3IQOA

1.5 angstrom x-ray structure of bovine ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The Effects of CapZ Peptide (TRTK-12) Binding to S100B-Ca(2+) as Examined by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 31
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3iqoA00
5CPVA 1F54A 1QLKA 1W7JB 3M0WA 2PALA 2WCFA 1CDMA 2H61A 4PCWA 1WRLA 3KO0A 1SCMB 4MEWA 2M7LA 3DD4A 1RROA 2K7BA 3SG2A 1IQ3A 3D0YA 4HRGA 4GNKB 1M31A 1JFKA 3PM8A 2PASA 1KSMA 2QACA 4MLWA 1SKTA 1KWOB 1FI6A 1QV1A 1CMFA 2OTGB 1G33A 2LVIA 1G4YR 2JXLA 1IJ5A 3A8RA 3DF0A 3SG5A 4YGDB 4I5LB 4YGCB 1S6IA 1A75A 2K2FA 1B9AA 1QV0A 2JC2A 2Q91A 2QPTA 5HLVA 1B8CA 1FPWA 3CZTX 5J3XA 3AAKA 1YRTB 2E30A 2LNKA 1MUXA 3OP0A 5I2OA 1K95A 1SR6B 2LLUA 1FW4A 1DGVA 2DOQA 2Q4UA 3ZNIA 4CFRA 1J7PA 1ALVA 2CXJA 1S6JA 4GPLB 4YI8A 2LC5A 1E8AA 2A4JA 1FI5A 4CPVA 4XJKB 4C0KA 2H2KA 2LANA 1K96A 1A2XA 1SBJA 2K2AA 2LLSA 3BQ3A 3EK8A 3JVTB 3IQQA 3TUYC 2LHIA 2KYFA 2TN4A 1NX3A 5DKNA 3WHUB 1ODBA 3HX4A 2K8MB 3K21A 2HPSA 3MSEB 4N5XA 3ZWHA 1C7VA 3ICBA 4MSPA 1VRKA 2KQ6A 3BUXB 2JULA 2GV5A 1F4QA 2KFFA 3E3RA 2PMYA 4ZCUA 1XFYO 1SPYA 3EKJA 3JTDC 1XK4C 1CB1A 3BXKA 2AUCA 1YUUA 3CLNA 1R2UA 2M97A 3DVEA 3SIAA 1CFPA 1AHRA 3KF9A 5JJGA 2LMVA 2PSRA 1CKKA 1J7OA 1NCXA 4XYNA 5PALA 1K9PA 1DVIA 1SRAA 3VROA 2HQWA 4PALA 1B1GA 4HRHA 3EKHA 2HQ8A 2K7OA 4JQ0D 1BJFA 1IG5A 1S1EA 2JQ6A 4PHMA 1BODA 2P6BB 1CMGA 2CTNA 2F8PA 2ZKMX 3LK1A 3PATA 1ZMZA 1UHJA 2FCEA 2LP2A 4MZLA 5HKZA 4BY4A 5BPJA 5G08A 5ER5A 5I2LA 1IQ5A 3O2PA 1GJYA 1W7IB 2M9GA 3VRQA 1RWYA 2Y4QA 2LUCA 1UHNA 2OPOA 2KYCA 4HREE 4JPZB 1YVLA 5F6TA 2LMTA 3C1VA 1SNLA 3SG3A 2EC6B 3OB1B 1M45A 3SG4A 1MF8B 2JOJA 4PE7A 1CNPA 5I2QA 1BR1B 4GUKA 2KQYA 1DF0A 1F4OA 2FOTA 1J1EA 1SL7A 4AQJA 4PE4A 3D10A 2EHBA 1ZOTB 1BU3A 2JT8A 3HCMA 1XFZO 5B8IB 1EXRA 3GK1A 3EVVA 1QJTA 2MA2A 4UPGA 1U5IA 1M63B 2KAXA 2BBMA 3WXAA 3CR4X 3FS7A 3I5IB 1KFXS 1SW8A 4HSZA 4TNCA 1X02A 1SYMA 1AP4A 1GQMA 2SCPA 4Q04A 2JPTA 4AOMA 5D69A 2BBNA 1UWOA 3RM1A 3OHMB 4YBHB 4DUQA 5HKYA 1H8BA 1K2HA 1KCYA 1WRKA 1J55A 4FQOA 4XJKA 1CLMA 3NSKA 3GOFA 1CFDA 2IS9A 3O6BA 5AFPA 4N1GA 4I5JA 1AVSA 1DJXA 1NX0A 4ETOA 1JF2A 1C07A 2AAOA 5IBWA 2ZNEA 1ZUZA 1IJ6A 1YR5A 1S3PA 1RK9A 1PK0D 1XFWO 3JVTC 1ZFSA 1DT7B 4QJ3B 3AKAA 2KI6D 1LVCD 1JSAA 2KAVA 4GGFC 5ER4X 2WCBA 1S36A 2K61A 2SASA 2M29A 3LCPC 5DKQA 1CDNA 1F70A 1ZACA 5GQQC 1TNXA 1GGZA 1UUSA 3FWBA 1S6CA 3KEVA 4M2PA 1IWQA 1NCYA 1A4PA 1QLSA 3CWGA 4GAOA 1FBVA 1XFXO 1QX2A 1Y1AA 1QX7A 1J7QA 1KQMC 4L9MA 3TS5B 1OSAA 1L2OC 4YRUA 3SJSA 2ZNDA 1K9UA 2MRDA 2ISDA 4FTGA 4A4BA 1OQPA 2ZRSA 3TDIA 3H4SE 5CSJA 1TCFA 1IGVA 2K7DA 2KI4B 1YURA 3PFVA 2MLEC 2L50A 5K89A 1RFJA 2KHNA 4MN0A 3BOWB 5FYXA 2I18A 4ORCB 1A03A 2JNXA 1BT6A 2LM5A 1BOCA 1K9KA 1OMVA 1JFJA 1YUTA 2M3WA 3VGOA 2COLB 2M8UA 2WNDA 1MQ1A 1XK4A 2EGDA 2KNEA 2R2IA 3BYAA 1Y6WA 2CCMA 4F0ZB 3I5GC 4YGBB 1C7WA 4PHKA 4YI9A 2BKHB 2I7AA 2JT3A 1CFFA 2GGMA 1TNWA 1TIZA 1WLMA 1UHKA 2EC6C 3BUWB 3BUMB 4NDDA 2F3ZA 4QJ5B 1JF0A 1KK8B 4QJ4B 1JWDA 1F71A 1OMRA 5AANA 4R1EA 3CR2A 1MXLC 1KQMB 3DVMA 4D1EA 1NYAA 1EG3A 1M39A 1QVIY 4OCIA 1L2OB 1K94A 2G2BA 1EH2A 1RTP1 3BUOB 4BY5A 1R6PA 1UURA 4M2QA 2I94A 1HQVA 1FF1A 2MLFC 1YRUB 2ZN9A 2BKIB 3DVKA 2KBIA 2ZN8A 5HYDA 3I5IC 2JTTA 3I5HB 1B47A 1BR4B 4WQ2A 3SG7A 1XA5A 2BE6A 1QIVA 4GGNA 1K90D 5TNCA 1DJYA 2LV7A 4NDBA 1JC2A 1V1GA 2M1UA 1Q80A 1CFCA 2OS8C 2JT0A 3GK4X 1OZOA 1QVIZ 5DKRA 3I5GB 2NCPA 1LA3A 3FIAA 1QTXA 1Y1XA 3NSLA 2JTZA 1WRZA 3CR5X 1SK6D 1CLLA 2LVVA 1PVBA 2VRGA 1PALA 1YUSA 2B1UA 3OX5A 2WC8A 1Y1UA 4PE1A 2LAPA 3OX6A 5I8NA 1NX2A 4I5KA 1K93D 1XVJA 5CSFA 1F8HA 1SMGA 1OMDA 2HETA 3SG6A 1SL8A 3BUNB 4DRWA 5AXIA 4WRIA 1EJ3A 1B7TY 3A4UB 1XO5A 5KU1A 2L4IA 4OV2A 1WDCC 2BECA 1OOJA 4NQGA 3IF7A 1CTRA 2M7NA 2M0RA 2OS8B 1YVHA 3TS5C 3BOWA 1KFUS 3EK4A 1EG4A 3VRRA 1QX5B 2HF5A 4OKHA 3TDUA 2L2EA 2O60A 1S26D 2KI4C 1UHIA 2BCAA 2BCXA 4GGFA 3TZ1A 4N1FA 1B7TZ 3PSRA 1DTLA 4PHNA 1NP8A 2AMIA 2WOSA 3I5FC 3SIBA 2RGIA 3CTNA 2LUXA 1KFXL 3EVUA 4ORAB 1J1DA 2F2OA 3VRPA 1MHOA 3LL8B 5AERA 1YX7A 1KK7Y 2LLTA 3EK7A 2BL0B 2M49B 4C0JA 1SL9A 4DCKA 2JRFA 1G8IA 1B8RA 3NSOA 4PE0A 1UP5A 1WDCB 2LVKA 3EVRA 2MAZA 2KAYA 1TNPA 1KK8C 1BF5A 2KFGA 2KGRA 1TN4A 1TOPA 2K0JA 1QS7A 2KI6C 1CM1A 1DJHA 2NLNA 1NSHA 4P2YB 2LCPA 1NCZA 2D8NA 3TDZA 2G9BA 1KK7Z 1YTZC 1A29A 1PVAA 1CDPA 2H61C 2JWWA 1QASA 2CNPA 2LVJA 2KOTA 3GK2A 4I5NB 4JWQA 1SY9A 1LINA 1OZSA 1DF0B 2ZFDA 4ICBA 2MBXA 1BLQA 1BG1A 2E6WA 1NWDA 3FWCA 3I5HC 5AEQA 2BE4A 3I5FB 1TNQA 1JBAA 1DJIA 3NXAA 4DS7A 2PVBA 4YGEB 1N65A 4A4CA 1F55A 2L51A 2I2RE 4U8DA 3WHTB 1MR8A 3AAJA 1U5IB 1DMOA 1WY9A 1DJZA 1TRFA 2JNFA 4OVNF 2NCOA 1PRWA 3CGAA 2F3YA 1AJ5A 2CBLA 1DJGA 2NXQA 4MRYA 2Y1NA 1QIWA 1L7ZA 1RJVA 4E68A 2KSPA 3KPXA 1NUBA 1AUIB 1DJWA 4CIDA 1S5GY 2L0PA 1CLBA 3PALA 3AKBA 4CFQA 1BMOA 1H4BA 1B8LA 2KFHA 1NIWA 3D0YB 4OR9B 4AQIA 2JZIA 1OE9B 2KGBC 2L5XB 1AJ4A 4MZKA 4M2OA 3KHEA 5KTYA 5JOLA 1DGUA 2K7CA 2NZ0A 4C0LA 1KQVA 4USLA 4PDZA 5D7FA 3DF0B 1N2DA 1XFVO 1D1OA 1LA0A 1PULA 1RECA 1S5GZ 1KSOA 2LP3A 3NSIA 1PSBA 2WCEA 1B4CA 1PSRA 2Y1MA 2CT9A 5HLOA 2KDHA 1A75B 1EL4A 1HT9A 2V53A 2F2PA 4P5OE 1GGWA 1WLZA 3CS1A 4MBEA 2LE9B 3O4YA 2Y5IA 2JU0A 2ZRTA 4MVFA 4YGAA 1XYDA 4IL1A 5CSNA 3TUYB 4ORBB 1Y0VH 2L98A 1IH0A 2O5GA 2FCDA 2BL0C 1MWNA 2M1KB 3PN7C 4MZJA 4GFTA 2GGZA 1V1FA 3JTDB 3LK0A 1ALWA 1IRJA 3QRXA 5CSIA 4DIRA 1SCMC 2MHHA 2WORA 3F45A 3DVJA 1XFUO 2LMUA 3WNXB 3O78A 4GBAA 3PLFB 3RLZA 1KWOC 5KSZA 1QATA 1TCOB 3OB2B 1MXEA 3LLEA 2LHLA 2OTGC 1AK8A 4NDCA 2PRUA 2F33A 4ZCVA 1J7RA 2FJUB 1NPQA 2BCBA 4WQ3A 1TTXA 1LXFC 1M46A 2L4HA 2KBMA 3VRNA 3IQOA 1CM4A 2MJWB 4PHJA 1NX1A 1UHHA 1YX8A 5HKWA 4CLNA 1IKUA 1K8UA 1N0YA 3PN7B 2JXCA 1JUOA 1CDLA 1LKJA 1SR6C 1SCVA 1KFUL 1QXPA 4MRXA
chains in the Genus database with same CATH superfamily
5CPVA 1F54A 1QLKA 1W7JB 3M0WA 2PALA 2WCFA 1CDMA 2H61A 4PCWA 1WRLA 2WCJA 3KO0A 1SCMB 4MEWA 2M7LA 3DD4A 1RROA 2K7BA 3SG2A 1IQ3A 3D0YA 4HRGA 4GNKB 1M31A 1JFKA 3NHTA 3PM8A 2PASA 1KSMA 2QACA 4MLWA 1SKTA 1KWOB 1FI6A 1QV1A 1CMFA 2OTGB 1G33A 2LVIA 1G4YR 2JXLA 1IJ5A 3A8RA 3DF0A 4JD9A 2YGUA 3SG5A 4YGDB 2K60A 3RZSA 4I5LB 2P71A 4YGCB 1S6IA 1A75A 3D77A 2K2FA 5D3OA 1B9AA 1QV0A 2JC2A 2Q91A 2QPTA 2ERBA 5HLVA 3L47A 1B8CA 1FPWA 3CZTX 5J3XA 3AAKA 1YRTB 2E30A 3D78A 3S0DA 2LNKA 1MUXA 3OP0A 5I2OA 1K95A 1SR6B 2LLUA 1FW4A 1DGVA 2DOQA 2Q4UA 3ZNIA 4CFRA 1J7PA 3S0GA 1ALVA 2CXJA 3BFAA 1S6JA 4GPLB 4YI8A 2LC5A 1E8AA 1OOGA 2A4JA 1FI5A 4CPVA 4XJKB 4C0KA 2H2KA 1DQEA 1K96A 1A2XA 1SBJA 2K2AA 2LANA 2LLSA 2QEHA 3BQ3A 3EK8A 3JVTB 2JPOA 3IQQA 3TUYC 2LHIA 2KYFA 2TN4A 1NX3A 5DKNA 3WHUB 1ODBA 3HX4A 2K8MB 3K21A 2HPSA 3MSEB 4N5XA 3ZWHA 1C7VA 3ICBA 4INXA 3CABA 4MSPA 1VRKA 2KQ6A 3BUXB 3EG5B 2JULA 2GV5A 1F4QA 2KFFA 3E3RA 2PMYA 4ZCUA 1XFYO 1SPYA 3EKJA 3JTDC 1XK4C 1CB1A 3BXKA 2AUCA 3PJIA 1YUUA 3CLNA 1R2UA 2M97A 3DVEA 3SIAA 1CFPA 1AHRA 3KF9A 5JJGA 2LMVA 2PSRA 1CKKA 1J7OA 1NCXA 5DICA 4XYNA 5PALA 1K9PA 1DVIA 1SRAA 3VROA 2HQWA 4PALA 1B1GA 4HRHA 3EKHA 2HQ8A 2K7OA 4JQ0D 1BJFA 1IG5A 1S1EA 2JQ6A 3QMEA 4PHMA 1BODA 3V2LA 2P6BB 1CMGA 2CTNA 2F8PA 2ZKMX 3LK1A 3PATA 1ZMZA 1UHJA 2FCEA 2LP2A 3CZ1A 4MZLA 5HKZA 4BY4A 5BPJA 5G08A 5ER5A 5I2LA 5HL1A 1QWVA 1IQ5A 3O2PA 1GJYA 1W7IB 2M9GA 3VRQA 1RWYA 2Y4QA 3Q8IA 2LUCA 1UHNA 2OPOA 2KYCA 4HREE 4JPZB 1YVLA 5F6TA 2LMTA 3C1VA 4PT1A 1SNLA 3SG3A 2EC6B 3OB1B 1M45A 3SG4A 1MF8B 2JOJA 4PE7A 1CNPA 5I2QA 1BR1B 4GUKA 2KQYA 1DF0A 1F4OA 2FOTA 1J1EA 2GTEA 1SL7A 4AQJA 4PE4A 2QEOA 3D10A 2EHBA 1ZOTB 1BU3A 2JT8A 3HCMA 1XFZO 5B8IB 1EXRA 3GK1A 2FJYA 3EVVA 1QJTA 2L2CA 2MA2A 4UPGA 1U5IA 1M63B 2KAXA 2BBMA 3R72A 3WXAA 3CR4X 3FS7A 3I5IB 1KFXS 1SW8A 4HSZA 4TNCA 1X02A 1SYMA 1AP4A 3DXLA 1GQMA 2SCPA 4Q04A 2JPTA 4AOMA 5D69A 2BBNA 1UWOA 3RM1A 3OHMB 4YBHB 4DUQA 5HKYA 1H8BA 1K2HA 1KCYA 1WRKA 1DELA 1J55A 4FQOA 4XJKA 1CLMA 3NSKA 3GOFA 1CFDA 2IS9A 3O6BA 3B88A 4N1GA 5AFPA 4I5JA 1AVSA 1DJXA 1NX0A 4ETOA 1JF2A 1P28A 1C07A 2AAOA 5IBWA 3S0FA 2ZNEA 1ZUZA 1IJ6A 1YR5A 1S3PA 1RK9A 1PK0D 1XFWO 3JVTC 1ZFSA 1DT7B 4QJ3B 3AKAA 2KI6D 1LVCD 1JSAA 2KAVA 4GGFC 5ER4X 2WCBA 1Z2CB 1F70A 1S36A 2K61A 2H8VA 2M29A 2SASA 3B7AA 3LCPC 2L5YA 1ZACA 5DKQA 5GQQC 1CDNA 1TNXA 1GGZA 1UUSA 3FWBA 1S6CA 3DZTA 3KEVA 4M2PA 1IWQA 1NCYA 1A4PA 1QLSA 3CWGA 4GAOA 1FBVA 1XFXO 1QX2A 1Y1AA 1QX7A 1J7QA 1KQMC 4L9MA 3TS5B 1OSAA 1L2OC 4YRUA 3SJSA 2ZNDA 1K9UA 2MRDA 2ISDA 4FTGA 4A4BA 1OQPA 3R1OA 2ZRSA 3OBVA 3TDIA 3H4SE 5CSJA 1TCFA 1IGVA 2K7DA 2KI4B 1YURA 3PFVA 2MLEC 2L50A 5K89A 1RFJA 2KHNA 4MN0A 3L4AA 3BOWB 5FYXA 2I18A 4ORCB 1A03A 2JNXA 1BT6A 2LM5A 1BOCA 1K9KA 1OMVA 1JFJA 1YUTA 1OOFA 2M3WA 2COLB 2M8UA 2WNDA 3VGOA 1MQ1A 1XK4A 3R1VA 1OOIX 2EGDA 2KNEA 2R2IA 2WCMA 3BYAA 1Y6WA 2CCMA 4F0ZB 3I5GC 4YGBB 3SS3A 1C7WA 4PHKA 3B86A 2BKHB 4YI9A 1GM0A 2I7AA 2JT3A 1CFFA 2GGMA 1TNWA 1TIZA 1WLMA 1UHKA 2EC6C 3BJHA 3IVTA 1DC1A 3BUWB 3BUMB 4NDDA 2F3ZA 4QJ5B 2KPHA 1JF0A 1KK8B 4QJ4B 1JWDA 1F71A 1OMRA 5AANA 4R1EA 3CR2A 1MXLC 1KQMB 3DVMA 4D1EA 1NYAA 1EG3A 1M39A 1QVIY 2WCLA 4OCIA 1L2OB 1K94A 1OOHA 2G2BA 1EH2A 1RTP1 1Z4HA 3BUOB 3SS5A 1R6PA 4BY5A 1UURA 4M2QA 2I94A 1HQVA 3SS4A 2MLFC 1FF1A 1YRUB 2ZN9A 2BKIB 3DVKA 2KBIA 2ZN8A 4INWA 5HYDA 3I5IC 2WC6A 2JTTA 3I5HB 1B47A 1BR4B 4WQ2A 3SG7A 1XA5A 1TUZA 2BE6A 1QIVA 4GGNA 3K1EA 5I94A 3PM2A 1K90D 5TNCA 1DJYA 2LV7A 4NDBA 1JC2A 1V1GA 2M1UA 1Q80A 1CFCA 2OS8C 1IIOA 3NHIA 2JT0A 3GK4X 1OZOA 1QVIZ 5DKRA 3I5GB 2NCPA 1LA3A 3FIAA 1QTXA 1Y1XA 5EL2A 3NSLA 2JTZA 1WRZA 3OGNA 2BAPA 1TWOA 3CR5X 2KLEA 1SK6D 3VB1A 1CLLA 2LVVA 1PVBA 2VRGA 1PALA 1YUSA 2B1UA 3OX5A 2WC8A 1Y1UA 4PE1A 2LAPA 3FE8A 3OX6A 5I8NA 1NX2A 4I5KA 1K93D 1XVJA 5CSFA 1F8HA 2WC5A 1SMGA 1OMDA 2HETA 3SG6A 1SL8A 3BUNB 4DRWA 5AXIA 1LS8A 4WRIA 1EJ3A 1B7TY 3A4UB 1XO5A 5KU1A 2L4IA 1T14A 4OV2A 1WDCC 2BECA 1OOJA 4NQGA 3IF7A 1CTRA 2M7NA 3BFBA 2M0RA 2OS8B 1YVHA 3TS5C 3BOWA 1KFUS 3EK4A 1EG4A 2WCKA 5FI2A 1QX5B 3VRRA 2HF5A 4OKHA 4F7FA 3D75A 3TDUA 2L2EA 2O60A 1S26D 2KI4C 1UHIA 2BCAA 2BCXA 4GGFA 3TZ1A 4N1FA 3S0EA 1B7TZ 3PSRA 1DTLA 4PHNA 1NP8A 2AMIA 2WOSA 3I5FC 3CZ2A 4JKTA 3SIBA 2RGIA 3CTNA 3D73A 2LUXA 1KFXL 3EVUA 4ORAB 1J1DA 2F2OA 3VRPA 1MHOA 3LL8B 5AERA 1YX7A 1KK7Y 2LLTA 3EK7A 2BL0B 2M49B 4C0JA 1SL9A 4DCKA 3S0BA 2JRFA 1G8IA 1B8RA 2PQLA 3NSOA 4PE0A 1UP5A 1WDCB 2LVKA 3EVRA 2MAZA 2KAYA 1TNPA 1KK8C 1BF5A 2KFGA 2KGRA 1TN4A 2PYQA 1TOPA 2K0JA 1QS7A 2QEVA 2KI6C 3CDNA 1CM1A 1DJHA 2NLNA 1NSHA 4P2YB 2LCPA 1NCZA 2D8NA 3TDZA 2G9BA 1KK7Z 1YTZC 1A29A 1PVAA 1CDPA 2H61C 1DEKA 1QASA 2CNPA 2JWWA 2KOTA 2LVJA 3GK2A 4I5NB 1SY9A 1LINA 1OZSA 1DF0B 2ZFDA 3R1PA 4ICBA 4JWQA 1BG1A 1BLQA 2E6WA 1NWDA 3D76A 3FWCA 3I5HC 5AEQA 2BE4A 3I5FB 1TNQA 1JBAA 4KYNA 1DJIA 3NXAA 4DS7A 2PVBA 4YGEB 1N65A 4A4CA 1F55A 2L51A 2I2RE 4U8DA 2QEBA 3WHTB 1MR8A 3AAJA 1U5IB 1DMOA 1WY9A 1DJZA 1TRFA 2JNFA 4OVNF 2NCOA 1PRWA 3CGAA 1ORGA 2F3YA 1AJ5A 2CBLA 3UNWA 1DJGA 3CZ0A 2NXQA 4MRYA 2Y1NA 1QIWA 1L7ZA 1RJVA 4E68A 2KSPA 3KPXA 1NUBA 1TUJA 3UO9A 1AUIB 1C3ZA 2MBXA 1DJWA 1XFRA 4CIDA 1S5GY 2BNXA 2L0PA 3PALA 1CLBA 5FI7A 3AKBA 4CFQA 1BMOA 1SSEB 1H4BA 1B8LA 2KFHA 4OZDA 1NIWA 3D0YB 4OR9B 1OW4A 2JZIA 1OE9B 2KGBC 2L5XB 4AQIA 1AJ4A 4MZKA 4M2OA 3KHEA 5KTYA 5JOLA 1DGUA 2K7CA 2NZ0A 4C0LA 2P70A 1W9ZA 3DY9A 1KQVA 4USLA 4PDZA 5D7FA 4IJ7A 3DF0B 1N2DA 1XFVO 3FE9A 1D1OA 1LA0A 1PULA 1RECA 1S5GZ 1KSOA 2LP3A 3NSIA 1PSBA 2WCEA 1B4CA 1PSRA 3D74A 2Y1MA 2CT9A 5HLOA 2KDHA 1A75B 1EL4A 1HT9A 2QDIA 2F2PA 2V53A 4P5OE 1WLZA 3S0AA 3CS1A 1GGWA 4MBEA 2LE9B 3O4YA 2Y5IA 2JU0A 3N7HA 3B87A 2ZRTA 4MVFA 4YGAA 1XYDA 4IL1A 5CSNA 3TUYB 3BFHA 4ORBB 1Y0VH 2L98A 1IH0A 2O5GA 2FCDA 2BL0C 1MWNA 2M1KB 3PN7C 4MZJA 5FI6A 4GFTA 2GGZA 1V1FA 4FQTA 3JTDB 3LK0A 1ALWA 1IRJA 3QRXA 5CSIA 4DIRA 1SCMC 2MHHA 2WORA 3NGVA 3F45A 3DVJA 1XFUO 2LMUA 3WNXB 3O78A 4GBAA 3PLFB 3RLZA 1KWOC 5KSZA 1QATA 3B6XA 1TCOB 3OB2B 3O4XA 1MXEA 3LLEA 2LHLA 2OTGC 1AK8A 3FE6A 4NDCA 2PRUA 2F33A 4ZCVA 1J7RA 2FJUB 1NPQA 2BCBA 4WQ3A 1TTXA 1LXFC 3CYZA 1M46A 2L4HA 2KBMA 3VRNA 3IQOA 1CM4A 2MJWB 1C3YA 3DYEA 1NX1A 4PHJA 1UHHA 1YX8A 5HKWA 4CLNA 1IKUA 1K8UA 1N0YA 3PN7B 2KLDA 2JXCA 2WCHA 1JUOA 3L4LA 1CDLA 1LKJA 1SR6C 1SCVA 1KFUL 1QXPA 4MRXA
chains in the Genus database with same CATH topology
5CPVA 1F54A 1QLKA 1W7JB 3M0WA 2PALA 2WCFA 1CDMA 2H61A 4PCWA 1WRLA 3KO0A 1SCMB 4MEWA 2M7LA 3DD4A 1RROA 2K7BA 3SG2A 1IQ3A 3D0YA 4HRGA 4GNKB 1M31A 1JFKA 3PM8A 2PASA 1KSMA 2QACA 4MLWA 1SKTA 1KWOB 1FI6A 1QV1A 1CMFA 2OTGB 1G33A 2LVIA 1G4YR 2JXLA 1IJ5A 3A8RA 3DF0A 3SG5A 4YGDB 4I5LB 4YGCB 1S6IA 1A75A 2K2FA 1B9AA 1QV0A 2JC2A 2Q91A 2QPTA 5HLVA 1B8CA 1FPWA 3CZTX 5J3XA 3AAKA 1YRTB 2E30A 2LNKA 1MUXA 3OP0A 5I2OA 1K95A 1SR6B 2LLUA 1FW4A 1DGVA 2DOQA 2Q4UA 3ZNIA 4CFRA 1J7PA 1ALVA 2CXJA 1S6JA 4GPLB 4YI8A 2LC5A 1E8AA 2A4JA 1FI5A 4CPVA 4XJKB 4C0KA 2H2KA 2LANA 1K96A 1A2XA 1SBJA 2K2AA 2LLSA 3BQ3A 3EK8A 3JVTB 3IQQA 3TUYC 2LHIA 2KYFA 2TN4A 1NX3A 5DKNA 3WHUB 1ODBA 3HX4A 2K8MB 3K21A 2HPSA 3MSEB 4N5XA 3ZWHA 1C7VA 3ICBA 4MSPA 1VRKA 2KQ6A 3BUXB 2JULA 2GV5A 1F4QA 2KFFA 3E3RA 2PMYA 4ZCUA 1XFYO 1SPYA 3EKJA 3JTDC 1XK4C 1CB1A 3BXKA 2AUCA 1YUUA 3CLNA 1R2UA 2M97A 3DVEA 3SIAA 1CFPA 1AHRA 3KF9A 5JJGA 2LMVA 2PSRA 1CKKA 1J7OA 1NCXA 4XYNA 5PALA 1K9PA 1DVIA 1SRAA 3VROA 2HQWA 4PALA 1B1GA 4HRHA 3EKHA 2HQ8A 2K7OA 4JQ0D 1BJFA 1IG5A 1S1EA 2JQ6A 4PHMA 1BODA 2P6BB 1CMGA 2CTNA 2F8PA 2ZKMX 3LK1A 3PATA 1ZMZA 1UHJA 2FCEA 2LP2A 4MZLA 5HKZA 4BY4A 5BPJA 5G08A 5ER5A 5I2LA 1IQ5A 3O2PA 1GJYA 1W7IB 2M9GA 3VRQA 1RWYA 2Y4QA 2LUCA 1UHNA 2OPOA 2KYCA 4HREE 4JPZB 1YVLA 5F6TA 2LMTA 3C1VA 1SNLA 3SG3A 2EC6B 3OB1B 1M45A 3SG4A 1MF8B 2JOJA 4PE7A 1CNPA 5I2QA 1BR1B 4GUKA 2KQYA 1DF0A 1F4OA 2FOTA 1J1EA 1SL7A 4AQJA 4PE4A 3D10A 2EHBA 1ZOTB 1BU3A 2JT8A 3HCMA 1XFZO 5B8IB 1EXRA 3GK1A 3EVVA 1QJTA 2MA2A 4UPGA 1U5IA 1M63B 2KAXA 2BBMA 3WXAA 3CR4X 3FS7A 3I5IB 1KFXS 1SW8A 4HSZA 4TNCA 1X02A 1SYMA 1AP4A 1GQMA 2SCPA 4Q04A 2JPTA 4AOMA 5D69A 2BBNA 1UWOA 3RM1A 3OHMB 4YBHB 4DUQA 5HKYA 1H8BA 1K2HA 1KCYA 1WRKA 1J55A 4FQOA 4XJKA 1CLMA 3NSKA 3GOFA 1CFDA 2IS9A 3O6BA 5AFPA 4N1GA 4I5JA 1AVSA 1DJXA 1NX0A 4ETOA 1JF2A 1C07A 2AAOA 5IBWA 2ZNEA 1ZUZA 1IJ6A 1YR5A 1S3PA 1RK9A 1PK0D 1XFWO 3JVTC 1ZFSA 1DT7B 4QJ3B 3AKAA 2KI6D 1LVCD 1JSAA 2KAVA 4GGFC 5ER4X 2WCBA 1S36A 2K61A 2SASA 2M29A 3LCPC 5DKQA 1CDNA 1F70A 1ZACA 5GQQC 1TNXA 1GGZA 1UUSA 3FWBA 1S6CA 3KEVA 4M2PA 1IWQA 1NCYA 1A4PA 1QLSA 3CWGA 4GAOA 1FBVA 1XFXO 1QX2A 1Y1AA 1QX7A 1J7QA 1KQMC 4L9MA 3TS5B 1OSAA 1L2OC 4YRUA 3SJSA 2ZNDA 1K9UA 2MRDA 2ISDA 4FTGA 4A4BA 1OQPA 2ZRSA 3TDIA 3H4SE 5CSJA 1TCFA 1IGVA 2K7DA 2KI4B 1YURA 3PFVA 2MLEC 2L50A 5K89A 1RFJA 2KHNA 4MN0A 3BOWB 5FYXA 2I18A 4ORCB 1A03A 2JNXA 1BT6A 2LM5A 1BOCA 1K9KA 1OMVA 1JFJA 1YUTA 2M3WA 3VGOA 2COLB 2M8UA 2WNDA 1MQ1A 1XK4A 2EGDA 2KNEA 2R2IA 3BYAA 1Y6WA 2CCMA 4F0ZB 3I5GC 4YGBB 1C7WA 4PHKA 4YI9A 2BKHB 2I7AA 2JT3A 1CFFA 2GGMA 1TNWA 1TIZA 1WLMA 1UHKA 2EC6C 3BUWB 3BUMB 4NDDA 2F3ZA 4QJ5B 1JF0A 1KK8B 4QJ4B 1JWDA 1F71A 1OMRA 5AANA 4R1EA 3CR2A 1MXLC 1KQMB 3DVMA 4D1EA 1NYAA 1EG3A 1M39A 1QVIY 4OCIA 1L2OB 1K94A 2G2BA 1EH2A 1RTP1 3BUOB 4BY5A 1R6PA 1UURA 4M2QA 2I94A 1HQVA 1FF1A 2MLFC 1YRUB 2ZN9A 2BKIB 3DVKA 2KBIA 2ZN8A 5HYDA 3I5IC 2JTTA 3I5HB 1B47A 1BR4B 4WQ2A 3SG7A 1XA5A 2BE6A 1QIVA 4GGNA 1K90D 5TNCA 1DJYA 2LV7A 4NDBA 1JC2A 1V1GA 2M1UA 1Q80A 1CFCA 2OS8C 2JT0A 3GK4X 1OZOA 1QVIZ 5DKRA 3I5GB 2NCPA 1LA3A 3FIAA 1QTXA 1Y1XA 3NSLA 2JTZA 1WRZA 3CR5X 1SK6D 1CLLA 2LVVA 1PVBA 2VRGA 1PALA 1YUSA 2B1UA 3OX5A 2WC8A 1Y1UA 4PE1A 2LAPA 3OX6A 5I8NA 1NX2A 4I5KA 1K93D 1XVJA 5CSFA 1F8HA 1SMGA 1OMDA 2HETA 3SG6A 1SL8A 3BUNB 4DRWA 5AXIA 4WRIA 1EJ3A 1B7TY 3A4UB 1XO5A 5KU1A 2L4IA 4OV2A 1WDCC 2BECA 1OOJA 4NQGA 3IF7A 1CTRA 2M7NA 2M0RA 2OS8B 1YVHA 3TS5C 3BOWA 1KFUS 3EK4A 1EG4A 3VRRA 1QX5B 2HF5A 4OKHA 3TDUA 2L2EA 2O60A 1S26D 2KI4C 1UHIA 2BCAA 2BCXA 4GGFA 3TZ1A 4N1FA 1B7TZ 3PSRA 1DTLA 4PHNA 1NP8A 2AMIA 2WOSA 3I5FC 3SIBA 2RGIA 3CTNA 2LUXA 1KFXL 3EVUA 4ORAB 1J1DA 2F2OA 3VRPA 1MHOA 3LL8B 5AERA 1YX7A 1KK7Y 2LLTA 3EK7A 2BL0B 2M49B 4C0JA 1SL9A 4DCKA 2JRFA 1G8IA 1B8RA 3NSOA 4PE0A 1UP5A 1WDCB 2LVKA 3EVRA 2MAZA 2KAYA 1TNPA 1KK8C 1BF5A 2KFGA 2KGRA 1TN4A 1TOPA 2K0JA 1QS7A 2KI6C 1CM1A 1DJHA 2NLNA 1NSHA 4P2YB 2LCPA 1NCZA 2D8NA 3TDZA 2G9BA 1KK7Z 1YTZC 1A29A 1PVAA 1CDPA 2H61C 2JWWA 1QASA 2CNPA 2LVJA 2KOTA 3GK2A 4I5NB 4JWQA 1SY9A 1LINA 1OZSA 1DF0B 2ZFDA 4ICBA 2MBXA 1BLQA 1BG1A 2E6WA 1NWDA 3FWCA 3I5HC 5AEQA 2BE4A 3I5FB 1TNQA 1JBAA 1DJIA 3NXAA 4DS7A 2PVBA 4YGEB 1N65A 4A4CA 1F55A 2L51A 2I2RE 4U8DA 3WHTB 1MR8A 3AAJA 1U5IB 1DMOA 1WY9A 1DJZA 1TRFA 2JNFA 4OVNF 2NCOA 1PRWA 3CGAA 2F3YA 1AJ5A 2CBLA 1DJGA 2NXQA 4MRYA 2Y1NA 1QIWA 1L7ZA 1RJVA 4E68A 2KSPA 3KPXA 1NUBA 1AUIB 1DJWA 4CIDA 1S5GY 2L0PA 1CLBA 3PALA 3AKBA 4CFQA 1BMOA 1H4BA 1B8LA 2KFHA 1NIWA 3D0YB 4OR9B 4AQIA 2JZIA 1OE9B 2KGBC 2L5XB 1AJ4A 4MZKA 4M2OA 3KHEA 5KTYA 5JOLA 1DGUA 2K7CA 2NZ0A 4C0LA 1KQVA 4USLA 4PDZA 5D7FA 3DF0B 1N2DA 1XFVO 1D1OA 1LA0A 1PULA 1RECA 1S5GZ 1KSOA 2LP3A 3NSIA 1PSBA 2WCEA 1B4CA 1PSRA 2Y1MA 2CT9A 5HLOA 2KDHA 1A75B 1EL4A 1HT9A 2V53A 2F2PA 4P5OE 1GGWA 1WLZA 3CS1A 4MBEA 2LE9B 3O4YA 2Y5IA 2JU0A 2ZRTA 4MVFA 4YGAA 1XYDA 4IL1A 5CSNA 3TUYB 4ORBB 1Y0VH 2L98A 1IH0A 2O5GA 2FCDA 2BL0C 1MWNA 2M1KB 3PN7C 4MZJA 4GFTA 2GGZA 1V1FA 3JTDB 3LK0A 1ALWA 1IRJA 3QRXA 5CSIA 4DIRA 1SCMC 2MHHA 2WORA 3F45A 3DVJA 1XFUO 2LMUA 3WNXB 3O78A 4GBAA 3PLFB 3RLZA 1KWOC 5KSZA 1QATA 1TCOB 3OB2B 1MXEA 3LLEA 2LHLA 2OTGC 1AK8A 4NDCA 2PRUA 2F33A 4ZCVA 1J7RA 2FJUB 1NPQA 2BCBA 4WQ3A 1TTXA 1LXFC 1M46A 2L4HA 2KBMA 3VRNA 3IQOA 1CM4A 2MJWB 4PHJA 1NX1A 1UHHA 1YX8A 5HKWA 4CLNA 1IKUA 1K8UA 1N0YA 3PN7B 2JXCA 1JUOA 1CDLA 1LKJA 1SR6C 1SCVA 1KFUL 1QXPA 4MRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPV A;  1F54 A;  1QLK A;  1W7J B;  3M0W A;  2PAL A;  2WCF A;  1CDM A;  2H61 A;  4PCW A;  1WRL A;  3KO0 A;  1SCM B;  4MEW A;  2M7L A;  3DD4 A;  1RRO A;  2K7B A;  3SG2 A;  1IQ3 A;  3D0Y A;  4HRG A;  4GNK B;  1M31 A;  1JFK A;  3PM8 A;  2PAS A;  1KSM A;  2QAC A;  4MLW A;  1SKT A;  1KWO B;  1FI6 A;  1QV1 A;  1CMF A;  2OTG B;  1G33 A;  2LVI A;  1G4Y R;  2JXL A;  1IJ5 A;  3A8R A;  3DF0 A;  3SG5 A;  4YGD B;  4I5L B;  4YGC B;  1S6I A;  1A75 A;  2K2F A;  1B9A A;  1QV0 A;  2JC2 A;  2Q91 A;  2QPT A;  5HLV A;  1B8C A;  1FPW A;  3CZT X;  5J3X A;  3AAK A;  1YRT B;  2E30 A;  2LNK A;  1MUX A;  3OP0 A;  5I2O A;  1K95 A;  1SR6 B;  2LLU A;  1FW4 A;  1DGV A;  2DOQ A;  2Q4U A;  3ZNI A;  4CFR A;  1J7P A;  1ALV A;  2CXJ A;  1S6J A;  4GPL B;  4YI8 A;  2LC5 A;  1E8A A;  2A4J A;  1FI5 A;  4CPV A;  4XJK B;  4C0K A;  2H2K A;  2LAN A;  1K96 A;  1A2X A;  1SBJ A;  2K2A A;  2LLS A;  3BQ3 A;  3EK8 A;  3JVT B;  3IQQ A;  3TUY C;  2LHI A;  2KYF A;  2TN4 A;  1NX3 A;  5DKN A;  3WHU B;  1ODB A;  3HX4 A;  2K8M B;  3K21 A;  2HPS A;  3MSE B;  4N5X A;  3ZWH A;  1C7V A;  3ICB A;  4MSP A;  1VRK A;  2KQ6 A;  3BUX B;  2JUL A;  2GV5 A;  1F4Q A;  2KFF A;  3E3R A;  2PMY A;  4ZCU A;  1XFY O;  1SPY A;  3EKJ A;  3JTD C;  1XK4 C;  1CB1 A;  3BXK A;  2AUC A;  1YUU A;  3CLN A;  1R2U A;  2M97 A;  3DVE A;  3SIA A;  1CFP A;  1AHR A;  3KF9 A;  5JJG A;  2LMV A;  2PSR A;  1CKK A;  1J7O A;  1NCX A;  4XYN A;  5PAL A;  1K9P A;  1DVI A;  1SRA A;  3VRO A;  2HQW A;  4PAL A;  1B1G A;  4HRH A;  3EKH A;  2HQ8 A;  2K7O A;  4JQ0 D;  1BJF A;  1IG5 A;  1S1E A;  2JQ6 A;  4PHM A;  1BOD A;  2P6B B;  1CMG A;  2CTN A;  2F8P A;  2ZKM X;  3LK1 A;  3PAT A;  1ZMZ A;  1UHJ A;  2FCE A;  2LP2 A;  4MZL A;  5HKZ A;  4BY4 A;  5BPJ A;  5G08 A;  5ER5 A;  5I2L A;  1IQ5 A;  3O2P A;  1GJY A;  1W7I B;  2M9G A;  3VRQ A;  1RWY A;  2Y4Q A;  2LUC A;  1UHN A;  2OPO A;  2KYC A;  4HRE E;  4JPZ B;  1YVL A;  5F6T A;  2LMT A;  3C1V A;  1SNL A;  3SG3 A;  2EC6 B;  3OB1 B;  1M45 A;  3SG4 A;  1MF8 B;  2JOJ A;  4PE7 A;  1CNP A;  5I2Q A;  1BR1 B;  4GUK A;  2KQY A;  1DF0 A;  1F4O A;  2FOT A;  1J1E A;  1SL7 A;  4AQJ A;  4PE4 A;  3D10 A;  2EHB A;  1ZOT B;  1BU3 A;  2JT8 A;  3HCM A;  1XFZ O;  5B8I B;  1EXR A;  3GK1 A;  3EVV A;  1QJT A;  2MA2 A;  4UPG A;  1U5I A;  1M63 B;  2KAX A;  2BBM A;  3WXA A;  3CR4 X;  3FS7 A;  3I5I B;  1KFX S;  1SW8 A;  4HSZ A;  4TNC A;  1X02 A;  1SYM A;  1AP4 A;  1GQM A;  2SCP A;  4Q04 A;  2JPT A;  4AOM A;  5D69 A;  2BBN A;  1UWO A;  3RM1 A;  3OHM B;  4YBH B;  4DUQ A;  5HKY A;  1H8B A;  1K2H A;  1KCY A;  1WRK A;  1J55 A;  4FQO A;  4XJK A;  1CLM A;  3NSK A;  3GOF A;  1CFD A;  2IS9 A;  3O6B A;  5AFP A;  4N1G A;  4I5J A;  1AVS A;  1DJX A;  1NX0 A;  4ETO A;  1JF2 A;  1C07 A;  2AAO A;  5IBW A;  2ZNE A;  1ZUZ A;  1IJ6 A;  1YR5 A;  1S3P A;  1RK9 A;  1PK0 D;  1XFW O;  3JVT C;  1ZFS A;  1DT7 B;  4QJ3 B;  3AKA A;  2KI6 D;  1LVC D;  1JSA A;  2KAV A;  4GGF C;  5ER4 X;  2WCB A;  1S36 A;  2K61 A;  2SAS A;  2M29 A;  3LCP C;  5DKQ A;  1CDN A;  1F70 A;  1ZAC A;  5GQQ C;  1TNX A;  1GGZ A;  1UUS A;  3FWB A;  1S6C A;  3KEV A;  4M2P A;  1IWQ A;  1NCY A;  1A4P A;  1QLS A;  3CWG A;  4GAO A;  1FBV A;  1XFX O;  1QX2 A;  1Y1A A;  1QX7 A;  1J7Q A;  1KQM C;  4L9M A;  3TS5 B;  1OSA A;  1L2O C;  4YRU A;  3SJS A;  2ZND A;  1K9U A;  2MRD A;  2ISD A;  4FTG A;  4A4B A;  1OQP A;  2ZRS A;  3TDI A;  3H4S E;  5CSJ A;  1TCF A;  1IGV A;  2K7D A;  2KI4 B;  1YUR A;  3PFV A;  2MLE C;  2L50 A;  5K89 A;  1RFJ A;  2KHN A;  4MN0 A;  3BOW B;  5FYX A;  2I18 A;  4ORC B;  1A03 A;  2JNX A;  1BT6 A;  2LM5 A;  1BOC A;  1K9K A;  1OMV A;  1JFJ A;  1YUT A;  2M3W A;  3VGO A;  2COL B;  2M8U A;  2WND A;  1MQ1 A;  1XK4 A;  2EGD A;  2KNE A;  2R2I A;  3BYA A;  1Y6W A;  2CCM A;  4F0Z B;  3I5G C;  4YGB B;  1C7W A;  4PHK A;  4YI9 A;  2BKH B;  2I7A A;  2JT3 A;  1CFF A;  2GGM A;  1TNW A;  1TIZ A;  1WLM A;  1UHK A;  2EC6 C;  3BUW B;  3BUM B;  4NDD A;  2F3Z A;  4QJ5 B;  1JF0 A;  1KK8 B;  4QJ4 B;  1JWD A;  1F71 A;  1OMR A;  5AAN A;  4R1E A;  3CR2 A;  1MXL C;  1KQM B;  3DVM A;  4D1E A;  1NYA A;  1EG3 A;  1M39 A;  1QVI Y;  4OCI A;  1L2O B;  1K94 A;  2G2B A;  1EH2 A;  1RTP 1;  3BUO B;  4BY5 A;  1R6P A;  1UUR A;  4M2Q A;  2I94 A;  1HQV A;  1FF1 A;  2MLF C;  1YRU B;  2ZN9 A;  2BKI B;  3DVK A;  2KBI A;  2ZN8 A;  5HYD A;  3I5I C;  2JTT A;  3I5H B;  1B47 A;  1BR4 B;  4WQ2 A;  3SG7 A;  1XA5 A;  2BE6 A;  1QIV A;  4GGN A;  1K90 D;  5TNC A;  1DJY A;  2LV7 A;  4NDB A;  1JC2 A;  1V1G A;  2M1U A;  1Q80 A;  1CFC A;  2OS8 C;  2JT0 A;  3GK4 X;  1OZO A;  1QVI Z;  5DKR A;  3I5G B;  2NCP A;  1LA3 A;  3FIA A;  1QTX A;  1Y1X A;  3NSL A;  2JTZ A;  1WRZ A;  3CR5 X;  1SK6 D;  1CLL A;  2LVV A;  1PVB A;  2VRG A;  1PAL A;  1YUS A;  2B1U A;  3OX5 A;  2WC8 A;  1Y1U A;  4PE1 A;  2LAP A;  3OX6 A;  5I8N A;  1NX2 A;  4I5K A;  1K93 D;  1XVJ A;  5CSF A;  1F8H A;  1SMG A;  1OMD A;  2HET A;  3SG6 A;  1SL8 A;  3BUN B;  4DRW A;  5AXI A;  4WRI A;  1EJ3 A;  1B7T Y;  3A4U B;  1XO5 A;  5KU1 A;  2L4I A;  4OV2 A;  1WDC C;  2BEC A;  1OOJ A;  4NQG A;  3IF7 A;  1CTR A;  2M7N A;  2M0R A;  2OS8 B;  1YVH A;  3TS5 C;  3BOW A;  1KFU S;  3EK4 A;  1EG4 A;  3VRR A;  1QX5 B;  2HF5 A;  4OKH A;  3TDU A;  2L2E A;  2O60 A;  1S26 D;  2KI4 C;  1UHI A;  2BCA A;  2BCX A;  4GGF A;  3TZ1 A;  4N1F A;  1B7T Z;  3PSR A;  1DTL A;  4PHN A;  1NP8 A;  2AMI A;  2WOS A;  3I5F C;  3SIB A;  2RGI A;  3CTN A;  2LUX A;  1KFX L;  3EVU A;  4ORA B;  1J1D A;  2F2O A;  3VRP A;  1MHO A;  3LL8 B;  5AER A;  1YX7 A;  1KK7 Y;  2LLT A;  3EK7 A;  2BL0 B;  2M49 B;  4C0J A;  1SL9 A;  4DCK A;  2JRF A;  1G8I A;  1B8R A;  3NSO A;  4PE0 A;  1UP5 A;  1WDC B;  2LVK A;  3EVR A;  2MAZ A;  2KAY A;  1TNP A;  1KK8 C;  1BF5 A;  2KFG A;  2KGR A;  1TN4 A;  1TOP A;  2K0J A;  1QS7 A;  2KI6 C;  1CM1 A;  1DJH A;  2NLN A;  1NSH A;  4P2Y B;  2LCP A;  1NCZ A;  2D8N A;  3TDZ A;  2G9B A;  1KK7 Z;  1YTZ C;  1A29 A;  1PVA A;  1CDP A;  2H61 C;  2JWW A;  1QAS A;  2CNP A;  2LVJ A;  2KOT A;  3GK2 A;  4I5N B;  4JWQ A;  1SY9 A;  1LIN A;  1OZS A;  1DF0 B;  2ZFD A;  4ICB A;  2MBX A;  1BLQ A;  1BG1 A;  2E6W A;  1NWD A;  3FWC A;  3I5H C;  5AEQ A;  2BE4 A;  3I5F B;  1TNQ A;  1JBA A;  1DJI A;  3NXA A;  4DS7 A;  2PVB A;  4YGE B;  1N65 A;  4A4C A;  1F55 A;  2L51 A;  2I2R E;  4U8D A;  3WHT B;  1MR8 A;  3AAJ A;  1U5I B;  1DMO A;  1WY9 A;  1DJZ A;  1TRF A;  2JNF A;  4OVN F;  2NCO A;  1PRW A;  3CGA A;  2F3Y A;  1AJ5 A;  2CBL A;  1DJG A;  2NXQ A;  4MRY A;  2Y1N A;  1QIW A;  1L7Z A;  1RJV A;  4E68 A;  2KSP A;  3KPX A;  1NUB A;  1AUI B;  1DJW A;  4CID A;  1S5G Y;  2L0P A;  1CLB A;  3PAL A;  3AKB A;  4CFQ A;  1BMO A;  1H4B A;  1B8L A;  2KFH A;  1NIW A;  3D0Y B;  4OR9 B;  4AQI A;  2JZI A;  1OE9 B;  2KGB C;  2L5X B;  1AJ4 A;  4MZK A;  4M2O A;  3KHE A;  5KTY A;  5JOL A;  1DGU A;  2K7C A;  2NZ0 A;  4C0L A;  1KQV A;  4USL A;  4PDZ A;  5D7F A;  3DF0 B;  1N2D A;  1XFV O;  1D1O A;  1LA0 A;  1PUL A;  1REC A;  1S5G Z;  1KSO A;  2LP3 A;  3NSI A;  1PSB A;  2WCE A;  1B4C A;  1PSR A;  2Y1M A;  2CT9 A;  5HLO A;  2KDH A;  1A75 B;  1EL4 A;  1HT9 A;  2V53 A;  2F2P A;  4P5O E;  1GGW A;  1WLZ A;  3CS1 A;  4MBE A;  2LE9 B;  3O4Y A;  2Y5I A;  2JU0 A;  2ZRT A;  4MVF A;  4YGA A;  1XYD A;  4IL1 A;  5CSN A;  3TUY B;  4ORB B;  1Y0V H;  2L98 A;  1IH0 A;  2O5G A;  2FCD A;  2BL0 C;  1MWN A;  2M1K B;  3PN7 C;  4MZJ A;  4GFT A;  2GGZ A;  1V1F A;  3JTD B;  3LK0 A;  1ALW A;  1IRJ A;  3QRX A;  5CSI A;  4DIR A;  1SCM C;  2MHH A;  2WOR A;  3F45 A;  3DVJ A;  1XFU O;  2LMU A;  3WNX B;  3O78 A;  4GBA A;  3PLF B;  3RLZ A;  1KWO C;  5KSZ A;  1QAT A;  1TCO B;  3OB2 B;  1MXE A;  3LLE A;  2LHL A;  2OTG C;  1AK8 A;  4NDC A;  2PRU A;  2F33 A;  4ZCV A;  1J7R A;  2FJU B;  1NPQ A;  2BCB A;  4WQ3 A;  1TTX A;  1LXF C;  1M46 A;  2L4H A;  2KBM A;  3VRN A;  3IQO A;  1CM4 A;  2MJW B;  4PHJ A;  1NX1 A;  1UHH A;  1YX8 A;  5HKW A;  4CLN A;  1IKU A;  1K8U A;  1N0Y A;  3PN7 B;  2JXC A;  1JUO A;  1CDL A;  1LKJ A;  1SR6 C;  1SCV A;  1KFU L;  1QXP A;  4MRX A; 
#chains in the Genus database with same CATH topology
 5CPV A;  1F54 A;  1QLK A;  1W7J B;  3M0W A;  2PAL A;  2WCF A;  1CDM A;  2H61 A;  4PCW A;  1WRL A;  2WCJ A;  3KO0 A;  1SCM B;  4MEW A;  2M7L A;  3DD4 A;  1RRO A;  2K7B A;  3SG2 A;  1IQ3 A;  3D0Y A;  4HRG A;  4GNK B;  1M31 A;  1JFK A;  3NHT A;  3PM8 A;  2PAS A;  1KSM A;  2QAC A;  4MLW A;  1SKT A;  1KWO B;  1FI6 A;  1QV1 A;  1CMF A;  2OTG B;  1G33 A;  2LVI A;  1G4Y R;  2JXL A;  1IJ5 A;  3A8R A;  3DF0 A;  4JD9 A;  2YGU A;  3SG5 A;  4YGD B;  2K60 A;  3RZS A;  4I5L B;  2P71 A;  4YGC B;  1S6I A;  1A75 A;  3D77 A;  2K2F A;  5D3O A;  1B9A A;  1QV0 A;  2JC2 A;  2Q91 A;  2QPT A;  2ERB A;  5HLV A;  3L47 A;  1B8C A;  1FPW A;  3CZT X;  5J3X A;  3AAK A;  1YRT B;  2E30 A;  3D78 A;  3S0D A;  2LNK A;  1MUX A;  3OP0 A;  5I2O A;  1K95 A;  1SR6 B;  2LLU A;  1FW4 A;  1DGV A;  2DOQ A;  2Q4U A;  3ZNI A;  4CFR A;  1J7P A;  3S0G A;  1ALV A;  2CXJ A;  3BFA A;  1S6J A;  4GPL B;  4YI8 A;  2LC5 A;  1E8A A;  1OOG A;  2A4J A;  1FI5 A;  4CPV A;  4XJK B;  4C0K A;  2H2K A;  1DQE A;  1K96 A;  1A2X A;  1SBJ A;  2K2A A;  2LAN A;  2LLS A;  2QEH A;  3BQ3 A;  3EK8 A;  3JVT B;  2JPO A;  3IQQ A;  3TUY C;  2LHI A;  2KYF A;  2TN4 A;  1NX3 A;  5DKN A;  3WHU B;  1ODB A;  3HX4 A;  2K8M B;  3K21 A;  2HPS A;  3MSE B;  4N5X A;  3ZWH A;  1C7V A;  3ICB A;  4INX A;  3CAB A;  4MSP A;  1VRK A;  2KQ6 A;  3BUX B;  3EG5 B;  2JUL A;  2GV5 A;  1F4Q A;  2KFF A;  3E3R A;  2PMY A;  4ZCU A;  1XFY O;  1SPY A;  3EKJ A;  3JTD C;  1XK4 C;  1CB1 A;  3BXK A;  2AUC A;  3PJI A;  1YUU A;  3CLN A;  1R2U A;  2M97 A;  3DVE A;  3SIA A;  1CFP A;  1AHR A;  3KF9 A;  5JJG A;  2LMV A;  2PSR A;  1CKK A;  1J7O A;  1NCX A;  5DIC A;  4XYN A;  5PAL A;  1K9P A;  1DVI A;  1SRA A;  3VRO A;  2HQW A;  4PAL A;  1B1G A;  4HRH A;  3EKH A;  2HQ8 A;  2K7O A;  4JQ0 D;  1BJF A;  1IG5 A;  1S1E A;  2JQ6 A;  3QME A;  4PHM A;  1BOD A;  3V2L A;  2P6B B;  1CMG A;  2CTN A;  2F8P A;  2ZKM X;  3LK1 A;  3PAT A;  1ZMZ A;  1UHJ A;  2FCE A;  2LP2 A;  3CZ1 A;  4MZL A;  5HKZ A;  4BY4 A;  5BPJ A;  5G08 A;  5ER5 A;  5I2L A;  5HL1 A;  1QWV A;  1IQ5 A;  3O2P A;  1GJY A;  1W7I B;  2M9G A;  3VRQ A;  1RWY A;  2Y4Q A;  3Q8I A;  2LUC A;  1UHN A;  2OPO A;  2KYC A;  4HRE E;  4JPZ B;  1YVL A;  5F6T A;  2LMT A;  3C1V A;  4PT1 A;  1SNL A;  3SG3 A;  2EC6 B;  3OB1 B;  1M45 A;  3SG4 A;  1MF8 B;  2JOJ A;  4PE7 A;  1CNP A;  5I2Q A;  1BR1 B;  4GUK A;  2KQY A;  1DF0 A;  1F4O A;  2FOT A;  1J1E A;  2GTE A;  1SL7 A;  4AQJ A;  4PE4 A;  2QEO A;  3D10 A;  2EHB A;  1ZOT B;  1BU3 A;  2JT8 A;  3HCM A;  1XFZ O;  5B8I B;  1EXR A;  3GK1 A;  2FJY A;  3EVV A;  1QJT A;  2L2C A;  2MA2 A;  4UPG A;  1U5I A;  1M63 B;  2KAX A;  2BBM A;  3R72 A;  3WXA A;  3CR4 X;  3FS7 A;  3I5I B;  1KFX S;  1SW8 A;  4HSZ A;  4TNC A;  1X02 A;  1SYM A;  1AP4 A;  3DXL A;  1GQM A;  2SCP A;  4Q04 A;  2JPT A;  4AOM A;  5D69 A;  2BBN A;  1UWO A;  3RM1 A;  3OHM B;  4YBH B;  4DUQ A;  5HKY A;  1H8B A;  1K2H A;  1KCY A;  1WRK A;  1DEL A;  1J55 A;  4FQO A;  4XJK A;  1CLM A;  3NSK A;  3GOF A;  1CFD A;  2IS9 A;  3O6B A;  3B88 A;  4N1G A;  5AFP A;  4I5J A;  1AVS A;  1DJX A;  1NX0 A;  4ETO A;  1JF2 A;  1P28 A;  1C07 A;  2AAO A;  5IBW A;  3S0F A;  2ZNE A;  1ZUZ A;  1IJ6 A;  1YR5 A;  1S3P A;  1RK9 A;  1PK0 D;  1XFW O;  3JVT C;  1ZFS A;  1DT7 B;  4QJ3 B;  3AKA A;  2KI6 D;  1LVC D;  1JSA A;  2KAV A;  4GGF C;  5ER4 X;  2WCB A;  1Z2C B;  1F70 A;  1S36 A;  2K61 A;  2H8V A;  2M29 A;  2SAS A;  3B7A A;  3LCP C;  2L5Y A;  1ZAC A;  5DKQ A;  5GQQ C;  1CDN A;  1TNX A;  1GGZ A;  1UUS A;  3FWB A;  1S6C A;  3DZT A;  3KEV A;  4M2P A;  1IWQ A;  1NCY A;  1A4P A;  1QLS A;  3CWG A;  4GAO A;  1FBV A;  1XFX O;  1QX2 A;  1Y1A A;  1QX7 A;  1J7Q A;  1KQM C;  4L9M A;  3TS5 B;  1OSA A;  1L2O C;  4YRU A;  3SJS A;  2ZND A;  1K9U A;  2MRD A;  2ISD A;  4FTG A;  4A4B A;  1OQP A;  3R1O A;  2ZRS A;  3OBV A;  3TDI A;  3H4S E;  5CSJ A;  1TCF A;  1IGV A;  2K7D A;  2KI4 B;  1YUR A;  3PFV A;  2MLE C;  2L50 A;  5K89 A;  1RFJ A;  2KHN A;  4MN0 A;  3L4A A;  3BOW B;  5FYX A;  2I18 A;  4ORC B;  1A03 A;  2JNX A;  1BT6 A;  2LM5 A;  1BOC A;  1K9K A;  1OMV A;  1JFJ A;  1YUT A;  1OOF A;  2M3W A;  2COL B;  2M8U A;  2WND A;  3VGO A;  1MQ1 A;  1XK4 A;  3R1V A;  1OOI X;  2EGD A;  2KNE A;  2R2I A;  2WCM A;  3BYA A;  1Y6W A;  2CCM A;  4F0Z B;  3I5G C;  4YGB B;  3SS3 A;  1C7W A;  4PHK A;  3B86 A;  2BKH B;  4YI9 A;  1GM0 A;  2I7A A;  2JT3 A;  1CFF A;  2GGM A;  1TNW A;  1TIZ A;  1WLM A;  1UHK A;  2EC6 C;  3BJH A;  3IVT A;  1DC1 A;  3BUW B;  3BUM B;  4NDD A;  2F3Z A;  4QJ5 B;  2KPH A;  1JF0 A;  1KK8 B;  4QJ4 B;  1JWD A;  1F71 A;  1OMR A;  5AAN A;  4R1E A;  3CR2 A;  1MXL C;  1KQM B;  3DVM A;  4D1E A;  1NYA A;  1EG3 A;  1M39 A;  1QVI Y;  2WCL A;  4OCI A;  1L2O B;  1K94 A;  1OOH A;  2G2B A;  1EH2 A;  1RTP 1;  1Z4H A;  3BUO B;  3SS5 A;  1R6P A;  4BY5 A;  1UUR A;  4M2Q A;  2I94 A;  1HQV A;  3SS4 A;  2MLF C;  1FF1 A;  1YRU B;  2ZN9 A;  2BKI B;  3DVK A;  2KBI A;  2ZN8 A;  4INW A;  5HYD A;  3I5I C;  2WC6 A;  2JTT A;  3I5H B;  1B47 A;  1BR4 B;  4WQ2 A;  3SG7 A;  1XA5 A;  1TUZ A;  2BE6 A;  1QIV A;  4GGN A;  3K1E A;  5I94 A;  3PM2 A;  1K90 D;  5TNC A;  1DJY A;  2LV7 A;  4NDB A;  1JC2 A;  1V1G A;  2M1U A;  1Q80 A;  1CFC A;  2OS8 C;  1IIO A;  3NHI A;  2JT0 A;  3GK4 X;  1OZO A;  1QVI Z;  5DKR A;  3I5G B;  2NCP A;  1LA3 A;  3FIA A;  1QTX A;  1Y1X A;  5EL2 A;  3NSL A;  2JTZ A;  1WRZ A;  3OGN A;  2BAP A;  1TWO A;  3CR5 X;  2KLE A;  1SK6 D;  3VB1 A;  1CLL A;  2LVV A;  1PVB A;  2VRG A;  1PAL A;  1YUS A;  2B1U A;  3OX5 A;  2WC8 A;  1Y1U A;  4PE1 A;  2LAP A;  3FE8 A;  3OX6 A;  5I8N A;  1NX2 A;  4I5K A;  1K93 D;  1XVJ A;  5CSF A;  1F8H A;  2WC5 A;  1SMG A;  1OMD A;  2HET A;  3SG6 A;  1SL8 A;  3BUN B;  4DRW A;  5AXI A;  1LS8 A;  4WRI A;  1EJ3 A;  1B7T Y;  3A4U B;  1XO5 A;  5KU1 A;  2L4I A;  1T14 A;  4OV2 A;  1WDC C;  2BEC A;  1OOJ A;  4NQG A;  3IF7 A;  1CTR A;  2M7N A;  3BFB A;  2M0R A;  2OS8 B;  1YVH A;  3TS5 C;  3BOW A;  1KFU S;  3EK4 A;  1EG4 A;  2WCK A;  5FI2 A;  1QX5 B;  3VRR A;  2HF5 A;  4OKH A;  4F7F A;  3D75 A;  3TDU A;  2L2E A;  2O60 A;  1S26 D;  2KI4 C;  1UHI A;  2BCA A;  2BCX A;  4GGF A;  3TZ1 A;  4N1F A;  3S0E A;  1B7T Z;  3PSR A;  1DTL A;  4PHN A;  1NP8 A;  2AMI A;  2WOS A;  3I5F C;  3CZ2 A;  4JKT A;  3SIB A;  2RGI A;  3CTN A;  3D73 A;  2LUX A;  1KFX L;  3EVU A;  4ORA B;  1J1D A;  2F2O A;  3VRP A;  1MHO A;  3LL8 B;  5AER A;  1YX7 A;  1KK7 Y;  2LLT A;  3EK7 A;  2BL0 B;  2M49 B;  4C0J A;  1SL9 A;  4DCK A;  3S0B A;  2JRF A;  1G8I A;  1B8R A;  2PQL A;  3NSO A;  4PE0 A;  1UP5 A;  1WDC B;  2LVK A;  3EVR A;  2MAZ A;  2KAY A;  1TNP A;  1KK8 C;  1BF5 A;  2KFG A;  2KGR A;  1TN4 A;  2PYQ A;  1TOP A;  2K0J A;  1QS7 A;  2QEV A;  2KI6 C;  3CDN A;  1CM1 A;  1DJH A;  2NLN A;  1NSH A;  4P2Y B;  2LCP A;  1NCZ A;  2D8N A;  3TDZ A;  2G9B A;  1KK7 Z;  1YTZ C;  1A29 A;  1PVA A;  1CDP A;  2H61 C;  1DEK A;  1QAS A;  2CNP A;  2JWW A;  2KOT A;  2LVJ A;  3GK2 A;  4I5N B;  1SY9 A;  1LIN A;  1OZS A;  1DF0 B;  2ZFD A;  3R1P A;  4ICB A;  4JWQ A;  1BG1 A;  1BLQ A;  2E6W A;  1NWD A;  3D76 A;  3FWC A;  3I5H C;  5AEQ A;  2BE4 A;  3I5F B;  1TNQ A;  1JBA A;  4KYN A;  1DJI A;  3NXA A;  4DS7 A;  2PVB A;  4YGE B;  1N65 A;  4A4C A;  1F55 A;  2L51 A;  2I2R E;  4U8D A;  2QEB A;  3WHT B;  1MR8 A;  3AAJ A;  1U5I B;  1DMO A;  1WY9 A;  1DJZ A;  1TRF A;  2JNF A;  4OVN F;  2NCO A;  1PRW A;  3CGA A;  1ORG A;  2F3Y A;  1AJ5 A;  2CBL A;  3UNW A;  1DJG A;  3CZ0 A;  2NXQ A;  4MRY A;  2Y1N A;  1QIW A;  1L7Z A;  1RJV A;  4E68 A;  2KSP A;  3KPX A;  1NUB A;  1TUJ A;  3UO9 A;  1AUI B;  1C3Z A;  2MBX A;  1DJW A;  1XFR A;  4CID A;  1S5G Y;  2BNX A;  2L0P A;  3PAL A;  1CLB A;  5FI7 A;  3AKB A;  4CFQ A;  1BMO A;  1SSE B;  1H4B A;  1B8L A;  2KFH A;  4OZD A;  1NIW A;  3D0Y B;  4OR9 B;  1OW4 A;  2JZI A;  1OE9 B;  2KGB C;  2L5X B;  4AQI A;  1AJ4 A;  4MZK A;  4M2O A;  3KHE A;  5KTY A;  5JOL A;  1DGU A;  2K7C A;  2NZ0 A;  4C0L A;  2P70 A;  1W9Z A;  3DY9 A;  1KQV A;  4USL A;  4PDZ A;  5D7F A;  4IJ7 A;  3DF0 B;  1N2D A;  1XFV O;  3FE9 A;  1D1O A;  1LA0 A;  1PUL A;  1REC A;  1S5G Z;  1KSO A;  2LP3 A;  3NSI A;  1PSB A;  2WCE A;  1B4C A;  1PSR A;  3D74 A;  2Y1M A;  2CT9 A;  5HLO A;  2KDH A;  1A75 B;  1EL4 A;  1HT9 A;  2QDI A;  2F2P A;  2V53 A;  4P5O E;  1WLZ A;  3S0A A;  3CS1 A;  1GGW A;  4MBE A;  2LE9 B;  3O4Y A;  2Y5I A;  2JU0 A;  3N7H A;  3B87 A;  2ZRT A;  4MVF A;  4YGA A;  1XYD A;  4IL1 A;  5CSN A;  3TUY B;  3BFH A;  4ORB B;  1Y0V H;  2L98 A;  1IH0 A;  2O5G A;  2FCD A;  2BL0 C;  1MWN A;  2M1K B;  3PN7 C;  4MZJ A;  5FI6 A;  4GFT A;  2GGZ A;  1V1F A;  4FQT A;  3JTD B;  3LK0 A;  1ALW A;  1IRJ A;  3QRX A;  5CSI A;  4DIR A;  1SCM C;  2MHH A;  2WOR A;  3NGV A;  3F45 A;  3DVJ A;  1XFU O;  2LMU A;  3WNX B;  3O78 A;  4GBA A;  3PLF B;  3RLZ A;  1KWO C;  5KSZ A;  1QAT A;  3B6X A;  1TCO B;  3OB2 B;  3O4X A;  1MXE A;  3LLE A;  2LHL A;  2OTG C;  1AK8 A;  3FE6 A;  4NDC A;  2PRU A;  2F33 A;  4ZCV A;  1J7R A;  2FJU B;  1NPQ A;  2BCB A;  4WQ3 A;  1TTX A;  1LXF C;  3CYZ A;  1M46 A;  2L4H A;  2KBM A;  3VRN A;  3IQO A;  1CM4 A;  2MJW B;  1C3Y A;  3DYE A;  1NX1 A;  4PHJ A;  1UHH A;  1YX8 A;  5HKW A;  4CLN A;  1IKU A;  1K8U A;  1N0Y A;  3PN7 B;  2KLD A;  2JXC A;  2WCH A;  1JUO A;  3L4L A;  1CDL A;  1LKJ A;  1SR6 C;  1SCV A;  1KFU L;  1QXP A;  4MRX A; 
#chains in the Genus database with same CATH homology
 5CPV A;  1F54 A;  1QLK A;  1W7J B;  3M0W A;  2PAL A;  2WCF A;  1CDM A;  2H61 A;  4PCW A;  1WRL A;  3KO0 A;  1SCM B;  4MEW A;  2M7L A;  3DD4 A;  1RRO A;  2K7B A;  3SG2 A;  1IQ3 A;  3D0Y A;  4HRG A;  4GNK B;  1M31 A;  1JFK A;  3PM8 A;  2PAS A;  1KSM A;  2QAC A;  4MLW A;  1SKT A;  1KWO B;  1FI6 A;  1QV1 A;  1CMF A;  2OTG B;  1G33 A;  2LVI A;  1G4Y R;  2JXL A;  1IJ5 A;  3A8R A;  3DF0 A;  3SG5 A;  4YGD B;  4I5L B;  4YGC B;  1S6I A;  1A75 A;  2K2F A;  1B9A A;  1QV0 A;  2JC2 A;  2Q91 A;  2QPT A;  5HLV A;  1B8C A;  1FPW A;  3CZT X;  5J3X A;  3AAK A;  1YRT B;  2E30 A;  2LNK A;  1MUX A;  3OP0 A;  5I2O A;  1K95 A;  1SR6 B;  2LLU A;  1FW4 A;  1DGV A;  2DOQ A;  2Q4U A;  3ZNI A;  4CFR A;  1J7P A;  1ALV A;  2CXJ A;  1S6J A;  4GPL B;  4YI8 A;  2LC5 A;  1E8A A;  2A4J A;  1FI5 A;  4CPV A;  4XJK B;  4C0K A;  2H2K A;  2LAN A;  1K96 A;  1A2X A;  1SBJ A;  2K2A A;  2LLS A;  3BQ3 A;  3EK8 A;  3JVT B;  3IQQ A;  3TUY C;  2LHI A;  2KYF A;  2TN4 A;  1NX3 A;  5DKN A;  3WHU B;  1ODB A;  3HX4 A;  2K8M B;  3K21 A;  2HPS A;  3MSE B;  4N5X A;  3ZWH A;  1C7V A;  3ICB A;  4MSP A;  1VRK A;  2KQ6 A;  3BUX B;  2JUL A;  2GV5 A;  1F4Q A;  2KFF A;  3E3R A;  2PMY A;  4ZCU A;  1XFY O;  1SPY A;  3EKJ A;  3JTD C;  1XK4 C;  1CB1 A;  3BXK A;  2AUC A;  1YUU A;  3CLN A;  1R2U A;  2M97 A;  3DVE A;  3SIA A;  1CFP A;  1AHR A;  3KF9 A;  5JJG A;  2LMV A;  2PSR A;  1CKK A;  1J7O A;  1NCX A;  4XYN A;  5PAL A;  1K9P A;  1DVI A;  1SRA A;  3VRO A;  2HQW A;  4PAL A;  1B1G A;  4HRH A;  3EKH A;  2HQ8 A;  2K7O A;  4JQ0 D;  1BJF A;  1IG5 A;  1S1E A;  2JQ6 A;  4PHM A;  1BOD A;  2P6B B;  1CMG A;  2CTN A;  2F8P A;  2ZKM X;  3LK1 A;  3PAT A;  1ZMZ A;  1UHJ A;  2FCE A;  2LP2 A;  4MZL A;  5HKZ A;  4BY4 A;  5BPJ A;  5G08 A;  5ER5 A;  5I2L A;  1IQ5 A;  3O2P A;  1GJY A;  1W7I B;  2M9G A;  3VRQ A;  1RWY A;  2Y4Q A;  2LUC A;  1UHN A;  2OPO A;  2KYC A;  4HRE E;  4JPZ B;  1YVL A;  5F6T A;  2LMT A;  3C1V A;  1SNL A;  3SG3 A;  2EC6 B;  3OB1 B;  1M45 A;  3SG4 A;  1MF8 B;  2JOJ A;  4PE7 A;  1CNP A;  5I2Q A;  1BR1 B;  4GUK A;  2KQY A;  1DF0 A;  1F4O A;  2FOT A;  1J1E A;  1SL7 A;  4AQJ A;  4PE4 A;  3D10 A;  2EHB A;  1ZOT B;  1BU3 A;  2JT8 A;  3HCM A;  1XFZ O;  5B8I B;  1EXR A;  3GK1 A;  3EVV A;  1QJT A;  2MA2 A;  4UPG A;  1U5I A;  1M63 B;  2KAX A;  2BBM A;  3WXA A;  3CR4 X;  3FS7 A;  3I5I B;  1KFX S;  1SW8 A;  4HSZ A;  4TNC A;  1X02 A;  1SYM A;  1AP4 A;  1GQM A;  2SCP A;  4Q04 A;  2JPT A;  4AOM A;  5D69 A;  2BBN A;  1UWO A;  3RM1 A;  3OHM B;  4YBH B;  4DUQ A;  5HKY A;  1H8B A;  1K2H A;  1KCY A;  1WRK A;  1J55 A;  4FQO A;  4XJK A;  1CLM A;  3NSK A;  3GOF A;  1CFD A;  2IS9 A;  3O6B A;  5AFP A;  4N1G A;  4I5J A;  1AVS A;  1DJX A;  1NX0 A;  4ETO A;  1JF2 A;  1C07 A;  2AAO A;  5IBW A;  2ZNE A;  1ZUZ A;  1IJ6 A;  1YR5 A;  1S3P A;  1RK9 A;  1PK0 D;  1XFW O;  3JVT C;  1ZFS A;  1DT7 B;  4QJ3 B;  3AKA A;  2KI6 D;  1LVC D;  1JSA A;  2KAV A;  4GGF C;  5ER4 X;  2WCB A;  1S36 A;  2K61 A;  2SAS A;  2M29 A;  3LCP C;  5DKQ A;  1CDN A;  1F70 A;  1ZAC A;  5GQQ C;  1TNX A;  1GGZ A;  1UUS A;  3FWB A;  1S6C A;  3KEV A;  4M2P A;  1IWQ A;  1NCY A;  1A4P A;  1QLS A;  3CWG A;  4GAO A;  1FBV A;  1XFX O;  1QX2 A;  1Y1A A;  1QX7 A;  1J7Q A;  1KQM C;  4L9M A;  3TS5 B;  1OSA A;  1L2O C;  4YRU A;  3SJS A;  2ZND A;  1K9U A;  2MRD A;  2ISD A;  4FTG A;  4A4B A;  1OQP A;  2ZRS A;  3TDI A;  3H4S E;  5CSJ A;  1TCF A;  1IGV A;  2K7D A;  2KI4 B;  1YUR A;  3PFV A;  2MLE C;  2L50 A;  5K89 A;  1RFJ A;  2KHN A;  4MN0 A;  3BOW B;  5FYX A;  2I18 A;  4ORC B;  1A03 A;  2JNX A;  1BT6 A;  2LM5 A;  1BOC A;  1K9K A;  1OMV A;  1JFJ A;  1YUT A;  2M3W A;  3VGO A;  2COL B;  2M8U A;  2WND A;  1MQ1 A;  1XK4 A;  2EGD A;  2KNE A;  2R2I A;  3BYA A;  1Y6W A;  2CCM A;  4F0Z B;  3I5G C;  4YGB B;  1C7W A;  4PHK A;  4YI9 A;  2BKH B;  2I7A A;  2JT3 A;  1CFF A;  2GGM A;  1TNW A;  1TIZ A;  1WLM A;  1UHK A;  2EC6 C;  3BUW B;  3BUM B;  4NDD A;  2F3Z A;  4QJ5 B;  1JF0 A;  1KK8 B;  4QJ4 B;  1JWD A;  1F71 A;  1OMR A;  5AAN A;  4R1E A;  3CR2 A;  1MXL C;  1KQM B;  3DVM A;  4D1E A;  1NYA A;  1EG3 A;  1M39 A;  1QVI Y;  4OCI A;  1L2O B;  1K94 A;  2G2B A;  1EH2 A;  1RTP 1;  3BUO B;  4BY5 A;  1R6P A;  1UUR A;  4M2Q A;  2I94 A;  1HQV A;  1FF1 A;  2MLF C;  1YRU B;  2ZN9 A;  2BKI B;  3DVK A;  2KBI A;  2ZN8 A;  5HYD A;  3I5I C;  2JTT A;  3I5H B;  1B47 A;  1BR4 B;  4WQ2 A;  3SG7 A;  1XA5 A;  2BE6 A;  1QIV A;  4GGN A;  1K90 D;  5TNC A;  1DJY A;  2LV7 A;  4NDB A;  1JC2 A;  1V1G A;  2M1U A;  1Q80 A;  1CFC A;  2OS8 C;  2JT0 A;  3GK4 X;  1OZO A;  1QVI Z;  5DKR A;  3I5G B;  2NCP A;  1LA3 A;  3FIA A;  1QTX A;  1Y1X A;  3NSL A;  2JTZ A;  1WRZ A;  3CR5 X;  1SK6 D;  1CLL A;  2LVV A;  1PVB A;  2VRG A;  1PAL A;  1YUS A;  2B1U A;  3OX5 A;  2WC8 A;  1Y1U A;  4PE1 A;  2LAP A;  3OX6 A;  5I8N A;  1NX2 A;  4I5K A;  1K93 D;  1XVJ A;  5CSF A;  1F8H A;  1SMG A;  1OMD A;  2HET A;  3SG6 A;  1SL8 A;  3BUN B;  4DRW A;  5AXI A;  4WRI A;  1EJ3 A;  1B7T Y;  3A4U B;  1XO5 A;  5KU1 A;  2L4I A;  4OV2 A;  1WDC C;  2BEC A;  1OOJ A;  4NQG A;  3IF7 A;  1CTR A;  2M7N A;  2M0R A;  2OS8 B;  1YVH A;  3TS5 C;  3BOW A;  1KFU S;  3EK4 A;  1EG4 A;  3VRR A;  1QX5 B;  2HF5 A;  4OKH A;  3TDU A;  2L2E A;  2O60 A;  1S26 D;  2KI4 C;  1UHI A;  2BCA A;  2BCX A;  4GGF A;  3TZ1 A;  4N1F A;  1B7T Z;  3PSR A;  1DTL A;  4PHN A;  1NP8 A;  2AMI A;  2WOS A;  3I5F C;  3SIB A;  2RGI A;  3CTN A;  2LUX A;  1KFX L;  3EVU A;  4ORA B;  1J1D A;  2F2O A;  3VRP A;  1MHO A;  3LL8 B;  5AER A;  1YX7 A;  1KK7 Y;  2LLT A;  3EK7 A;  2BL0 B;  2M49 B;  4C0J A;  1SL9 A;  4DCK A;  2JRF A;  1G8I A;  1B8R A;  3NSO A;  4PE0 A;  1UP5 A;  1WDC B;  2LVK A;  3EVR A;  2MAZ A;  2KAY A;  1TNP A;  1KK8 C;  1BF5 A;  2KFG A;  2KGR A;  1TN4 A;  1TOP A;  2K0J A;  1QS7 A;  2KI6 C;  1CM1 A;  1DJH A;  2NLN A;  1NSH A;  4P2Y B;  2LCP A;  1NCZ A;  2D8N A;  3TDZ A;  2G9B A;  1KK7 Z;  1YTZ C;  1A29 A;  1PVA A;  1CDP A;  2H61 C;  2JWW A;  1QAS A;  2CNP A;  2LVJ A;  2KOT A;  3GK2 A;  4I5N B;  4JWQ A;  1SY9 A;  1LIN A;  1OZS A;  1DF0 B;  2ZFD A;  4ICB A;  2MBX A;  1BLQ A;  1BG1 A;  2E6W A;  1NWD A;  3FWC A;  3I5H C;  5AEQ A;  2BE4 A;  3I5F B;  1TNQ A;  1JBA A;  1DJI A;  3NXA A;  4DS7 A;  2PVB A;  4YGE B;  1N65 A;  4A4C A;  1F55 A;  2L51 A;  2I2R E;  4U8D A;  3WHT B;  1MR8 A;  3AAJ A;  1U5I B;  1DMO A;  1WY9 A;  1DJZ A;  1TRF A;  2JNF A;  4OVN F;  2NCO A;  1PRW A;  3CGA A;  2F3Y A;  1AJ5 A;  2CBL A;  1DJG A;  2NXQ A;  4MRY A;  2Y1N A;  1QIW A;  1L7Z A;  1RJV A;  4E68 A;  2KSP A;  3KPX A;  1NUB A;  1AUI B;  1DJW A;  4CID A;  1S5G Y;  2L0P A;  1CLB A;  3PAL A;  3AKB A;  4CFQ A;  1BMO A;  1H4B A;  1B8L A;  2KFH A;  1NIW A;  3D0Y B;  4OR9 B;  4AQI A;  2JZI A;  1OE9 B;  2KGB C;  2L5X B;  1AJ4 A;  4MZK A;  4M2O A;  3KHE A;  5KTY A;  5JOL A;  1DGU A;  2K7C A;  2NZ0 A;  4C0L A;  1KQV A;  4USL A;  4PDZ A;  5D7F A;  3DF0 B;  1N2D A;  1XFV O;  1D1O A;  1LA0 A;  1PUL A;  1REC A;  1S5G Z;  1KSO A;  2LP3 A;  3NSI A;  1PSB A;  2WCE A;  1B4C A;  1PSR A;  2Y1M A;  2CT9 A;  5HLO A;  2KDH A;  1A75 B;  1EL4 A;  1HT9 A;  2V53 A;  2F2P A;  4P5O E;  1GGW A;  1WLZ A;  3CS1 A;  4MBE A;  2LE9 B;  3O4Y A;  2Y5I A;  2JU0 A;  2ZRT A;  4MVF A;  4YGA A;  1XYD A;  4IL1 A;  5CSN A;  3TUY B;  4ORB B;  1Y0V H;  2L98 A;  1IH0 A;  2O5G A;  2FCD A;  2BL0 C;  1MWN A;  2M1K B;  3PN7 C;  4MZJ A;  4GFT A;  2GGZ A;  1V1F A;  3JTD B;  3LK0 A;  1ALW A;  1IRJ A;  3QRX A;  5CSI A;  4DIR A;  1SCM C;  2MHH A;  2WOR A;  3F45 A;  3DVJ A;  1XFU O;  2LMU A;  3WNX B;  3O78 A;  4GBA A;  3PLF B;  3RLZ A;  1KWO C;  5KSZ A;  1QAT A;  1TCO B;  3OB2 B;  1MXE A;  3LLE A;  2LHL A;  2OTG C;  1AK8 A;  4NDC A;  2PRU A;  2F33 A;  4ZCV A;  1J7R A;  2FJU B;  1NPQ A;  2BCB A;  4WQ3 A;  1TTX A;  1LXF C;  1M46 A;  2L4H A;  2KBM A;  3VRN A;  3IQO A;  1CM4 A;  2MJW B;  4PHJ A;  1NX1 A;  1UHH A;  1YX8 A;  5HKW A;  4CLN A;  1IKU A;  1K8U A;  1N0Y A;  3PN7 B;  2JXC A;  1JUO A;  1CDL A;  1LKJ A;  1SR6 C;  1SCV A;  1KFU L;  1QXP A;  4MRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...