3IQOA

1.5 angstrom x-ray structure of bovine ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Effects of CapZ Peptide (TRTK-12) Binding to S100B-Ca(2+) as Examined by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
molecule keywords Protein S100-B
total genus 31
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3iqoA00
4PHNA 2EC6C 2KQ6A 1DJYA 1CDNA 4YI9A 1W7IB 1MHOA 4M2PA 1B47A 1DGVA 2ZRSA 1SKTA 5GQQC 2FCDA 4IL1A 3D10A 2M8UA 2BL0B 1PSRA 4MSPA 3D0YA 3NSKA 1F4OA 1NUBA 4YBHB 1A75B 3TS5C 1NCZA 2CCMA 3WXAA 4ORAB 3I5FB 1CFFA 2F2PA 1YURA 1FBVA 4L9MA 2LUCA 1A4PA 1JFKA 1F4QA 2I94A 1SW8A 2KOTA 3A8RA 4ORBB 1J55A 5HKZA 1UUSA 1Q80A 4OR9B 1RTP1 3EVRA 3GK4X 1VRKA 5I2LA 2KQYA 1HT9A 1YTZC 4GFTA 1QX2A 4R1EA 4PHKA 1G4YR 1F70A 1MWNA 2HQWA 4JQ0D 1K9PA 1QIWA 3CR5X 3TUYB 1S6CA 2LUXA 1J7QA 2H61C 3LK0A 1OQPA 2PVBA 3SIAA 3CTNA 3C1VA 2KFFA 3BQ3A 4YGDB 5KSZA 4M2QA 3EVUA 3AKAA 1RECA 1SYMA 3TDZA 1BJFA 4MEWA 1M63B 3WHUB 2KI6C 3PSRA 4OCIA 2DOQA 1QV1A 1C07A 3PN7B 2BCXA 2M7LA 3CLNA 5JOLA 4GGFC 1SRAA 3IQOA 2BKIB 4N5XA 4P2YB 4XYNA 3EVVA 1SL8A 1NSHA 2OS8B 1KFXL 1S3PA 2GGMA 2M7NA 4ZCUA 2VRGA 4FQOA 2WORA 2BCBA 1YRUB 4P5OE 3EK7A 1BT6A 1DT7B 1ALWA 3NXAA 1B7TY 2KI4B 1QX7A 2JWWA 1XK4C 3K21A 2M3WA 1LA0A 1CKKA 4OV2A 1CTRA 2MLFC 1RK9A 1S5GZ 3KEVA 2JOJA 5AERA 4I5NB 1YRTB 3CS1A 3DF0B 3JTDC 1DVIA 1UP5A 4E68A 2LLUA 3SIBA 3WHTB 3EKJA 1K93D 3FWCA 1DF0A 4MBEA 1KWOB 2WC8A 1C7VA 1AUIB 2BKHB 2ZRTA 1DF0B 3OB2B 1SCMC 2BBNA 2O5GA 2LM5A 1WDCB 4GUKA 4N1GA 2KNEA 4MRXA 1YVLA 2O60A 1SY9A 2F3YA 5PALA 2IS9A 1AP4A 1UHJA 1TNPA 1EH2A 5I2QA 5I8NA 2KYFA 1QTXA 3VGOA 1CDMA 1H8BA 1XFYO 1RWYA 1QLKA 3BXKA 2JT8A 3KPXA 5FYXA 1F55A 3O2PA 3BUXB 3GK2A 1U5IA 1WLMA 1UHKA 1BG1A 1QJTA 2TN4A 3LK1A 2LLSA 2KFHA 1IG5A 1QVIY 2HETA 1JWDA 2AAOA 1IRJA 1NX1A 4HRGA 2JNFA 3TDIA 1XA5A 2NZ0A 5I2OA 3TS5B 1CM4A 5CSIA 2GV5A 1MXEA 1CLLA 2CNPA 1QS7A 3CZTX 1L2OC 1XFXO 3GK1A 2F2OA 1LINA 1MR8A 3MSEB 1W7JB 1ZACA 3BUOB 3DVKA 4USLA 2LP2A 2KFGA 4CPVA 1DJXA 3PALA 1OSAA 3M0WA 2PRUA 1KQMC 1UWOA 1OMVA 4MLWA 1PSBA 1XYDA 2G2BA 1BLQA 4MZJA 1F54A 3SJSA 3NSIA 1Y1XA 1MUXA 1NX0A 5AEQA 1KFUS 2K0JA 4WQ2A 1YX7A 1CMGA 1A75A 3F45A 4OVNF 5KU1A 5K89A 4ORCB 1MQ1A 1FI6A 4BY4A 1KQVA 1TNXA 2ZKMX 4DS7A 1UHHA 1IQ5A 1M31A 2JRFA 1PVAA 2LVKA 1LVCD 1RFJA 1S6JA 1EXRA 2LNKA 3RM1A 1SL7A 4GGFA 2P6BB 1PALA 1RROA 2LVVA 3SG3A 3H4SE 1CM1A 1Y6WA 1JFJA 2I2RE 2K8MB 1ZFSA 1A2XA 1G8IA 1NWDA 3QRXA 2PMYA 4M2OA 4NQGA 3ICBA 1YUSA 1KQMB 3NSLA 2JZIA 3TZ1A 1SCMB 1A03A 1YX8A 1PVBA 3PM8A 4XJKB 3AAJA 5IBWA 1DJWA 2CXJA 1YUTA 2F33A 4CIDA 1KWOC 3KHEA 2JTZA 1CFDA 2GGZA 4QJ5B 1JSAA 2L50A 4CFRA 2EHBA 1YR5A 3BUNB 4NDBA 2ZN9A 1CMFA 2MA2A 4I5JA 2KYCA 5BPJA 1HQVA 2COLB 1IQ3A 1JC2A 3O4YA 1EG4A 3WNXB 1XFVO 4DUQA 2L51A 5TNCA 2MBXA 1S6IA 4QJ4B 1U5IB 2BCAA 2KSPA 2LC5A 1BOCA 1DMOA 4DIRA 3DD4A 1E8AA 1XVJA 2LCPA 1YVHA 4GPLB 2Q91A 1K90D 1FW4A 1DGUA 2LVIA 3LL8B 1DJGA 2M1KB 2JXLA 2KAVA 3DVEA 4PDZA 2BL0C 1J1DA 3DF0A 4YGEB 1SL9A 1RJVA 1XFZO 2KAYA 2Q4UA 3PN7C 1J7OA 5D7FA 3AAKA 4HREE 1SBJA 2LANA 3JVTB 2KBIA 1FF1A 4PALA 1ODBA 1AJ5A 1EJ3A 1BR4B 1ALVA 3I5IC 1NCYA 2L5XB 1UHNA 3O6BA 2HQ8A 1S1EA 1OMRA 3VRRA 3DVMA 4XJKA 5AFPA 2R2IA 5J3XA 1IJ5A 1CFPA 4HSZA 1B8CA 1CNPA 4N1FA 1NYAA 2E30A 1LXFC 2RGIA 1TTXA 1D1OA 1K8UA 5CSNA 1NPQA 4C0JA 1PULA 1IH0A 2L2EA 1TIZA 3FIAA 1SCVA 1L7ZA 2BBMA 2LMUA 1BMOA 2KGRA 2NCPA 1XFWO 2A4JA 4C0LA 4PCWA 2H2KA 1EL4A 1CDPA 1NP8A 1TRFA 3IQQA 3EK8A 1BF5A 1KK8C 3NSOA 1JF0A 2K7BA 2L98A 3HCMA 2LLTA 2LP3A 1KK8B 1M39A 1NCXA 1IJ6A 1TNQA 1AVSA 2NLNA 2OS8C 2ZFDA 2FOTA 1WDCC 2K7OA 5HKYA 2WCEA 3E3RA 1BR1B 4A4CA 4U8DA 2MLEC 3I5IB 2M0RA 4DCKA 4ETOA 2F8PA 2KGBC 3BUMB 3SG5A 4D1EA 3EKHA 1K9UA 4Q04A 1B4CA 1L2OB 4MN0A 1Y1AA 4A4BA 1IKUA 4JPZB 1B8LA 1G33A 1C7WA 2LV7A 1LKJA 2ZNEA 2K2FA 5JJGA 1F8HA 1ZOTB 4UPGA 1A29A 1KFXS 1M46A 2KI4C 4GNKB 2OTGC 4GBAA 3EK4A 1TOPA 2JULA 1B8RA 2K2AA 4I5LB 3GOFA 1EG3A 1V1FA 2L4HA 3O78A 5G08A 1XK4A 2CBLA 4DRWA 1JUOA 1X02A 3PATA 3VRQA 3KO0A 2PSRA 1Y1UA 1MXLC 2FJUB 4CLNA 1FPWA 2JTTA 1M45A 2Y1MA 1WRLA 5KTYA 1TNWA 2JT0A 1KK7Z 2L4IA 1WRKA 2JU0A 4PHJA 1R6PA 1NX2A 1F71A 4YRUA 1SNLA 3I5GB 4QJ3B 2I7AA 1CLMA 1AHRA 1GJYA 1LA3A 1OOJA 2QACA 1ZUZA 4WQ3A 4MVFA 1CFCA 1GGZA 2LHLA 4TNCA 1UURA 1XO5A 4MZKA 3ZWHA 2NXQA 5CPVA 1CB1A 3ZNIA 1B7TZ 2F3ZA 2BE4A 2M49B 1KSMA 1OZOA 5DKRA 2NCOA 3TDUA 2LMTA 2JT3A 5HYDA 1YUUA 2K61A 2LE9B 2PALA 4PHMA 1JF2A 2K7DA 1PRWA 3I5GC 2G9BA 2KDHA 2WCBA 3I5HC 3CWGA 1DJIA 1QXPA 1CLBA 1B1GA 2HPSA 3BOWA 2LAPA 5CSJA 3I5FC 3OX6A 5DKNA 4GGNA 1QIVA 1PK0D 2JQ6A 1KSOA 2MHHA 2LMVA 1WLZA 2V53A 1J7RA 3SG6A 3SG7A 3FS7A 2E6WA 2SASA 3BYAA 1DJZA 1BU3A 2M97A 4MZLA 1FI5A 2H61A 2M29A 4CFQA 1SMGA 1N2DA 5B8IB 1TN4A 3OP0A 1XFUO 1J7PA 4PE4A 3VRPA 1IGVA 2L0PA 2WCFA 3PFVA 4HRHA 4WRIA 3TUYC 4PE1A 1IWQA 4ICBA 5CSFA 1KFUL 2KAXA 1JBAA 2B1UA 3SG4A 2MAZA 4ZCVA 1QATA 1K2HA 1KK7Y 2FCEA 4AQJA 1TCFA 3CR4X 1OE9B 1WY9A 2HF5A 2Y5IA 2AMIA 3D0YB 2D8NA 2LVJA 2SCPA 1SR6B 4AQIA 4BY5A 3KF9A 3CGAA 5F6TA 1S26D 2JXCA 1KCYA 2K7CA 1CDLA 3OHMB 1GQMA 2Y4QA 1J1EA 4NDDA 3RLZA 2WNDA 2QPTA 1R2UA 1SPYA 1NIWA 2M1UA 5ER4X 1TCOB 5AXIA 1K96A 3VROA 1K95A 3FWBA 1SR6C 1K94A 3HX4A 1N0YA 4YGAA 2PASA 4PE7A 3I5HB 1QASA 4FTGA 3SG2A 1QLSA 1S36A 2OPOA 2WOSA 1BODA 2M9GA 2KI6D 3CR2A 2OTGB 2Y1NA 2JPTA 1QX5B 4PE0A 1WRZA 2CT9A 4AOMA 4YGBB 1DJHA 1V1GA 1B9AA 2AUCA 3PLFB 4GAOA 1AK8A 1OZSA 4MRYA 1DTLA 2BE6A 3JVTC 1NX3A 4OKHA 5HKWA 3LCPC 1S5GY 1GGWA 3OB1B 3A4UB 1UHIA 2ZN8A 4F0ZB 2JC2A 4I5KA 1H4BA 4JWQA 5AANA 3BUWB 5D69A 3BOWB 3JTDB 2ZNDA 2LHIA 4NDCA 1QV0A 3LLEA 4C0KA 5HLVA 1N65A 1Y0VH 3DVJA 1ZMZA 1MF8B 1K9KA 2JNXA 2BECA 2KBMA 2ISDA 5ER5A 2I18A 4YI8A 1QVIZ 5HLOA 1SK6D 2CTNA 1OMDA 2MJWB 2KHNA 4YGCB 3OX5A 2MRDA 3AKBA 3IF7A 5DKQA 3VRNA 2EC6B 2EGDA 1AJ4A
chains in the Genus database with same CATH superfamily
4PHNA 2EC6C 2KQ6A 1DJYA 1CDNA 4YI9A 1W7IB 2KLDA 1MHOA 4JKTA 5I94A 4M2PA 1B47A 1DGVA 3FE9A 2ZRSA 1SKTA 5GQQC 2FCDA 4IL1A 3D10A 2M8UA 2BL0B 1PSRA 4MSPA 3D0YA 2KPHA 1F4OA 1NUBA 3NSKA 4YBHB 1A75B 3TS5C 2QDIA 1NCZA 2CCMA 3WXAA 4ORAB 3I5FB 1CFFA 2F2PA 1YURA 1FBVA 4L9MA 2LUCA 1A4PA 1JFKA 1F4QA 2I94A 1SW8A 2KOTA 3A8RA 3D78A 4ORBB 1J55A 5HKZA 1UUSA 1Q80A 4OR9B 1RTP1 3EVRA 3GK4X 1VRKA 5I2LA 2KQYA 1HT9A 1YTZC 4GFTA 1QX2A 4KYNA 4R1EA 4PHKA 1G4YR 1F70A 3L47A 1MWNA 2HQWA 4JQ0D 3B87A 1K9PA 3V2LA 1QIWA 1TUZA 3CR5X 3TUYB 1S6CA 2LUXA 1J7QA 2H61C 3LK0A 1OQPA 2PVBA 3SIAA 3CTNA 3C1VA 2KFFA 3BQ3A 4YGDB 5KSZA 4M2QA 3EVUA 1OOHA 1RECA 1SYMA 3AKAA 1BJFA 4MEWA 3TDZA 1M63B 3WHUB 2KI6C 3PSRA 4OCIA 2DOQA 3OBVA 1QV1A 1C07A 3PN7B 2BCXA 3NGVA 1OW4A 2M7LA 3CLNA 5JOLA 4GGFC 1SRAA 3IQOA 2BKIB 4N5XA 4P2YB 4XYNA 3EVVA 1SL8A 1NSHA 2OS8B 4OZDA 1CFCA 1KFXL 1S3PA 1QWVA 1TWOA 2GGMA 2M7NA 2VRGA 2WCHA 4ZCUA 4FQOA 2WORA 2P71A 3BJHA 2BCBA 1YRUB 3R1PA 4P5OE 3EK7A 1BT6A 1DT7B 1ALWA 3S0FA 3NXAA 1B7TY 2KI4B 1QX7A 2JWWA 1XK4C 3K21A 2M3WA 1LA0A 1CKKA 4OV2A 1CTRA 2BNXA 1RK9A 1S5GZ 2MLFC 3KEVA 2JOJA 5AERA 4I5NB 1YRTB 3CS1A 3DF0B 3JTDC 1DVIA 1UP5A 4E68A 2LLUA 3SIBA 3WHTB 3EKJA 1K93D 3FWCA 1DF0A 3QMEA 4MBEA 2QEBA 1KWOB 2WC8A 1C7VA 1AUIB 2BKHB 2ZRTA 1DF0B 2WCKA 3OB2B 3R1VA 1SCMC 2BBNA 2O5GA 2LM5A 5FI2A 1WDCB 4GUKA 4N1GA 2KNEA 3CZ1A 4MRXA 1YVLA 2O60A 1SY9A 2F3YA 5PALA 2IS9A 1AP4A 1UHJA 1TNPA 1EH2A 5I2QA 5I8NA 2KYFA 1DELA 2WCLA 1QTXA 3VGOA 1CDMA 1H8BA 1XFYO 1RWYA 1QLKA 3BXKA 2JT8A 3KPXA 5FYXA 1F55A 3O2PA 3BUXB 3GK2A 1U5IA 1WLMA 1UHKA 4PT1A 2JPOA 3S0GA 1BG1A 1QJTA 2TN4A 3LK1A 3SS4A 2LLSA 2KFHA 1IG5A 1QVIY 2HETA 1JWDA 2AAOA 1IRJA 1NX1A 2WCJA 2JNFA 4HRGA 3D76A 3TDIA 1XA5A 2NZ0A 5I2OA 3TS5B 1CM4A 5CSIA 2GV5A 1MXEA 1CLLA 2CNPA 3DZTA 1QS7A 3CZTX 1L2OC 1XFXO 3GK1A 2F2OA 1LINA 1MR8A 3MSEB 1W7JB 1ZACA 3BUOB 3DVKA 4USLA 2L5YA 2LP2A 2KFGA 4CPVA 1DJXA 3PALA 1OSAA 3M0WA 2PRUA 1KQMC 1UWOA 1OMVA 4MLWA 1PSBA 1XYDA 2G2BA 3DY9A 4MZJA 1BLQA 1F54A 3SJSA 3NSIA 1IIOA 1Y1XA 1MUXA 1NX0A 5AEQA 1KFUS 2K0JA 4WQ2A 1YX7A 5FI7A 1CMGA 1A75A 5DICA 3F45A 4OVNF 5KU1A 5K89A 4ORCB 1MQ1A 1FI6A 4BY4A 1KQVA 1TNXA 2ZKMX 4DS7A 1UHHA 1IQ5A 2PYQA 1M31A 2JRFA 1PVAA 2LVKA 1LVCD 1Z4HA 1RFJA 1S6JA 1EXRA 2LNKA 3RM1A 3R1OA 2P70A 1SL7A 4GGFA 2P6BB 1PALA 1RROA 2LVVA 3SG3A 1ORGA 1CM1A 3CZ2A 1Y6WA 3H4SE 3PM2A 1JFJA 1LS8A 2I2RE 2K8MB 1ZFSA 1A2XA 1G8IA 1DQEA 1NWDA 2PMYA 3QRXA 4M2OA 4NQGA 3D73A 3ICBA 3NHIA 1YUSA 1KQMB 3SS5A 3K1EA 3NSLA 2JZIA 3TZ1A 1SCMB 1A03A 1YX8A 1PVBA 3PM8A 4XJKB 3AAJA 3BFAA 5IBWA 1DJWA 2CXJA 1YUTA 2F33A 2WC6A 4CIDA 1KWOC 3KHEA 2JTZA 1CFDA 2GGZA 4QJ5B 1JSAA 2L50A 4CFRA 2EHBA 1YR5A 3BUNB 4NDBA 2ZN9A 1CMFA 2MA2A 4I5JA 2KYCA 5BPJA 1HQVA 2COLB 1IQ3A 1JC2A 3O4YA 1EG4A 3WNXB 1XFVO 4DUQA 2L51A 5TNCA 2MBXA 1S6IA 4QJ4B 1U5IB 2BCAA 2KSPA 2LC5A 1BOCA 1DMOA 4DIRA 3DD4A 1E8AA 1XVJA 2LCPA 1YVHA 4GPLB 5D3OA 2Q91A 1K90D 1FW4A 1DGUA 2LVIA 3LL8B 1DJGA 2M1KB 2JXLA 2KAVA 3DVEA 4PDZA 2BL0C 1J1DA 3DF0A 4YGEB 1SL9A 2QEHA 1RJVA 1XFZO 2KAYA 2Q4UA 3CABA 3PN7C 1J7OA 5D7FA 3AAKA 4HREE 1SBJA 2LANA 3JVTB 2KBIA 1FF1A 1C3ZA 1ODBA 4PALA 1AJ5A 1EJ3A 1BR4B 3R72A 1ALVA 3I5IC 3L4LA 1NCYA 2L5XB 1UHNA 3O6BA 2HQ8A 1S1EA 1OMRA 3UO9A 3VRRA 3DVMA 4XJKA 5AFPA 2R2IA 5J3XA 1IJ5A 1CFPA 4HSZA 2QEVA 1B8CA 3B88A 3Q8IA 1CNPA 4N1FA 1NYAA 2E30A 1LXFC 2RGIA 1TTXA 1D1OA 1K8UA 5CSNA 1NPQA 3IVTA 4C0JA 1PULA 1IH0A 2L2EA 1XFRA 1TIZA 3FIAA 1SCVA 1L7ZA 2BBMA 2LMUA 1BMOA 2KGRA 2NCPA 1XFWO 2A4JA 4C0LA 4PCWA 1EL4A 1CDPA 2H2KA 1NP8A 1TRFA 3DYEA 3EK8A 3IQQA 1KK8C 2ERBA 1JF0A 3NSOA 2K7BA 2L98A 3HCMA 2LLTA 2LP3A 1Z2CB 1KK8B 1M39A 1NCXA 1IJ6A 1TNQA 1AVSA 2NLNA 2OS8C 2QEOA 1OOIX 1WDCC 2FOTA 2K7OA 5HKYA 2WCEA 2YGUA 1OOGA 1BR1B 3E3RA 4A4CA 4U8DA 2MLEC 3I5IB 2M0RA 4DCKA 4ETOA 2F8PA 2KGBC 3BUMB 3SG5A 4D1EA 3EKHA 1K9UA 4Q04A 1B4CA 1L2OB 4MN0A 1Y1AA 4A4BA 1IKUA 4JPZB 1B8LA 1G33A 1C7WA 2LV7A 1LKJA 2ZNEA 2K2FA 5JJGA 1F8HA 1ZOTB 4UPGA 1A29A 3DXLA 1KFXS 1M46A 2KI4C 4GNKB 2OTGC 4GBAA 1C3YA 2H8VA 3EK4A 1TOPA 1TUJA 2K60A 2JULA 1B8RA 2K2AA 4I5LB 3GOFA 1EG3A 1V1FA 2L4HA 3O78A 5G08A 1XK4A 2CBLA 4DRWA 3S0EA 1JUOA 1X02A 3PATA 3VRQA 3KO0A 2PSRA 2L2CA 1Y1UA 1MXLC 2FJUB 4CLNA 1FPWA 2JTTA 1M45A 2Y1MA 1WRLA 5KTYA 1TNWA 2JT0A 1KK7Z 3S0BA 2L4IA 1WRKA 2JU0A 4PHJA 1R6PA 1NX2A 1F71A 4YRUA 1SNLA 3I5GB 3D74A 4QJ3B 5EL2A 2I7AA 1CLMA 1AHRA 1GJYA 1LA3A 1OOJA 1T14A 1ZUZA 2QACA 4MVFA 4WQ3A 1GGZA 2LHLA 3SS3A 4TNCA 1UURA 1XO5A 4MZKA 3ZWHA 2NXQA 5CPVA 1CB1A 3ZNIA 1B7TZ 2F3ZA 2BE4A 2M49B 1KSMA 4F7FA 1OZOA 5DKRA 2NCOA 3TDUA 2LMTA 2JT3A 3B7AA 5HYDA 1YUUA 3EG5B 2K61A 2LE9B 2PALA 4PHMA 1DC1A 1JF2A 2K7DA 1PRWA 3I5GC 2G9BA 2KDHA 2WCBA 3I5HC 2WCMA 3CWGA 1DJIA 1QXPA 3D75A 1CLBA 1B1GA 2HPSA 3BOWA 3S0DA 2LAPA 5CSJA 3CYZA 3I5FC 3OX6A 5DKNA 4GGNA 1QIVA 1PK0D 2JQ6A 3CDNA 4FQTA 1KSOA 2MHHA 2LMVA 1WLZA 2V53A 1J7RA 3SG6A 3SG7A 2FJYA 3FS7A 2E6WA 2SASA 3BYAA 1DJZA 1BU3A 2M97A 4MZLA 1FI5A 2H61A 2M29A 4IJ7A 4CFQA 1SMGA 1N2DA 5B8IB 1TN4A 3S0AA 3OP0A 1XFUO 1J7PA 4PE4A 3VRPA 1IGVA 2L0PA 2WCFA 3PFVA 4HRHA 4WRIA 3TUYC 4PE1A 3L4AA 1DEKA 1IWQA 4ICBA 5CSFA 2WC5A 1KFUL 2KAXA 1JBAA 2B1UA 3SG4A 2MAZA 4ZCVA 1QATA 1K2HA 1KK7Y 2FCEA 4AQJA 3PJIA 1TCFA 2BAPA 3CR4X 1OE9B 1WY9A 2HF5A 2Y5IA 2AMIA 3D0YB 2D8NA 2LVJA 2SCPA 1SR6B 4AQIA 4BY5A 3KF9A 3CGAA 5F6TA 1S26D 2JXCA 1KCYA 2K7CA 1CDLA 3OHMB 1GQMA 2Y4QA 1J1EA 4NDDA 3RLZA 1GM0A 3NHTA 2WNDA 2QPTA 1R2UA 1SPYA 3BFBA 1NIWA 2M1UA 3D77A 1TCOB 1SSEB 1K96A 5ER4X 5AXIA 3VROA 3B6XA 1K95A 3FWBA 1SR6C 1K94A 1P28A 3HX4A 1N0YA 4YGAA 2PASA 4PE7A 3I5HB 1QASA 1W9ZA 4FTGA 1QLSA 1S36A 2OPOA 2WOSA 3SG2A 1BODA 3VB1A 2M9GA 2KI6D 3CR2A 2OTGB 2PQLA 4JD9A 2Y1NA 2JPTA 1QX5B 4PE0A 1WRZA 2CT9A 4AOMA 4YGBB 1DJHA 1V1GA 1B9AA 2AUCA 3PLFB 4GAOA 1AK8A 3RZSA 1OZSA 4MRYA 3FE8A 4INXA 1DTLA 2BE6A 3JVTC 1NX3A 4OKHA 5HKWA 3LCPC 2ZFDA 1S5GY 3N7HA 3OB1B 3A4UB 1GGWA 3B86A 1UHIA 2ZN8A 4F0ZB 2JC2A 4I5KA 1H4BA 3FE6A 4JWQA 5AANA 3BUWB 3O4XA 5D69A 3BOWB 3JTDB 2ZNDA 1OOFA 2LHIA 2GTEA 4NDCA 1QV0A 3LLEA 5HL1A 3CZ0A 4INWA 4C0KA 5HLVA 1N65A 1Y0VH 3DVJA 1ZMZA 1MF8B 1K9KA 2JNXA 2BECA 2KLEA 2KBMA 2ISDA 5ER5A 2I18A 4YI8A 1QVIZ 5HLOA 1SK6D 1BF5A 3BFHA 3UNWA 2CTNA 5FI6A 1OMDA 2MJWB 2KHNA 4YGCB 3OX5A 2MRDA 3AKBA 3IF7A 5DKQA 3VRNA 3OGNA 2EC6B 2EGDA 1AJ4A
chains in the Genus database with same CATH topology
4PHNA 2EC6C 2KQ6A 1DJYA 1CDNA 4YI9A 1W7IB 1MHOA 4M2PA 1B47A 1DGVA 2ZRSA 1SKTA 5GQQC 2FCDA 4IL1A 3D10A 2M8UA 2BL0B 1PSRA 4MSPA 3D0YA 3NSKA 1F4OA 1NUBA 4YBHB 1A75B 3TS5C 1NCZA 2CCMA 3WXAA 4ORAB 3I5FB 1CFFA 2F2PA 1YURA 1FBVA 4L9MA 2LUCA 1A4PA 1JFKA 1F4QA 2I94A 1SW8A 2KOTA 3A8RA 4ORBB 1J55A 5HKZA 1UUSA 1Q80A 4OR9B 1RTP1 3EVRA 3GK4X 1VRKA 5I2LA 2KQYA 1HT9A 1YTZC 4GFTA 1QX2A 4R1EA 4PHKA 1G4YR 1F70A 1MWNA 2HQWA 4JQ0D 1K9PA 1QIWA 3CR5X 3TUYB 1S6CA 2LUXA 1J7QA 2H61C 3LK0A 1OQPA 2PVBA 3SIAA 3CTNA 3C1VA 2KFFA 3BQ3A 4YGDB 5KSZA 4M2QA 3EVUA 3AKAA 1RECA 1SYMA 3TDZA 1BJFA 4MEWA 1M63B 3WHUB 2KI6C 3PSRA 4OCIA 2DOQA 1QV1A 1C07A 3PN7B 2BCXA 2M7LA 3CLNA 5JOLA 4GGFC 1SRAA 3IQOA 2BKIB 4N5XA 4P2YB 4XYNA 3EVVA 1SL8A 1NSHA 2OS8B 1KFXL 1S3PA 2GGMA 2M7NA 4ZCUA 2VRGA 4FQOA 2WORA 2BCBA 1YRUB 4P5OE 3EK7A 1BT6A 1DT7B 1ALWA 3NXAA 1B7TY 2KI4B 1QX7A 2JWWA 1XK4C 3K21A 2M3WA 1LA0A 1CKKA 4OV2A 1CTRA 2MLFC 1RK9A 1S5GZ 3KEVA 2JOJA 5AERA 4I5NB 1YRTB 3CS1A 3DF0B 3JTDC 1DVIA 1UP5A 4E68A 2LLUA 3SIBA 3WHTB 3EKJA 1K93D 3FWCA 1DF0A 4MBEA 1KWOB 2WC8A 1C7VA 1AUIB 2BKHB 2ZRTA 1DF0B 3OB2B 1SCMC 2BBNA 2O5GA 2LM5A 1WDCB 4GUKA 4N1GA 2KNEA 4MRXA 1YVLA 2O60A 1SY9A 2F3YA 5PALA 2IS9A 1AP4A 1UHJA 1TNPA 1EH2A 5I2QA 5I8NA 2KYFA 1QTXA 3VGOA 1CDMA 1H8BA 1XFYO 1RWYA 1QLKA 3BXKA 2JT8A 3KPXA 5FYXA 1F55A 3O2PA 3BUXB 3GK2A 1U5IA 1WLMA 1UHKA 1BG1A 1QJTA 2TN4A 3LK1A 2LLSA 2KFHA 1IG5A 1QVIY 2HETA 1JWDA 2AAOA 1IRJA 1NX1A 4HRGA 2JNFA 3TDIA 1XA5A 2NZ0A 5I2OA 3TS5B 1CM4A 5CSIA 2GV5A 1MXEA 1CLLA 2CNPA 1QS7A 3CZTX 1L2OC 1XFXO 3GK1A 2F2OA 1LINA 1MR8A 3MSEB 1W7JB 1ZACA 3BUOB 3DVKA 4USLA 2LP2A 2KFGA 4CPVA 1DJXA 3PALA 1OSAA 3M0WA 2PRUA 1KQMC 1UWOA 1OMVA 4MLWA 1PSBA 1XYDA 2G2BA 1BLQA 4MZJA 1F54A 3SJSA 3NSIA 1Y1XA 1MUXA 1NX0A 5AEQA 1KFUS 2K0JA 4WQ2A 1YX7A 1CMGA 1A75A 3F45A 4OVNF 5KU1A 5K89A 4ORCB 1MQ1A 1FI6A 4BY4A 1KQVA 1TNXA 2ZKMX 4DS7A 1UHHA 1IQ5A 1M31A 2JRFA 1PVAA 2LVKA 1LVCD 1RFJA 1S6JA 1EXRA 2LNKA 3RM1A 1SL7A 4GGFA 2P6BB 1PALA 1RROA 2LVVA 3SG3A 3H4SE 1CM1A 1Y6WA 1JFJA 2I2RE 2K8MB 1ZFSA 1A2XA 1G8IA 1NWDA 3QRXA 2PMYA 4M2OA 4NQGA 3ICBA 1YUSA 1KQMB 3NSLA 2JZIA 3TZ1A 1SCMB 1A03A 1YX8A 1PVBA 3PM8A 4XJKB 3AAJA 5IBWA 1DJWA 2CXJA 1YUTA 2F33A 4CIDA 1KWOC 3KHEA 2JTZA 1CFDA 2GGZA 4QJ5B 1JSAA 2L50A 4CFRA 2EHBA 1YR5A 3BUNB 4NDBA 2ZN9A 1CMFA 2MA2A 4I5JA 2KYCA 5BPJA 1HQVA 2COLB 1IQ3A 1JC2A 3O4YA 1EG4A 3WNXB 1XFVO 4DUQA 2L51A 5TNCA 2MBXA 1S6IA 4QJ4B 1U5IB 2BCAA 2KSPA 2LC5A 1BOCA 1DMOA 4DIRA 3DD4A 1E8AA 1XVJA 2LCPA 1YVHA 4GPLB 2Q91A 1K90D 1FW4A 1DGUA 2LVIA 3LL8B 1DJGA 2M1KB 2JXLA 2KAVA 3DVEA 4PDZA 2BL0C 1J1DA 3DF0A 4YGEB 1SL9A 1RJVA 1XFZO 2KAYA 2Q4UA 3PN7C 1J7OA 5D7FA 3AAKA 4HREE 1SBJA 2LANA 3JVTB 2KBIA 1FF1A 4PALA 1ODBA 1AJ5A 1EJ3A 1BR4B 1ALVA 3I5IC 1NCYA 2L5XB 1UHNA 3O6BA 2HQ8A 1S1EA 1OMRA 3VRRA 3DVMA 4XJKA 5AFPA 2R2IA 5J3XA 1IJ5A 1CFPA 4HSZA 1B8CA 1CNPA 4N1FA 1NYAA 2E30A 1LXFC 2RGIA 1TTXA 1D1OA 1K8UA 5CSNA 1NPQA 4C0JA 1PULA 1IH0A 2L2EA 1TIZA 3FIAA 1SCVA 1L7ZA 2BBMA 2LMUA 1BMOA 2KGRA 2NCPA 1XFWO 2A4JA 4C0LA 4PCWA 2H2KA 1EL4A 1CDPA 1NP8A 1TRFA 3IQQA 3EK8A 1BF5A 1KK8C 3NSOA 1JF0A 2K7BA 2L98A 3HCMA 2LLTA 2LP3A 1KK8B 1M39A 1NCXA 1IJ6A 1TNQA 1AVSA 2NLNA 2OS8C 2ZFDA 2FOTA 1WDCC 2K7OA 5HKYA 2WCEA 3E3RA 1BR1B 4A4CA 4U8DA 2MLEC 3I5IB 2M0RA 4DCKA 4ETOA 2F8PA 2KGBC 3BUMB 3SG5A 4D1EA 3EKHA 1K9UA 4Q04A 1B4CA 1L2OB 4MN0A 1Y1AA 4A4BA 1IKUA 4JPZB 1B8LA 1G33A 1C7WA 2LV7A 1LKJA 2ZNEA 2K2FA 5JJGA 1F8HA 1ZOTB 4UPGA 1A29A 1KFXS 1M46A 2KI4C 4GNKB 2OTGC 4GBAA 3EK4A 1TOPA 2JULA 1B8RA 2K2AA 4I5LB 3GOFA 1EG3A 1V1FA 2L4HA 3O78A 5G08A 1XK4A 2CBLA 4DRWA 1JUOA 1X02A 3PATA 3VRQA 3KO0A 2PSRA 1Y1UA 1MXLC 2FJUB 4CLNA 1FPWA 2JTTA 1M45A 2Y1MA 1WRLA 5KTYA 1TNWA 2JT0A 1KK7Z 2L4IA 1WRKA 2JU0A 4PHJA 1R6PA 1NX2A 1F71A 4YRUA 1SNLA 3I5GB 4QJ3B 2I7AA 1CLMA 1AHRA 1GJYA 1LA3A 1OOJA 2QACA 1ZUZA 4WQ3A 4MVFA 1CFCA 1GGZA 2LHLA 4TNCA 1UURA 1XO5A 4MZKA 3ZWHA 2NXQA 5CPVA 1CB1A 3ZNIA 1B7TZ 2F3ZA 2BE4A 2M49B 1KSMA 1OZOA 5DKRA 2NCOA 3TDUA 2LMTA 2JT3A 5HYDA 1YUUA 2K61A 2LE9B 2PALA 4PHMA 1JF2A 2K7DA 1PRWA 3I5GC 2G9BA 2KDHA 2WCBA 3I5HC 3CWGA 1DJIA 1QXPA 1CLBA 1B1GA 2HPSA 3BOWA 2LAPA 5CSJA 3I5FC 3OX6A 5DKNA 4GGNA 1QIVA 1PK0D 2JQ6A 1KSOA 2MHHA 2LMVA 1WLZA 2V53A 1J7RA 3SG6A 3SG7A 3FS7A 2E6WA 2SASA 3BYAA 1DJZA 1BU3A 2M97A 4MZLA 1FI5A 2H61A 2M29A 4CFQA 1SMGA 1N2DA 5B8IB 1TN4A 3OP0A 1XFUO 1J7PA 4PE4A 3VRPA 1IGVA 2L0PA 2WCFA 3PFVA 4HRHA 4WRIA 3TUYC 4PE1A 1IWQA 4ICBA 5CSFA 1KFUL 2KAXA 1JBAA 2B1UA 3SG4A 2MAZA 4ZCVA 1QATA 1K2HA 1KK7Y 2FCEA 4AQJA 1TCFA 3CR4X 1OE9B 1WY9A 2HF5A 2Y5IA 2AMIA 3D0YB 2D8NA 2LVJA 2SCPA 1SR6B 4AQIA 4BY5A 3KF9A 3CGAA 5F6TA 1S26D 2JXCA 1KCYA 2K7CA 1CDLA 3OHMB 1GQMA 2Y4QA 1J1EA 4NDDA 3RLZA 2WNDA 2QPTA 1R2UA 1SPYA 1NIWA 2M1UA 5ER4X 1TCOB 5AXIA 1K96A 3VROA 1K95A 3FWBA 1SR6C 1K94A 3HX4A 1N0YA 4YGAA 2PASA 4PE7A 3I5HB 1QASA 4FTGA 3SG2A 1QLSA 1S36A 2OPOA 2WOSA 1BODA 2M9GA 2KI6D 3CR2A 2OTGB 2Y1NA 2JPTA 1QX5B 4PE0A 1WRZA 2CT9A 4AOMA 4YGBB 1DJHA 1V1GA 1B9AA 2AUCA 3PLFB 4GAOA 1AK8A 1OZSA 4MRYA 1DTLA 2BE6A 3JVTC 1NX3A 4OKHA 5HKWA 3LCPC 1S5GY 1GGWA 3OB1B 3A4UB 1UHIA 2ZN8A 4F0ZB 2JC2A 4I5KA 1H4BA 4JWQA 5AANA 3BUWB 5D69A 3BOWB 3JTDB 2ZNDA 2LHIA 4NDCA 1QV0A 3LLEA 4C0KA 5HLVA 1N65A 1Y0VH 3DVJA 1ZMZA 1MF8B 1K9KA 2JNXA 2BECA 2KBMA 2ISDA 5ER5A 2I18A 4YI8A 1QVIZ 5HLOA 1SK6D 2CTNA 1OMDA 2MJWB 2KHNA 4YGCB 3OX5A 2MRDA 3AKBA 3IF7A 5DKQA 3VRNA 2EC6B 2EGDA 1AJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHN A;  2EC6 C;  2KQ6 A;  1DJY A;  1CDN A;  4YI9 A;  1W7I B;  1MHO A;  4M2P A;  1B47 A;  1DGV A;  2ZRS A;  1SKT A;  5GQQ C;  2FCD A;  4IL1 A;  3D10 A;  2M8U A;  2BL0 B;  1PSR A;  4MSP A;  3D0Y A;  3NSK A;  1F4O A;  1NUB A;  4YBH B;  1A75 B;  3TS5 C;  1NCZ A;  2CCM A;  3WXA A;  4ORA B;  3I5F B;  1CFF A;  2F2P A;  1YUR A;  1FBV A;  4L9M A;  2LUC A;  1A4P A;  1JFK A;  1F4Q A;  2I94 A;  1SW8 A;  2KOT A;  3A8R A;  4ORB B;  1J55 A;  5HKZ A;  1UUS A;  1Q80 A;  4OR9 B;  1RTP 1;  3EVR A;  3GK4 X;  1VRK A;  5I2L A;  2KQY A;  1HT9 A;  1YTZ C;  4GFT A;  1QX2 A;  4R1E A;  4PHK A;  1G4Y R;  1F70 A;  1MWN A;  2HQW A;  4JQ0 D;  1K9P A;  1QIW A;  3CR5 X;  3TUY B;  1S6C A;  2LUX A;  1J7Q A;  2H61 C;  3LK0 A;  1OQP A;  2PVB A;  3SIA A;  3CTN A;  3C1V A;  2KFF A;  3BQ3 A;  4YGD B;  5KSZ A;  4M2Q A;  3EVU A;  3AKA A;  1REC A;  1SYM A;  3TDZ A;  1BJF A;  4MEW A;  1M63 B;  3WHU B;  2KI6 C;  3PSR A;  4OCI A;  2DOQ A;  1QV1 A;  1C07 A;  3PN7 B;  2BCX A;  2M7L A;  3CLN A;  5JOL A;  4GGF C;  1SRA A;  3IQO A;  2BKI B;  4N5X A;  4P2Y B;  4XYN A;  3EVV A;  1SL8 A;  1NSH A;  2OS8 B;  1KFX L;  1S3P A;  2GGM A;  2M7N A;  4ZCU A;  2VRG A;  4FQO A;  2WOR A;  2BCB A;  1YRU B;  4P5O E;  3EK7 A;  1BT6 A;  1DT7 B;  1ALW A;  3NXA A;  1B7T Y;  2KI4 B;  1QX7 A;  2JWW A;  1XK4 C;  3K21 A;  2M3W A;  1LA0 A;  1CKK A;  4OV2 A;  1CTR A;  2MLF C;  1RK9 A;  1S5G Z;  3KEV A;  2JOJ A;  5AER A;  4I5N B;  1YRT B;  3CS1 A;  3DF0 B;  3JTD C;  1DVI A;  1UP5 A;  4E68 A;  2LLU A;  3SIB A;  3WHT B;  3EKJ A;  1K93 D;  3FWC A;  1DF0 A;  4MBE A;  1KWO B;  2WC8 A;  1C7V A;  1AUI B;  2BKH B;  2ZRT A;  1DF0 B;  3OB2 B;  1SCM C;  2BBN A;  2O5G A;  2LM5 A;  1WDC B;  4GUK A;  4N1G A;  2KNE A;  4MRX A;  1YVL A;  2O60 A;  1SY9 A;  2F3Y A;  5PAL A;  2IS9 A;  1AP4 A;  1UHJ A;  1TNP A;  1EH2 A;  5I2Q A;  5I8N A;  2KYF A;  1QTX A;  3VGO A;  1CDM A;  1H8B A;  1XFY O;  1RWY A;  1QLK A;  3BXK A;  2JT8 A;  3KPX A;  5FYX A;  1F55 A;  3O2P A;  3BUX B;  3GK2 A;  1U5I A;  1WLM A;  1UHK A;  1BG1 A;  1QJT A;  2TN4 A;  3LK1 A;  2LLS A;  2KFH A;  1IG5 A;  1QVI Y;  2HET A;  1JWD A;  2AAO A;  1IRJ A;  1NX1 A;  4HRG A;  2JNF A;  3TDI A;  1XA5 A;  2NZ0 A;  5I2O A;  3TS5 B;  1CM4 A;  5CSI A;  2GV5 A;  1MXE A;  1CLL A;  2CNP A;  1QS7 A;  3CZT X;  1L2O C;  1XFX O;  3GK1 A;  2F2O A;  1LIN A;  1MR8 A;  3MSE B;  1W7J B;  1ZAC A;  3BUO B;  3DVK A;  4USL A;  2LP2 A;  2KFG A;  4CPV A;  1DJX A;  3PAL A;  1OSA A;  3M0W A;  2PRU A;  1KQM C;  1UWO A;  1OMV A;  4MLW A;  1PSB A;  1XYD A;  2G2B A;  1BLQ A;  4MZJ A;  1F54 A;  3SJS A;  3NSI A;  1Y1X A;  1MUX A;  1NX0 A;  5AEQ A;  1KFU S;  2K0J A;  4WQ2 A;  1YX7 A;  1CMG A;  1A75 A;  3F45 A;  4OVN F;  5KU1 A;  5K89 A;  4ORC B;  1MQ1 A;  1FI6 A;  4BY4 A;  1KQV A;  1TNX A;  2ZKM X;  4DS7 A;  1UHH A;  1IQ5 A;  1M31 A;  2JRF A;  1PVA A;  2LVK A;  1LVC D;  1RFJ A;  1S6J A;  1EXR A;  2LNK A;  3RM1 A;  1SL7 A;  4GGF A;  2P6B B;  1PAL A;  1RRO A;  2LVV A;  3SG3 A;  3H4S E;  1CM1 A;  1Y6W A;  1JFJ A;  2I2R E;  2K8M B;  1ZFS A;  1A2X A;  1G8I A;  1NWD A;  3QRX A;  2PMY A;  4M2O A;  4NQG A;  3ICB A;  1YUS A;  1KQM B;  3NSL A;  2JZI A;  3TZ1 A;  1SCM B;  1A03 A;  1YX8 A;  1PVB A;  3PM8 A;  4XJK B;  3AAJ A;  5IBW A;  1DJW A;  2CXJ A;  1YUT A;  2F33 A;  4CID A;  1KWO C;  3KHE A;  2JTZ A;  1CFD A;  2GGZ A;  4QJ5 B;  1JSA A;  2L50 A;  4CFR A;  2EHB A;  1YR5 A;  3BUN B;  4NDB A;  2ZN9 A;  1CMF A;  2MA2 A;  4I5J A;  2KYC A;  5BPJ A;  1HQV A;  2COL B;  1IQ3 A;  1JC2 A;  3O4Y A;  1EG4 A;  3WNX B;  1XFV O;  4DUQ A;  2L51 A;  5TNC A;  2MBX A;  1S6I A;  4QJ4 B;  1U5I B;  2BCA A;  2KSP A;  2LC5 A;  1BOC A;  1DMO A;  4DIR A;  3DD4 A;  1E8A A;  1XVJ A;  2LCP A;  1YVH A;  4GPL B;  2Q91 A;  1K90 D;  1FW4 A;  1DGU A;  2LVI A;  3LL8 B;  1DJG A;  2M1K B;  2JXL A;  2KAV A;  3DVE A;  4PDZ A;  2BL0 C;  1J1D A;  3DF0 A;  4YGE B;  1SL9 A;  1RJV A;  1XFZ O;  2KAY A;  2Q4U A;  3PN7 C;  1J7O A;  5D7F A;  3AAK A;  4HRE E;  1SBJ A;  2LAN A;  3JVT B;  2KBI A;  1FF1 A;  4PAL A;  1ODB A;  1AJ5 A;  1EJ3 A;  1BR4 B;  1ALV A;  3I5I C;  1NCY A;  2L5X B;  1UHN A;  3O6B A;  2HQ8 A;  1S1E A;  1OMR A;  3VRR A;  3DVM A;  4XJK A;  5AFP A;  2R2I A;  5J3X A;  1IJ5 A;  1CFP A;  4HSZ A;  1B8C A;  1CNP A;  4N1F A;  1NYA A;  2E30 A;  1LXF C;  2RGI A;  1TTX A;  1D1O A;  1K8U A;  5CSN A;  1NPQ A;  4C0J A;  1PUL A;  1IH0 A;  2L2E A;  1TIZ A;  3FIA A;  1SCV A;  1L7Z A;  2BBM A;  2LMU A;  1BMO A;  2KGR A;  2NCP A;  1XFW O;  2A4J A;  4C0L A;  4PCW A;  2H2K A;  1EL4 A;  1CDP A;  1NP8 A;  1TRF A;  3IQQ A;  3EK8 A;  1BF5 A;  1KK8 C;  3NSO A;  1JF0 A;  2K7B A;  2L98 A;  3HCM A;  2LLT A;  2LP3 A;  1KK8 B;  1M39 A;  1NCX A;  1IJ6 A;  1TNQ A;  1AVS A;  2NLN A;  2OS8 C;  2ZFD A;  2FOT A;  1WDC C;  2K7O A;  5HKY A;  2WCE A;  3E3R A;  1BR1 B;  4A4C A;  4U8D A;  2MLE C;  3I5I B;  2M0R A;  4DCK A;  4ETO A;  2F8P A;  2KGB C;  3BUM B;  3SG5 A;  4D1E A;  3EKH A;  1K9U A;  4Q04 A;  1B4C A;  1L2O B;  4MN0 A;  1Y1A A;  4A4B A;  1IKU A;  4JPZ B;  1B8L A;  1G33 A;  1C7W A;  2LV7 A;  1LKJ A;  2ZNE A;  2K2F A;  5JJG A;  1F8H A;  1ZOT B;  4UPG A;  1A29 A;  1KFX S;  1M46 A;  2KI4 C;  4GNK B;  2OTG C;  4GBA A;  3EK4 A;  1TOP A;  2JUL A;  1B8R A;  2K2A A;  4I5L B;  3GOF A;  1EG3 A;  1V1F A;  2L4H A;  3O78 A;  5G08 A;  1XK4 A;  2CBL A;  4DRW A;  1JUO A;  1X02 A;  3PAT A;  3VRQ A;  3KO0 A;  2PSR A;  1Y1U A;  1MXL C;  2FJU B;  4CLN A;  1FPW A;  2JTT A;  1M45 A;  2Y1M A;  1WRL A;  5KTY A;  1TNW A;  2JT0 A;  1KK7 Z;  2L4I A;  1WRK A;  2JU0 A;  4PHJ A;  1R6P A;  1NX2 A;  1F71 A;  4YRU A;  1SNL A;  3I5G B;  4QJ3 B;  2I7A A;  1CLM A;  1AHR A;  1GJY A;  1LA3 A;  1OOJ A;  2QAC A;  1ZUZ A;  4WQ3 A;  4MVF A;  1CFC A;  1GGZ A;  2LHL A;  4TNC A;  1UUR A;  1XO5 A;  4MZK A;  3ZWH A;  2NXQ A;  5CPV A;  1CB1 A;  3ZNI A;  1B7T Z;  2F3Z A;  2BE4 A;  2M49 B;  1KSM A;  1OZO A;  5DKR A;  2NCO A;  3TDU A;  2LMT A;  2JT3 A;  5HYD A;  1YUU A;  2K61 A;  2LE9 B;  2PAL A;  4PHM A;  1JF2 A;  2K7D A;  1PRW A;  3I5G C;  2G9B A;  2KDH A;  2WCB A;  3I5H C;  3CWG A;  1DJI A;  1QXP A;  1CLB A;  1B1G A;  2HPS A;  3BOW A;  2LAP A;  5CSJ A;  3I5F C;  3OX6 A;  5DKN A;  4GGN A;  1QIV A;  1PK0 D;  2JQ6 A;  1KSO A;  2MHH A;  2LMV A;  1WLZ A;  2V53 A;  1J7R A;  3SG6 A;  3SG7 A;  3FS7 A;  2E6W A;  2SAS A;  3BYA A;  1DJZ A;  1BU3 A;  2M97 A;  4MZL A;  1FI5 A;  2H61 A;  2M29 A;  4CFQ A;  1SMG A;  1N2D A;  5B8I B;  1TN4 A;  3OP0 A;  1XFU O;  1J7P A;  4PE4 A;  3VRP A;  1IGV A;  2L0P A;  2WCF A;  3PFV A;  4HRH A;  4WRI A;  3TUY C;  4PE1 A;  1IWQ A;  4ICB A;  5CSF A;  1KFU L;  2KAX A;  1JBA A;  2B1U A;  3SG4 A;  2MAZ A;  4ZCV A;  1QAT A;  1K2H A;  1KK7 Y;  2FCE A;  4AQJ A;  1TCF A;  3CR4 X;  1OE9 B;  1WY9 A;  2HF5 A;  2Y5I A;  2AMI A;  3D0Y B;  2D8N A;  2LVJ A;  2SCP A;  1SR6 B;  4AQI A;  4BY5 A;  3KF9 A;  3CGA A;  5F6T A;  1S26 D;  2JXC A;  1KCY A;  2K7C A;  1CDL A;  3OHM B;  1GQM A;  2Y4Q A;  1J1E A;  4NDD A;  3RLZ A;  2WND A;  2QPT A;  1R2U A;  1SPY A;  1NIW A;  2M1U A;  5ER4 X;  1TCO B;  5AXI A;  1K96 A;  3VRO A;  1K95 A;  3FWB A;  1SR6 C;  1K94 A;  3HX4 A;  1N0Y A;  4YGA A;  2PAS A;  4PE7 A;  3I5H B;  1QAS A;  4FTG A;  3SG2 A;  1QLS A;  1S36 A;  2OPO A;  2WOS A;  1BOD A;  2M9G A;  2KI6 D;  3CR2 A;  2OTG B;  2Y1N A;  2JPT A;  1QX5 B;  4PE0 A;  1WRZ A;  2CT9 A;  4AOM A;  4YGB B;  1DJH A;  1V1G A;  1B9A A;  2AUC A;  3PLF B;  4GAO A;  1AK8 A;  1OZS A;  4MRY A;  1DTL A;  2BE6 A;  3JVT C;  1NX3 A;  4OKH A;  5HKW A;  3LCP C;  1S5G Y;  1GGW A;  3OB1 B;  3A4U B;  1UHI A;  2ZN8 A;  4F0Z B;  2JC2 A;  4I5K A;  1H4B A;  4JWQ A;  5AAN A;  3BUW B;  5D69 A;  3BOW B;  3JTD B;  2ZND A;  2LHI A;  4NDC A;  1QV0 A;  3LLE A;  4C0K A;  5HLV A;  1N65 A;  1Y0V H;  3DVJ A;  1ZMZ A;  1MF8 B;  1K9K A;  2JNX A;  2BEC A;  2KBM A;  2ISD A;  5ER5 A;  2I18 A;  4YI8 A;  1QVI Z;  5HLO A;  1SK6 D;  2CTN A;  1OMD A;  2MJW B;  2KHN A;  4YGC B;  3OX5 A;  2MRD A;  3AKB A;  3IF7 A;  5DKQ A;  3VRN A;  2EC6 B;  2EGD A;  1AJ4 A; 
#chains in the Genus database with same CATH topology
 4PHN A;  2EC6 C;  2KQ6 A;  1DJY A;  1CDN A;  4YI9 A;  1W7I B;  2KLD A;  1MHO A;  4JKT A;  5I94 A;  4M2P A;  1B47 A;  1DGV A;  3FE9 A;  2ZRS A;  1SKT A;  5GQQ C;  2FCD A;  4IL1 A;  3D10 A;  2M8U A;  2BL0 B;  1PSR A;  4MSP A;  3D0Y A;  2KPH A;  1F4O A;  1NUB A;  3NSK A;  4YBH B;  1A75 B;  3TS5 C;  2QDI A;  1NCZ A;  2CCM A;  3WXA A;  4ORA B;  3I5F B;  1CFF A;  2F2P A;  1YUR A;  1FBV A;  4L9M A;  2LUC A;  1A4P A;  1JFK A;  1F4Q A;  2I94 A;  1SW8 A;  2KOT A;  3A8R A;  3D78 A;  4ORB B;  1J55 A;  5HKZ A;  1UUS A;  1Q80 A;  4OR9 B;  1RTP 1;  3EVR A;  3GK4 X;  1VRK A;  5I2L A;  2KQY A;  1HT9 A;  1YTZ C;  4GFT A;  1QX2 A;  4KYN A;  4R1E A;  4PHK A;  1G4Y R;  1F70 A;  3L47 A;  1MWN A;  2HQW A;  4JQ0 D;  3B87 A;  1K9P A;  3V2L A;  1QIW A;  1TUZ A;  3CR5 X;  3TUY B;  1S6C A;  2LUX A;  1J7Q A;  2H61 C;  3LK0 A;  1OQP A;  2PVB A;  3SIA A;  3CTN A;  3C1V A;  2KFF A;  3BQ3 A;  4YGD B;  5KSZ A;  4M2Q A;  3EVU A;  1OOH A;  1REC A;  1SYM A;  3AKA A;  1BJF A;  4MEW A;  3TDZ A;  1M63 B;  3WHU B;  2KI6 C;  3PSR A;  4OCI A;  2DOQ A;  3OBV A;  1QV1 A;  1C07 A;  3PN7 B;  2BCX A;  3NGV A;  1OW4 A;  2M7L A;  3CLN A;  5JOL A;  4GGF C;  1SRA A;  3IQO A;  2BKI B;  4N5X A;  4P2Y B;  4XYN A;  3EVV A;  1SL8 A;  1NSH A;  2OS8 B;  4OZD A;  1CFC A;  1KFX L;  1S3P A;  1QWV A;  1TWO A;  2GGM A;  2M7N A;  2VRG A;  2WCH A;  4ZCU A;  4FQO A;  2WOR A;  2P71 A;  3BJH A;  2BCB A;  1YRU B;  3R1P A;  4P5O E;  3EK7 A;  1BT6 A;  1DT7 B;  1ALW A;  3S0F A;  3NXA A;  1B7T Y;  2KI4 B;  1QX7 A;  2JWW A;  1XK4 C;  3K21 A;  2M3W A;  1LA0 A;  1CKK A;  4OV2 A;  1CTR A;  2BNX A;  1RK9 A;  1S5G Z;  2MLF C;  3KEV A;  2JOJ A;  5AER A;  4I5N B;  1YRT B;  3CS1 A;  3DF0 B;  3JTD C;  1DVI A;  1UP5 A;  4E68 A;  2LLU A;  3SIB A;  3WHT B;  3EKJ A;  1K93 D;  3FWC A;  1DF0 A;  3QME A;  4MBE A;  2QEB A;  1KWO B;  2WC8 A;  1C7V A;  1AUI B;  2BKH B;  2ZRT A;  1DF0 B;  2WCK A;  3OB2 B;  3R1V A;  1SCM C;  2BBN A;  2O5G A;  2LM5 A;  5FI2 A;  1WDC B;  4GUK A;  4N1G A;  2KNE A;  3CZ1 A;  4MRX A;  1YVL A;  2O60 A;  1SY9 A;  2F3Y A;  5PAL A;  2IS9 A;  1AP4 A;  1UHJ A;  1TNP A;  1EH2 A;  5I2Q A;  5I8N A;  2KYF A;  1DEL A;  2WCL A;  1QTX A;  3VGO A;  1CDM A;  1H8B A;  1XFY O;  1RWY A;  1QLK A;  3BXK A;  2JT8 A;  3KPX A;  5FYX A;  1F55 A;  3O2P A;  3BUX B;  3GK2 A;  1U5I A;  1WLM A;  1UHK A;  4PT1 A;  2JPO A;  3S0G A;  1BG1 A;  1QJT A;  2TN4 A;  3LK1 A;  3SS4 A;  2LLS A;  2KFH A;  1IG5 A;  1QVI Y;  2HET A;  1JWD A;  2AAO A;  1IRJ A;  1NX1 A;  2WCJ A;  2JNF A;  4HRG A;  3D76 A;  3TDI A;  1XA5 A;  2NZ0 A;  5I2O A;  3TS5 B;  1CM4 A;  5CSI A;  2GV5 A;  1MXE A;  1CLL A;  2CNP A;  3DZT A;  1QS7 A;  3CZT X;  1L2O C;  1XFX O;  3GK1 A;  2F2O A;  1LIN A;  1MR8 A;  3MSE B;  1W7J B;  1ZAC A;  3BUO B;  3DVK A;  4USL A;  2L5Y A;  2LP2 A;  2KFG A;  4CPV A;  1DJX A;  3PAL A;  1OSA A;  3M0W A;  2PRU A;  1KQM C;  1UWO A;  1OMV A;  4MLW A;  1PSB A;  1XYD A;  2G2B A;  3DY9 A;  4MZJ A;  1BLQ A;  1F54 A;  3SJS A;  3NSI A;  1IIO A;  1Y1X A;  1MUX A;  1NX0 A;  5AEQ A;  1KFU S;  2K0J A;  4WQ2 A;  1YX7 A;  5FI7 A;  1CMG A;  1A75 A;  5DIC A;  3F45 A;  4OVN F;  5KU1 A;  5K89 A;  4ORC B;  1MQ1 A;  1FI6 A;  4BY4 A;  1KQV A;  1TNX A;  2ZKM X;  4DS7 A;  1UHH A;  1IQ5 A;  2PYQ A;  1M31 A;  2JRF A;  1PVA A;  2LVK A;  1LVC D;  1Z4H A;  1RFJ A;  1S6J A;  1EXR A;  2LNK A;  3RM1 A;  3R1O A;  2P70 A;  1SL7 A;  4GGF A;  2P6B B;  1PAL A;  1RRO A;  2LVV A;  3SG3 A;  1ORG A;  1CM1 A;  3CZ2 A;  1Y6W A;  3H4S E;  3PM2 A;  1JFJ A;  1LS8 A;  2I2R E;  2K8M B;  1ZFS A;  1A2X A;  1G8I A;  1DQE A;  1NWD A;  2PMY A;  3QRX A;  4M2O A;  4NQG A;  3D73 A;  3ICB A;  3NHI A;  1YUS A;  1KQM B;  3SS5 A;  3K1E A;  3NSL A;  2JZI A;  3TZ1 A;  1SCM B;  1A03 A;  1YX8 A;  1PVB A;  3PM8 A;  4XJK B;  3AAJ A;  3BFA A;  5IBW A;  1DJW A;  2CXJ A;  1YUT A;  2F33 A;  2WC6 A;  4CID A;  1KWO C;  3KHE A;  2JTZ A;  1CFD A;  2GGZ A;  4QJ5 B;  1JSA A;  2L50 A;  4CFR A;  2EHB A;  1YR5 A;  3BUN B;  4NDB A;  2ZN9 A;  1CMF A;  2MA2 A;  4I5J A;  2KYC A;  5BPJ A;  1HQV A;  2COL B;  1IQ3 A;  1JC2 A;  3O4Y A;  1EG4 A;  3WNX B;  1XFV O;  4DUQ A;  2L51 A;  5TNC A;  2MBX A;  1S6I A;  4QJ4 B;  1U5I B;  2BCA A;  2KSP A;  2LC5 A;  1BOC A;  1DMO A;  4DIR A;  3DD4 A;  1E8A A;  1XVJ A;  2LCP A;  1YVH A;  4GPL B;  5D3O A;  2Q91 A;  1K90 D;  1FW4 A;  1DGU A;  2LVI A;  3LL8 B;  1DJG A;  2M1K B;  2JXL A;  2KAV A;  3DVE A;  4PDZ A;  2BL0 C;  1J1D A;  3DF0 A;  4YGE B;  1SL9 A;  2QEH A;  1RJV A;  1XFZ O;  2KAY A;  2Q4U A;  3CAB A;  3PN7 C;  1J7O A;  5D7F A;  3AAK A;  4HRE E;  1SBJ A;  2LAN A;  3JVT B;  2KBI A;  1FF1 A;  1C3Z A;  1ODB A;  4PAL A;  1AJ5 A;  1EJ3 A;  1BR4 B;  3R72 A;  1ALV A;  3I5I C;  3L4L A;  1NCY A;  2L5X B;  1UHN A;  3O6B A;  2HQ8 A;  1S1E A;  1OMR A;  3UO9 A;  3VRR A;  3DVM A;  4XJK A;  5AFP A;  2R2I A;  5J3X A;  1IJ5 A;  1CFP A;  4HSZ A;  2QEV A;  1B8C A;  3B88 A;  3Q8I A;  1CNP A;  4N1F A;  1NYA A;  2E30 A;  1LXF C;  2RGI A;  1TTX A;  1D1O A;  1K8U A;  5CSN A;  1NPQ A;  3IVT A;  4C0J A;  1PUL A;  1IH0 A;  2L2E A;  1XFR A;  1TIZ A;  3FIA A;  1SCV A;  1L7Z A;  2BBM A;  2LMU A;  1BMO A;  2KGR A;  2NCP A;  1XFW O;  2A4J A;  4C0L A;  4PCW A;  1EL4 A;  1CDP A;  2H2K A;  1NP8 A;  1TRF A;  3DYE A;  3EK8 A;  3IQQ A;  1KK8 C;  2ERB A;  1JF0 A;  3NSO A;  2K7B A;  2L98 A;  3HCM A;  2LLT A;  2LP3 A;  1Z2C B;  1KK8 B;  1M39 A;  1NCX A;  1IJ6 A;  1TNQ A;  1AVS A;  2NLN A;  2OS8 C;  2QEO A;  1OOI X;  1WDC C;  2FOT A;  2K7O A;  5HKY A;  2WCE A;  2YGU A;  1OOG A;  1BR1 B;  3E3R A;  4A4C A;  4U8D A;  2MLE C;  3I5I B;  2M0R A;  4DCK A;  4ETO A;  2F8P A;  2KGB C;  3BUM B;  3SG5 A;  4D1E A;  3EKH A;  1K9U A;  4Q04 A;  1B4C A;  1L2O B;  4MN0 A;  1Y1A A;  4A4B A;  1IKU A;  4JPZ B;  1B8L A;  1G33 A;  1C7W A;  2LV7 A;  1LKJ A;  2ZNE A;  2K2F A;  5JJG A;  1F8H A;  1ZOT B;  4UPG A;  1A29 A;  3DXL A;  1KFX S;  1M46 A;  2KI4 C;  4GNK B;  2OTG C;  4GBA A;  1C3Y A;  2H8V A;  3EK4 A;  1TOP A;  1TUJ A;  2K60 A;  2JUL A;  1B8R A;  2K2A A;  4I5L B;  3GOF A;  1EG3 A;  1V1F A;  2L4H A;  3O78 A;  5G08 A;  1XK4 A;  2CBL A;  4DRW A;  3S0E A;  1JUO A;  1X02 A;  3PAT A;  3VRQ A;  3KO0 A;  2PSR A;  2L2C A;  1Y1U A;  1MXL C;  2FJU B;  4CLN A;  1FPW A;  2JTT A;  1M45 A;  2Y1M A;  1WRL A;  5KTY A;  1TNW A;  2JT0 A;  1KK7 Z;  3S0B A;  2L4I A;  1WRK A;  2JU0 A;  4PHJ A;  1R6P A;  1NX2 A;  1F71 A;  4YRU A;  1SNL A;  3I5G B;  3D74 A;  4QJ3 B;  5EL2 A;  2I7A A;  1CLM A;  1AHR A;  1GJY A;  1LA3 A;  1OOJ A;  1T14 A;  1ZUZ A;  2QAC A;  4MVF A;  4WQ3 A;  1GGZ A;  2LHL A;  3SS3 A;  4TNC A;  1UUR A;  1XO5 A;  4MZK A;  3ZWH A;  2NXQ A;  5CPV A;  1CB1 A;  3ZNI A;  1B7T Z;  2F3Z A;  2BE4 A;  2M49 B;  1KSM A;  4F7F A;  1OZO A;  5DKR A;  2NCO A;  3TDU A;  2LMT A;  2JT3 A;  3B7A A;  5HYD A;  1YUU A;  3EG5 B;  2K61 A;  2LE9 B;  2PAL A;  4PHM A;  1DC1 A;  1JF2 A;  2K7D A;  1PRW A;  3I5G C;  2G9B A;  2KDH A;  2WCB A;  3I5H C;  2WCM A;  3CWG A;  1DJI A;  1QXP A;  3D75 A;  1CLB A;  1B1G A;  2HPS A;  3BOW A;  3S0D A;  2LAP A;  5CSJ A;  3CYZ A;  3I5F C;  3OX6 A;  5DKN A;  4GGN A;  1QIV A;  1PK0 D;  2JQ6 A;  3CDN A;  4FQT A;  1KSO A;  2MHH A;  2LMV A;  1WLZ A;  2V53 A;  1J7R A;  3SG6 A;  3SG7 A;  2FJY A;  3FS7 A;  2E6W A;  2SAS A;  3BYA A;  1DJZ A;  1BU3 A;  2M97 A;  4MZL A;  1FI5 A;  2H61 A;  2M29 A;  4IJ7 A;  4CFQ A;  1SMG A;  1N2D A;  5B8I B;  1TN4 A;  3S0A A;  3OP0 A;  1XFU O;  1J7P A;  4PE4 A;  3VRP A;  1IGV A;  2L0P A;  2WCF A;  3PFV A;  4HRH A;  4WRI A;  3TUY C;  4PE1 A;  3L4A A;  1DEK A;  1IWQ A;  4ICB A;  5CSF A;  2WC5 A;  1KFU L;  2KAX A;  1JBA A;  2B1U A;  3SG4 A;  2MAZ A;  4ZCV A;  1QAT A;  1K2H A;  1KK7 Y;  2FCE A;  4AQJ A;  3PJI A;  1TCF A;  2BAP A;  3CR4 X;  1OE9 B;  1WY9 A;  2HF5 A;  2Y5I A;  2AMI A;  3D0Y B;  2D8N A;  2LVJ A;  2SCP A;  1SR6 B;  4AQI A;  4BY5 A;  3KF9 A;  3CGA A;  5F6T A;  1S26 D;  2JXC A;  1KCY A;  2K7C A;  1CDL A;  3OHM B;  1GQM A;  2Y4Q A;  1J1E A;  4NDD A;  3RLZ A;  1GM0 A;  3NHT A;  2WND A;  2QPT A;  1R2U A;  1SPY A;  3BFB A;  1NIW A;  2M1U A;  3D77 A;  1TCO B;  1SSE B;  1K96 A;  5ER4 X;  5AXI A;  3VRO A;  3B6X A;  1K95 A;  3FWB A;  1SR6 C;  1K94 A;  1P28 A;  3HX4 A;  1N0Y A;  4YGA A;  2PAS A;  4PE7 A;  3I5H B;  1QAS A;  1W9Z A;  4FTG A;  1QLS A;  1S36 A;  2OPO A;  2WOS A;  3SG2 A;  1BOD A;  3VB1 A;  2M9G A;  2KI6 D;  3CR2 A;  2OTG B;  2PQL A;  4JD9 A;  2Y1N A;  2JPT A;  1QX5 B;  4PE0 A;  1WRZ A;  2CT9 A;  4AOM A;  4YGB B;  1DJH A;  1V1G A;  1B9A A;  2AUC A;  3PLF B;  4GAO A;  1AK8 A;  3RZS A;  1OZS A;  4MRY A;  3FE8 A;  4INX A;  1DTL A;  2BE6 A;  3JVT C;  1NX3 A;  4OKH A;  5HKW A;  3LCP C;  2ZFD A;  1S5G Y;  3N7H A;  3OB1 B;  3A4U B;  1GGW A;  3B86 A;  1UHI A;  2ZN8 A;  4F0Z B;  2JC2 A;  4I5K A;  1H4B A;  3FE6 A;  4JWQ A;  5AAN A;  3BUW B;  3O4X A;  5D69 A;  3BOW B;  3JTD B;  2ZND A;  1OOF A;  2LHI A;  2GTE A;  4NDC A;  1QV0 A;  3LLE A;  5HL1 A;  3CZ0 A;  4INW A;  4C0K A;  5HLV A;  1N65 A;  1Y0V H;  3DVJ A;  1ZMZ A;  1MF8 B;  1K9K A;  2JNX A;  2BEC A;  2KLE A;  2KBM A;  2ISD A;  5ER5 A;  2I18 A;  4YI8 A;  1QVI Z;  5HLO A;  1SK6 D;  1BF5 A;  3BFH A;  3UNW A;  2CTN A;  5FI6 A;  1OMD A;  2MJW B;  2KHN A;  4YGC B;  3OX5 A;  2MRD A;  3AKB A;  3IF7 A;  5DKQ A;  3VRN A;  3OGN A;  2EC6 B;  2EGD A;  1AJ4 A; 
#chains in the Genus database with same CATH homology
 4PHN A;  2EC6 C;  2KQ6 A;  1DJY A;  1CDN A;  4YI9 A;  1W7I B;  1MHO A;  4M2P A;  1B47 A;  1DGV A;  2ZRS A;  1SKT A;  5GQQ C;  2FCD A;  4IL1 A;  3D10 A;  2M8U A;  2BL0 B;  1PSR A;  4MSP A;  3D0Y A;  3NSK A;  1F4O A;  1NUB A;  4YBH B;  1A75 B;  3TS5 C;  1NCZ A;  2CCM A;  3WXA A;  4ORA B;  3I5F B;  1CFF A;  2F2P A;  1YUR A;  1FBV A;  4L9M A;  2LUC A;  1A4P A;  1JFK A;  1F4Q A;  2I94 A;  1SW8 A;  2KOT A;  3A8R A;  4ORB B;  1J55 A;  5HKZ A;  1UUS A;  1Q80 A;  4OR9 B;  1RTP 1;  3EVR A;  3GK4 X;  1VRK A;  5I2L A;  2KQY A;  1HT9 A;  1YTZ C;  4GFT A;  1QX2 A;  4R1E A;  4PHK A;  1G4Y R;  1F70 A;  1MWN A;  2HQW A;  4JQ0 D;  1K9P A;  1QIW A;  3CR5 X;  3TUY B;  1S6C A;  2LUX A;  1J7Q A;  2H61 C;  3LK0 A;  1OQP A;  2PVB A;  3SIA A;  3CTN A;  3C1V A;  2KFF A;  3BQ3 A;  4YGD B;  5KSZ A;  4M2Q A;  3EVU A;  3AKA A;  1REC A;  1SYM A;  3TDZ A;  1BJF A;  4MEW A;  1M63 B;  3WHU B;  2KI6 C;  3PSR A;  4OCI A;  2DOQ A;  1QV1 A;  1C07 A;  3PN7 B;  2BCX A;  2M7L A;  3CLN A;  5JOL A;  4GGF C;  1SRA A;  3IQO A;  2BKI B;  4N5X A;  4P2Y B;  4XYN A;  3EVV A;  1SL8 A;  1NSH A;  2OS8 B;  1KFX L;  1S3P A;  2GGM A;  2M7N A;  4ZCU A;  2VRG A;  4FQO A;  2WOR A;  2BCB A;  1YRU B;  4P5O E;  3EK7 A;  1BT6 A;  1DT7 B;  1ALW A;  3NXA A;  1B7T Y;  2KI4 B;  1QX7 A;  2JWW A;  1XK4 C;  3K21 A;  2M3W A;  1LA0 A;  1CKK A;  4OV2 A;  1CTR A;  2MLF C;  1RK9 A;  1S5G Z;  3KEV A;  2JOJ A;  5AER A;  4I5N B;  1YRT B;  3CS1 A;  3DF0 B;  3JTD C;  1DVI A;  1UP5 A;  4E68 A;  2LLU A;  3SIB A;  3WHT B;  3EKJ A;  1K93 D;  3FWC A;  1DF0 A;  4MBE A;  1KWO B;  2WC8 A;  1C7V A;  1AUI B;  2BKH B;  2ZRT A;  1DF0 B;  3OB2 B;  1SCM C;  2BBN A;  2O5G A;  2LM5 A;  1WDC B;  4GUK A;  4N1G A;  2KNE A;  4MRX A;  1YVL A;  2O60 A;  1SY9 A;  2F3Y A;  5PAL A;  2IS9 A;  1AP4 A;  1UHJ A;  1TNP A;  1EH2 A;  5I2Q A;  5I8N A;  2KYF A;  1QTX A;  3VGO A;  1CDM A;  1H8B A;  1XFY O;  1RWY A;  1QLK A;  3BXK A;  2JT8 A;  3KPX A;  5FYX A;  1F55 A;  3O2P A;  3BUX B;  3GK2 A;  1U5I A;  1WLM A;  1UHK A;  1BG1 A;  1QJT A;  2TN4 A;  3LK1 A;  2LLS A;  2KFH A;  1IG5 A;  1QVI Y;  2HET A;  1JWD A;  2AAO A;  1IRJ A;  1NX1 A;  4HRG A;  2JNF A;  3TDI A;  1XA5 A;  2NZ0 A;  5I2O A;  3TS5 B;  1CM4 A;  5CSI A;  2GV5 A;  1MXE A;  1CLL A;  2CNP A;  1QS7 A;  3CZT X;  1L2O C;  1XFX O;  3GK1 A;  2F2O A;  1LIN A;  1MR8 A;  3MSE B;  1W7J B;  1ZAC A;  3BUO B;  3DVK A;  4USL A;  2LP2 A;  2KFG A;  4CPV A;  1DJX A;  3PAL A;  1OSA A;  3M0W A;  2PRU A;  1KQM C;  1UWO A;  1OMV A;  4MLW A;  1PSB A;  1XYD A;  2G2B A;  1BLQ A;  4MZJ A;  1F54 A;  3SJS A;  3NSI A;  1Y1X A;  1MUX A;  1NX0 A;  5AEQ A;  1KFU S;  2K0J A;  4WQ2 A;  1YX7 A;  1CMG A;  1A75 A;  3F45 A;  4OVN F;  5KU1 A;  5K89 A;  4ORC B;  1MQ1 A;  1FI6 A;  4BY4 A;  1KQV A;  1TNX A;  2ZKM X;  4DS7 A;  1UHH A;  1IQ5 A;  1M31 A;  2JRF A;  1PVA A;  2LVK A;  1LVC D;  1RFJ A;  1S6J A;  1EXR A;  2LNK A;  3RM1 A;  1SL7 A;  4GGF A;  2P6B B;  1PAL A;  1RRO A;  2LVV A;  3SG3 A;  3H4S E;  1CM1 A;  1Y6W A;  1JFJ A;  2I2R E;  2K8M B;  1ZFS A;  1A2X A;  1G8I A;  1NWD A;  3QRX A;  2PMY A;  4M2O A;  4NQG A;  3ICB A;  1YUS A;  1KQM B;  3NSL A;  2JZI A;  3TZ1 A;  1SCM B;  1A03 A;  1YX8 A;  1PVB A;  3PM8 A;  4XJK B;  3AAJ A;  5IBW A;  1DJW A;  2CXJ A;  1YUT A;  2F33 A;  4CID A;  1KWO C;  3KHE A;  2JTZ A;  1CFD A;  2GGZ A;  4QJ5 B;  1JSA A;  2L50 A;  4CFR A;  2EHB A;  1YR5 A;  3BUN B;  4NDB A;  2ZN9 A;  1CMF A;  2MA2 A;  4I5J A;  2KYC A;  5BPJ A;  1HQV A;  2COL B;  1IQ3 A;  1JC2 A;  3O4Y A;  1EG4 A;  3WNX B;  1XFV O;  4DUQ A;  2L51 A;  5TNC A;  2MBX A;  1S6I A;  4QJ4 B;  1U5I B;  2BCA A;  2KSP A;  2LC5 A;  1BOC A;  1DMO A;  4DIR A;  3DD4 A;  1E8A A;  1XVJ A;  2LCP A;  1YVH A;  4GPL B;  2Q91 A;  1K90 D;  1FW4 A;  1DGU A;  2LVI A;  3LL8 B;  1DJG A;  2M1K B;  2JXL A;  2KAV A;  3DVE A;  4PDZ A;  2BL0 C;  1J1D A;  3DF0 A;  4YGE B;  1SL9 A;  1RJV A;  1XFZ O;  2KAY A;  2Q4U A;  3PN7 C;  1J7O A;  5D7F A;  3AAK A;  4HRE E;  1SBJ A;  2LAN A;  3JVT B;  2KBI A;  1FF1 A;  4PAL A;  1ODB A;  1AJ5 A;  1EJ3 A;  1BR4 B;  1ALV A;  3I5I C;  1NCY A;  2L5X B;  1UHN A;  3O6B A;  2HQ8 A;  1S1E A;  1OMR A;  3VRR A;  3DVM A;  4XJK A;  5AFP A;  2R2I A;  5J3X A;  1IJ5 A;  1CFP A;  4HSZ A;  1B8C A;  1CNP A;  4N1F A;  1NYA A;  2E30 A;  1LXF C;  2RGI A;  1TTX A;  1D1O A;  1K8U A;  5CSN A;  1NPQ A;  4C0J A;  1PUL A;  1IH0 A;  2L2E A;  1TIZ A;  3FIA A;  1SCV A;  1L7Z A;  2BBM A;  2LMU A;  1BMO A;  2KGR A;  2NCP A;  1XFW O;  2A4J A;  4C0L A;  4PCW A;  2H2K A;  1EL4 A;  1CDP A;  1NP8 A;  1TRF A;  3IQQ A;  3EK8 A;  1BF5 A;  1KK8 C;  3NSO A;  1JF0 A;  2K7B A;  2L98 A;  3HCM A;  2LLT A;  2LP3 A;  1KK8 B;  1M39 A;  1NCX A;  1IJ6 A;  1TNQ A;  1AVS A;  2NLN A;  2OS8 C;  2ZFD A;  2FOT A;  1WDC C;  2K7O A;  5HKY A;  2WCE A;  3E3R A;  1BR1 B;  4A4C A;  4U8D A;  2MLE C;  3I5I B;  2M0R A;  4DCK A;  4ETO A;  2F8P A;  2KGB C;  3BUM B;  3SG5 A;  4D1E A;  3EKH A;  1K9U A;  4Q04 A;  1B4C A;  1L2O B;  4MN0 A;  1Y1A A;  4A4B A;  1IKU A;  4JPZ B;  1B8L A;  1G33 A;  1C7W A;  2LV7 A;  1LKJ A;  2ZNE A;  2K2F A;  5JJG A;  1F8H A;  1ZOT B;  4UPG A;  1A29 A;  1KFX S;  1M46 A;  2KI4 C;  4GNK B;  2OTG C;  4GBA A;  3EK4 A;  1TOP A;  2JUL A;  1B8R A;  2K2A A;  4I5L B;  3GOF A;  1EG3 A;  1V1F A;  2L4H A;  3O78 A;  5G08 A;  1XK4 A;  2CBL A;  4DRW A;  1JUO A;  1X02 A;  3PAT A;  3VRQ A;  3KO0 A;  2PSR A;  1Y1U A;  1MXL C;  2FJU B;  4CLN A;  1FPW A;  2JTT A;  1M45 A;  2Y1M A;  1WRL A;  5KTY A;  1TNW A;  2JT0 A;  1KK7 Z;  2L4I A;  1WRK A;  2JU0 A;  4PHJ A;  1R6P A;  1NX2 A;  1F71 A;  4YRU A;  1SNL A;  3I5G B;  4QJ3 B;  2I7A A;  1CLM A;  1AHR A;  1GJY A;  1LA3 A;  1OOJ A;  2QAC A;  1ZUZ A;  4WQ3 A;  4MVF A;  1CFC A;  1GGZ A;  2LHL A;  4TNC A;  1UUR A;  1XO5 A;  4MZK A;  3ZWH A;  2NXQ A;  5CPV A;  1CB1 A;  3ZNI A;  1B7T Z;  2F3Z A;  2BE4 A;  2M49 B;  1KSM A;  1OZO A;  5DKR A;  2NCO A;  3TDU A;  2LMT A;  2JT3 A;  5HYD A;  1YUU A;  2K61 A;  2LE9 B;  2PAL A;  4PHM A;  1JF2 A;  2K7D A;  1PRW A;  3I5G C;  2G9B A;  2KDH A;  2WCB A;  3I5H C;  3CWG A;  1DJI A;  1QXP A;  1CLB A;  1B1G A;  2HPS A;  3BOW A;  2LAP A;  5CSJ A;  3I5F C;  3OX6 A;  5DKN A;  4GGN A;  1QIV A;  1PK0 D;  2JQ6 A;  1KSO A;  2MHH A;  2LMV A;  1WLZ A;  2V53 A;  1J7R A;  3SG6 A;  3SG7 A;  3FS7 A;  2E6W A;  2SAS A;  3BYA A;  1DJZ A;  1BU3 A;  2M97 A;  4MZL A;  1FI5 A;  2H61 A;  2M29 A;  4CFQ A;  1SMG A;  1N2D A;  5B8I B;  1TN4 A;  3OP0 A;  1XFU O;  1J7P A;  4PE4 A;  3VRP A;  1IGV A;  2L0P A;  2WCF A;  3PFV A;  4HRH A;  4WRI A;  3TUY C;  4PE1 A;  1IWQ A;  4ICB A;  5CSF A;  1KFU L;  2KAX A;  1JBA A;  2B1U A;  3SG4 A;  2MAZ A;  4ZCV A;  1QAT A;  1K2H A;  1KK7 Y;  2FCE A;  4AQJ A;  1TCF A;  3CR4 X;  1OE9 B;  1WY9 A;  2HF5 A;  2Y5I A;  2AMI A;  3D0Y B;  2D8N A;  2LVJ A;  2SCP A;  1SR6 B;  4AQI A;  4BY5 A;  3KF9 A;  3CGA A;  5F6T A;  1S26 D;  2JXC A;  1KCY A;  2K7C A;  1CDL A;  3OHM B;  1GQM A;  2Y4Q A;  1J1E A;  4NDD A;  3RLZ A;  2WND A;  2QPT A;  1R2U A;  1SPY A;  1NIW A;  2M1U A;  5ER4 X;  1TCO B;  5AXI A;  1K96 A;  3VRO A;  1K95 A;  3FWB A;  1SR6 C;  1K94 A;  3HX4 A;  1N0Y A;  4YGA A;  2PAS A;  4PE7 A;  3I5H B;  1QAS A;  4FTG A;  3SG2 A;  1QLS A;  1S36 A;  2OPO A;  2WOS A;  1BOD A;  2M9G A;  2KI6 D;  3CR2 A;  2OTG B;  2Y1N A;  2JPT A;  1QX5 B;  4PE0 A;  1WRZ A;  2CT9 A;  4AOM A;  4YGB B;  1DJH A;  1V1G A;  1B9A A;  2AUC A;  3PLF B;  4GAO A;  1AK8 A;  1OZS A;  4MRY A;  1DTL A;  2BE6 A;  3JVT C;  1NX3 A;  4OKH A;  5HKW A;  3LCP C;  1S5G Y;  1GGW A;  3OB1 B;  3A4U B;  1UHI A;  2ZN8 A;  4F0Z B;  2JC2 A;  4I5K A;  1H4B A;  4JWQ A;  5AAN A;  3BUW B;  5D69 A;  3BOW B;  3JTD B;  2ZND A;  2LHI A;  4NDC A;  1QV0 A;  3LLE A;  4C0K A;  5HLV A;  1N65 A;  1Y0V H;  3DVJ A;  1ZMZ A;  1MF8 B;  1K9K A;  2JNX A;  2BEC A;  2KBM A;  2ISD A;  5ER5 A;  2I18 A;  4YI8 A;  1QVI Z;  5HLO A;  1SK6 D;  2CTN A;  1OMD A;  2MJW B;  2KHN A;  4YGC B;  3OX5 A;  2MRD A;  3AKB A;  3IF7 A;  5DKQ A;  3VRN A;  2EC6 B;  2EGD A;  1AJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...