5D3MB 4FNMA 4GMDA 3UK6A 2PZLA 1O5TA 4OSEA 3F5QA 2WQ6A 3D8BA 3OSUA 3FOZA 1PGNA 1S9DA 3UAZA 4NZNA 4RD6A 3FCUB 1MENA 1XBTA 1ARZA 4QLAA 1FFHA 4P4GA 4WGFA 4DKXA 2YWEA 3KB2A 2HKIA 3QLVA 3WJAA 4KH0A 4LJ4A 1XTIA 2O1XA 3KETA 3LT1A 3MFYA 5HTOA 4OHFA 1QV7A 3G6KA 4QXQA 2V6FA 3K70C 3CWCA 1UBFA 4G5HA 3QFRA 1E0KA 1M6HA 4G0VA 1NNSA 2IU4A 5ITZB 4IRUB 2FUG6 2X9NA 5A06A 2GLUA 4EHKA 4QFMA 5EESA 1YB1A 4JOBA 1R0RE 3ZU2A 3B89A 2OLEA 5CVVA 1LSJA 5DGDA 4L3OA 5ICEA 3PBKA 3OSZA 4F04A 2WCEA 1A9TA 4B1FA 2IYWA 3EZXA 3HZOA 2WF6A 4ES6A 4I3GA 3TX6A 3VYVA 5D87A 4TXHA 1L5HA 1E9EA 2C7BA 3IHKA 1YI8A 1E5XA 4DMKA 1XZCA 4U8HA 5CX1B 1NI4A 4DJJA 5NLLA 3EODA 3ESZA 3ESXA 3N2GB 3N05A 4UFNA 1ZMZA 3TLMA 1UP5A 4HDRB 1CYDA 3NIFB 3C5HA 1HE8B 1FE8A 3F73A 3LPLA 1UBMS 1CLLA 2VUHB 1ZEMA 1QIFA 3CVXA 4BO7A 1WHSB 2H6EA 1K5PA 2AMFA 1A5SB 2ST1A 3DV2A 3F6BX 2ZTLA 4HJXA 1LC3A 5F7OA 1EXWA 1E5DA 4YAWA 4EB6A 1BKYA 3RYCB 1VL5A 1YBHA 3Q85A 3R9XB 2QZ9A 2QWXA 5AVZA 1LY1A 2WHXA 2NPOA 1QKJA 2GK6A 3I9MA 3GLGE 4XGNA 2H1HA 3WQBA 2UZIR 2QW8A 5CEJA 3M83A 4WSOA 1EEXB 3EPKA 3HLTA 2D0PB 3NGLA 1KI6B 1QFJA 4AJNA 2I4MA 5I2QA 4UOEA 1I13A 2X23A 4MRPA 1GA1A 3ND8A 4LV6A 2JBAA 2V59A 1MAAA 4NOJA 1KY3A 3RGGA 4PG4A 3UB2A 2IS2A 2C9BA 1XLWA 1SKQA 1T15A 5ALLA 2E4AA 1CW2B 1RTTA 3JQ9A 3RSGA 4RENA 3K1EA 4LMAA 3SXJA 5T6MA 2UV8A 1UPXA 4YS6A 2R6CA 1P1KA 2W2PA 1X2EA 4C6RA 3IUMA 5FXMA 4N9WA 1NPTO 4G8CA 2KE5A 4P4UA 2V65A 5EYPB 4MUXA 1CBUA 4MKRA 5A7FA 3AUTA 4O5AA 2YW2A 1FLDA 3DO6A 2H5LA 3F90A 1V11B 1Z6QA 3SR0A 4PO1A 2VP6A 2YNMC 3OKFA 3R9IA 1E6CA 3VKFA 5ARBA 4YAIA 3ZGLA 2FPPA 5B7GA 3OLWA 3INYA 4EJ6A 5LOVF 4C5AA 3GL9A 2FGKA 4JBXA 2MMGA 4G81A 4HNHA 4CIAA 1FP7A 2H07A 3IUNA 3GRVA 4NEHB 1GVNB 1NBEA 2QXYA 4KSCA 2BGWA 3PCXA 2FW9A 2YXEA 3K96A 1KEEB 5L4LA 3IJEB 3A9SA 3V5NA 1Z6YA 5BSHA 1T9ZA 4IFBA 5JAHA 2P6NA 2D7CA 3HFSA 2M7NA 1X13A 1TEVA 4LA4A 5KNCH 4MP6A 4NV0A 4PC7A 4OVNF 1SNLA 3UM9A 5J2UA 4B87A 1QGDA 2J32A 1EFAA 1FYDA 2H00A 1NT2A 5I47A 4W8HA 3PR1A 3IOBA 5ULLA 1SHUX 3RSHA 1OWNA 2PX2A 3PICA 3LD9A 3UICA 1EAMA 4TRRA 1TCOB 1S5PA 3BDVA 2L69A 4FN4A 5ALHA 4M0EA 4ARBA 1JZSA 1R0SA 1OC4A 1P2BA 4D4MA 1V8BA 1OZHA 2AF4C 1JH9A 1SCVA 1OGJA 4E1AA 3H8JA 3NTLA 4R9NA 3NVAA 2PS9A 1VSBA 1LU9A 2E37A 2IWRA 4QFBA 1GYPA 2YCBA 1D2GA 3MTEA 3LZCA 2BKVA 4DCCA 3TDZA 3FKJA 2PWBA 4PLZA 1B0AA 4XUEA 3TBFA 3E4CA 4KXFB 2F00A 5TMPA 1KMMA 4LXTA 4ZARA 4TXNA 1DBPA 2ZU6A 4OBXA 5HWSA 3WP1B 5B1YA 4Q1BA 2IV3A 5KDDA 4YHBA 3KALA 5BVHB 1ZIXA 2GJKA 1X3SA 2VXCA 5H1YA 1YMUA 1ZGHA 2CDAA 1VDZA 3COWA 3A3NA 4LY6A 2QDIA 1U7XA 1WM1A 5FKJA 4DR2B 3GUUA 2QDKA 1LLCA 2QAGC 2BSXA 1YGYA 2O7QA 3IR7A 4ZVOA 1C8BA 2BTOA 2WT4A 1M74A 2PS3A 4OHMA 5AD1A 1PJQA 3DLBA 1MBZA 3PT9A 4D5EA 4ZP1A 1FDTA 5HYDA 2PYIA 3HKCA 4IUDS 1VKRA 4F1JA 3B88A 4PO9A 4GO1A 4ZI7B 4HAWA 1ZUZA 2ONYA 1N5JA 4DNPA 1YR9A 2ZT6A 3FR7A 1DG1G 2I1WA 4JNCA 1B73A 1KZ4A 1VL8A 4JENA 4HWRA 2JCXA 1JG4A 2CT9A 5DH9A 1AK9A 4S1OA 4ZOLA 1CE8B 4QATA 4LECA 2PIAA 2DOKA 3D7LA 5EIAA 3GVPA 1O5OA 1FMJA 2ZAMA 1NLYA 3BM5A 1SHTX 3Q98A 4CEIB 1Q20A 3LNCA 4OAOA 3B20A 4P4SA 1J1IA 1HE3A 1E4EA 5KOJB 4O4LF 4QXAA 1PS8A 3AESB 3VRRA 1W1IA 1HDRA 1VPVA 2L0PA 2XTAA 2GCGA 2XX3A 2WWGA 1JQ5A 5FWYA 2ZYSA 5EGSA 3RU3A 4B3MB 2WCMA 4FX5A 1XI2A 1H6BA 2FN8A 2VSQA 1YQUA 2RGUA 2NO4A 3A3KA 3HVJA 4U2KA 2R79A 4FYPA 2YVUA 1YR2A 1K8QA 2GETA 1R4NB 5EAIA 3DOOA 3V3TA 2BMFA 2CFTA 2NU8A 1E2FA 1JMVA 3OY7A 1XP5A 1ETHA 1PNTA 5ES3A 3TPZA 3L4SO 2BTQB 1IUNA 4PLFA 1CYEA 5I51A 3L7KA 3BCHA 4BMXA 3Q3HA 4HZIA 3L6RA 2FQXA 4MHTA 5JISA 3BYZA 5KSYA 4JSTA 2ZS8A 1NRJB 1QPZA 1Y6WA 4RANA 4PAGA 3FS7A 3MK31 4QGSA 3WRYC 3RF6A 2GPWA 3H16A 3DP9A 3SKXA 1K3FA 2H3EA 3GN1A 5DNUA 2BRUC 1ZUD1 4MWEA 2XA1A 3MWEB 1HT9A 2UVQA 1M1UA 3LBFA 4I1VA 1U80A 1NNLA 3VYUB 1FF9A 2YCLA 4KO1S 4OMFG 3I1IA 4DR3B 3ZWXA 4LYDA 4AC9A 3NM6B 4L5JA 4QXRA 2HMUA 1QH9A 4GVXA 1G4UR 3M6FA 3GA5A 3IKTA 4PEVA 3SAJA 5DULA 4DDWA 1YC5A 2VATA 1JXMA 5SYNA 1X7WB 1NIWA 1IG0A 2V7GA 3AUXA 1K1EA 3O3CA 4CN9A 3KPJA 2MTBA 5A0VA 1Z25A 1RWPA 3PU6A 1G3IA 2P90A 1TO2E 1BGXT 5J2TF 1RXSA 1C29B 2A1IA 2RGBA 3WQQA 3H9QA 3DGFC 4BNWA 2B7LA 4RZUA 2H7VA 3WB2A 2EJTA 4GI5A 1RRCA 1MD9A 3PUXA 4C3ZA 1CUAA 1KI3A 1YQDA 2ZYAA 1TJYA 1CWUA 1K7EB 1A0OA 1A04A 3KHKA 2ZVJA 1GIAA 3GPDG 2V03A 2OLJA 1YFLA 2CJPA 4JYZA 2ARKA 2XDAA 4YUXA 5EI5A 3ZWNA 5G08A 2VF8A 2PQMA 4D9NA 4CTNA 4LBYA 3NEAA 3LSTA 3LP6A 3MT7A