4C0KA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one calcium ion (ca-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MITOCHONDRIAL RHO GTPASE
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0kA03
3F8TA 3SC3A 3U44A 1CLLA 2F1RA 3FPAA 4AG6A 4LV6A 4US2R 3K09C 1RC8A 2A9KA 4HDQB 1BMOA 2QENA 1CIPA 1IKUA 1BO6A 3DEFA 3PUWA 2JJ2A 2OBNA 2OXRA 3M1IA 4YGEB 3TUYB 1AK8A 3EWAA 5IT5A 4F7WA 1D9ZA 5K8IA 1JAHA 3R20A 3W34A 5HR5A 1WBBA 4LJ6A 4Q1CA 5FTJA 3VKGA 2QAGC 3K70C 3WRXC 5UKDA 5DE3A 1P5ZB 1BJFA 1FQKA 1QLKA 4YGDB 1H8ED 1KDTA 2QM8A 2R6GA 2ZTSA 4Q5IA 3SE0A 3TNFA 2OO7A 2I94A 3OP0A 3KPXA 1RYHA 4C3ZA 4A4DA 4PSAA 2W0SA 5CYPA 4BPBA 4M1SA 1KAOA 1Z6AA 5KSOA 3CW2A 1SHZA 2GEUA 4JZKA 4YI9A 1RE0A 3PR1A 5AJXA 5BN4A 3T12A 2ZXUA 2IK8A 2L2EA 4Q1EA 5TY0A 3P32A 2BOVA 2ZJOA 2EFGA 5EZ6B 4HLUC 3U5ZB 4TL8A 5DYGA 3SEAA 1COWA 3LFUA 3N70A 5BW8A 3TJZA 1AJEA 3BOWA 1G17A 1QIWA 2HXSA 2Q9BA 4DHEA 4ESHA 3CR7A 4N0EA 3AF2A 2XOKD 1JF0A 3UG6A 2QP4A 4GGFA 4MRNA 1NLYA 1QG4A 3B1XA 1KDOA 1N5IA 1SXJB 1HURA 4A0RA 4HAVA 1E9CA 5BQ5A 5IK2A 3VR5A 1VTKA 3K1JA 4IFEA 1MOZA 4Q1FA 2YNMA 1EGAA 1GNPA 3CNNA 3IO5A 4OL0A 2A7QA 4GPTA 5B2ZA 1VCOA 1VG1A 2CLDX 2OZEA 1FFHA 4B71A 5JLJA 4CRWB 2DPXA 4CEIA 3PUZA 4QGHA 1XTKA 4RSGA 5FBWB 1SQ5A 2JGNA 2JLSA 3D31A 4B44A 1ZUZA 1ZUHA 2ZRCA 3AKBA 621PA 2J7PA 2A78A 2M0RA 4CFRA 4RD1A 1JR3A 1DG3A 1OOJA 1GIAA 5C2JB 1LXFC 1Z47A 2E87A 1F55A 1NSTA 1E6CA 1DJWA 3BRWD 3PV0A 1S9HA 1A4PA 4BEBA 4TZ6A 1M8PA 1NYAA 1SL7A 3GLGB 4XVRA 1US8A 1E2JA 2MMCA 5KO2A 2JPTA 3WBJA 1GKUB 1NUBA 2C77A 3MAAC 4LYAA 3VMFA 4QKQA 5LDDC 3T1QA 4FMBB 5J4LA 4POAA 1KSMA 1Q1ZA 5JJGA 4DKXA 4LGMA 5DNYB 2LLUA 4NDZA 1E9FA 4HDOB 1JBKA 2O0KA 1G19A 2D62A 2XITA 4D0NA 1Y1XA 3FGNA 2KSPA 2FWRA 3SJBA 3PUVA 2IYVA 2FJUB 3UK6A 4C0KA 3MFYA 3QVVA 2J7KA 1XTJA 2BDTA 4NDBA 1PLLA 4Q00A 2F2OA 1B7TZ 1CDLA 1DBSA 1KSGA 1R4AA 1U8AA 2F55A 2KI6D 3T15A 1E2NA 1MH1A 2BIFA 4DLXA 4F4JA 2BM0A 1YR7A 3FWYA 1UEIA 1GNQA 5BYKA 4E5UA 2YV5A 3RC3A 2FDCA 3B60A 1PV4A 4D26A 1F2TA 1SY9A 4OR9B 2XSZD 3Q5DA 4M9ZA 2BCGY 5AEQA 4ZDIA 2JT8A 4PX9A 2IYSA 4EJSB 3KL4A 1TQ6A 1T8UA 1IN4A 1JJVA 4P4UA 5G40A 1XTQA 4TQ9A 3I92A 1TNXA 2CHGA 1WB9A 3TR5A 2XNSA 3SR0A 2QAGB 3KKNA 3I5XA 4OI2A 1CS4C 1RJ9A 3FB4A 1G8GA 4LPKA 1E2FA 2COLB 2F33A 4O25A 4MRYA 2ZUDA 4YRUA 1CFDA 2JTTA 2K7CA 2L51A 2FGKA 2FNAA 4Q02A 2WIBA 1FUKA 1HH4A 1OLOA 1FUUA 2H2KA 1Y1AA 3SFVA 4KU4A 4D4MA 1N3BA 4D80A 4LBZA 1LA3A 1N6KA 2ZJ2A 4M9SA 3BXKA 1S3SA 2WNDA 4RZXA 2YC4C 4B3XA 2F9MA 4JS0A 1GJYA 1NJGA 1QASA 2G6BA 2HCBA 2ZRPA 4GZLA 3ZQJA 3W3AA 1WCV1 3NHAA 4MGZR 4XWKA 3PM8A 2N46A 4IKEA 4AIIA 1OE0A 1YR9A 4KFUA 3HR8A 1CF4A 4PC3A 3TAHA 5JRJA 2WWIA 1DT7B 5AWFC 1T3HA 3AF1A 4XTCS 3ZWHA 2Q91A 4MKHA 3WNCA 4I1OA 4C0SA 4LHYA 2XZOA 3GEIA 2JA1A 4G1UC 4PPNA 1JSAA 2G0NA 2OESA 1NY6A 1GZSA 2G0TA 3QKTA 1AZSC 5DLQC 2MLEC 4RFVA 4P4TA 2FN4A 5SZKB 3QE0A 4NQGA 1KTVA 1XJCA 2JAQA 1IG5A 3VR6A 2GKSA 1S96A 2C03A 1UBCA 2CBZA 3T06B 2C96A 2AN9A 2WJIA 2LM5A 4C0QC 5J4HA 4PHHA 5CLQA 1NN5A 5JCZA 1RIFA 4MKFA 4HAYA 4ARZB 5JS8A 1G3RA 4AKIA 4GP7A 2WWXA 4URYR 1JQJC 1S1EA 2NG1A 4CT5A 2WORA 4MRSA 1S8FA 2Q6TA 4D82A 1H8EA 1KJYA 2NXQA 2DFKB 4LY6A 3CRVA 2CEAA 3P20A 1ZMZA 4NTZA 2EVWX 2JLVA 2LHLA 2VHJA 4CEJA 3QJYA 3LWNA 1UWOA 3CH4B 1ALWA 3FMFA 4JLPA 3T34A 3L0IB 3OEHD 3R9XA 3VNVA 2JQ6A 5EP1A 1TADA 2V1XA 5DYIA 4Z51A 4MRXA 3IGFA 3NC0C 2K5UA 1EFRD 3A6PC 2REXB 3D3QA 3GJ0A 2K2AA 4Q1AA 3TS5B 3O8DA 2Z5FA 4QJ5B 3U7FB 3QOFA 3BS4A 4F4CA 1YVHA 1DF0B 1S5GY 1TRFA 1VYUA 3AAJA 4QFMA 2PT7A 3AVQA 3U44B 2WIAA 1CR1A 4OCIA 1ZM3A 2XOKA 3K0AA 4ZCIA 4C2TA 5FI1B 3FE2A 1XXHA 1PUIA 1B7TY 1CKEA 2CK3D 2GBLA 3RS4A 3ZZUA 2HQ8A 2Q9AA 1L2TA 3CX6A 2GK7A 4TTRA 1K9UA 4ZDWA 1EWQA 3RABA 2IF2A 2IEZA 3T1OA 4WIAA 5EUMA 1E96A 1WRBA 1ZCAA 3SYLA 3W6NA 2Y1MA 1OXUA 5KDDA 2FX3A 1EXRA 4YMTA 2P5SA 4OI4A 1G8PA 4U5XA 4YBHB 2Q9CA 5J4VA 2HYDA 5J47A 3K21A 1P61B 3KQKA 3I61A 2TN4A 2D7CA 2PCJA 2BBTA 1OW3B 4JJKA 4BZPA 1Z0DA 1B8CA 5JOLA 1G5RA 4YXWD 1HQCA 1IWQA 2Z83A 4NYIQ 2XGJA 2EGDA 1DADA 2ZIAA 4URZR 4OHXA 3AVYA 4IDQA 2PBRA 1VG8A 4YC7A 5L3SA 2GAAA 1FP6A 2NIPA 1I2DA 1OIVA 1LW7A 1W48A 2QEQA 2R62A 3PFIA 4JYBA 3CF2A 1OZSA 1UBFA 1OQPA 4FWIB 4OHYA 1E1RD 4TQUS 1KK8B 3P4YA 5BXQC 4URXR 1Z0AA 2NPFA 1G8IA 2ZRIA 4USLA 1N5KA 1XWIA 4PO9A 1NX0A 1GKYA 1Q1QA 2V6JA 2ZI4A 3CR8A 1M6NA 1E79A 3LK0A 3KO0A 4ZI2A 5L8VA 1XB2A 2FPLA 3AQ4A 3BOWB 1Z06A 3VRRA 3BFVA 4Q47A 3WXMA 3A58B 4GOJA 4RD4A 4DWJA 3AKCA 1DJYA 3WY9A 2JU0A 3H86A 5EE5B 1SKYB 4IVQA 2HJGA 3BK7A 4B76A 1YRUB 4HZIA 3AGPA 4ZKEA 5CK4A 1IXSB 2E6WA 1NP8A 1ZU5A 2WPDD 4A4BA 1WXQA 2GJ9A 1NIPA 2EFEB 1TF7A 2FSFA 5BYJA 5CB6A 1OYYA 3A1UA 3C14C 1A2XA 4IDHA 1ZNZA 2IX3A 1NCZA 2OS8C 2VP9A 1SL8A 3IUYA 1BU3A 2XXAA 3CM0A 2XNDA 4A6PA 1Q57A 5J4KA 2PT5A 2Y4QA 1IXRC 2W2XA 3IEVA 1JFJA 1G3QA 2Z6VA 2WC8A 1GKIA 2ZJ5A 3JVUA 3C5CA 3VR4A 2KWIA 2R2AA 3P27A 1UAAA 2M29A 2VRWA 1A29A 2NO9A 2VQSA 2OXCA 5AJYA 5HCIA 5HZHA 1NX1A 4CDGA 3VR3A 3EZ7A 3VNUA 2L0PA 2HF9A 1NN1A 3E70C 4MA4A 3ZIAD 1NIWA 5F2EA 2WJVA 2I1VB 1S1CA 1B9AA 5KNDA 2CE7A 4KV9A 4P0TA 3ZQ6A 5JWRA 2KBFA 2AXNA 1US8B 4PTLA 2GZAA 1UADA 2QAJA 5HKWA 3LXXA 4D25A 3EWSA 2RGAA 2ZRMA 1XEFA 3FMOB 4ILEA 4E22A 3GK2A 1RVDA 3MGCA 3NHBA 1OH6A 1Y3AA 1XA5A 4DEXA 2K7OA 2FFBA 1P3JA 1W4BA 3HU3A 4BRUA 1N6PA 5G3ZA 1OMRA 2XTZA 4YDHB 4DLYA 3LRPA 3EASA 2CHQA 4WZAE 4DB2A 2LKCA 3NTUA 3QPWA 1IJEA 1HY3A 1NKTA 3TUJC 3I3SR 2KNEA 2ZI3A 4JL8A 3KF9A 5H8WA 4PHKA 3O8CA 3ADDA 3Q85A 3D7MA 1RW4A 2IHBA 1DTSA 1G5TA 4UNRA 4XJKA 1QV0A 2ZRFA 1CR0A 4IOKA 4OVNF 2BL0B 3DVMA 4OK5A 1WLZA 1D9XA 3Q7PA 4LHVA 1ZC4A 4M1OA 4UXIA 2CCGA 1MRSA 1MO5A 2VLIA 3BB1A 1YVLA 4QM6A 1E9BA 4PANA 2ATXA 1F2TB 4L9SA 4YMVA 4LV8B 1NBMD 1JPJA 3EXAA 4O2LA 2VP5A 2ZYUX 2JULA 4ZDJA 4GOXA 3T1TA 2ZRGA 4LK2A 1M7HA 1G20E 4I5LB 3D10A 1J7OA 2V7QD 3MJRA 1TEXA 1XEWY 2M3WA 5CDFA 2B92A 1HT1E 2CJWA 2JTZA 1G21E 3AKAA 3I5GB 4WRIA 3UWKA 1RJ9B 2AXPA 2WOOA 4PFSA 4L9MA 1VG9B 2OEPA 1Y6WA 1KOFA 3KUCA 1DAEA 3CPHA 1O3YA 4F0ZB 1E2LA 4JWQA 4PDZA 2HPSA 3JTDB 1D2NA 1SVLA 4FMCF 4PR0A 4RCZA 3WBKA 4B74A 2GF0A 4M1TA 4NU0A 1FL9A 1XK4A 2RCNA 4HLCA 5A4JA 3B1WA 3L8ZA 2OLJA 2FPMA 2GVZC 4LSGA 1AP4A 4M1MA 2JXLA 2R6DA 4B43A 1AQUA 3OEHA 2PMKA 2J41A 4TT3D 1KO4A 5JJIA 2E30A 1HE1C 2Q3HA 2V55B 3MWKA 1RRPA 3ASZA 4NYJQ 1Z0IA 3BIFA 4Q4JA 4NCHA 1J90A 4WAUA 4CPVA 1QHXA 3TSOA 1XBTA 3TQFA 4CT4B 2NZ8A 2JWWA 4HSEA 3PEWA 1EFRA 2ZRHA 4PHMA 4M53A 2IC5A 4PO8A 3EW9A 2ATVA 4YONB 4QRHA 2KAYA 1XF9A 5D69A 4B3DA 1E2MA 4DIRA 4BFXA 4BFUA 4LWZA 5JMTA 1G33A 1CNPA 1W36D 3AKDA 1QDEA 5EE3A 4BASA 1FI5A 1X8KA 3WHTB 2KAXA 2LV7A 1OFTA 1X3SA 5KSZA 1B47A 1W4RA 2B7BA 3AF3A 2OT3B 4I5NB 1QX7A 4D1EA 2FZ4A 4US1R 3ZD6A 2UVQA 5TVKA 1AHRA 1TEVA 3BC1A 4PQYA 4MRRA 5H68A 3TRFA 4YGBB 3DO6A 3WP0A 3FWBA 1DVIA 4PHNA 4IJMA 421PA 1IOZA 2QGZA 2O8BA 4MN0A 1E4YA 2KOTA 4GP6A 3DOFA 2EFHB 4AG5A 1RK9A 1SL9A 1KI4A 4KITB 2H8KA 3PXGA 4WQ3A 1UDXA 1XFAA 2ZRDA 4KLZA 3SBEA 4CEJB 5JJLA 1TNQA 1NN3A 5C4MA 1OJLA 1VDZA 1NG9A 4HLDA 1QRAA 2C99A 2XJ4A 1G16A 4Q48A 1VIYA 3C15C 1PSBA 3NSKA 1T0JB 3NC1C 5E95A 1F54A 1E1RA 3W5IA 3QKRA 1M7GA 1ZCBA 4MVFA 2IF0A 2ZR7A 2B6HA 4TLEA 3VKWA 4QM7A 4JT2A 1CLBA 3CWQA 4XH9B 2OM2A 2ZSFA 4PO1A 4E07A 4G3XA 2LANA 1L2OC 2VHCA 3B8HA 4Q7KA 3W8RA 3GJ5A 2YWEA 1CP2A 3MSXA 3DD4A 1XFYO 2BCBA 4W5JA 3GEHA 3K0AB 2RB4A 1PVOA 2WCFA 1VMAA 2PL3A 2WV9A 5DISB 3BFKA 1Z2CA 1XXHB 2AFHE 2BEJA 2IYYA 2WPDA 2Y8EA 1UKYA 1PK0D 1OYWA 1GWNA 3LLUA 2A3RA 3AUXA 1IXZA 1N0UA 1K94A 2WMOB 4Q1BA 5E4FA 3GFOA 2DFTA 2YZ2A 3CS1A 3T61A 1NCXA 1CTQA 5ELXA 3DVKA 4RD0A 3OE7A 1ZRHA 2LP2A 4XSHA 1C4OA 2VF7A 1J8YF 4JBWA 2D2EA 2H61A 3I72A 4QGGA 3MJHA 2K0JA 4QBFA 4DSUA 3EPHA 3KB2A 4AKEA 1NN0A 2QPAA 5L3SB 1J7PA 4Y0VA 5I2LA 1RFLA 2HLDD 3BJIC 3GLHE 3W6PA 3JZMA 4C4PA 3RLZA 4ZDKA 4TMWA 4C7OA 2WJGA 3ZIAA 1LF0A 4DUGD 1NVVQ 1HT2E 3K0CA 4MZLA 1KMHA 1W47A 1XDBA 1XD2A 2GGMA 3D0YA 1X1SA 2Q3MA 3ONWA 4BY5A 3BYAA 2YOHA 2WVJA 4ACAA 3D6TB 4QG7A 3RYTC 4DLSA 4FW9A 3CR5X 2W6ID 1KK0A 3EPJA 3OEEA 3EZ2A 3OIUA 4L4UA 3SN6A 5F6TA 4XVUA 5KTYA 2P2LA 3KKPA 1YR8A 2ZJYA 2QTFA 1ZIOA 4DLWA 221PA 3PUYA 4JLMA 4B3FX 3AGQA 4ZV4A 1T6NA 1SXJC 2ZETA 2WZQA 1DEKA 3TDZA 3I4LA 2AX4A 1QIVA 2C9YA 1SR6C 2MSEB 1P60A 3SIBA 1BOFA 2VP2A 1UHIA 3HCMA 3ZZ0A 4U7DA 2XB4A 3PEYA 4K46A 1OXXK 5FTKA 1DAHA 5AUOB 3DVEA 1SK6D 4UNQA 1YZGA 1QZXA 2L50A 2KHNA 1KFUS 1NNEA 4TYQA 1CLMA 1K2HA 1TTXA 2DR3A 1J1EA 4MUBA 5EP4A 2GXSA 1JBAA 3N2IA 4UNSA 1TQ2A 3EK8A 1M1YE 1IY1A 1XFUO 1G7SA 3CR2A 1KK1A 5J3XA 3NXSA 4ON9A 2WWFA 2KAVA 3VROA 3SIAA 2WKPA 2PRUA 4MYUA 2GGZA 1NBME 2D7DA 2ZRTA 4CLNA 3S1AA 4IXNA 4AK9A 4OI1A 2V7QA 2ERYA 1E99A 4H1VA 2Q4UA 4B2LA 4DLZA 4GBAA 3WNDA 2CXXA 1XTIA 5L3VA 1FX0A 1LVGA 2ZRNA 4XWOA 4B3GA 1JQLB 5CSNA 3DMNA 4X8HA 3H0KA 1F4OA 3HU1A 1Q12A 3U6BA 1DAMA 1VECA 2CDNA 1JAIA 1NIJA 1N5LA 1ZD9A 1E2PA 3FIAA 3PFVA 4UNNA 2MA2A 3RSOA 4DT1A 4EIWA 2GJ8A 2WICA 4Q9HA 2MRDA 1A82A 2J0QA 3QBTA 2H17A 1T4GA 4QNRA 4V0KA 3NKVA 1R2QA 4TWZA 5KDOA 3HYTA 1KJWA 1J2JA 3TKLA 3TZ1A 4XJKB 4TT3A 4LYJA 1P9WA 1Z6TA 1F8HA 4GOKA 5DN6A 2RGXA 2C5LA 3VGOA 4LZZA 2HQWA 1S1MA 3UIEA 3JVVA 2KBEA 3QG1A 4DCVA 2D06A 1XTRA 4A6XA 1CFPA 2GJSA 2KBIA 2QSZA 1UBEA 4KBGA 2F7SA 1MF8B 5KOYA 3ASYA 3EARA 2QN6A 3T5DA 3WYAA 2HJVA 4AKHA 721PA 3WXAA 3PVSA 2H61C 4X8OA 4EJSC 3F45A 1HQVA 4M2QA 1ZNXA 3B1YA 1YZUA 2ZSEA 2O5VA 2JOJA 4NYJR 4Q18A 2A5YB 1R5BA 2CJWB 2WM9B 1Q0UA 1ZIPA 3OX5A 2HUPA 3C1VA 2CL0X 2FSGA 3DZ8A 1W0KD 2FSIA 2B8TA 3VX3A 1GSIA 4W5WA 1UFQA 4LV5B 4TN1A 3K0CC 3CRMA 2ECKA 2EWVA 2Q3FA 1CDPA 4QBHA 1T5IA 3SS8A 1IN7A 4NYMR 2V54A 1N6OA 1X6VA 3M0EA 4PSKA 4XOIA 4Y0AA 3TUIC 2YJTD 2ZRBA 4XWAA 4HYYA 3BFXA 4KLNA 4AC9A 3O2PA 4LJ9A 3C5HA 2JJ8A 4C2UA 4QGAA 3D8BA 1TOPA 5JZVA 2RGDA 2W6JD 2ORVA 2OFWA 3AP1A 4PE4A 2VA8A 1G6OA 2X2FA 2JJ1D 5FOTA 4F93B 1ZYUA 3K0FA 4KSCA 3LVQE 4I1VA 5FOVA 2A5JA 1XP8A 3A8TA 2R8RA 4Q4JB 3X1XA 1IJ6A 2M1UA 1E9AA 1T8TA 1XPRA 2TMKA 2ZE7A 4LJYA 4WXRA 4KAXA 1FMJA 1QV1A 2VYFA 3CONA 3F5FA 1QJTA 3IHWA 2OCAA 3QEOA 5KNBA 2L98A 1H4BA 5CM9C 3IIMA 2PZEA 2HF5A 2ZAMA 1QVIY 1SR6B 4MRPA 3QNUA 4JLAA 4PC7A 4D4JA 4PC1A 1E0SA 4F91B 3EK4A 4PPQA 4FCTA 1FTNA 1QHHA 2F3RA 2G77B 4UNPA 1TIZA 3KEVA 3ZDQA 2ODWA 3RNLA 1QX5B 4DBLC 1MR3F 1XYDA 5ANRB 4RZ2A 1CMGA 1UJ2A 3NEJA 3EVRA 1NVXQ 1U90A 3OFND 3DDCA 4UKDA 4UPGA 5FPHA 3RRNA 3F0TA 4KFRA 4CEHA 3GJ7A 2O8BB 1KI9A 2F43A 4GSYA 4ZCLA 1ZM2A 4S2EA 1M31A 4ZCMA 5JS7A 4DEYA 2GVDC 1EH2A 3CH5A 3LD9A 5TV2A 1CJMA 4J0QA 1WLMA 4TMXA 5KU1A 4HZUB 4FMDB 1RROA 2ZI7A 1G4UR 1Z6XA 4P31A 3IILA 1U0HC 4RKFA 5AR1A 2HLDA 5J4YA 4HRHA 2ZANA 5DHFA 2ZI9A 4V0NA 2OBLA 3JZAA 1FNNA 1U81A 3RWOA 4MGIR 1LVCD 1MV5A 3GK4X 3QKRB 4R2IA 3WMEA 3SBDA 4DUGA 1FW4A 3IQXA 1OXSC 1U0JA 4BE7B 3IHLA 1E2GA 2JXCA 3W6OA 1R10A 1SVMA 2FOTA 1LV7A 5B57C 1T91A 1F4QA 3TS5C 1W2GA 2W00A 3PUXA 4KYIB 4PPGA 4BEJA 1U5IA 4AOMA 1DG1G 4HLQB 2XTMA 2O0JA 5E3HA 1GDDA 2RHDA 2Z4SA 4YGAA 3JVTC 1D6JA 1B8RA 4OI0A 1TNPA 2DOQA 3R9WA 4HSZA 1AS3A 1X8LA 3MLEA 3VFDA 1F2UA 2JCSA 1CJTC 2OLKA 3B85A 3A1WA 2O8EA 5LD2B 4N5XA 5AUNB 1CMFA 1J99A 1E0KA 5HPYB 1G7TA 4HUQA 1CU1A 5TB5A 2CXJA 3PALA 2FEOA 1Z3IX 3EX7C 1TF2A 1K5GA 1OKKD 1XD8A 2FH5B 3QSYA 1XZPA 2E1RA 1NMYA 2BJVA 1QLSA 1UPTA 3WNBA 2GJAA 2QE7A 1ZD8A 5JECA 2NO0A 4RJLA 3X2SA 2ERXA 5BWMA 2IA5A 4JJZA 2XEXA 2MHHA 4G5RA 1E2KA 2ZU6A 2IS9A 4C7OB 1N0YA 1KMHB 1KK8C 5EP2A 1XD2B 4DLRA 5FPSA 1M39A 1IJFA 3D0YB 1UKVY 2FFQA 3KZ1E 1YURA 2AL7A 3QKSA 2WJJA 4G5GA 5GADl 4DUQA 2KFGA 4TSFD 3LX5A 3AM1A 4A92A 2GESA 1K5DA 2M1KB 2HCJB 3HPRA 2A5FA 1W4AA 3WP1B 4LBVA 3CX8A 3ZLJA 2ZFDA 1NX2A 2VSOA 1T5LA 4U02A 4LJ4A 2V53A 4DSTA 1FTSA 2WAXA 1KCYA 2WAYA 4D4KA 1CM4A 1S2MA 2KE5A 2QT0A 2WWHA 4GGFC 3I5YA 2NZ0A 2F9LA 5FBVB 3C8UA 2I18A 5LPNA 3UPUA 1RRCA 3CRW1 3THYA 2IS6A 2EW1A 4JQ0D 1AUIB 1DJZA 1BR1B 1HV8A 1GM5A 2RGNA 4Q19A 3GOFA 1N6HA 1NVUQ 3X1ZA 1YJ5A 2ODEA 3EZFA 1M46A 1E94E 1DAGA 4DB4A 1E2HA 1V1GA 1M45A 2NZJA 1L4UA 2FSHA 2XTNA 3NBFA 4IVRA 4B3BA 821PA 1AJ4A 5CSJA 4NBSA 3CUEF 4LUCA 2OHFA 1GAJA 3WMFA 1AIPA 1YHNA 1E2EA 3TLXA 3IQQA 2X77A 2BMDA 2Z4RA 1V43A 1G7CA 1N6IA 1G4AE 2FOLA 3R7WA 3CTNA 3IIJA 2I2RE 1YUUA 3GLFE 3S1AB 4HUTA 5HKZA 1OT3A 1UDWA 3DL0A 4OQFA 1ESMA 3I8XA 3TAUA 1F6BA 3LV8A 5KSPA 1ESNA 1FNMA 1OFUX 1FX0B 5FOUA 1DAIA 1XJQA 2PJZA 1V1FA 2OE2A 5D3MA 3SG7A 3B1ZA 2E9SA 1SZPA 2BBNA 2HDNB 3PEVA 4OQNA 2PZFA 1CRQA 3RVBA 1YZTA 2BC9A 3DVJA 3TR0A 5CJPA 3DMDA 1WY9A 3AVTA 2QRZA 4R71A 1IY0A 2GA8A 3C4JA 4DT1B 5AJVB 1K93D 4NCJA 3IQOA 2ZRAA 1QXPA 1UUSA 1W49A 1YR6A 2FFAA 3W90A 2EHBA 3AVXA 2QPTA 3LLEA 3OB1B 2W6JA 3OESA 3QBVA 5GQQC 1JB1A 2CL7X 4IXMA 4WBSA 2B21A 1EG3A 3PITA 4CVNA 3I5FB 4PHFA 2O8CA 4AY2A 2N1BA 1JNYA 3ECCA 1TUIA 3MUFA 2BL0C 2ZN8A 1OIXA 1Z5ZA 1LS6A 5J40A 3U3OA 2NCOA 3GLIE 1E3MA 1U9IA 5B64A 1EXMA 3AH8A 4R2HA 1TCFA 2P5TB 1SULA 1CJVC 2MBXA 1LKJA 1TN4A 1G6HA 1OE9B 1PSRA 3JVTB 1Z2AA 4H1UA 6Q21A 2JNXA 3KFXA 4M1KA 2KGRA 5CM8B 2WHXA 5HCNA 1W36B 3LBNA 2BCXA 3M0WA 3VX4A 3EZ9A 1XPUA 4AI6A 2YOGA 3GEEA 4MQBA 1U2RA 4WOPA 2IUUA 2BM1A 2DY1A 2BVNA 3O4YA 4RY2A 5FH9A 2WTUA 2ZVPX 3I5GC 4DZZA 3OFNA 3MSEB 2BMEA 3KXLA 2ZJBA 1SVOA 2LVIA 1Z07A 1PVBA 4EPXA 2LVVA 2WSSD 1KK7Z 3RRYA 1IQPA 2REBA 2J0VA 1DGVA 3JTDC 4IL1A 1NG1A 3EA0A 4M21A 5K8TA 2O8DA 2F1JA 3BH7A 1RKBA 3NDBB 1JXMA 4RVCA 1P9NA 3AVVA 1SCVA 1WMSA 5E7IA 1ZINA 1KDPA 1E2IA 1EK0A 4LOAA 3BUXB 3EAQA 4FWTA 3VQTA 3K0FB 2WWWA 3QVUA 3QXSA 3EVVA 2JIZD 3CZTX 4LC0A 4GT1A 1D1OA 4P32A 4EPVA 1AQYA 3O8RA 4RCYA 4TZ0A 4A9AA 2IYRA 3FKQA 4IOMA 4NKRA 2M97A 3K9GA 3QG5A 1KKLA 2ZPTX 4JL6A 2C9OA 5CPVA 3FMPB 3WRYC 5LB2A 2GDJA 1XTSA 2GCPA 5FTMA 4B73A 1P62B 1EFUA 1YX7A 4CGZA 4C9BA 2MSCB 3DHWC 1TAGA 1JUOA 1FMLA 3I1FA 3LQQA 2KYCA 3WHUB 5GVRA 2ZREA 2IT1A 4OK6A 3TK1A 3V00A 3EPLA 1K90D 1EWRA 1BH2A 4JYCA 3KQNA 1QHHB 1BIFA 3FTQA 1EESA 1R8QA 2GK6A 1Z22A 1VPLA 4BUJA 4YMWA 4OKHA 1AA9A 2AD5A 1RTP1 1D2MA 1KGDA 4NPHA 5ER4X 2VSFA 4CEHB 5DKNA 1KZGB 4CEIB 4C0AC 1BR4B 5FPYA 3CRRA 2F43B 2XSZA 3A4LA 1TQDA 3CB4A 5DI3A 2G9BA 1XFXO 2ZUBA 4G5OA 3GD7A 4KI0A 3LL8B 2ZE8A 4P4SA 4AURA 4EUNA 1UHNA 2FCEA 1OKKA 2QQEA 4MUAA 4Q03A 2P6RA 2BBMA 4GFDA 3QENA 3ZH9B 5FL7D 2VHTA 3I8SA 4U00A 1W5SA 2K7DA 4P33A 5CITA 3RM1A 3C41J 1P2UA 2LLTA 1B8LA 3B2EA 4V02A 3DKPA 2QMUA 2ZKMX 1A75A 3RS5A 1I2MA 3VRPA 4MZKA 5KUTA 3G5UA 1DO2A 1QATA 4TSFA 1YX8A 2PSRA 2LUCA 2BKIB 3KHEA 2ZRLA 2CMKA 2ORIA 3IBYA 1UHKA 2P3SA 4BGDA 3U3RA 4Q7MB 1BF5A 3NH9A 3K70D 1U9IC 1U5IB 3SU8A 2RKOA 4RD6A 4DLTA 1W5TA 2QT1A 2WJYA 1SKQA 2F3TA 2FEMA 5G3YA 4EDHA 2HYIC 2LKDA 4OHZA 1BMFD 1GQMA 1NMZA 1UEJA 2HT6A 1SVKA 1ZUNB 2GBLC 2X1VA 1SCMC 1D8TA 1K6MA 1HTWA 5FR1A 1XU4A 4URVR 1JEEA 1F2UB 1PLKA 1CDMA 1K9KA 3EA5A 3PG5A 4WVFA 5EP3A 2O8EB 3PIRA 4EQ6A 3ICBA 1G7RA 4I1SA 4TMKA 4DDUA 4HUQB 1NP6A 4M1YA 5JI3E 4XVQA 5E7MA 5LB4A 5CB8A 1IH0A 5FFMA 3KKOA 3AP2A 1AK2A 2ZE5A 2WWYA 1IQ5A 2IWRA 1CFCA 2GAOA 3PQCA 3RANA 1CXZA 2J9RA 1VYVA 3TW4A 2UZ3A 2WKRA 5CK5A 4QXAA 1TL7C 4U8DA 4PAOA 3VKHA 4DCUA 1Y63A 2IXFA 2OCBA 4A36A 4V0MA 1S6JA 1YZKA 5JCPA 1E9EA 1JI0A 1ONBA 2LCFA 5TXGA 1KNQA 1ZFSA 5HLVA 1M7BA 3H4MA 2GCOA 4V0ME 4Z54A 5I2QA 3OHMA 4B75A 5TNCA 2L4HA 1S0UA 2B7CA 2YHSA 3HPQA 3QKSB 4LRWA 4AD8A 3HR7A 5SZHB 2BKUA 5JSZA 2PCLA 2UZIR 3KJIA 1Q80A 4IFBA 1ZM9A 2CL6X 2GJKA 1YRBA 4M2LA 3IBGA 4YGCB 3RHFA 1G8FA 3K9NA 4A2PA 5HKKD 2FZLA 2JLWA 1D5CA 1RWYA 1K8RA 3ADKA 2CCJA 121PA 1DELA 2P6NA 3THYB 2BE4A 1GRRA 4PC2A 2LLSA 3K8YA 1KI1A 1SKTA 2J1LA 2P65A 3VHXA 2JLQA 2ZE6A 2J0SA 1S3GA 2ZS9A 1GG2A 4OJQA 1E2QA 5DI9A 2IWHA 2EWWA 5H70A 3SJSA 3CF0A 1VIAA 3KFVA 4O3MA 2KI6C 3CF6R 1Y0VH 4ITRC 2ZJZA 4M9QA 1SMGA 3WNXB 1SVSA 2IYUA 1R0XA 2G2BA 5EXXA 2ZSDA 1KI7A 3GJXC 2GZDA 4IHQA 1VCIA 4WZ6A 4B2IA 1TCOB 4NZYA 3H2YA 1Z8FA 3KQLA 4YMSA 1KQMC 4M8NE 5KNCA 1OH8A 2CK3A 5EJEA 3TE6A 4B3CA 1Y1UA 3R7WB 1OV4A 3PCRB 2ZJ8A 1E2DA 4LJAA 1VCMA 2VH5R 4A8JA 4I5JA 1NSFA 2QNRA 4D0LB 1JR6A 3SG3A 3QF4A 1EG4A 2MJWB 4TNCA 4Q7JB 4B35A 3KXKA 5JEEA 1XVJA 5PALA 2W0MA 4L16A 1MR8A 1SW8A 4QOSA 1W46A 4TMTA 2G1KA 3C7KA 2KGBC 4HDCA 3K53A 1QTXA 5D3MB 4PZZA 1P9RA 1KO1A 1ZJ6A 4MLWA 1S9DA 2IXEA 3NSIA 1TPZA 4LBWA 4YXWA 3CNOA 4LYFA 4V03A 2I1QA 2VRGA 2WSSA 1SXJE 4GPLB 1K9PA 5HZKA 4AYTA 2CNPA 1OSAA 5FTLA 4ZO4A 1P2VA 4Q1DA 3N5CA 3GP8A 2MSDB 1CM1A 2CLCX 4IVPA 1P7CA 4P2YB 3ZNIA 1ZUIA 2NO1A 5KDLA 1PRWA 2AD1A 2QU8A 3NDPA 3O6BA 1OFIA 2F3ZA 1RYFA 4EFNA 3SOPA 3AF0A 5CIQA 3V4RA 2C8VA 2LWIA 1U8ZA 1DARA 4B2PA 4DIEA 2O8CB 2JIZA 4NYIR 4OQMA 1BODA 1FW6A 1C9KA 2J59A 3B6EA 1TF5A 3HX4A 1DJGA 2H92A 4KFTA 4LYHA 4Q01A 1ZP6A 3NBYC 5DGXA 1BLQA 1P2TA 1N0VC 3SG4A 1JC2A 3QQ5A 5D3QA 2ZR0A 3MWYW 4HB2A 1K95A 1AZTA 1QF9A 2X8AA 3BB4A 3W8NA 4PCWA 4BY4A 1JEDA 2IS4A 1SCMB 2JT3A 2M9GA 4AQJA 1MT0A 2LMUA 1COWD 2PH1A 3O47A 3T35A 1KI6A 4R98A 3GLGE 5FBRB 1LB1B 2CLSA 3T5GA 4CF7A 1OIWA 4KCGA 4IEIA 3Q7QA 4DXAA 2R44A 4US0R 1DAFA 1IQ3A 2LMTA 2SCPA 4ASUD 3ZYCA 2DYKA 3NH6A 1Z28A 1EG7A 2HF8A 1XRJA 4PHGA 2OTGB 2BJWA 2IS1A 4IOJA 2KFHA 4Q21A 3E5HA 1EX6A 2JNFA 1W2HA 1KY2A 1YVDA 3BH6A 3L2OB 5P21A 5IK2D 5TMPA 4ZKDA 3GLHA 1U94A 1KYIA 2SHKA 1J55A 4Q9LA 2FA9A 2X2EA 1XJ0A 3B5JA 1QS7A 2O8DB 2KI4B 4JKIA 1KO5A 2PMDA 1KSJA 2LCPA 1XK4C 3TDIA 3L0OA 1G9XA 3RRMA 4BZXA 2L5XB 2QI9C 1C7VA 5FL7A 1GILA 1SNLA 3NEYA 4GBMA 4PQFA 1A03A 1TU3A 4QNMA 4RKEA 5BPJA 2PVBA 1M34E 1H8HD 1GRQA 1TNDA 2QORA 2ZQ5A 3K09A 4JLBA 4BLQA 5A5GA 1N2DA 1FQJA 4JLKA 1G41A 1CLUA 2IYXA 5EE1A 1JR3D 2FF7A 2WJHA 1RRFA 3HDTA 5FUXA 5GJWC 3GCGA 2O60A 1M63B 3SQXA 2J45A 3CWZA 3UMFA 1CR2A 2DCUA 2FPKA 4TTQA 1TTTA 3RDPA 3KJEA 4DCKA 2FFHA 2H16A 1NSHA 1UHJA 1AKEA 4JLVA 4JVNA 4Q9JA 3VU9A 3HU2A 2YC2C 2QAGA 3CWGA 3LLMA 5GVSA 1J8MF 1B23P 3GFPA 4D6PA 1CFFA 2FMXA 3KDSE 1E8AA 4QJ4A 3WHKA 2ZSAA 3C16C 4A2QA 2ZR9A 4FXPA 2IW3A 4NONA 1CRPA 4EPWA 5I2OA 1BMFA 1CTRA 2XXAB 4D81A 3BWDD 2EC6C 2ORWA 1GOTA 4GGNA 3GJ4A 3L43A 2HETA 5FPKA 1N2CE 5F9HA 1XFZO 4PALA 4K81B 4A8JC 3K9LA 1TNWA 3QUSA 2QL6A 4AWXA 2NGRA 2FG5A 1MWNA 2C78A 5FOWA 5AERA 4LPSA 3AEZA 2ONJA 1WBDA 3VRNA 1WP9A 1OH5A 2GF9A 2EYQA 1KQMB 2JASA 1F5NA 1KDRA 3QKUA 4FI3C 4JSYA 1NBMA 5DI3B 4BLSA 4QJ3A 4Z1MD 4GDFA 3OF5A 3ICEA 2YOFA 4OV2A 3IIKA 4D4LA 2CT9A 2IYTA 2XJ9A 4W9MC 3WMGA 2PLFA 1ZNWA 3TMKA 3HJNA 4WZBE 4I4LA 5C1BA 4TLBA 4BWYA 4FD2A 2QM7A 4N3NA 4C30A 1NCYA 3AVOA 4FN5A 1OB2A 3A8RA 3U7EB 1AS0A 1MRNA 1B1GA 1DJIA 1JF2A 1NLFA 1MXEA 1T0HB 4B33A 4M9XA 2R65A 5IBWA 3GK1A 4ORAB 1A75B 1LINA 2A2ZA 1VHLA 2NO7A 3TGPA 1GL6A 2H5EA 3U6KA 1QHNA 1I4DD 2QZ4A 1JWDA 1RJVA 3OX6A 1XD9A 4DS7A 1F60A 2BEKA 4X8LA 1FI6A 3ZS9A 3BBPA 521PA 1Q44A 1TQ4A 4FIDA 2VO1A 2WWGA 3BERA 4BRWA 4L8GA 1YRTB 2KQ6A 4YLGA 1S36A 4UJ5A 1BYIA 5HKKA 1WDCC 1I4LD 3EC1A 3EIHA 1HQYE 4A82A 1R8SA 5M04A 3RS7A 1KKMA 4O2RA 1Z83A 5AUPB 1YU9A 5FBLB 4BFSA 1KFXL 3ADCA 1XNJA 4ETOA 3QF7A 3VR1A 4EQ6B 2NOAA 3H84A 4ERNA 2R9VA 2K8MB 4I81A 4A0HA 5KYKA 2EQBA 3L8YA 3EKJA 5LD2C 3SG2A 1YTZC 2AAOA 1C7WA 4Q4LA 4KYUA 1I4TD 4D2IA 1GGWA 4MGYR 4EPTA 3Q9LA 4LHZA 1X02A 2CCMA 3LCPC 1KK2A 1E1QD 2VPPA 3B82A 2KYFA 4IRUB 5KSYA 2V8OA 4MITA 5DSZA 1W0JD 2PEZA 1XCGB 3ZJYA 2I3BA 3BUMB 2WCEA 1A4RA 1IHUA 1NWDA 4JBXA 5IF9A 2VHQA 2GCOB 4C0HA 2OFXA 2CCKA 3EIQA 1DTLA 3OHMB 2QSYA 1XFWO 1OSNA 5EE9A 4EKDA 1E9DA 3AKEA 4JVSB 1Z0FA 1RRGA 3SNHA 5JSZB 4B47A 1S26D 2X19A 3BORA 1Z6GA 4QGFA 3I5IB 2V4ZA 2H57A 3HYRA 3B78A 3O78A 4HATA 3HWSA 2IL1A 4LJ7A 3KQUA 1J1DA 1MQ1A 2RH5A 2LE9B 2GEDA 4FCWA 3UWOA 1U98A 3I62A 4DIDA 2XZLA 1Q1BA 5HLOA 4IDOA 1ZBDA 4HB0A 4BQSA 3R8FA 5EXPA 1J7RA 2BKHB 1B4CA 4KODA 1OFHA 3MWLA 2GTPA 3K0SA 4OHVA 3EG5A 1OMVA 1A1VA 3NSOA 4LI0A 4YMUA 4DCNA 5L3RA 2O5GA 4CFQA 3BUOB 1N6RA 1SGWA 4YI8A 2KJQA 3UANA 1FZQA 5SZIA 1QX2A 1IRJA 1KHTA 4GRAA 1ANKA 1KSOA 5L3QA 2CHVA 1UBGA 3OAAD 3QEJA 2DWQA 3SZRA 4LHWA 4PQRA 2BKEA 3U60B 4JLNA 2EC6B 3PJRA 1KJZA 3WYGA 1DE0A 5FOSA 5AJZA 3ADBA 4E09A 3DPUA 4A8JB 2VP6A 3HP1A 5HTKA 5AK0A 3EIEA 3QF4B 5HKYA 2M8UA 3AVWA 1A2KC 3FS7A 4QBGB 3DVLA 1PALA 4KHZA 3TW8B 4ASUA 4C0JA 1XPOA 3GJ8A 3PN7B 4EPYA 2P6BB 1S3PA 1Q22A 3V9PA 3L0SA 1SKYE 2JLXA 1ZC3A 3E3RA 1P73A 1S6IA 2KDHA 1HE8B 3MD0A 1NY5A 4Z8XA 3CLVA 1OXTA 2OBMA 1BOCA 1OB5A 3CZPA 5DIFA 3LY5A 3RC8A 4LC1A 4HAUA 4MYCA 2P67A 3P1JA 3IDQA 4G0NA 1PULA 1G4YR 2A5DA 4MEWA 4IDNA 3I32A 4ZCUA 1E9RA 5H1YA 1XEWX 1U0LA 5C46F 1SBJA 1GP2A 3RLFA 4JSTA 5FI0B 1ZNYA 3AUYA 3W3ZB 1H8HA 2CE2X 3I5FC 1SRAA 1KAGA 5I8NA 1AM4D 2O0HA 3CPEA 1IM2A 3PLFB 1IN6A 5GJCA 2W6IA 3U3MA 2JZIA 2LVKA 3ND8A 1VYTA 1P6XA 2CVFA 2ZRJA 4PE7A 5GJVC 1JR3E 3AKYA 4Q4AA 1WDCB 3BGWA 4TQAA 4QL3A 4R9UC 2ODBA 2JDID 3BUWB 3CPJB 4JLJA 4KFSA 5B8IB 3QIAA 1E79D 2JRFA 1NVVR 2NO6A 4K8OA 1UKZA 4MRVA 1KI6B 1W36C 1G291 3ZVNA 2GILA 3Q8XB 4XJXA 2VIIA 4M4SA 5F9FA 3U4QA 4TYWA 1V5WA 4Z8YA 1HA3A 1YRAA 1IN8A 3TDUA 4NL4H 2G88A 3PEUA 1E4VA 4HEJA 4OHWA 1S5GZ 2BBWA 5CLLA 1KY3A 4HAZA 2BECA 3BXZA 4PHTA 4B34A 1J70A 4I1UA 1AGRA 1PZNA 1WE2A 1KFUL 4I99A 3GLHB 2AMIA 3QXCA 2K7BA 3AAKA 4Z1MA 5KPDA 2HT1A 4ZCVA 2I4IA 4JLOA 2PASA 2OG2A 2ANCA 2XNDD 4G01B 5JWHA 5JFGA 4BFWA 1LY1A 3R8CA 1LTQA 1CBUA 4BLTA 3CBQA 1KMQA 2CTNA 4NMMA 5AXIA 5HYDA 1T9HA 3KQHA 2VSXA 2YWHA 2NCPA 4MH0R 3OIYA 5SZJA 1DS6A 1Z6YA 4BZQA 1OMDA 2FCDA 2IYLD 4KVGA 1G5PA 4UXJA 4M2PA 2IYWA 2CNWD 2ZI6A 3A4MA 1W1WA 2W58A 4O0MA 4JIMA 1GFIA 1NJFA 1W4CA 3THWB 2PJRA 2W2VA 1GGZA 1NLZA 2LC5A 2LNKA 2JATA 3GQBA 2G1JA 3EZ6A 3N2EA 4OYHA 5DHAA 3THXA 4DRWA 2QUZA 3VU9B 1GTVA 3FMIA 3K70B 1XEXA 4BLRA 4QJ4B 4F4IA 1FOEB 1P4SA 3UXMA 2IYZA 1C1YA 4ABYA 1ELOA 3CRQA 2QTHA 2JC2A 2J0UA 3LO5A 1F48A 4ZIRA 3LX8A 5FPTA 5AJWA 2ZUCA 3A4UB 2BMFA 2GEVA 2JT0A 4P3YA 5EQTA 2DHRA 1ZU4A 5J5CA 3PENA 5KHOC 1OXVA 1RFJA 1QHGA 2CBLA 4MZJA 4DSOA 2RGBA 5FUWA 5JRZA 2NTYC 2GWHA 1E98A 2XAUA 3Q3JB 2D74A 2AHOA 5B30A 4QJ3B 1ODBA 3GLFA 3SJAA 2Q21A 5CIWA 1BKDR 3QY0A 1CB1A 3L82B 4NCKA 4NP6A 2ZYTX 1UM8A 4Q7LA 4EPRA 3I5HC 3IPXA 1XCMA 1MHOA 1II8A 1DO0A 1E1QA 4GAOA 1E32A 1L4YA 4NE2A 1ZOTB 3TSZA 1W0JA 4NDDA 3A1VA 4Q04A 2BCAA 1N25A 1W0KA 4IDPA 2Y5IA 5JI2E 2FGJA 2O52A 3NG1A 2R6FA 1LFDB 1EFHA 5JWOA 1J7QA 1LS1A 2MMGA 1SYMA 3EK7A 2KFFA 4BECA 1W7JB 2NPIA 4HI0E 4ORBB 1WRZA 4A4CA 2ISDA 1F71A 1DPFA 2VL7A 3QPVA 4XD7D 1XO5A 1Q21A 2DWPA 2XX3A 5A0FA 4GUKA 1UHHA 1ZAKA 1D2EA 1N6LA 1KO8A 1E0JA 2DFNA 2ONKA 2VP0A 4FMCB 4ACBA 1VRKA 1E69A 1KI8A 2B1UA 1OH7A 2OAP1 4UXHA 5F3WB 2G9NA 2VTKA 2Z43A 3P26A 3FHCB 1N5JA 2JJ1A 3FKSD 3GJ3A 3GLIA 4V0OA 4ZI3A 3THWA 3SDZA 2C2HA 4PE1A 1VG0B 2QTVB 2C9CA 5JHHB 4WQ2A 1GVNB 2QACA 4IW3B 2AR7A 4NH0A 3RS2A 2V1UA 3UG7A 4GNKA 4PHJA 3REFA 3BUNB 1UKEA 4RZUA 5FBQB 3BD9A 2QP9X 2BE6A 1AS2A 4LDJA 1IBRA 3SI7A 4I5KA 1N6NA 2C04A 2JEOA 3BAFA 2H7VA 3TVTA 4JVMA 2YKGA 3RS0A 2J87A 1GRNA 3LXRA 2QQ0A 2IS2A 1R6PA 2UKDA 2WBLC 3OAAA 2DWOA 4MYTA 5HE8A 4RD3A 1O87A 1ZD1A 4BLOA 2F6RA 1LNZA 4B6FA 2WMNB 2JLYA 4F92B 1HEIA 3IO3A 3EPKA 2QBYA 2WCBA 2IBMA 1N65A 4NDCA 1DOAA 5K8UA 3B9QA 3CGAA 4X8MA 3PSRA 3ETLA 1SXJD 4TYPA 4BFVA 2AWOA 4JL5A 5FYXA 5CYOA 2D8NA 1Q1EA 2LVJA 2P0EA 3U3JA 4D0GA 2BBSA 3J81k 2ZI5A 2QMOA 2ZROA 5FUVA 1Q20A 4N1FA 3A1SA 1HT9A 3EKHA 4DRZA 3T1VA 4FTGA 1BT6A 3DZDA 2LAPA 1U8YA 1XXHE 3RWMB 3X1YA 3FHTA 1KI3A 1DJXA 1OHHD 1PLJA 4OKSA 4Q9IA 1XFVO 1TU4A 2ZS7A 3RS3A 1FF1A 1J7KA 3B9PA 3B1VA 4OK3A 4QC2A 4FMDF 3GPLA 2W83A 2RGNC 1Z0JA 4R7ZA 5CJ2A 2NMVA 3GJ6A 4URUR 3UATA 3VAAA 2ZU0C 2QROA 4DSNA 1BG1A 3AF4A 3MMPA 1NX3A 2J46A 4Q4HA 1LA0A 4DCTA 3U61B 3DKVA 4EFLA 1B0UA 2QMHA 4M0LA 3NWJA 3SJCA 1TMKA 2D4HA 3GFTA 2B8WA 1YUTA 5L3QB 2SASA 2QRNA 3U7GA 1X8JA 1OZOA 2BCJQ 2M7NA 5EZ5A 2JDIA 3NIBA 2O8FA 4PC6A 4HB4A 4DLVA 3A36A 2LUXA 3K0EA 1MABA 1JALA 1TX4B 1IGVA 2BV3A 3A4NA 3KKQA 5DO9A 1RECA 3CR4X 4KXFB 4XIGS 2ZM5A 2FV8A 3G0HA 2ZVQX 4URWR 2F8PA 2EFCB 5E7JA 1XMVA 2QA5A 4QHYA 3FYHA 2QGNA 2M49B 3MRSA 3R9IA 3BOSA 2KBMA 3I5HB 5JJKA 1EFTA 1KZ7B 3VTKA 4RFSA 1WF3A 3DM9B 4LCBA 5FUYA 2YVUA 2IEYA 2AKAB 1X86B 2MLFC 1X1RA 1CJKC 2BBOA 2CVHA 2D2FA 2ZYWX 4PZLA 2IUSA 1MKYA 4ICBA 1RPZA 2J3EA 4OQLA 4OQXA 4A1FA 2F1IA 4A0FA 3LBIA 3OE7D 1GUAA 1PUJA 3CO5A 3FWCA 2GXUA 4OJKA 4WW0A 4WXPA 5DKQA 1IN5A 2V3CC 4NCIA 3A1TA 2KB0A 3TIFA 2PZGA 4DLUA 4DJTA 3LNCA 2EYUA 3QRXA 1KSHA 3FDIA 1EFCA 5IDVA 2GV5A 1KNXA 2GETA 3E2IA 4LBYA 1DJHA 1MUXA 2H1LA 4PZYA 2ZEJA 2CNWA 2IYQA 4AKGA 5HE9A 2ZYVX 3DF0A 1YZQA 4LX0A 1Z29A 3CKLA 4Q4AB 4JMPA 4DC9A 1DGUA 3IF7A 1ZM7A 2IXGA 1G64A 4PE0A 1FPWA 4BLPA 1P2SA 2K2FA 4GFTA 1KO7A 3B7GA 3ZVLA 5JEDA 4TLCA 3B13B 3KXIA 1A5TA 1YE8A 2PLRA 2VBCA 3OEED 4HAWA 4AYXA 3U4QB 4MYHA 2YWGA 2M7LA 4TTPA 3RAPR 1R5OA 3UMSA 1G8HA 3QPUA 1XMJA 2YINC 3CLNA 5EUQB 1AKYA 2V6IA 3AVUA 2IUTA 3ICQB 2OTGC 4ORCB 3EC2A 3OIVA 4GMXA 1L7ZA 1GNRA 3SJZA 2OV2A 4B48A 1ZACA 2PX0A 3KTAA 3MWJA 4TMVA 3UMRA 1ZM4A 5TDHA 4KBFA 2A30A 2KI4C 1KWOC 5DKRA 4H9GA 4W5HA 3AP3A 3REGA 1NKSA 1IONA 1GL7A 1IJ5A 1ODFA 2AWNA 3KJGA 1WQ1R 2YYZA 3U7HB 2HV8A 4OBEA 1QVRA 5AFPA 2WOSA 4JLDA 4MBEA 5D7FA 1NMXA 2ZS8A 1KK7Y 1PJRA 1ETUA 3U2QA 3V4FA 3CZQA 2A5GA 2XB2A 4YQFA 4KJZA 1NPQA 1R2UA 1ZVQA 1PVAA 4UJ3A 4LJ8A 5LBIA 2AK3A 2QPOA 1II0A 1R0WA 1T3SA 2C95A 4HAXA 3THXB 4XD7A 4A0GA 4EAQA 1XEXB 2BWJA 4HRGA 5CDFE 1A7JA 1EL4A 2JLUA 2ODNA 2ZNEA 3WYFA 1R6BX 4TYNA 2J0UB 2QP3A 3KX2A 2GXQA 3FHOA 3FKSA 2OPOA 5C4GB 4ZIRB 4N1GA 2F1HA 3CIOA 3G82C 3SQWA 3SHWA 1AVSA 1SVWA 4FINA 1QG2A 1SPYA 2ZNDA 3P4XA 3LK1A 4Q9KA 3AB3A 4TLDA 3LW8A 1G3UA 1XX6A 2VP4A 2ZSBA 2PMYA 2RMKA 3TVDA 3NBZC 3IPYA 4Q66C 2R6CA 3GLFB 1S4QA 2G83A 2BMJA 2ANBA 1KFXS 1SHKA 2KI5A 1GITA 4MKIA 1R5NA 5DN6D 1Z63A 1G1MA 3CX7A 1VCNA 3UKDA 1II8B 5JHGB 2AFIE 1Z08A 3IEUA 1AJ5A 2AK2A 1Q3HA 1R7RA 4N1AA 5IHPA 1H8BA 2OAQ1 4F38A 1R0ZA 4PSVA 2D3WA 4HREE 4HB3A 2KSQA 3VHLB 1R0YA 5IRCD 4W7SA 1P75A 2REOA 3VRQA 1CEEA 1SXJA 2JJ2D 2PEYA 4NYMQ 1JPNA 2OUKA 4FCVA 3KUDA 4BFYA 3ZD7A 2K61A 1P72A 2OS8B 3FVQA 1LF5A 1DMOA 3ND9A 1K96A 1FPMA 3LBHA 5ER5A 2RGIA 1KI2A 1NF3A 4LJ5A 5FR2A 4GL2A 5TARA 5C18A 5DH9A 5EE0A 1MO4A 2ZRSA 2F2PA 2L4IA 1G3IA 1XMIA 2ZN9A 1G8YA 1II9A 2OFOA 4JPZB 4ZPXA 2YWFA 1OHHA 3DM5A 1YZLA 3NVAA 1YQTA 4JT4A 3NSLA 3SG5A 2IHYA 5G53C 5KPJA 2RGCA 3QI2A 3GLIB 3TUZC 3IKJA 4LHXA 2XZPA 3K9HA 4S35A 3W9YA 4MDFA 1KIMA 2Z0MA 3PATA 1CULC 3DOEA 1MO3A 4GNKB 2AKYA 5CSIA 4AQIA 2OCYC 3MG9A 4DDVA 2QG6A 4HZUA 3BQ3A 3ZGXA 1W7AA 1YUSA 1XZQA 3KB1A 3QXXA 3U3KA 2FU5C 4XTRA 1EX7A 2OILA 4XYNA 3GLGA 1WRLA 4PPFA 2I7AA 1IAQA 2WKQA 4R1EA 1FBVA 4MGKR 3OB2B 3M6AA 3IQWA 4QHSA 5JBQA 2RHMA 1KSFX 4IOLA 5AANA 2KQYA 2LP3A 1CKKA 1MO6A 2QMEA 3I73A 3BB3A 2QBYB 2GXAA 2GNOA 1SVIA 3LH5A 4DCSA 4KO8A 1JXOA 4A15A 1KQVA 2OSBA 2FJUA 1QBKC 4GZMA 1NI3A 2EU8A 2C98A 1AGPA 4CYMA 2Y1NA 3OZXA 2R6AA 2RAPA 4XSGA 1JFKA 1C07A 4DVGA 3BE4A 1KWOB 1M74A 2GZHA 5K89A 3I5IC 1T3LA 1XMSA 1AN0A 4V0LA 4CZ2A 2V9PA 3TUYC 4B32A 3X1DA 2VF8A 4E03A 5FTNA 4BFTA 3TSWA 2WOJA 5FL3A 1WDTA 3ZVMA 4G5SA 3SFZA 2ZITA 4RD2A 4QHTA 3KJHA 1VHTA 2FE4A 2J7PD 3Q72A 2A4JA 4M22A 2LHIA 2ZJAA 3RSLA 1FP7A 4EJSA 3TBKA 4B6EA 4QBIA 1XCPA 3H4SE 2J5XA 1M2OB 2ZAOA 4Q4HB 5F98A 3KKMA 4CW7A 2AUCA 3FFAA 2DBYA 1BYUA 1QHIA 3TH5A 4JVLA 3ZS8A 3THOA 1QVAA 4NCNA 3QXJA 2O8FB 4TMZA 2GCNA 1YR5A 3AV0B 4L15A 2HXYA 4KVAA 4KSBA 1JECA 1MABB 4II7A 5EXSA 4BFZA 2EFDB 2OCPA 4EFMA 1YKSA 5CSFA 2NQ2C 1CDNA 1HYQA 3GMTA 3M4YA 3X1WA 4TYYA 1WRKA 1KK3A 1DAKA 4MKGA 3W5JA 2R2IA 1NRJB 2QY9A 2N42A 4P4SB 4HLUA 4TL9A 1N0WA 1NL3A 2MAZA 3PN7C 4JBYA 3ZZTA 5FOXA 2H18A 2L0XA 1QVIZ 1CR4A 1BS1A 4RFSB 3L0PA 5K8LA 5BN5A 3NXAA 4M1WA 2ZRKA 2WSMA 1RZ3A 2PALA 4PAQA 3F3YA 1OF1A 1JJ7A 4E68A 3VR2A 1ALVA 3ZVRA 1W44A 4FQOA 1DVRA 4DDTA 1ZW6A 1E0AA 3LW7A 4L9WA 3SYNA 2P6UA 3OIWA 1Q3TA 4A2WA 4CIDA 1CJUC 3AVPA 5GJBA 2Q0HA 4PAMA 1NVWQ 1G18A 2QE7D 4JKYA 3LDAA 1W7IB 1WA5A 2RGGA 1UF9A 1YZNA 3CNLA 1A2BA 1GL9B 1F3OA 3QXHA 3H1TA 4N0DA 2DB3A 3E1SA 3TQCA 5EXTA 3DF0B 1L8QA 2BHRA 1K8UA 1H65A 4YDSA 1Z0KA 3NBXX 2DFLA 4WA7A 1F70A 3FOZA 1QHSA 2JLRA 3RRZA 4P5OE 3MCAA 1QHYA 4ARZA 1EJ3A 3SYKA 2G3YA 4AYWA 2LMVA 1G3MA 4MDEA 3LQRA 4GI7A 4GMDA 1VKJA 4G5QA 3O8BA 3SG6A 2JLZA 5AUQA 5B58C 1S6CA 2VEDA 4C0BA 3FFBA 3BH0A 1UP5A 5G08A 1HUQA 4PXAA 4TLAA 4MSPA 3SHFA 2NLNA 3Q5EA 4IEEA 4ESVA 2W2TA 4UQOA 3LAWA 5G41A 3EVUA 1TUEA 2GRJA 4TL6A 4TL7A 5BN3A 4NHOA 4RZ3A 1UURA 2RGEA 2GHIA 3KTAB 1U99A 1ZMXA 2HEIA 2PX3A 3A37A 1MXLC 2ASEA 1OPXA 2F3YA 4DDWA 1L2OB 1E9SA 4C0LA 1L7VC 3WHLA 3LVRE 1IY2A 3LA6A 4M2OA 4QJ5A 8OHMA 1DF0A 4L5BA 2VHUA
chains in the Genus database with same CATH superfamily
1DIHA 3VPFA 3PUWA 4ZT7A 3EWAA 1T1JA 2ZZNA 3G8BA 3I01A 3WRXC 5DE3A 5LQKA 4YGDB 1SOVA 3WGQA 1AF4A 4BPBA 3LQ1A 1E20A 8ABPA 5AJXA 5BN4A 5AVXA 5JQGF 2Z2YA 5EZ6B 3GJTA 1H93A 3TDKA 1DEAA 3BOWA 2NUTB 1QCCA 4N0EA 2XWPA 4ZI5A 3IVGA 3PQEA 3BK1A 2NUPB 2B94A 1QS0A 5HGXA 5BQ5A 1YR3A 2CW5A 3OZDA 2A7QA 3V4SA 2OZEA 4B71A 1IHDA 2JGNA 1BE6A 1O4VA 3BRWD 1S9HA 1PYOA 2J9YB 2VTEA 3QVKA 5I7HA 2VLBA 5HK8A 1XA4A 4QKQA 4FMBB 4D0NA 2QQ5A 2BDTA 3IVXA 1B7TZ 4L0MA 1E3JA 2BIFA 2X1LA 4U7WA 1E0DA 5DMXA 2FUKA 3U0BA 3ULKA 2IYSA 3GFBA 3TR5A 1E58A 2DC1A 2ZB3A 4HS9A 3ED5A 3UMGA 1N3IA 1G8GA 1VJ5A 2WMYA 1DHRA 5AFSA 1W88B 3BXKA 3GK3A 2F9MA 5JY1A 2NVUB 3FNQA 3O9MA 4W8HA 4ZODA 1OE0A 4JELA 3R7BA 5JRJA 3OFSA 4YMGA 1TYEB 1T2UA 3NHJA 4I46A 2G0TA 5DLQC 4G5HA 3L8MA 1KTVA 3NTQA 1IG5A 1T8RA 5IT4A 2M6SA 1WUYA 5JCZA 1RIFA 3IKVA 1G3RA 3K6RA 5G2OA 1JQJC 2AW5A 3EXHA 4HTFA 3P20A 1QE0A 4WADA 1XFRA 5DP1A 1KOGA 4L72A 5ENZA 5KZMB 1Z2OX 2P6OA 4JUDX 4X93A 2REXB 3TXYA 1WZUA 2E18A 4QJ5B 1QGOA 3LL4A 5AVUA 4K6KA 5I9NA 4BX0A 3RABA 2IF2A 2CLMB 4WIAA 2ZUUA 1WRBA 3USZA 5J4VA 2ILVA 4HXFB 4OXKA 2Z83A 1JWBB 1I3KA 1T15A 2CMHA 1OIVA 4D3YA 4LISA 1OZSA 1EX1A 3IEXA 1Z0AA 4CLOB 2ZI4A 3CR8A 1XDSA 4CCSA 4ZI2A 2NYRA 4BNUA 4EMBA 4B76A 1IUOA 1XNHA 1WXQA 2P3QA 4UHBA 1GNLA 4AZTA 3VBCA 2XNDA 3E3MA 3SS4A 4F12A 3VR4A 2SBTA 5L6MB 3CZ9A 4IZIA 3ZWYA 4LTDA 1QUEA 1NX1A 3HA2A 1SHUX 1JNXX 5A02A 4F9EA 2BMWA 3K0KA 2H2HA 3UC9A 3PHCA 1Z7YA 5EL0A 4M9RA 1N2BA 1XZBA 3IHTA 3TPFA 3QPWA 3OUUA 2R1VB 2KNEA 1IBSA 4XJKA 4BCDA 1AB6A 3ZKWA 3L6OO 4KSYA 1J0CA 1GRVA 1ZIDA 2Y99A 4V2IA 5CJJA 3I1JA 3H9BA 2NZXA 1I7LA 4X6XA 4XUDA 2OQRA 3LHKA 2IEAA 2JIBA 2GUGA 1DJQA 2OEPA 4N5HX 4F0ZB 3QX7A 4LECA 3PFBA 1DEOA 4WCVA 2BH2A 1J90A 5ALYA 1VM6A 1X15A 4HJRA 3KVRA 3RADC 4BFUA 5JMTA 4ZQEA 3UFXB 4E08A 3OPYI 3WHTB 4NJEA 2HFKA 1QX7A 4J7UA 2BTQA 5H68A 4MWCA 3HDVA 3CVWA 4M60A 1K7EB 3A6KA 3K15A 1U8TA 5JANA 4UTRA 2NV2B 5JJLA 1V6AA 2XEDA 1KC1A 2AN5A 3IXLA 3QKRA 1MZPA 3EIOA 3VKWA 1VRCA 1NJ1A 2GSDA 1UPXA 4P22A 4D1YA 3M70A 4PO1A 2EQAA 2VHCA 4GM0A 5KNBD 1CP2A 4CF3A 3ZCSA 3PL5A 2AFHE 1ZX1A 1MFZA 4D41A 3AETA 4RV4A 2YIJA 3HL4A 3BFHA 1FJ2A 2MJLA 1HKUA 2I3AA 3EPHA 1N57A 3IS3A 4DCGA 4ENSA 1QVZA 5I2LA 3LUAA 4X41A 1U7UA 5HP4A 1DJMA 4C4PA 4ZDKA 5JNSA 2GSWA 4YCAA 3AU9A 5IJXA 1MIOA 1H1TA 1KBZA 1KK0A 3OEEA 4JDUA 2OHOA 2CVZA 4XVUA 3KKPA 1ZIOA 3PUYA 3S2GA 3UPTA 2I2FA 5FTKA 2JF0A 5C7LO 3HB4X 1DQZA 1VMEA 5C8YB 1Q7RA 1VZ2A 1NBME 1ZVMA 3UM9A 2H2IA 4R9SA 5BPHA 4YHHB 4V0SA 4XWOA 2W2KA 1FDIA 2H4JA 1MU0A 2QEVA 1ZW1A 4M0EA 3IP6A 5A4AA 2Y71A 2Z04A 4TWZA 5KDOA 2C7RA 3OHSX 3LECA 4LCJA 5FD8A 3JVVA 5C34B 3DXYA 2GJSA 3TKAA 3HXKA 5T41A 1YZUA 1N2JA 4EG0A 2HUPA 5B7PA 4KE6A 3FRJA 1GZHB 1SC1A 4TN1A 4QZVA 3CB2A 1T5IA 3GFSA 4O4JF 5IDQA 2V54A 4KGDA 4PSKA 1MAWA 3Q88A 3B7PA 1IH8A 5ESXA 3W2IA 1XZCA 2OFWA 2JJ1D 4FFBB 5FOTA 2VDVE 2HRCA 4GC5A 4PLTA 4DLPA 4LJYA 4QSMA 4KRGA 4YQYA 2XCTB 3PDWA 5LIRA 1H05A 3U39A 4EFDA 3ZDQA 1O6CA 2OHJA 2VHZA 1ADJA 1RWXA 1P91A 4JENA 3DLIA 3FX2A 3HZRA 1RROA 3R3UA 1TUBB 3OZIA 4TTSA 3USES 1QSGA 1N8NA 2QYHA 5IAOA 2D2VA 4OJNA 2IHTA 2FSUA 4GE3A 1ZI9A 4IBOA 1J99A 3RVLA 4RV9A 2FEOA 3H9JA 2R1TB 2B35A 1VQ1A 2BJVA 4V1CB 4TTIA 3WGKA 1E2KA 2GKOA 3IQFA 1L4BA 4ICIA 5A04A 2QEBA 4JJ7A 4DLRA 1JH9A 4LZPA 3OWHA 2G76A 3HWX1 3VAYA 1NX2A 2REQA 1W6UA 3GVXA 4EHKA 1YAHA 3PKJA 3FOFC 1ZOIA 1RTTA 4PS0A 1NASA 4YAEA 5LQSA 1W2WB 3I6ZA 2O7NA 3UAYA 1L5RA 2D2XA 2L2CA 2UXDB 1XQ1A 4BO1A 1VE5A 1YC5A 3SHVA 1OT3A 1O0BA 4WXYB 3LV8A 3RBVA 1QMPA 1SBHA 2IV2X 4K88A 1DAIA 1EQAA 1ZQ9A 1C0EA 3HCBA 3PEVA 1XVVA 3TR0A 2VZEA 3VTAA 4IDAA 1NAIA 3WYNA 5JH7F 3B6IA 1W49A 3W5BA 5GQQC 4PHFA 3PXXA 5E1DA 2P9FA 1LS6A 2WC1A 2VHWA 4G1MB 1EXMA 4QPJC 1LBHA 5L7TA 1LCIA 1OE9B 2HAEA 3N8HA 1PWEA 5CM8B 3KCQA 4BO0A 1U9JA 1U2RA 1JVBA 2DY1A 3IEKA 4FLFA 2F2TA 1PVBA 2X6RA 3RRYA 2XE4A 4LXHA 2CGEA 1NW6A 4M21A 3UV3A 3TB4A 3PJGA 1MEOA 3M9WA 1WMSA 1SCUB 3EQ9A 4R40A 3I2KA 3WQRA 3EVVA 4ZGWA 1AQYA 4RCYA 1N0IA 3K5WA 2XKAA 4JL6A 1BGWA 2QYSA 2GCPA 1EFUA 1L0BA 2J33A 4E21A 4X1YA 1K90D 2Q6LA 3FTQA 5LYYA 2QQGA 3OO0A 1JDUA 4F4DA 2G9BA 2ZUBA 3JQBC 1WD7A 4C6TA 1KQ3A 2FCEA 2FG6C 4FP9A 3D3JA 5KTPA 3AV3A 1TCVA 2W8ZA 4XQEA 1QO0D 3UYLA 3MXTA 4E5VA 3DJYA 3S0JA 5E6UA 3G5UA 4W5OA 1IJBA 3ZDEA 3PT9A 1EVIA 2ORIA 1UHKA 1CUWA 4QYSA 4E7PA 1Z15A 4N6GA 4UUNA 1A9OA 3NZEA 1CDMA 1GZ6A 3S0GA 3TBFA 1NP6A 1JQDA 1CY7A 3LHIA 1CXZA 4ZO6A 2J3IA 2WV7A 1S8OA 2WYVA 4L74A 4TVBA 4K86A 3HBNA 4R7TA 1QF6A 3GMSA 3KYDA 5JT1A 1S6JA 5BOSA 3QKSB 2Q3EA 2IE8A 4R2LA 2CL6X 2CNNA 2MWMA 1YUMA 3K9NA 2X4DA 2J1LA 1QFJA 1GG2A 3I3OA 4O3MA 3QVWA 4NR0A 2BTOA 1SVSA 1U28A 3AR9A 2PZJA 4JUCA 3L06A 1TCOB 2YWDA 3MYYA 4OYYA 2QRMA 1AV6A 5JEEA 3KXKA 1FIUA 4C5BA 4QOSA 1NJ2A 1HSOA 3EBLA 1U7XA 5FTLA 4Q1DA 3H19A 6LDHA 1RYFA 3AF0A 1NP3A 4G4SP 2H92A 1CC1S 3LO8A 1N0VC 1OX5A 2O48X 1O96B 3KQYA 1JWAB 3W8NA 2VJAA 5CEFA 4LRYA 1OLUA 4ZALA 1Q7GA 4XEUA 5LQCA 5HJ7A 4Q21A 1ZUWA 3GLHA 4O1MA 2VUSA 1NYRA 1FFBA 1KSJA 4PSCA 3TDIA 3JWPA 1YV9A 4AMYA 2PVCA 4NS1A 1FQJA 4KK3A 2V6FA 2EKLA 3DVQX 3CWZA 1I36A 3RDPA 2R97A 2X8LA 5I2OA 4COOA 4DNQA 1N77A 4D9IA 1Y8AA 3OTWA 5FPKA 1N2CE 1V5FA 4L76A 4AWXA 5A1TA 2Q1TA 4J8PA 4FI3C 4RY9A 2XVAA 4GDFA 2IPNA 4CCYA 2YOFA 1S7GA 1KXJA 3TINA 5C5DA 2JCYA 1RJDA 4CG2A 4BEWA 1MHPA 4NJMA 4D57A 4JU8A 3OX6A 4DS7A 4DLNA 1FI6A 1GU7A 1FX1A 4E70A 1Y3CE 5AI8A 5KWIA 1BYIA 4KX5A 3KAPA 2IIQA 2FB9A 1XNJA 3LUFA 4ETOA 4U2CA 2P27A 1XLWA 1MXHA 2YRWA 3C3BA 1A8IA 2OCXA 5DSZA 5ALUA 3FZQA 4F06A 4I8XA 5C5CA 2SCUB 3BORA 1Z6GA 2J48A 5LKAA 3RC7A 4NHEA 2RH5A 4MLPA 2XZLA 1F6WA 3VHXB 4QU9A 1HFEL 1OOIX 5DGIA 5SZIA 5LC1A 2PV0A 5EVJA 1KOJA 3QEJA 2Q45A 1M2NA 7REQA 4GR4A 1K6IA 4J1TA 3QLEA 1EZ1A 1RAHA 1UMDA 3RJTA 4ASUA 4RSRA 2D5LA 2JLXA 2C8JA 1SFRA 5BYBA 1XCJA 3QKIA 5FA8A 1MOSA 3ZHQA 2RH9B 4D99A 4DCPA 5FI0B 2CE2X 3WGJA 1ISGA 1O95C 5HFAA 3MEQA 4FN4A 4D92A 4DQVA 4N65A 4L28A 3RU7A 4K8OA 2VIIA 4M4SA 1XFDA 1E4VA 2FSVA 1FRVA 2BBWA 1ZOLA 4I99A 2DBVO 1CWUA 2EDCA 2Q3LA 5BORA 2WTAA 1EJ0A 3TZ6A 1JG2A 3MJEA 3EMVA 1GGZA 4R1MA 3I34X 3WLNA 1C7ZA 1YT5A 4RSHA 4WOKA 2Z2JA 5EQTA 5C5EA 4U8HA 5HM8A 3VKFA 3R24A 2QQFA 4GVPA 5BNWA 4PLGA 4YPOA 4YUZA 3WLTA 3KUUA 1E32A 1Y1PA 1YKGA 3RUAA 1Z75A 3O95A 1GGNA 4HNAB 3TZLA 5J9FA 4ORBB 4AU1A 3KQVA 5DXAA 1CZUA 3QH4A 2DWPA 5F21A 1N6LA 2O2EA 2ABWA 1E0JA 5K6AA 5KHLB 1KRWA 4KDCA 2EIXA 3E6AA 2W43A 3AJAA 4L51A 1M76A 4I5KA 3SI7A 1T2NA 1T2AA 4JJGA 2XUOA 4IHJF 1T5DX 2WBLC 3CXRA 4RVNA 4BTLA 4FFSA 1C9YA 3ETLA 4F11A 2LVJA 3QFCA 3C1AA 3L7JA 2VNSA 3P9ZA 1IVNA 1LBTA 4R7ZA 3HA5A 2OORA 4AICA 2ZU0C 4N3AA 1ZRSA 3IMKA 1SCKA 3S5JA 5HMMA 4Y2GA 2C8LA 4F46A 3BOSA 4RK6A 1EFTA 5HFJA 3VKUA 1M6VA 5B36A 4DC1A 4PCUA 2F1IA 3QVSA 3LBIA 5A05A 1H3FA 2I0FA 1JSLA 2VK8A 3GGPA 3AY6A 3BTUA 3RV4A 5FYDA 2QZJA 1I5OA 5KYXB 3ZHRA 1Y6RA 4MYHA 2YWGA 1R5OA 5TEWA 3TPCA 1FVHA 3SBOA 3ESBA 1ZY2A 4H9GA 3AP3A 2G9VA 2WOSA 1NMXA 2JHGA 5ALGA 4GNRA 4H0CA 5IUKC 4LXUA 2JLUA 1TK9A 4AKTA 1GXSB 2EKDA 5AK5A 4NS4A 1GKKA 2ZSBA 2DLCX 1SHKA 4MKIA 5DN6D 1AJ5A 3BM5A 4BWVA 4YYZA 3BE8A 1DIBA 4DR5B 5IRCD 1JG6A 1SXJA 3BWBA 5EKDA 2F3PA 1ARZA 3RJ9A 3KUDA 5CRIA 1LF5A 4UU0A 3MIIA 2RGIA 1KI2A 2F2PA 1G3IA 2CXHA 1L9KA 2GZSA 1YK1A 3CH6A 3Q8WA 1JXQA 5JQGB 1R3DA 3ZV5A 2FPIA 4FYJA 3IJEB 4JWTA 5AXBA 3KB1A 4FWBA 2A4MA 1WEHA 3E9ZA 4WXMA 3WB2A 4R1EA 1YSCA 3WNQA 3P0EA 1KSFX 4IOLA 1CKKA 1LK5A 3BQMB 2GNOA 1G1AA 1EFVB 2VUUA 1JFKA 1KWOB 1JV2B 1XMSA 1Y7LA 4B32A 1M34A 3X1DA 3WX0A 1CUSA 3ILHA 4LRUA 1A7KA 3FNIA 5A62A 1Q1GA 3RSQA 3GAMA 5F98A 3KKMA 3WRXA 2FMIA 3GLRA 3ELBA 1TZMA 3GFFA 1WUTA 2PDAA 4Y9RA 4OHKA 1QVAA 1ZHOA 2F00A 1LQUA 4EFMA 1YKSA 3SDSA 1SO8A 1WRKA 1MXFA 3BMNB 1DAKA 1XCBA 1NRJB 4TL9A 4UOZA 1CUDA 4N3BA 2WUGA 3AL2A 2XUDA 4F71A 1PVDA 1DX4A 1ZG3A 3AJDA 5GJBA 2Q0HA 4RLFA 1AQ6A 2ZQYA 2PYZA 3AEKA 4OLHA 1JQEA 1F8YA 2BHRA 1H65A 3D6MA 1F70A 1XTZA 3OM9A 2ZB2A 2YS6A 2RDMA 5FB3A 5DHPA 1QP0A 3PQDA 4S1OA 3BH0A 4PXAA 4TLAA 3MW8A 1L5WA 1T9ZA 3W3AD 5BN3A 3KTAB 1BD3A 2F3YA 4H0NA 1AZWA 1LVHA 2J5RA 2QWXA 3KTOA 4MI9A 5I6DA 2IPXA 3K09C 4BMPB 2YJNA 5M7EA 3AEXA 1IK4A 3W34A 2Q5QA 3VPHA 4CMJA 1OBHA 3EOZA 2FPUA 2R6GA 3BHIA 3V42A 5TY0A 1UMKA 2DHQA 1QVVA 3SHQA 2PYIA 5IDXA 4YJ2A 1OCEA 4MJ7A 1SOAA 1QG4A 4HAVA 3HCNA 3CX3A 4ZICA 4QATA 1P4JA 1FFHA 4ZZ2A 3DOUA 2HK8A 3EG9A 1W85B 4P80A 1SCAA 5I7EA 2E87A 5KCMA 1ODIA 4BEBA 3UH0A 1F06A 3R44A 1SL7A 4MV5A 5H9WA 1UOEA 5H81A 4NDZA 4DYVA 4HDOB 2WIFA 1FDVA 2C4KA 5JXJA 4IIJA 5K7SA 1GGMA 2P41A 2BLLA 4JFRA 1GNQA 5BYKA 1L8AA 2HBRA 2BCGY 1L8OA 1DUSA 4EYOA 5JSUA 3KL4A 3PC8C 3IR5A 5I8ZA 5CFPA 1SBQA 1C80A 4TMYA 4O25A 2JTTA 2FUNB 2AYXA 2H2KA 2PY6A 4NV0A 2X4IA 1LPSA 1DHTA 1PT5A 4FNAA 2ONCA 2N46A 1GGKA 4KRYA 4PCLA 5EHIA 2WWIA 4JJ6A 5HWSA 4P4TA 3L9WA 2QVYX 2IP2A 2XTAA 2BMAA 3QMEA 1ZGHA 5BWLA 3B36A 3ET5A 4IY1A 4MRSA 5KTKA 1YWGO 1Z68A 1KJYA 3BN3A 1NBOA 1SIBE 4LY6A 4Y2VA 1WZCA 2DUWA 4ZK2A 2JHFA 1U0SY 3G88A 1NUSA 3VDXA 4EABA 3KHUA 3D3QA 4UM9D 5KYWB 1GZ7A 1NWHA 2H52A 2XOKA 2Q4OA 1LGYA 3F6SA 2QVZX 4Z9XA 5EUMA 3L6DA 4UU8A 4X1OA 3BSYA 1OW3B 4X24A 2GAAA 1V47A 5LZ4A 2JGDA 1Z8DA 4OHYA 5BXQC 3IL2A 4X92A 3JATB 1DKLA 2C5SA 3T0GA 1SQ0A 1Y34E 4Q47A 3GEMA 1Y5MA 1GL3A 3FVWA 1L3BA 4GKAA 1NCZA 2FLWA 2VP9A 1BU3A 3CM0A 3ZHSA 4DQUA 3DL4A 3JVUA 3P27A 2NTEA 1N8KA 5HCIA 3VR3A 2YICA 3OZEA 2P1RA 3LQYA 1P5FA 4MR8A 1D4OA 1QV7A 2GZAA 2QAJA 1Z4JA 5IBCA 1GARA 4BRUA 4Y3UA 1GA6A 3EASA 4RH3A 1WLSA 5JDIC 2DXIA 2HGSA 3S5UA 2IHBA 1BCSB 3DVMA 4B6PA 1CUGA 3ZU6A 2CCGA 2VLIA 1PX2A 3K92A 5DM70 4L9SA 3TJMA 3A6JA 2G7MC 3EXAA 2JULA 5F4ZA 4YRAA 3B70A 1HT1E 4GVLA 3H5RA 1JVNA 4XDZA 2WOOA 1EXWA 4JUBA 5BYAA 2BFCA 2JAWA 4MINA 3TZEA 1XK4A 1C3XA 2OLJA 2FPMA 1SC4A 1AP4A 2CXSA 5JXHA 2Q3HA 4HSEA 2NN3C 4PZUA 2GPAA 2K60A 1IEWA 1FU7A 4ZHSA 2C42A 4TKUA 1Y5RA 4E2WA 1W5BA 4KQEA 1GLGA 2C58A 3TRFA 4CLHA 3CLRD 3DOFA 1KI4A 4KITB 1ZONA 4M0PA 5C1IA 2XJ4A 3WLFA 2AOUA 2A86A 4QARA 1FFAA 5EFOA 3CEPB 2LANA 4N9QA 2YRFA 4HVAA 4L57A 1VL6A 4CU2A 1XXHB 1O89A 1Y3FE 5AKYA 4TTJA 3HE3A 3T61A 2IPLA 5ENDA 2CKDA 5EZSA 5B12A 4DSUA 2V5AA 3UYKA 1RFLA 3NTRA 1EHIA 3W8DA 4F5ZA 2FQQA 3D0YA 2XNKA 1DWQA 4EHLA 3C4QA 1TIPA 4D6XA 4RPHA 2HPHA 3NEAA 2AX4A 4U7DA 2HMVA 3PFCA 1F8UA 4UNQA 3E9MA 1M1YE 2UXCB 1IY1A 2VXYA 3ZGZA 3LIPA 3BZWA 5WRFA 4H3VA 4D0SA 1CUAA 2GAIA 4DLZA 3WNDA 1F14A 1CUXA 3EDQA 3DHEA 4RQAA 2II6A 4L8FA 1BFKA 1SN7A 4FU0A 1GFWA 1O6FA 3K9WA 1K1EA 2TYSB 3VZRA 3U09A 2RGXA 3VGOA 3U4HA 5E1MA 4C6RA 3FKJA 3RFUA 3HKCA 4TWAA 4HY3A 2JKZA 2QSZA 4LTMA 3Q15C 3PVSA 3A3YA 1Z7BA 2IPMA 2JOJA 3KSBC 3QLVA 2CFIA 2CL0X 3EOAI 3S2ZA 3ENZA 5JH7B 2HY7A 2WG0A 3FYUA 1CZLA 3M0EA 4J1NA 5ICEA 1SQ6A 4YRNA 2RGDA 3LC1O 1I7DA 1CQJB 3MB8A 3ES9A 2YN2A 4MS1B 1FP4A 2NU8B 1SHLA 4K3VA 3AUAA 1GUFA 1W9ZA 2ZBPA 1BA2A 2PZEA 4F91B 1TIZA 5AW1A 4DBLC 4N7BA 1U90A 2O3JA 5FPHA 4WESA 3A3KA 2ZI7A 5J1TB 3GK4X 3SBDA 4UBLA 3TG2A 1XZNA 3WFJA 3VYRB 5CG2A 1F4QA 1QE5A 4PPGA 3JQAB 3I01M 1GDDA 4YGAA 1MT3A 2GA9A 3WK9A 1YE5A 3GF4A 3R3WA 1QLSA 2HDHA 1VSBA 3WNBA 1Q77A 2HU8A 4BKRA 1XDGA 3U1TA 1UKVY 4X61A 3LX5A 3FM9A 2M1KB 4RKRA 2ZFDA 2DUNA 3GD5A 1EAMA 4AUEA 5BR4A 2WWHA 2QT0A 4GGFC 4UPEA 5FBVB 5K03A 4DIFA 4FDTA 2Z08A 1GYRA 2ZQZA 1JAZA 1BKSB 4UUMA 1UK9A 1LLQA 4C7KA 2BMDA 4UM5A 4QYIA 1G4AE 3S3TA 4OQFA 5IKPA 3I8XA 5JNTA 3QVGB 2BNXA 4G26A 1A27A 4GL4A 1XJQA 2PJZA 3VNRA 3B1ZA 1L5OA 1XVIA 1G5QA 2VH1A 1Y82A 1MJNA 5CFRA 3CE9A 3C3JA 3OESA 3VXKA 1JB1A 1P1KA 1BXZA 1N1GA 4JBLA 2V3WA 3U7QB 1P0CA 2QI9F 3UB2A 2P35A 4B6RA 5CH5A 2UXBB 3V2IA 1G6HA 1SU6A 2BW0A 2XA9A 1T9GR 3EA4A 2XWSA 4GOOD 1XZDA 4KB5A 3OFNA 1P3DA 1PK8A 2QX6A 4MQFA 1UL1X 2LVVA 2Q0QA 1SCBA 1B73A 3A10A 2YZKA 2FQYA 3QXSA 3DLPX 3FNRA 3S4YA 3TLGA 2ZPTX 2HNAA 4FUQA 4MVJA 5FUMA 2Q6VA 2NP7A 3KQNA 1BH2A 2Q49A 4YJKA 3LHFA 2F9FA 4IDCA 1VPLA 3CJTA 3BSSA 1B41A 3TOVA 2F43B 4M6WB 4P4SA 1PL0A 2VYND 3RGWS 3KKLA 2VA9A 4HWOA 4IQ8A 3H13A 2C3UA 2H85A 2K7DA 2LLTA 3VSBA 2C00A 4D3DA 1R6VA 3ZU5A 4KAJA 1WBDA 4BGDA 4KO3S 2G8LA 4RV5A 3PR3A 1RT9A 5G3YA 1SKQA 2LKDA 3OOSA 2WG1A 3Q6NA 1UEJA 2GEFA 2GBLC 5FR1A 1F2UB 1PLKA 1SD5A 3TCXB 2CSUA 5I7UA 3GIWA 3OKPA 3SR3A 5LB4A 5DBFA 5FFMA 1PU2A 1YMVA 1ZSYA 4BU1A 3PQ2A 4L8YA 1ODKA 2XYPA 1UMCB 4PN3A 3VU8A 5TNCA 3VPSA 5SZHB 1N1MA 4JGGA 2PBZA 4IFBA 3A7EA 1Y6QA 1CP3A 4KPUA 3I28A 3VPDA 2JLWA 1K8RA 1QH1B 1DELA 4IIHA 1ZRMA 1M2WA 3STVA 4BV3A 4N6NA 2W6OA 3RYHA 3SJSA 4DUZB 1ECJA 4ITRC 1PJBA 3ZDAA 3K8ZA 4NZYA 1Z8FA 4EA9A 3R7WB 4D0LB 1WCIB 1P4GA 4MLWA 4LBWA 4YXWA 5EN4A 3NBQA 3IRVA 1QIFA 2WSSA 1TEHA 3QMWA 3COJA 1MF7A 5KNCH 3M4XA 1ZUIA 4E12