3IQOA

1.5 angstrom x-ray structure of bovine ca(2+)-s100b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
b'SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-B
publication title The Effects of CapZ Peptide (TRTK-12) Binding to S100B-Ca(2+) as Examined by NMR and X-ray Crystallography
pubmed doi rcsb
source organism Bos taurus
molecule tags Metal binding protein
total genus 31
structure length 88
sequence length 88
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3iqoA00
5AXIA 1LA0A 1HQVA 3EVVA 3EKJA 4PHMA 2PSRA 1K9UA 1NP8A 1QV1A 2JTZA 3I5GC 4FTGA 4C0KA 1BR1B 1KK7Y 2KAYA 2L50A 2WCBA 1IGVA 3EK8A 3BUMB 2F2OA 2KSPA 2KFFA 4QJ5B 2I18A 2LANA 1KSOA 1OE9B 1KQMB 1CB1A 1IQ3A 2I2RE 2RGIA 4YGEB 1KCYA 1NCZA 4JQ0D 1KK7Z 2LVJA 1SY9A 2JRFA 1CLLA 1G8IA 1M39A 1UWOA 1KK8C 2F2PA 1ZMZA 1BLQA 4ORBB 4MN0A 3TS5B 4UPGA 2GV5A 3CLNA 5AFPA 3IQOA 1BR4B 4E68A 2BCXA 4M2QA 1SW8A 3JTDC 3TDZA 3O6BA 1XK4C 5I8NA 1PK0D 2L0PA 3DF0A 4AQIA 3TZ1A 2NXQA 1J7QA 3D10A 3LK1A 3NSKA 3OX6A 5HKYA 3C1VA 3SG2A 2L98A 2K0JA 2R2IA 1CKKA 2WCEA 4P2YB 1J7RA 1CDPA 1PVBA 2L51A 1GGZA 2JQ6A 3ZWHA 2ZFDA 4I5JA 2KAVA 3PALA 2JZIA 2O5GA 4ICBA 4PE0A 5AERA 4C0JA 3SJSA 1BJFA 1YURA 1MQ1A 1S6JA 2BCBA 1KK8B 2PALA 3VRNA 1NIWA 1ZOTB 1CNPA 5I2OA 1KSMA 2K2FA 3D0YB 1FI6A 2KFHA 1TNXA 3OP0A 2KGRA 1V1GA 2F3ZA 4YGAA 2L4HA 2H61C 3IQQA 4OR9B 4Q04A 1UHJA 3VRPA 1DGUA 1RFJA 2A4JA 1QJTA 1K95A 3BQ3A 3OB2B 1B4CA 3DVJA 1BMOA 3MSEB 2B1UA 1CM1A 1SKTA 3SG7A 1ODBA 4BY4A 1MR8A 1XFZO 2MJWB 1NPQA 1TOPA 1SCMC 1F4OA 1MWNA 2LLUA 1BOCA 1UHIA 1B8LA 4FQOA 1B47A 4PALA 3NSIA 2JU0A 2GGZA 5TNCA 2KQ6A 1UHHA 3WHTB 4CFQA 2BE6A 3CR4X 4N1FA 3GK4X 1OZSA 3HCMA 5CSJA 4M2OA 5DKRA 3F45A 4DS7A 1JWDA 1DTLA 2LHIA 2NZ0A 5FYXA 1L2OC 2L2EA 3BYAA 5CPVA 1K8UA 1KFXS 1S6CA 1U5IB 1PSBA 3OB1B 1YUTA 4I5KA 3RLZA 1A75A 3LLEA 4XYNA 1JSAA 1TRFA 1IJ5A 2KI6C 3KO0A 5D69A 4MVFA 1KQVA 1J1EA 1RTP1 2Q91A 3EVRA 1CDNA 1XFVO 4BY5A 2KI4C 1CM4A 1WY9A 3CR5X 3JVTC 3VROA 3O78A 1SYMA 1UHKA 1SMGA 3SG4A 1SCMB 2F3YA 3CS1A 2CTNA 1YR5A 3LK0A 1WRZA 2KGBC 1CFFA 1AJ4A 2P6BB 2LV7A 2K7BA 4MBEA 2F8PA 5ER4X 2CBLA 2Y1MA 4QJ3B 5IBWA 1G4YR 2EGDA 3SG3A 2K7CA 1YTZC 1B8RA 4IL1A 1UHNA 4GGNA 3CZTX 1DJXA 1AUIB 3TS5C 1K2HA 2JULA 2Y4QA 4L9MA 1SPYA 1NX0A 1R2UA 4AQJA 1XFXO 1RJVA 1WLZA 1OOJA 3TDIA 1BT6A 2MLEC 1S6IA 3OHMB 2M9GA 4DCKA 2BL0C 1C7VA 1RWYA 1XA5A 4WQ2A 2KI4B 3JVTB 3FS7A 1XO5A 3O2PA 1XFUO 2EC6B 1M63B 1DJYA 1FBVA 4WRIA 1BG1A 5CSNA 1BU3A 1DJHA 2CNPA 3PN7C 1QX5B 2I7AA 3BUWB 1IRJA 1EG4A 1CDMA 1S5GZ 2D8NA 3BOWA 5DKQA 1VRKA 1QASA 1CDLA 1C7WA 1NX2A 3BUOB 3LL8B 3NSOA 1NX1A 1DT7B 2KYCA 1B1GA 1TTXA 2JWWA 1F54A 2KBMA 2MAZA 1DF0B 1PVAA 4CIDA 4MRYA 1TNQA 2HF5A 1QXPA 2JTTA 2MBXA 4HRHA 4DUQA 5KTYA 2M3WA 1ALWA 1QLKA 2BL0B 1W7IB 2HQWA 1OSAA 2AAOA 4HRGA 4A4BA 3KEVA 2JT8A 4N1GA 1GQMA 2LMUA 2M7NA 1Y1XA 2AMIA 4ETOA 1PSRA 3PLFB 3I5HC 2HQ8A 1XK4A 2LC5A 1MF8B 4AOMA 1K94A 3PN7B 1CFCA 3WHUB 2ZRTA 1K90D 2ZRSA 4YBHB 2MRDA 5I2LA 1F70A 3KHEA 1ZFSA 2PRUA 1JF0A 1M31A 1NCXA 3ZNIA 5K89A 2KQYA 2LP3A 3DD4A 2LP2A 4XJKB 2M1UA 1V1FA 3AKBA 4I5NB 3NSLA 3KPXA 1KFUL 1PRWA 3RM1A 3CTNA 4WQ3A 1IJ6A 2OPOA 1DJWA 2L4IA 2ZNDA 4C0LA 1MHOA 2BKHB 4A4CA 2M97A 3I5FC 1WRKA 1UP5A 4MRXA 2I94A 4ZCVA 2FCEA 1CLBA 2H61A 2Y1NA 3CR2A 1RROA 3SIBA 5KSZA 3I5HB 1AJ5A 1TCFA 2WOSA 4GGFC 1CLMA 1EG3A 5HKWA 2JXLA 2M1KB 1AP4A 4TNCA 1SCVA 3DF0B 1LVCD 1SR6C 2JNFA 2L5XB 2MA2A 4MZJA 1YUUA 2TN4A 1AK8A 1OMVA 4GUKA 5HLVA 1IQ5A 1QX2A 4YGCB 3FWCA 1SL9A 2LAPA 1NUBA 2COLB 2Y5IA 3FWBA 1RECA 1S26D 1XVJA 2LE9B 5HKZA 3DVEA 4OVNF 1N0YA 2LVVA 1FW4A 1QV0A 2SASA 4JWQA 4M2PA 2LNKA 1IKUA 1N65A 2KOTA 1JF2A 4HSZA 1EXRA 1OZOA 1XFYO 3I5FB 2WNDA 1XYDA 1ZUZA 2LMTA 2Q4UA 1OMRA 3I5IC 1K93D 1PULA 2KNEA 1DVIA 5G08A 1QLSA 1SBJA 2EC6C 1WDCC 2KHNA 1J7PA 2BE4A 3O4YA 2JPTA 2JXCA 1DJGA 1M45A 2LLSA 2BBMA 1B7TY 1SR6B 3SG5A 5I2QA 1IG5A 3M0WA 1Q80A 2E30A 5ER5A 2ISDA 1IH0A 2KYFA 2H2KA 3A4UB 1B7TZ 2PVBA 2M49B 3BUXB 3CWGA 2JT0A 2CXJA 3EK4A 4GAOA 4YGBB 1JUOA 1GJYA 1WRLA 1E8AA 1UURA 4PHNA 1ALVA 4GNKB 2QPTA 1CMFA 2CT9A 1S5GY 4YI9A 3GK1A 3PATA 3I5IB 2BCAA 5PALA 1QVIY 1TN4A 1WDCB 1J1DA 3BUNB 4QJ4B 5CSIA 2OTGC 2LCPA 2G9BA 2JOJA 1CTRA 4ZCUA 2LLTA 1TNWA 2HPSA 1NYAA 3AAJA 4OV2A 1G33A 2E6WA 1J7OA 2KDHA 1QVIZ 2LHLA 2CCMA 1F4QA 2M7LA 1K96A 1YUSA 2FOTA 5J3XA 1TCOB 4N5XA 3VRRA 4PDZA 4R1EA 3VRQA 3CGAA 3K21A 2LM5A 3DVKA 2K7DA 2LUCA 5F6TA 2MLFC 3TUYC 1NSHA 1R6PA 1W7JB 4MEWA 4XJKA 3D0YA 1GGWA 1CFDA 2NCOA 2EHBA 4NQGA 2WCFA 2SCPA 2K7OA 3H4SE 4OKHA 4PE1A 2FJUB 4MZLA 1SNLA 4D1EA 2FCDA 4CPVA 2NCPA 1YVLA 2OTGB 2JC2A 1XFWO 3SIAA 5B8IB 1MUXA 2PASA 1ZACA 3PSRA 3HX4A 2ZKMX 1HT9A 3ICBA 4F0ZB 1S3PA 2BBNA 4MSPA 2M8UA 2BECA 2KBIA 1QX7A 2WORA 3A8RA 3I5GB 1QIVA 2JNXA 4YI8A 4OCIA 5D7FA 1S36A 3QRXA 2F33A 3EVUA 3IF7A 4PHKA 1BF5A 3BOWB 3BXKA 3EKHA 5HYDA 1MXEA 3FIAA 3TUYB 1M46A 1RK9A 4MZKA 1KFUS 1WLMA 4YGDB 5KU1A 1SL7A 1F71A 2K8MB 4CLNA 1NCYA 2O60A 1U5IA 3OX5A 1C07A 2AUCA 1AVSA 1YVHA 2QACA 3DVMA 1DJZA 3LCPC 4PHJA 3AKAA 5BPJA 1A03A 2KAXA 4GBAA 2DOQA 1BODA 1SL8A 1H4BA 1B9AA 2VRGA 5CSFA 1YX8A 1Y6WA 2LMVA 1PALA 3PFVA 1H8BA 2BKIB 1KWOC 3PM8A 2LVKA 3JTDB 4GGFA 1OQPA 2HETA 1QATA 2GGMA 2G2BA 4U8DA 2OS8C 4ORCB 1B8CA 1QIWA 5GQQC 1F55A 4P5OE 2M0RA 3VGOA 3WNXB 4HREE 2M29A 1JFKA 5AANA 1D1OA 5HLOA 2WC8A 1EL4A 1Y0VH 1A29A 2V53A 5JOLA 1JC2A 2ZN9A 1LINA 2LVIA 4PE7A 4YRUA 2K2AA 1SRAA 1FPWA 1S1EA 1DMOA 1L7ZA 2PMYA 5JJGA 1MXLC 1KFXL 1CFPA 3KF9A 4NDDA 4DIRA 4USLA 1CMGA 1K9PA 1KWOB 2KI6D 3E3RA 3TDUA 1JFJA 1TNPA 2ZNEA 2NLNA 3EK7A 5DKNA 2KFGA 1Y1AA 2OS8B 4PCWA 1EJ3A 4MLWA 1LKJA 1UUSA 1YRUB 1SK6D 4ORAB 1YRTB 1QS7A 3WXAA 1NX3A 1LA3A 1EH2A 2JT3A 1OMDA 4GFTA 1A4PA 1JBAA 1KQMC 1DGVA 2K61A 1A2XA 3SG6A 1N2DA 2ZN8A 3AAKA 4DRWA 4CFRA 1DF0A 1DJIA 1QTXA 4GPLB 4I5LB 2IS9A 4NDCA 1Y1UA 1IWQA 1NWDA 1F8HA 1FF1A 4PE4A 5AEQA 1J55A 1FI5A 1A75B 1LXFC 4NDBA 1K9KA 2LUXA 3NXAA 1X02A 2MHHA 1YX7A 3GOFA 1AHRA 1L2OB 1TIZA 3GK2A 4JPZB
chains in the Genus database with same CATH superfamily
5AXIA 1LA0A 1HQVA 3EVVA 3EKJA 4PHMA 2PSRA 1K9UA 1NP8A 2WCJA 1QV1A 2JTZA 3I5GC 4FTGA 1DQEA 4C0KA 1BR1B 1KK7Y 2KAYA 2L50A 2WCBA 1IGVA 3EK8A 4PT1A 5D3OA 3BUMB 2F2OA 2KSPA 2KFFA 4QJ5B 2I18A 2LANA 1KSOA 1OE9B 1KQMB 1CB1A 1IQ3A 2I2RE 2RGIA 4YGEB 1KCYA 1NCZA 4JQ0D 1KK7Z 2LVJA 1SY9A 2JRFA 1CLLA 1G8IA 3BJHA 1M39A 1UWOA 1C3ZA 1KK8C 2F2PA 2WCKA 1ZMZA 1BLQA 4ORBB 4MN0A 3TS5B 4UPGA 2GV5A 3CLNA 5AFPA 3IQOA 1BR4B 4E68A 5DICA 1C3YA 2BCXA 4M2QA 1SW8A 3JTDC 3TDZA 3S0AA 3FE8A 3O6BA 1XK4C 5I8NA 1PK0D 2L0PA 3DF0A 4AQIA 3TZ1A 2NXQA 1J7QA 3D10A 3LK1A 3NSKA 3OX6A 5FI6A 3CDNA 5HKYA 3C1VA 3SG2A 2L98A 2K0JA 2R2IA 5FI2A 2QEOA 1CKKA 2WCEA 4P2YB 1J7RA 1CDPA 1PVBA 2L51A 1GGZA 2JQ6A 3ZWHA 1W9ZA 2ZFDA 4I5JA 2KAVA 2P70A 3PALA 2JZIA 2O5GA 1ORGA 4ICBA 4PE0A 5AERA 4C0JA 3SJSA 1BJFA 1YURA 1MQ1A 1S6JA 2BCBA 1KK8B 2PALA 3VRNA 1NIWA 1ZOTB 3DZTA 5I2OA 1CNPA 1KSMA 2K2FA 3D0YB 3N7HA 1FI6A 2KFHA 1TNXA 3OBVA 3OP0A 2KGRA 1V1GA 2F3ZA 4YGAA 2L4HA 2H61C 3IQQA 4OR9B 4Q04A 1UHJA 3VRPA 1DGUA 1RFJA 2A4JA 1QJTA 1K95A 3BQ3A 3OB2B 1B4CA 3DVJA 3DY9A 1BMOA 3MSEB 2B1UA 1CM1A 1SKTA 3SG7A 1ODBA 4INXA 4BY4A 1MR8A 1XFZO 2MJWB 1NPQA 1TOPA 1SCMC 1F4OA 1MWNA 1Z2CB 2LLUA 1UHIA 1BOCA 1B8LA 4FQOA 1B47A 4PALA 3NSIA 2JU0A 3S0FA 2GGZA 5TNCA 2KQ6A 1UHHA 3WHTB 1TUZA 1IIOA 4CFQA 2BE6A 3CR4X 4N1FA 3GK4X 1OZSA 3HCMA 5CSJA 4M2OA 3PM2A 5DKRA 3F45A 4DS7A 1JWDA 1DTLA 2LHIA 2NZ0A 1BF5A 5FYXA 1L2OC 2L2EA 3BYAA 5CPVA 1K8UA 1KFXS 1S6CA 1U5IB 1PSBA 3OB1B 1YUTA 4I5KA 3RLZA 3VB1A 1OOGA 1A75A 3LLEA 4XYNA 1QWVA 3BFHA 1TRFA 1SSEB 1IJ5A 2KI6C 3KO0A 5D69A 1JSAA 4MVFA 1KQVA 1J1EA 1RTP1 2Q91A 3EVRA 1CDNA 1XFVO 4BY5A 2KI4C 1CM4A 1WY9A 3CR5X 3JVTC 3VROA 3O78A 1SYMA 2WC6A 1UHKA 1SMGA 3SG4A 1SCMB 3D78A 2F3YA 3CS1A 2CTNA 1YR5A 2L5YA 3LK0A 1WRZA 2KGBC 1CFFA 1AJ4A 2P6BB 2LV7A 2K7BA 4MBEA 2F8PA 5ER4X 2CBLA 2Y1MA 4QJ3B 5IBWA 1G4YR 2EGDA 3BFBA 3SG3A 2K7CA 1YTZC 1B8RA 4IL1A 1UHNA 4GGNA 3CZTX 1DJXA 3R1PA 1AUIB 3TS5C 1K2HA 2JULA 2Y4QA 4L9MA 1SPYA 1NX0A 1R2UA 2WCHA 4AQJA 1XFXO 1RJVA 1DELA 1OOJA 1WLZA 3TDIA 3K1EA 1BT6A 2MLEC 1S6IA 3OHMB 2M9GA 4DCKA 2BL0C 1C7VA 3D75A 1RWYA 1XA5A 4WQ2A 2KI4B 3JVTB 3FS7A 1XO5A 3O2PA 1XFUO 2EC6B 1M63B 1DJYA 1FBVA 3D76A 2JPOA 4WRIA 1BG1A 2KLEA 1BU3A 1DJHA 1XFRA 2CNPA 3PN7C 1QX5B 2I7AA 3BUWB 5CSNA 1IRJA 1EG4A 1CDMA 1S5GZ 2D8NA 3BOWA 5DKQA 2YGUA 1VRKA 1QASA 1CDLA 1C7WA 1NX2A 3BUOB 3LL8B 3NSOA 1NX1A 1DT7B 2KYCA 1B1GA 3DXLA 1TTXA 2JWWA 3R72A 1F54A 2KBMA 2MAZA 1LS8A 1DF0B 1PVAA 1OW4A 4CIDA 4MRYA 1TNQA 2HF5A 1QXPA 2JTTA 2MBXA 4HRHA 4DUQA 5KTYA 2M3WA 1ALWA 1QLKA 1W7IB 2BL0B 2HQWA 1OSAA 2AAOA 4HRGA 4A4BA 3KEVA 2JT8A 4N1GA 1GQMA 2LMUA 2M7NA 1Y1XA 2AMIA 4ETOA 1PSRA 3PLFB 3I5HC 2HQ8A 1XK4A 5EL2A 2LC5A 1MF8B 4AOMA 1K94A 3FE6A 3PN7B 1OOHA 3WHUB 1CFCA 2ZRTA 1K90D 2QEBA 2ZRSA 2MRDA 4YBHB 5I2LA 3OGNA 1F70A 3KHEA 1ZFSA 2PRUA 1JF0A 1M31A 1NCXA 4JD9A 3ZNIA 5K89A 2KQYA 2LP3A 1DEKA 3DD4A 2LP2A 4XJKB 2M1UA 1P28A 1V1FA 3AKBA 4I5NB 4JKTA 3NSLA 3KPXA 1KFUL 1PRWA 3RM1A 3CTNA 1DC1A 2KPHA 4WQ3A 1IJ6A 1OOFA 2OPOA 1DJWA 2L4IA 2ZNDA 4C0LA 1MHOA 2BKHB 4A4CA 2M97A 3I5FC 1WRKA 1UP5A 3EG5B 4MRXA 2I94A 4ZCVA 2FCEA 1CLBA 2H61A 2Y1NA 3CR2A 1RROA 3SIBA 5KSZA 2FJYA 2QEHA 3I5HB 1AJ5A 1TCFA 2WOSA 4GGFC 1CLMA 1EG3A 5HKWA 2JXLA 2M1KB 1AP4A 4TNCA 1SCVA 3DF0B 1LVCD 1SR6C 2L2CA 2JNFA 2L5XB 2MA2A 2ERBA 4MZJA 1YUUA 2TN4A 1AK8A 1OMVA 4GUKA 5HLVA 1IQ5A 1QX2A 4YGCB 3B6XA 3FWCA 1SL9A 2LAPA 4FQTA 1NUBA 2COLB 3UNWA 2Y5IA 3FWBA 1RECA 1S26D 1XVJA 2LE9B 5HKZA 3DVEA 3R1VA 1N0YA 2LVVA 1FW4A 1QV0A 2SASA 3L4LA 4JWQA 4M2PA 3S0BA 4OVNF 2LNKA 1IKUA 1N65A 2KOTA 1JF2A 4HSZA 1EXRA 1OZOA 1XFYO 3I5FB 3SS3A 2WNDA 1XYDA 1ZUZA 2LMTA 2Q4UA 1OMRA 3I5IC 1K93D 1PULA 2KNEA 1DVIA 5G08A 1QLSA 1SBJA 2EC6C 1WDCC 2KHNA 1J7PA 3FE9A 2BE4A 3O4YA 2JPTA 2JXCA 1DJGA 1M45A 2LLSA 2BBMA 3SS5A 1B7TY 1SR6B 2QEVA 3B87A 3B7AA 3SG5A 5I2QA 1IG5A 3M0WA 1Q80A 2E30A 5ER5A 2ISDA 1IH0A 2KYFA 2H2KA 3A4UB 3RZSA 1TUJA 1OOIX 1B7TZ 2PVBA 2M49B 3BUXB 3CWGA 3DYEA 2JT0A 1TWOA 2CXJA 3EK4A 2KLDA 4GAOA 3B88A 4YGBB 1JUOA 1GJYA 1WRLA 1E8AA 1UURA 4PHNA 1ALVA 4GNKB 2QPTA 1CMFA 2CT9A 1S5GY 4YI9A 3GK1A 3CYZA 3PATA 5FI7A 3I5IB 3Q8IA 2BCAA 5PALA 1QVIY 1TN4A 1WDCB 1J1DA 3BUNB 4QJ4B 5CSIA 2OTGC 2K60A 2LCPA 2G9BA 2JOJA 1CTRA 4ZCUA 2LLTA 3CZ2A 1TNWA 2HPSA 1NYAA 3AAJA 4OV2A 1G33A 2E6WA 1J7OA 2KDHA 1QVIZ 2LHLA 2CCMA 1F4QA 2M7LA 1K96A 3S0EA 1YUSA 2FOTA 5J3XA 4KYNA 1TCOB 4INWA 4N5XA 3VRRA 4PDZA 4R1EA 3VRQA 3CGAA 3K21A 2LM5A 2BNXA 4IJ7A 3DVKA 2QDIA 2K7DA 2LUCA 5F6TA 2MLFC 3TUYC 1NSHA 1R6PA 1W7JB 3SS4A 2H8VA 4MEWA 3IVTA 4XJKA 3D0YA 1GGWA 1CFDA 2NCOA 2EHBA 4NQGA 3NGVA 2WCFA 2SCPA 4OZDA 2K7OA 3H4SE 4OKHA 4PE1A 2FJUB 4MZLA 2BAPA 1SNLA 4D1EA 2FCDA 4CPVA 2NCPA 1YVLA 2OTGB 2WC5A 2JC2A 1XFWO 3SIAA 5B8IB 1MUXA 2PASA 1ZACA 3PSRA 3HX4A 2ZKMX 1HT9A 3ICBA 4F0ZB 1S3PA 2BBNA 4MSPA 2M8UA 2BECA 2KBIA 1QX7A 2WORA 3A8RA 3D77A 3I5GB 1QIVA 2JNXA 4YI8A 4OCIA 5D7FA 1S36A 3QRXA 2F33A 3EVUA 3IF7A 4PHKA 1T14A 3BOWB 3BXKA 3EKHA 5HYDA 3BFAA 1MXEA 3FIAA 3TUYB 1M46A 1RK9A 4MZKA 1KFUS 1WLMA 4YGDB 5KU1A 1SL7A 1F71A 2K8MB 4CLNA 1NCYA 2O60A 2PYQA 1U5IA 3OX5A 1C07A 3CZ0A 2AUCA 1AVSA 1YVHA 1Z4HA 2QACA 5HL1A 3DVMA 1DJZA 3LCPC 4PHJA 3AKAA 5BPJA 3V2LA 2KAXA 1A03A 4GBAA 2DOQA 1BODA 1SL8A 1H4BA 1B9AA 2VRGA 5CSFA 2P71A 3O4XA 5I94A 1YX8A 1Y6WA 2LMVA 1PALA 2PQLA 3PFVA 1H8BA 2BKIB 1KWOC 3PM8A 2LVKA 3JTDB 2WCMA 4GGFA 1OQPA 2HETA 1QATA 2GGMA 2G2BA 4U8DA 3S0GA 2OS8C 4ORCB 1B8CA 1QIWA 5GQQC 1F55A 4P5OE 3D73A 2M0RA 3VGOA 4F7FA 3WNXB 4HREE 2M29A 1JFKA 5AANA 1D1OA 3L47A 3B86A 3CABA 2WC8A 1EL4A 5HLOA 1Y0VH 1A29A 2V53A 5JOLA 1JC2A 2ZN9A 1LINA 2LVIA 4PE7A 4YRUA 2K2AA 3NHTA 1SRAA 1FPWA 1S1EA 3R1OA 1DMOA 1L7ZA 2PMYA 5JJGA 1MXLC 1KFXL 3NHIA 1CFPA 3KF9A 4NDDA 4DIRA 4USLA 1CMGA 1K9PA 1KWOB 2KI6D 3E3RA 2GTEA 3TDUA 1TNPA 3PJIA 1JFJA 2ZNEA 2NLNA 3EK7A 5DKNA 2KFGA 1Y1AA 2OS8B 4PCWA 1EJ3A 4MLWA 1LKJA 1UUSA 1YRUB 3CZ1A 1SK6D 4ORAB 1YRTB 1QS7A 3WXAA 3QMEA 3UO9A 1NX3A 3L4AA 1LA3A 1EH2A 2JT3A 1OMDA 4GFTA 1A4PA 1JBAA 1KQMC 1DGVA 2K61A 1A2XA 3SG6A 1N2DA 2ZN8A 3AAKA 4DRWA 4CFRA 1DF0A 1DJIA 1QTXA 4GPLB 4I5LB 2IS9A 4NDCA 1Y1UA 1IWQA 3S0DA 1NWDA 1F8HA 1FF1A 4PE4A 5AEQA 1J55A 1FI5A 1A75B 1LXFC 4NDBA 2WCLA 1K9KA 1GM0A 2LUXA 3NXAA 1X02A 2MHHA 3D74A 1YX7A 3GOFA 1AHRA 1L2OB 1TIZA 3GK2A 4JPZB
chains in the Genus database with same CATH topology
5AXIA 1LA0A 1HQVA 3EVVA 3EKJA 4PHMA 2PSRA 1K9UA 1NP8A 1QV1A 2JTZA 3I5GC 4FTGA 4C0KA 1BR1B 1KK7Y 2KAYA 2L50A 2WCBA 1IGVA 3EK8A 3BUMB 2F2OA 2KSPA 2KFFA 4QJ5B 2I18A 2LANA 1KSOA 1OE9B 1KQMB 1CB1A 1IQ3A 2I2RE 2RGIA 4YGEB 1KCYA 1NCZA 4JQ0D 1KK7Z 2LVJA 1SY9A 2JRFA 1CLLA 1G8IA 1M39A 1UWOA 1KK8C 2F2PA 1ZMZA 1BLQA 4ORBB 4MN0A 3TS5B 4UPGA 2GV5A 3CLNA 5AFPA 3IQOA 1BR4B 4E68A 2BCXA 4M2QA 1SW8A 3JTDC 3TDZA 3O6BA 1XK4C 5I8NA 1PK0D 2L0PA 3DF0A 4AQIA 3TZ1A 2NXQA 1J7QA 3D10A 3LK1A 3NSKA 3OX6A 5HKYA 3C1VA 3SG2A 2L98A 2K0JA 2R2IA 1CKKA 2WCEA 4P2YB 1J7RA 1CDPA 1PVBA 2L51A 1GGZA 2JQ6A 3ZWHA 2ZFDA 4I5JA 2KAVA 3PALA 2JZIA 2O5GA 4ICBA 4PE0A 5AERA 4C0JA 3SJSA 1BJFA 1YURA 1MQ1A 1S6JA 2BCBA 1KK8B 2PALA 3VRNA 1NIWA 1ZOTB 1CNPA 5I2OA 1KSMA 2K2FA 3D0YB 1FI6A 2KFHA 1TNXA 3OP0A 2KGRA 1V1GA 2F3ZA 4YGAA 2L4HA 2H61C 3IQQA 4OR9B 4Q04A 1UHJA 3VRPA 1DGUA 1RFJA 2A4JA 1QJTA 1K95A 3BQ3A 3OB2B 1B4CA 3DVJA 1BMOA 3MSEB 2B1UA 1CM1A 1SKTA 3SG7A 1ODBA 4BY4A 1MR8A 1XFZO 2MJWB 1NPQA 1TOPA 1SCMC 1F4OA 1MWNA 2LLUA 1BOCA 1UHIA 1B8LA 4FQOA 1B47A 4PALA 3NSIA 2JU0A 2GGZA 5TNCA 2KQ6A 1UHHA 3WHTB 4CFQA 2BE6A 3CR4X 4N1FA 3GK4X 1OZSA 3HCMA 5CSJA 4M2OA 5DKRA 3F45A 4DS7A 1JWDA 1DTLA 2LHIA 2NZ0A 5FYXA 1L2OC 2L2EA 3BYAA 5CPVA 1K8UA 1KFXS 1S6CA 1U5IB 1PSBA 3OB1B 1YUTA 4I5KA 3RLZA 1A75A 3LLEA 4XYNA 1JSAA 1TRFA 1IJ5A 2KI6C 3KO0A 5D69A 4MVFA 1KQVA 1J1EA 1RTP1 2Q91A 3EVRA 1CDNA 1XFVO 4BY5A 2KI4C 1CM4A 1WY9A 3CR5X 3JVTC 3VROA 3O78A 1SYMA 1UHKA 1SMGA 3SG4A 1SCMB 2F3YA 3CS1A 2CTNA 1YR5A 3LK0A 1WRZA 2KGBC 1CFFA 1AJ4A 2P6BB 2LV7A 2K7BA 4MBEA 2F8PA 5ER4X 2CBLA 2Y1MA 4QJ3B 5IBWA 1G4YR 2EGDA 3SG3A 2K7CA 1YTZC 1B8RA 4IL1A 1UHNA 4GGNA 3CZTX 1DJXA 1AUIB 3TS5C 1K2HA 2JULA 2Y4QA 4L9MA 1SPYA 1NX0A 1R2UA 4AQJA 1XFXO 1RJVA 1WLZA 1OOJA 3TDIA 1BT6A 2MLEC 1S6IA 3OHMB 2M9GA 4DCKA 2BL0C 1C7VA 1RWYA 1XA5A 4WQ2A 2KI4B 3JVTB 3FS7A 1XO5A 3O2PA 1XFUO 2EC6B 1M63B 1DJYA 1FBVA 4WRIA 1BG1A 5CSNA 1BU3A 1DJHA 2CNPA 3PN7C 1QX5B 2I7AA 3BUWB 1IRJA 1EG4A 1CDMA 1S5GZ 2D8NA 3BOWA 5DKQA 1VRKA 1QASA 1CDLA 1C7WA 1NX2A 3BUOB 3LL8B 3NSOA 1NX1A 1DT7B 2KYCA 1B1GA 1TTXA 2JWWA 1F54A 2KBMA 2MAZA 1DF0B 1PVAA 4CIDA 4MRYA 1TNQA 2HF5A 1QXPA 2JTTA 2MBXA 4HRHA 4DUQA 5KTYA 2M3WA 1ALWA 1QLKA 2BL0B 1W7IB 2HQWA 1OSAA 2AAOA 4HRGA 4A4BA 3KEVA 2JT8A 4N1GA 1GQMA 2LMUA 2M7NA 1Y1XA 2AMIA 4ETOA 1PSRA 3PLFB 3I5HC 2HQ8A 1XK4A 2LC5A 1MF8B 4AOMA 1K94A 3PN7B 1CFCA 3WHUB 2ZRTA 1K90D 2ZRSA 4YBHB 2MRDA 5I2LA 1F70A 3KHEA 1ZFSA 2PRUA 1JF0A 1M31A 1NCXA 3ZNIA 5K89A 2KQYA 2LP3A 3DD4A 2LP2A 4XJKB 2M1UA 1V1FA 3AKBA 4I5NB 3NSLA 3KPXA 1KFUL 1PRWA 3RM1A 3CTNA 4WQ3A 1IJ6A 2OPOA 1DJWA 2L4IA 2ZNDA 4C0LA 1MHOA 2BKHB 4A4CA 2M97A 3I5FC 1WRKA 1UP5A 4MRXA 2I94A 4ZCVA 2FCEA 1CLBA 2H61A 2Y1NA 3CR2A 1RROA 3SIBA 5KSZA 3I5HB 1AJ5A 1TCFA 2WOSA 4GGFC 1CLMA 1EG3A 5HKWA 2JXLA 2M1KB 1AP4A 4TNCA 1SCVA 3DF0B 1LVCD 1SR6C 2JNFA 2L5XB 2MA2A 4MZJA 1YUUA 2TN4A 1AK8A 1OMVA 4GUKA 5HLVA 1IQ5A 1QX2A 4YGCB 3FWCA 1SL9A 2LAPA 1NUBA 2COLB 2Y5IA 3FWBA 1RECA 1S26D 1XVJA 2LE9B 5HKZA 3DVEA 4OVNF 1N0YA 2LVVA 1FW4A 1QV0A 2SASA 4JWQA 4M2PA 2LNKA 1IKUA 1N65A 2KOTA 1JF2A 4HSZA 1EXRA 1OZOA 1XFYO 3I5FB 2WNDA 1XYDA 1ZUZA 2LMTA 2Q4UA 1OMRA 3I5IC 1K93D 1PULA 2KNEA 1DVIA 5G08A 1QLSA 1SBJA 2EC6C 1WDCC 2KHNA 1J7PA 2BE4A 3O4YA 2JPTA 2JXCA 1DJGA 1M45A 2LLSA 2BBMA 1B7TY 1SR6B 3SG5A 5I2QA 1IG5A 3M0WA 1Q80A 2E30A 5ER5A 2ISDA 1IH0A 2KYFA 2H2KA 3A4UB 1B7TZ 2PVBA 2M49B 3BUXB 3CWGA 2JT0A 2CXJA 3EK4A 4GAOA 4YGBB 1JUOA 1GJYA 1WRLA 1E8AA 1UURA 4PHNA 1ALVA 4GNKB 2QPTA 1CMFA 2CT9A 1S5GY 4YI9A 3GK1A 3PATA 3I5IB 2BCAA 5PALA 1QVIY 1TN4A 1WDCB 1J1DA 3BUNB 4QJ4B 5CSIA 2OTGC 2LCPA 2G9BA 2JOJA 1CTRA 4ZCUA 2LLTA 1TNWA 2HPSA 1NYAA 3AAJA 4OV2A 1G33A 2E6WA 1J7OA 2KDHA 1QVIZ 2LHLA 2CCMA 1F4QA 2M7LA 1K96A 1YUSA 2FOTA 5J3XA 1TCOB 4N5XA 3VRRA 4PDZA 4R1EA 3VRQA 3CGAA 3K21A 2LM5A 3DVKA 2K7DA 2LUCA 5F6TA 2MLFC 3TUYC 1NSHA 1R6PA 1W7JB 4MEWA 4XJKA 3D0YA 1GGWA 1CFDA 2NCOA 2EHBA 4NQGA 2WCFA 2SCPA 2K7OA 3H4SE 4OKHA 4PE1A 2FJUB 4MZLA 1SNLA 4D1EA 2FCDA 4CPVA 2NCPA 1YVLA 2OTGB 2JC2A 1XFWO 3SIAA 5B8IB 1MUXA 2PASA 1ZACA 3PSRA 3HX4A 2ZKMX 1HT9A 3ICBA 4F0ZB 1S3PA 2BBNA 4MSPA 2M8UA 2BECA 2KBIA 1QX7A 2WORA 3A8RA 3I5GB 1QIVA 2JNXA 4YI8A 4OCIA 5D7FA 1S36A 3QRXA 2F33A 3EVUA 3IF7A 4PHKA 1BF5A 3BOWB 3BXKA 3EKHA 5HYDA 1MXEA 3FIAA 3TUYB 1M46A 1RK9A 4MZKA 1KFUS 1WLMA 4YGDB 5KU1A 1SL7A 1F71A 2K8MB 4CLNA 1NCYA 2O60A 1U5IA 3OX5A 1C07A 2AUCA 1AVSA 1YVHA 2QACA 3DVMA 1DJZA 3LCPC 4PHJA 3AKAA 5BPJA 1A03A 2KAXA 4GBAA 2DOQA 1BODA 1SL8A 1H4BA 1B9AA 2VRGA 5CSFA 1YX8A 1Y6WA 2LMVA 1PALA 3PFVA 1H8BA 2BKIB 1KWOC 3PM8A 2LVKA 3JTDB 4GGFA 1OQPA 2HETA 1QATA 2GGMA 2G2BA 4U8DA 2OS8C 4ORCB 1B8CA 1QIWA 5GQQC 1F55A 4P5OE 2M0RA 3VGOA 3WNXB 4HREE 2M29A 1JFKA 5AANA 1D1OA 5HLOA 2WC8A 1EL4A 1Y0VH 1A29A 2V53A 5JOLA 1JC2A 2ZN9A 1LINA 2LVIA 4PE7A 4YRUA 2K2AA 1SRAA 1FPWA 1S1EA 1DMOA 1L7ZA 2PMYA 5JJGA 1MXLC 1KFXL 1CFPA 3KF9A 4NDDA 4DIRA 4USLA 1CMGA 1K9PA 1KWOB 2KI6D 3E3RA 3TDUA 1JFJA 1TNPA 2ZNEA 2NLNA 3EK7A 5DKNA 2KFGA 1Y1AA 2OS8B 4PCWA 1EJ3A 4MLWA 1LKJA 1UUSA 1YRUB 1SK6D 4ORAB 1YRTB 1QS7A 3WXAA 1NX3A 1LA3A 1EH2A 2JT3A 1OMDA 4GFTA 1A4PA 1JBAA 1KQMC 1DGVA 2K61A 1A2XA 3SG6A 1N2DA 2ZN8A 3AAKA 4DRWA 4CFRA 1DF0A 1DJIA 1QTXA 4GPLB 4I5LB 2IS9A 4NDCA 1Y1UA 1IWQA 1NWDA 1F8HA 1FF1A 4PE4A 5AEQA 1J55A 1FI5A 1A75B 1LXFC 4NDBA 1K9KA 2LUXA 3NXAA 1X02A 2MHHA 1YX7A 3GOFA 1AHRA 1L2OB 1TIZA 3GK2A 4JPZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AXI A;  1LA0 A;  1HQV A;  3EVV A;  3EKJ A;  4PHM A;  2PSR A;  1K9U A;  1NP8 A;  1QV1 A;  2JTZ A;  3I5G C;  4FTG A;  4C0K A;  1BR1 B;  1KK7 Y;  2KAY A;  2L50 A;  2WCB A;  1IGV A;  3EK8 A;  3BUM B;  2F2O A;  2KSP A;  2KFF A;  4QJ5 B;  2I18 A;  2LAN A;  1KSO A;  1OE9 B;  1KQM B;  1CB1 A;  1IQ3 A;  2I2R E;  2RGI A;  4YGE B;  1KCY A;  1NCZ A;  4JQ0 D;  1KK7 Z;  2LVJ A;  1SY9 A;  2JRF A;  1CLL A;  1G8I A;  1M39 A;  1UWO A;  1KK8 C;  2F2P A;  1ZMZ A;  1BLQ A;  4ORB B;  4MN0 A;  3TS5 B;  4UPG A;  2GV5 A;  3CLN A;  5AFP A;  3IQO A;  1BR4 B;  4E68 A;  2BCX A;  4M2Q A;  1SW8 A;  3JTD C;  3TDZ A;  3O6B A;  1XK4 C;  5I8N A;  1PK0 D;  2L0P A;  3DF0 A;  4AQI A;  3TZ1 A;  2NXQ A;  1J7Q A;  3D10 A;  3LK1 A;  3NSK A;  3OX6 A;  5HKY A;  3C1V A;  3SG2 A;  2L98 A;  2K0J A;  2R2I A;  1CKK A;  2WCE A;  4P2Y B;  1J7R A;  1CDP A;  1PVB A;  2L51 A;  1GGZ A;  2JQ6 A;  3ZWH A;  2ZFD A;  4I5J A;  2KAV A;  3PAL A;  2JZI A;  2O5G A;  4ICB A;  4PE0 A;  5AER A;  4C0J A;  3SJS A;  1BJF A;  1YUR A;  1MQ1 A;  1S6J A;  2BCB A;  1KK8 B;  2PAL A;  3VRN A;  1NIW A;  1ZOT B;  1CNP A;  5I2O A;  1KSM A;  2K2F A;  3D0Y B;  1FI6 A;  2KFH A;  1TNX A;  3OP0 A;  2KGR A;  1V1G A;  2F3Z A;  4YGA A;  2L4H A;  2H61 C;  3IQQ A;  4OR9 B;  4Q04 A;  1UHJ A;  3VRP A;  1DGU A;  1RFJ A;  2A4J A;  1QJT A;  1K95 A;  3BQ3 A;  3OB2 B;  1B4C A;  3DVJ A;  1BMO A;  3MSE B;  2B1U A;  1CM1 A;  1SKT A;  3SG7 A;  1ODB A;  4BY4 A;  1MR8 A;  1XFZ O;  2MJW B;  1NPQ A;  1TOP A;  1SCM C;  1F4O A;  1MWN A;  2LLU A;  1BOC A;  1UHI A;  1B8L A;  4FQO A;  1B47 A;  4PAL A;  3NSI A;  2JU0 A;  2GGZ A;  5TNC A;  2KQ6 A;  1UHH A;  3WHT B;  4CFQ A;  2BE6 A;  3CR4 X;  4N1F A;  3GK4 X;  1OZS A;  3HCM A;  5CSJ A;  4M2O A;  5DKR A;  3F45 A;  4DS7 A;  1JWD A;  1DTL A;  2LHI A;  2NZ0 A;  5FYX A;  1L2O C;  2L2E A;  3BYA A;  5CPV A;  1K8U A;  1KFX S;  1S6C A;  1U5I B;  1PSB A;  3OB1 B;  1YUT A;  4I5K A;  3RLZ A;  1A75 A;  3LLE A;  4XYN A;  1JSA A;  1TRF A;  1IJ5 A;  2KI6 C;  3KO0 A;  5D69 A;  4MVF A;  1KQV A;  1J1E A;  1RTP 1;  2Q91 A;  3EVR A;  1CDN A;  1XFV O;  4BY5 A;  2KI4 C;  1CM4 A;  1WY9 A;  3CR5 X;  3JVT C;  3VRO A;  3O78 A;  1SYM A;  1UHK A;  1SMG A;  3SG4 A;  1SCM B;  2F3Y A;  3CS1 A;  2CTN A;  1YR5 A;  3LK0 A;  1WRZ A;  2KGB C;  1CFF A;  1AJ4 A;  2P6B B;  2LV7 A;  2K7B A;  4MBE A;  2F8P A;  5ER4 X;  2CBL A;  2Y1M A;  4QJ3 B;  5IBW A;  1G4Y R;  2EGD A;  3SG3 A;  2K7C A;  1YTZ C;  1B8R A;  4IL1 A;  1UHN A;  4GGN A;  3CZT X;  1DJX A;  1AUI B;  3TS5 C;  1K2H A;  2JUL A;  2Y4Q A;  4L9M A;  1SPY A;  1NX0 A;  1R2U A;  4AQJ A;  1XFX O;  1RJV A;  1WLZ A;  1OOJ A;  3TDI A;  1BT6 A;  2MLE C;  1S6I A;  3OHM B;  2M9G A;  4DCK A;  2BL0 C;  1C7V A;  1RWY A;  1XA5 A;  4WQ2 A;  2KI4 B;  3JVT B;  3FS7 A;  1XO5 A;  3O2P A;  1XFU O;  2EC6 B;  1M63 B;  1DJY A;  1FBV A;  4WRI A;  1BG1 A;  5CSN A;  1BU3 A;  1DJH A;  2CNP A;  3PN7 C;  1QX5 B;  2I7A A;  3BUW B;  1IRJ A;  1EG4 A;  1CDM A;  1S5G Z;  2D8N A;  3BOW A;  5DKQ A;  1VRK A;  1QAS A;  1CDL A;  1C7W A;  1NX2 A;  3BUO B;  3LL8 B;  3NSO A;  1NX1 A;  1DT7 B;  2KYC A;  1B1G A;  1TTX A;  2JWW A;  1F54 A;  2KBM A;  2MAZ A;  1DF0 B;  1PVA A;  4CID A;  4MRY A;  1TNQ A;  2HF5 A;  1QXP A;  2JTT A;  2MBX A;  4HRH A;  4DUQ A;  5KTY A;  2M3W A;  1ALW A;  1QLK A;  2BL0 B;  1W7I B;  2HQW A;  1OSA A;  2AAO A;  4HRG A;  4A4B A;  3KEV A;  2JT8 A;  4N1G A;  1GQM A;  2LMU A;  2M7N A;  1Y1X A;  2AMI A;  4ETO A;  1PSR A;  3PLF B;  3I5H C;  2HQ8 A;  1XK4 A;  2LC5 A;  1MF8 B;  4AOM A;  1K94 A;  3PN7 B;  1CFC A;  3WHU B;  2ZRT A;  1K90 D;  2ZRS A;  4YBH B;  2MRD A;  5I2L A;  1F70 A;  3KHE A;  1ZFS A;  2PRU A;  1JF0 A;  1M31 A;  1NCX A;  3ZNI A;  5K89 A;  2KQY A;  2LP3 A;  3DD4 A;  2LP2 A;  4XJK B;  2M1U A;  1V1F A;  3AKB A;  4I5N B;  3NSL A;  3KPX A;  1KFU L;  1PRW A;  3RM1 A;  3CTN A;  4WQ3 A;  1IJ6 A;  2OPO A;  1DJW A;  2L4I A;  2ZND A;  4C0L A;  1MHO A;  2BKH B;  4A4C A;  2M97 A;  3I5F C;  1WRK A;  1UP5 A;  4MRX A;  2I94 A;  4ZCV A;  2FCE A;  1CLB A;  2H61 A;  2Y1N A;  3CR2 A;  1RRO A;  3SIB A;  5KSZ A;  3I5H B;  1AJ5 A;  1TCF A;  2WOS A;  4GGF C;  1CLM A;  1EG3 A;  5HKW A;  2JXL A;  2M1K B;  1AP4 A;  4TNC A;  1SCV A;  3DF0 B;  1LVC D;  1SR6 C;  2JNF A;  2L5X B;  2MA2 A;  4MZJ A;  1YUU A;  2TN4 A;  1AK8 A;  1OMV A;  4GUK A;  5HLV A;  1IQ5 A;  1QX2 A;  4YGC B;  3FWC A;  1SL9 A;  2LAP A;  1NUB A;  2COL B;  2Y5I A;  3FWB A;  1REC A;  1S26 D;  1XVJ A;  2LE9 B;  5HKZ A;  3DVE A;  4OVN F;  1N0Y A;  2LVV A;  1FW4 A;  1QV0 A;  2SAS A;  4JWQ A;  4M2P A;  2LNK A;  1IKU A;  1N65 A;  2KOT A;  1JF2 A;  4HSZ A;  1EXR A;  1OZO A;  1XFY O;  3I5F B;  2WND A;  1XYD A;  1ZUZ A;  2LMT A;  2Q4U A;  1OMR A;  3I5I C;  1K93 D;  1PUL A;  2KNE A;  1DVI A;  5G08 A;  1QLS A;  1SBJ A;  2EC6 C;  1WDC C;  2KHN A;  1J7P A;  2BE4 A;  3O4Y A;  2JPT A;  2JXC A;  1DJG A;  1M45 A;  2LLS A;  2BBM A;  1B7T Y;  1SR6 B;  3SG5 A;  5I2Q A;  1IG5 A;  3M0W A;  1Q80 A;  2E30 A;  5ER5 A;  2ISD A;  1IH0 A;  2KYF A;  2H2K A;  3A4U B;  1B7T Z;  2PVB A;  2M49 B;  3BUX B;  3CWG A;  2JT0 A;  2CXJ A;  3EK4 A;  4GAO A;  4YGB B;  1JUO A;  1GJY A;  1WRL A;  1E8A A;  1UUR A;  4PHN A;  1ALV A;  4GNK B;  2QPT A;  1CMF A;  2CT9 A;  1S5G Y;  4YI9 A;  3GK1 A;  3PAT A;  3I5I B;  2BCA A;  5PAL A;  1QVI Y;  1TN4 A;  1WDC B;  1J1D A;  3BUN B;  4QJ4 B;  5CSI A;  2OTG C;  2LCP A;  2G9B A;  2JOJ A;  1CTR A;  4ZCU A;  2LLT A;  1TNW A;  2HPS A;  1NYA A;  3AAJ A;  4OV2 A;  1G33 A;  2E6W A;  1J7O A;  2KDH A;  1QVI Z;  2LHL A;  2CCM A;  1F4Q A;  2M7L A;  1K96 A;  1YUS A;  2FOT A;  5J3X A;  1TCO B;  4N5X A;  3VRR A;  4PDZ A;  4R1E A;  3VRQ A;  3CGA A;  3K21 A;  2LM5 A;  3DVK A;  2K7D A;  2LUC A;  5F6T A;  2MLF C;  3TUY C;  1NSH A;  1R6P A;  1W7J B;  4MEW A;  4XJK A;  3D0Y A;  1GGW A;  1CFD A;  2NCO A;  2EHB A;  4NQG A;  2WCF A;  2SCP A;  2K7O A;  3H4S E;  4OKH A;  4PE1 A;  2FJU B;  4MZL A;  1SNL A;  4D1E A;  2FCD A;  4CPV A;  2NCP A;  1YVL A;  2OTG B;  2JC2 A;  1XFW O;  3SIA A;  5B8I B;  1MUX A;  2PAS A;  1ZAC A;  3PSR A;  3HX4 A;  2ZKM X;  1HT9 A;  3ICB A;  4F0Z B;  1S3P A;  2BBN A;  4MSP A;  2M8U A;  2BEC A;  2KBI A;  1QX7 A;  2WOR A;  3A8R A;  3I5G B;  1QIV A;  2JNX A;  4YI8 A;  4OCI A;  5D7F A;  1S36 A;  3QRX A;  2F33 A;  3EVU A;  3IF7 A;  4PHK A;  1BF5 A;  3BOW B;  3BXK A;  3EKH A;  5HYD A;  1MXE A;  3FIA A;  3TUY B;  1M46 A;  1RK9 A;  4MZK A;  1KFU S;  1WLM A;  4YGD B;  5KU1 A;  1SL7 A;  1F71 A;  2K8M B;  4CLN A;  1NCY A;  2O60 A;  1U5I A;  3OX5 A;  1C07 A;  2AUC A;  1AVS A;  1YVH A;  2QAC A;  3DVM A;  1DJZ A;  3LCP C;  4PHJ A;  3AKA A;  5BPJ A;  1A03 A;  2KAX A;  4GBA A;  2DOQ A;  1BOD A;  1SL8 A;  1H4B A;  1B9A A;  2VRG A;  5CSF A;  1YX8 A;  1Y6W A;  2LMV A;  1PAL A;  3PFV A;  1H8B A;  2BKI B;  1KWO C;  3PM8 A;  2LVK A;  3JTD B;  4GGF A;  1OQP A;  2HET A;  1QAT A;  2GGM A;  2G2B A;  4U8D A;  2OS8 C;  4ORC B;  1B8C A;  1QIW A;  5GQQ C;  1F55 A;  4P5O E;  2M0R A;  3VGO A;  3WNX B;  4HRE E;  2M29 A;  1JFK A;  5AAN A;  1D1O A;  5HLO A;  2WC8 A;  1EL4 A;  1Y0V H;  1A29 A;  2V53 A;  5JOL A;  1JC2 A;  2ZN9 A;  1LIN A;  2LVI A;  4PE7 A;  4YRU A;  2K2A A;  1SRA A;  1FPW A;  1S1E A;  1DMO A;  1L7Z A;  2PMY A;  5JJG A;  1MXL C;  1KFX L;  1CFP A;  3KF9 A;  4NDD A;  4DIR A;  4USL A;  1CMG A;  1K9P A;  1KWO B;  2KI6 D;  3E3R A;  3TDU A;  1JFJ A;  1TNP A;  2ZNE A;  2NLN A;  3EK7 A;  5DKN A;  2KFG A;  1Y1A A;  2OS8 B;  4PCW A;  1EJ3 A;  4MLW A;  1LKJ A;  1UUS A;  1YRU B;  1SK6 D;  4ORA B;  1YRT B;  1QS7 A;  3WXA A;  1NX3 A;  1LA3 A;  1EH2 A;  2JT3 A;  1OMD A;  4GFT A;  1A4P A;  1JBA A;  1KQM C;  1DGV A;  2K61 A;  1A2X A;  3SG6 A;  1N2D A;  2ZN8 A;  3AAK A;  4DRW A;  4CFR A;  1DF0 A;  1DJI A;  1QTX A;  4GPL B;  4I5L B;  2IS9 A;  4NDC A;  1Y1U A;  1IWQ A;  1NWD A;  1F8H A;  1FF1 A;  4PE4 A;  5AEQ A;  1J55 A;  1FI5 A;  1A75 B;  1LXF C;  4NDB A;  1K9K A;  2LUX A;  3NXA A;  1X02 A;  2MHH A;  1YX7 A;  3GOF A;  1AHR A;  1L2O B;  1TIZ A;  3GK2 A;  4JPZ B; 
#chains in the Genus database with same CATH topology
 5AXI A;  1LA0 A;  1HQV A;  3EVV A;  3EKJ A;  4PHM A;  2PSR A;  1K9U A;  1NP8 A;  2WCJ A;  1QV1 A;  2JTZ A;  3I5G C;  4FTG A;  1DQE A;  4C0K A;  1BR1 B;  1KK7 Y;  2KAY A;  2L50 A;  2WCB A;  1IGV A;  3EK8 A;  4PT1 A;  5D3O A;  3BUM B;  2F2O A;  2KSP A;  2KFF A;  4QJ5 B;  2I18 A;  2LAN A;  1KSO A;  1OE9 B;  1KQM B;  1CB1 A;  1IQ3 A;  2I2R E;  2RGI A;  4YGE B;  1KCY A;  1NCZ A;  4JQ0 D;  1KK7 Z;  2LVJ A;  1SY9 A;  2JRF A;  1CLL A;  1G8I A;  3BJH A;  1M39 A;  1UWO A;  1C3Z A;  1KK8 C;  2F2P A;  2WCK A;  1ZMZ A;  1BLQ A;  4ORB B;  4MN0 A;  3TS5 B;  4UPG A;  2GV5 A;  3CLN A;  5AFP A;  3IQO A;  1BR4 B;  4E68 A;  5DIC A;  1C3Y A;  2BCX A;  4M2Q A;  1SW8 A;  3JTD C;  3TDZ A;  3S0A A;  3FE8 A;  3O6B A;  1XK4 C;  5I8N A;  1PK0 D;  2L0P A;  3DF0 A;  4AQI A;  3TZ1 A;  2NXQ A;  1J7Q A;  3D10 A;  3LK1 A;  3NSK A;  3OX6 A;  5FI6 A;  3CDN A;  5HKY A;  3C1V A;  3SG2 A;  2L98 A;  2K0J A;  2R2I A;  5FI2 A;  2QEO A;  1CKK A;  2WCE A;  4P2Y B;  1J7R A;  1CDP A;  1PVB A;  2L51 A;  1GGZ A;  2JQ6 A;  3ZWH A;  1W9Z A;  2ZFD A;  4I5J A;  2KAV A;  2P70 A;  3PAL A;  2JZI A;  2O5G A;  1ORG A;  4ICB A;  4PE0 A;  5AER A;  4C0J A;  3SJS A;  1BJF A;  1YUR A;  1MQ1 A;  1S6J A;  2BCB A;  1KK8 B;  2PAL A;  3VRN A;  1NIW A;  1ZOT B;  3DZT A;  5I2O A;  1CNP A;  1KSM A;  2K2F A;  3D0Y B;  3N7H A;  1FI6 A;  2KFH A;  1TNX A;  3OBV A;  3OP0 A;  2KGR A;  1V1G A;  2F3Z A;  4YGA A;  2L4H A;  2H61 C;  3IQQ A;  4OR9 B;  4Q04 A;  1UHJ A;  3VRP A;  1DGU A;  1RFJ A;  2A4J A;  1QJT A;  1K95 A;  3BQ3 A;  3OB2 B;  1B4C A;  3DVJ A;  3DY9 A;  1BMO A;  3MSE B;  2B1U A;  1CM1 A;  1SKT A;  3SG7 A;  1ODB A;  4INX A;  4BY4 A;  1MR8 A;  1XFZ O;  2MJW B;  1NPQ A;  1TOP A;  1SCM C;  1F4O A;  1MWN A;  1Z2C B;  2LLU A;  1UHI A;  1BOC A;  1B8L A;  4FQO A;  1B47 A;  4PAL A;  3NSI A;  2JU0 A;  3S0F A;  2GGZ A;  5TNC A;  2KQ6 A;  1UHH A;  3WHT B;  1TUZ A;  1IIO A;  4CFQ A;  2BE6 A;  3CR4 X;  4N1F A;  3GK4 X;  1OZS A;  3HCM A;  5CSJ A;  4M2O A;  3PM2 A;  5DKR A;  3F45 A;  4DS7 A;  1JWD A;  1DTL A;  2LHI A;  2NZ0 A;  1BF5 A;  5FYX A;  1L2O C;  2L2E A;  3BYA A;  5CPV A;  1K8U A;  1KFX S;  1S6C A;  1U5I B;  1PSB A;  3OB1 B;  1YUT A;  4I5K A;  3RLZ A;  3VB1 A;  1OOG A;  1A75 A;  3LLE A;  4XYN A;  1QWV A;  3BFH A;  1TRF A;  1SSE B;  1IJ5 A;  2KI6 C;  3KO0 A;  5D69 A;  1JSA A;  4MVF A;  1KQV A;  1J1E A;  1RTP 1;  2Q91 A;  3EVR A;  1CDN A;  1XFV O;  4BY5 A;  2KI4 C;  1CM4 A;  1WY9 A;  3CR5 X;  3JVT C;  3VRO A;  3O78 A;  1SYM A;  2WC6 A;  1UHK A;  1SMG A;  3SG4 A;  1SCM B;  3D78 A;  2F3Y A;  3CS1 A;  2CTN A;  1YR5 A;  2L5Y A;  3LK0 A;  1WRZ A;  2KGB C;  1CFF A;  1AJ4 A;  2P6B B;  2LV7 A;  2K7B A;  4MBE A;  2F8P A;  5ER4 X;  2CBL A;  2Y1M A;  4QJ3 B;  5IBW A;  1G4Y R;  2EGD A;  3BFB A;  3SG3 A;  2K7C A;  1YTZ C;  1B8R A;  4IL1 A;  1UHN A;  4GGN A;  3CZT X;  1DJX A;  3R1P A;  1AUI B;  3TS5 C;  1K2H A;  2JUL A;  2Y4Q A;  4L9M A;  1SPY A;  1NX0 A;  1R2U A;  2WCH A;  4AQJ A;  1XFX O;  1RJV A;  1DEL A;  1OOJ A;  1WLZ A;  3TDI A;  3K1E A;  1BT6 A;  2MLE C;  1S6I A;  3OHM B;  2M9G A;  4DCK A;  2BL0 C;  1C7V A;  3D75 A;  1RWY A;  1XA5 A;  4WQ2 A;  2KI4 B;  3JVT B;  3FS7 A;  1XO5 A;  3O2P A;  1XFU O;  2EC6 B;  1M63 B;  1DJY A;  1FBV A;  3D76 A;  2JPO A;  4WRI A;  1BG1 A;  2KLE A;  1BU3 A;  1DJH A;  1XFR A;  2CNP A;  3PN7 C;  1QX5 B;  2I7A A;  3BUW B;  5CSN A;  1IRJ A;  1EG4 A;  1CDM A;  1S5G Z;  2D8N A;  3BOW A;  5DKQ A;  2YGU A;  1VRK A;  1QAS A;  1CDL A;  1C7W A;  1NX2 A;  3BUO B;  3LL8 B;  3NSO A;  1NX1 A;  1DT7 B;  2KYC A;  1B1G A;  3DXL A;  1TTX A;  2JWW A;  3R72 A;  1F54 A;  2KBM A;  2MAZ A;  1LS8 A;  1DF0 B;  1PVA A;  1OW4 A;  4CID A;  4MRY A;  1TNQ A;  2HF5 A;  1QXP A;  2JTT A;  2MBX A;  4HRH A;  4DUQ A;  5KTY A;  2M3W A;  1ALW A;  1QLK A;  1W7I B;  2BL0 B;  2HQW A;  1OSA A;  2AAO A;  4HRG A;  4A4B A;  3KEV A;  2JT8 A;  4N1G A;  1GQM A;  2LMU A;  2M7N A;  1Y1X A;  2AMI A;  4ETO A;  1PSR A;  3PLF B;  3I5H C;  2HQ8 A;  1XK4 A;  5EL2 A;  2LC5 A;  1MF8 B;  4AOM A;  1K94 A;  3FE6 A;  3PN7 B;  1OOH A;  3WHU B;  1CFC A;  2ZRT A;  1K90 D;  2QEB A;  2ZRS A;  2MRD A;  4YBH B;  5I2L A;  3OGN A;  1F70 A;  3KHE A;  1ZFS A;  2PRU A;  1JF0 A;  1M31 A;  1NCX A;  4JD9 A;  3ZNI A;  5K89 A;  2KQY A;  2LP3 A;  1DEK A;  3DD4 A;  2LP2 A;  4XJK B;  2M1U A;  1P28 A;  1V1F A;  3AKB A;  4I5N B;  4JKT A;  3NSL A;  3KPX A;  1KFU L;  1PRW A;  3RM1 A;  3CTN A;  1DC1 A;  2KPH A;  4WQ3 A;  1IJ6 A;  1OOF A;  2OPO A;  1DJW A;  2L4I A;  2ZND A;  4C0L A;  1MHO A;  2BKH B;  4A4C A;  2M97 A;  3I5F C;  1WRK A;  1UP5 A;  3EG5 B;  4MRX A;  2I94 A;  4ZCV A;  2FCE A;  1CLB A;  2H61 A;  2Y1N A;  3CR2 A;  1RRO A;  3SIB A;  5KSZ A;  2FJY A;  2QEH A;  3I5H B;  1AJ5 A;  1TCF A;  2WOS A;  4GGF C;  1CLM A;  1EG3 A;  5HKW A;  2JXL A;  2M1K B;  1AP4 A;  4TNC A;  1SCV A;  3DF0 B;  1LVC D;  1SR6 C;  2L2C A;  2JNF A;  2L5X B;  2MA2 A;  2ERB A;  4MZJ A;  1YUU A;  2TN4 A;  1AK8 A;  1OMV A;  4GUK A;  5HLV A;  1IQ5 A;  1QX2 A;  4YGC B;  3B6X A;  3FWC A;  1SL9 A;  2LAP A;  4FQT A;  1NUB A;  2COL B;  3UNW A;  2Y5I A;  3FWB A;  1REC A;  1S26 D;  1XVJ A;  2LE9 B;  5HKZ A;  3DVE A;  3R1V A;  1N0Y A;  2LVV A;  1FW4 A;  1QV0 A;  2SAS A;  3L4L A;  4JWQ A;  4M2P A;  3S0B A;  4OVN F;  2LNK A;  1IKU A;  1N65 A;  2KOT A;  1JF2 A;  4HSZ A;  1EXR A;  1OZO A;  1XFY O;  3I5F B;  3SS3 A;  2WND A;  1XYD A;  1ZUZ A;  2LMT A;  2Q4U A;  1OMR A;  3I5I C;  1K93 D;  1PUL A;  2KNE A;  1DVI A;  5G08 A;  1QLS A;  1SBJ A;  2EC6 C;  1WDC C;  2KHN A;  1J7P A;  3FE9 A;  2BE4 A;  3O4Y A;  2JPT A;  2JXC A;  1DJG A;  1M45 A;  2LLS A;  2BBM A;  3SS5 A;  1B7T Y;  1SR6 B;  2QEV A;  3B87 A;  3B7A A;  3SG5 A;  5I2Q A;  1IG5 A;  3M0W A;  1Q80 A;  2E30 A;  5ER5 A;  2ISD A;  1IH0 A;  2KYF A;  2H2K A;  3A4U B;  3RZS A;  1TUJ A;  1OOI X;  1B7T Z;  2PVB A;  2M49 B;  3BUX B;  3CWG A;  3DYE A;  2JT0 A;  1TWO A;  2CXJ A;  3EK4 A;  2KLD A;  4GAO A;  3B88 A;  4YGB B;  1JUO A;  1GJY A;  1WRL A;  1E8A A;  1UUR A;  4PHN A;  1ALV A;  4GNK B;  2QPT A;  1CMF A;  2CT9 A;  1S5G Y;  4YI9 A;  3GK1 A;  3CYZ A;  3PAT A;  5FI7 A;  3I5I B;  3Q8I A;  2BCA A;  5PAL A;  1QVI Y;  1TN4 A;  1WDC B;  1J1D A;  3BUN B;  4QJ4 B;  5CSI A;  2OTG C;  2K60 A;  2LCP A;  2G9B A;  2JOJ A;  1CTR A;  4ZCU A;  2LLT A;  3CZ2 A;  1TNW A;  2HPS A;  1NYA A;  3AAJ A;  4OV2 A;  1G33 A;  2E6W A;  1J7O A;  2KDH A;  1QVI Z;  2LHL A;  2CCM A;  1F4Q A;  2M7L A;  1K96 A;  3S0E A;  1YUS A;  2FOT A;  5J3X A;  4KYN A;  1TCO B;  4INW A;  4N5X A;  3VRR A;  4PDZ A;  4R1E A;  3VRQ A;  3CGA A;  3K21 A;  2LM5 A;  2BNX A;  4IJ7 A;  3DVK A;  2QDI A;  2K7D A;  2LUC A;  5F6T A;  2MLF C;  3TUY C;  1NSH A;  1R6P A;  1W7J B;  3SS4 A;  2H8V A;  4MEW A;  3IVT A;  4XJK A;  3D0Y A;  1GGW A;  1CFD A;  2NCO A;  2EHB A;  4NQG A;  3NGV A;  2WCF A;  2SCP A;  4OZD A;  2K7O A;  3H4S E;  4OKH A;  4PE1 A;  2FJU B;  4MZL A;  2BAP A;  1SNL A;  4D1E A;  2FCD A;  4CPV A;  2NCP A;  1YVL A;  2OTG B;  2WC5 A;  2JC2 A;  1XFW O;  3SIA A;  5B8I B;  1MUX A;  2PAS A;  1ZAC A;  3PSR A;  3HX4 A;  2ZKM X;  1HT9 A;  3ICB A;  4F0Z B;  1S3P A;  2BBN A;  4MSP A;  2M8U A;  2BEC A;  2KBI A;  1QX7 A;  2WOR A;  3A8R A;  3D77 A;  3I5G B;  1QIV A;  2JNX A;  4YI8 A;  4OCI A;  5D7F A;  1S36 A;  3QRX A;  2F33 A;  3EVU A;  3IF7 A;  4PHK A;  1T14 A;  3BOW B;  3BXK A;  3EKH A;  5HYD A;  3BFA A;  1MXE A;  3FIA A;  3TUY B;  1M46 A;  1RK9 A;  4MZK A;  1KFU S;  1WLM A;  4YGD B;  5KU1 A;  1SL7 A;  1F71 A;  2K8M B;  4CLN A;  1NCY A;  2O60 A;  2PYQ A;  1U5I A;  3OX5 A;  1C07 A;  3CZ0 A;  2AUC A;  1AVS A;  1YVH A;  1Z4H A;  2QAC A;  5HL1 A;  3DVM A;  1DJZ A;  3LCP C;  4PHJ A;  3AKA A;  5BPJ A;  3V2L A;  2KAX A;  1A03 A;  4GBA A;  2DOQ A;  1BOD A;  1SL8 A;  1H4B A;  1B9A A;  2VRG A;  5CSF A;  2P71 A;  3O4X A;  5I94 A;  1YX8 A;  1Y6W A;  2LMV A;  1PAL A;  2PQL A;  3PFV A;  1H8B A;  2BKI B;  1KWO C;  3PM8 A;  2LVK A;  3JTD B;  2WCM A;  4GGF A;  1OQP A;  2HET A;  1QAT A;  2GGM A;  2G2B A;  4U8D A;  3S0G A;  2OS8 C;  4ORC B;  1B8C A;  1QIW A;  5GQQ C;  1F55 A;  4P5O E;  3D73 A;  2M0R A;  3VGO A;  4F7F A;  3WNX B;  4HRE E;  2M29 A;  1JFK A;  5AAN A;  1D1O A;  3L47 A;  3B86 A;  3CAB A;  2WC8 A;  1EL4 A;  5HLO A;  1Y0V H;  1A29 A;  2V53 A;  5JOL A;  1JC2 A;  2ZN9 A;  1LIN A;  2LVI A;  4PE7 A;  4YRU A;  2K2A A;  3NHT A;  1SRA A;  1FPW A;  1S1E A;  3R1O A;  1DMO A;  1L7Z A;  2PMY A;  5JJG A;  1MXL C;  1KFX L;  3NHI A;  1CFP A;  3KF9 A;  4NDD A;  4DIR A;  4USL A;  1CMG A;  1K9P A;  1KWO B;  2KI6 D;  3E3R A;  2GTE A;  3TDU A;  1TNP A;  3PJI A;  1JFJ A;  2ZNE A;  2NLN A;  3EK7 A;  5DKN A;  2KFG A;  1Y1A A;  2OS8 B;  4PCW A;  1EJ3 A;  4MLW A;  1LKJ A;  1UUS A;  1YRU B;  3CZ1 A;  1SK6 D;  4ORA B;  1YRT B;  1QS7 A;  3WXA A;  3QME A;  3UO9 A;  1NX3 A;  3L4A A;  1LA3 A;  1EH2 A;  2JT3 A;  1OMD A;  4GFT A;  1A4P A;  1JBA A;  1KQM C;  1DGV A;  2K61 A;  1A2X A;  3SG6 A;  1N2D A;  2ZN8 A;  3AAK A;  4DRW A;  4CFR A;  1DF0 A;  1DJI A;  1QTX A;  4GPL B;  4I5L B;  2IS9 A;  4NDC A;  1Y1U A;  1IWQ A;  3S0D A;  1NWD A;  1F8H A;  1FF1 A;  4PE4 A;  5AEQ A;  1J55 A;  1FI5 A;  1A75 B;  1LXF C;  4NDB A;  2WCL A;  1K9K A;  1GM0 A;  2LUX A;  3NXA A;  1X02 A;  2MHH A;  3D74 A;  1YX7 A;  3GOF A;  1AHR A;  1L2O B;  1TIZ A;  3GK2 A;  4JPZ B; 
#chains in the Genus database with same CATH homology
 5AXI A;  1LA0 A;  1HQV A;  3EVV A;  3EKJ A;  4PHM A;  2PSR A;  1K9U A;  1NP8 A;  1QV1 A;  2JTZ A;  3I5G C;  4FTG A;  4C0K A;  1BR1 B;  1KK7 Y;  2KAY A;  2L50 A;  2WCB A;  1IGV A;  3EK8 A;  3BUM B;  2F2O A;  2KSP A;  2KFF A;  4QJ5 B;  2I18 A;  2LAN A;  1KSO A;  1OE9 B;  1KQM B;  1CB1 A;  1IQ3 A;  2I2R E;  2RGI A;  4YGE B;  1KCY A;  1NCZ A;  4JQ0 D;  1KK7 Z;  2LVJ A;  1SY9 A;  2JRF A;  1CLL A;  1G8I A;  1M39 A;  1UWO A;  1KK8 C;  2F2P A;  1ZMZ A;  1BLQ A;  4ORB B;  4MN0 A;  3TS5 B;  4UPG A;  2GV5 A;  3CLN A;  5AFP A;  3IQO A;  1BR4 B;  4E68 A;  2BCX A;  4M2Q A;  1SW8 A;  3JTD C;  3TDZ A;  3O6B A;  1XK4 C;  5I8N A;  1PK0 D;  2L0P A;  3DF0 A;  4AQI A;  3TZ1 A;  2NXQ A;  1J7Q A;  3D10 A;  3LK1 A;  3NSK A;  3OX6 A;  5HKY A;  3C1V A;  3SG2 A;  2L98 A;  2K0J A;  2R2I A;  1CKK A;  2WCE A;  4P2Y B;  1J7R A;  1CDP A;  1PVB A;  2L51 A;  1GGZ A;  2JQ6 A;  3ZWH A;  2ZFD A;  4I5J A;  2KAV A;  3PAL A;  2JZI A;  2O5G A;  4ICB A;  4PE0 A;  5AER A;  4C0J A;  3SJS A;  1BJF A;  1YUR A;  1MQ1 A;  1S6J A;  2BCB A;  1KK8 B;  2PAL A;  3VRN A;  1NIW A;  1ZOT B;  1CNP A;  5I2O A;  1KSM A;  2K2F A;  3D0Y B;  1FI6 A;  2KFH A;  1TNX A;  3OP0 A;  2KGR A;  1V1G A;  2F3Z A;  4YGA A;  2L4H A;  2H61 C;  3IQQ A;  4OR9 B;  4Q04 A;  1UHJ A;  3VRP A;  1DGU A;  1RFJ A;  2A4J A;  1QJT A;  1K95 A;  3BQ3 A;  3OB2 B;  1B4C A;  3DVJ A;  1BMO A;  3MSE B;  2B1U A;  1CM1 A;  1SKT A;  3SG7 A;  1ODB A;  4BY4 A;  1MR8 A;  1XFZ O;  2MJW B;  1NPQ A;  1TOP A;  1SCM C;  1F4O A;  1MWN A;  2LLU A;  1BOC A;  1UHI A;  1B8L A;  4FQO A;  1B47 A;  4PAL A;  3NSI A;  2JU0 A;  2GGZ A;  5TNC A;  2KQ6 A;  1UHH A;  3WHT B;  4CFQ A;  2BE6 A;  3CR4 X;  4N1F A;  3GK4 X;  1OZS A;  3HCM A;  5CSJ A;  4M2O A;  5DKR A;  3F45 A;  4DS7 A;  1JWD A;  1DTL A;  2LHI A;  2NZ0 A;  5FYX A;  1L2O C;  2L2E A;  3BYA A;  5CPV A;  1K8U A;  1KFX S;  1S6C A;  1U5I B;  1PSB A;  3OB1 B;  1YUT A;  4I5K A;  3RLZ A;  1A75 A;  3LLE A;  4XYN A;  1JSA A;  1TRF A;  1IJ5 A;  2KI6 C;  3KO0 A;  5D69 A;  4MVF A;  1KQV A;  1J1E A;  1RTP 1;  2Q91 A;  3EVR A;  1CDN A;  1XFV O;  4BY5 A;  2KI4 C;  1CM4 A;  1WY9 A;  3CR5 X;  3JVT C;  3VRO A;  3O78 A;  1SYM A;  1UHK A;  1SMG A;  3SG4 A;  1SCM B;  2F3Y A;  3CS1 A;  2CTN A;  1YR5 A;  3LK0 A;  1WRZ A;  2KGB C;  1CFF A;  1AJ4 A;  2P6B B;  2LV7 A;  2K7B A;  4MBE A;  2F8P A;  5ER4 X;  2CBL A;  2Y1M A;  4QJ3 B;  5IBW A;  1G4Y R;  2EGD A;  3SG3 A;  2K7C A;  1YTZ C;  1B8R A;  4IL1 A;  1UHN A;  4GGN A;  3CZT X;  1DJX A;  1AUI B;  3TS5 C;  1K2H A;  2JUL A;  2Y4Q A;  4L9M A;  1SPY A;  1NX0 A;  1R2U A;  4AQJ A;  1XFX O;  1RJV A;  1WLZ A;  1OOJ A;  3TDI A;  1BT6 A;  2MLE C;  1S6I A;  3OHM B;  2M9G A;  4DCK A;  2BL0 C;  1C7V A;  1RWY A;  1XA5 A;  4WQ2 A;  2KI4 B;  3JVT B;  3FS7 A;  1XO5 A;  3O2P A;  1XFU O;  2EC6 B;  1M63 B;  1DJY A;  1FBV A;  4WRI A;  1BG1 A;  5CSN A;  1BU3 A;  1DJH A;  2CNP A;  3PN7 C;  1QX5 B;  2I7A A;  3BUW B;  1IRJ A;  1EG4 A;  1CDM A;  1S5G Z;  2D8N A;  3BOW A;  5DKQ A;  1VRK A;  1QAS A;  1CDL A;  1C7W A;  1NX2 A;  3BUO B;  3LL8 B;  3NSO A;  1NX1 A;  1DT7 B;  2KYC A;  1B1G A;  1TTX A;  2JWW A;  1F54 A;  2KBM A;  2MAZ A;  1DF0 B;  1PVA A;  4CID A;  4MRY A;  1TNQ A;  2HF5 A;  1QXP A;  2JTT A;  2MBX A;  4HRH A;  4DUQ A;  5KTY A;  2M3W A;  1ALW A;  1QLK A;  2BL0 B;  1W7I B;  2HQW A;  1OSA A;  2AAO A;  4HRG A;  4A4B A;  3KEV A;  2JT8 A;  4N1G A;  1GQM A;  2LMU A;  2M7N A;  1Y1X A;  2AMI A;  4ETO A;  1PSR A;  3PLF B;  3I5H C;  2HQ8 A;  1XK4 A;  2LC5 A;  1MF8 B;  4AOM A;  1K94 A;  3PN7 B;  1CFC A;  3WHU B;  2ZRT A;  1K90 D;  2ZRS A;  4YBH B;  2MRD A;  5I2L A;  1F70 A;  3KHE A;  1ZFS A;  2PRU A;  1JF0 A;  1M31 A;  1NCX A;  3ZNI A;  5K89 A;  2KQY A;  2LP3 A;  3DD4 A;  2LP2 A;  4XJK B;  2M1U A;  1V1F A;  3AKB A;  4I5N B;  3NSL A;  3KPX A;  1KFU L;  1PRW A;  3RM1 A;  3CTN A;  4WQ3 A;  1IJ6 A;  2OPO A;  1DJW A;  2L4I A;  2ZND A;  4C0L A;  1MHO A;  2BKH B;  4A4C A;  2M97 A;  3I5F C;  1WRK A;  1UP5 A;  4MRX A;  2I94 A;  4ZCV A;  2FCE A;  1CLB A;  2H61 A;  2Y1N A;  3CR2 A;  1RRO A;  3SIB A;  5KSZ A;  3I5H B;  1AJ5 A;  1TCF A;  2WOS A;  4GGF C;  1CLM A;  1EG3 A;  5HKW A;  2JXL A;  2M1K B;  1AP4 A;  4TNC A;  1SCV A;  3DF0 B;  1LVC D;  1SR6 C;  2JNF A;  2L5X B;  2MA2 A;  4MZJ A;  1YUU A;  2TN4 A;  1AK8 A;  1OMV A;  4GUK A;  5HLV A;  1IQ5 A;  1QX2 A;  4YGC B;  3FWC A;  1SL9 A;  2LAP A;  1NUB A;  2COL B;  2Y5I A;  3FWB A;  1REC A;  1S26 D;  1XVJ A;  2LE9 B;  5HKZ A;  3DVE A;  4OVN F;  1N0Y A;  2LVV A;  1FW4 A;  1QV0 A;  2SAS A;  4JWQ A;  4M2P A;  2LNK A;  1IKU A;  1N65 A;  2KOT A;  1JF2 A;  4HSZ A;  1EXR A;  1OZO A;  1XFY O;  3I5F B;  2WND A;  1XYD A;  1ZUZ A;  2LMT A;  2Q4U A;  1OMR A;  3I5I C;  1K93 D;  1PUL A;  2KNE A;  1DVI A;  5G08 A;  1QLS A;  1SBJ A;  2EC6 C;  1WDC C;  2KHN A;  1J7P A;  2BE4 A;  3O4Y A;  2JPT A;  2JXC A;  1DJG A;  1M45 A;  2LLS A;  2BBM A;  1B7T Y;  1SR6 B;  3SG5 A;  5I2Q A;  1IG5 A;  3M0W A;  1Q80 A;  2E30 A;  5ER5 A;  2ISD A;  1IH0 A;  2KYF A;  2H2K A;  3A4U B;  1B7T Z;  2PVB A;  2M49 B;  3BUX B;  3CWG A;  2JT0 A;  2CXJ A;  3EK4 A;  4GAO A;  4YGB B;  1JUO A;  1GJY A;  1WRL A;  1E8A A;  1UUR A;  4PHN A;  1ALV A;  4GNK B;  2QPT A;  1CMF A;  2CT9 A;  1S5G Y;  4YI9 A;  3GK1 A;  3PAT A;  3I5I B;  2BCA A;  5PAL A;  1QVI Y;  1TN4 A;  1WDC B;  1J1D A;  3BUN B;  4QJ4 B;  5CSI A;  2OTG C;  2LCP A;  2G9B A;  2JOJ A;  1CTR A;  4ZCU A;  2LLT A;  1TNW A;  2HPS A;  1NYA A;  3AAJ A;  4OV2 A;  1G33 A;  2E6W A;  1J7O A;  2KDH A;  1QVI Z;  2LHL A;  2CCM A;  1F4Q A;  2M7L A;  1K96 A;  1YUS A;  2FOT A;  5J3X A;  1TCO B;  4N5X A;  3VRR A;  4PDZ A;  4R1E A;  3VRQ A;  3CGA A;  3K21 A;  2LM5 A;  3DVK A;  2K7D A;  2LUC A;  5F6T A;  2MLF C;  3TUY C;  1NSH A;  1R6P A;  1W7J B;  4MEW A;  4XJK A;  3D0Y A;  1GGW A;  1CFD A;  2NCO A;  2EHB A;  4NQG A;  2WCF A;  2SCP A;  2K7O A;  3H4S E;  4OKH A;  4PE1 A;  2FJU B;  4MZL A;  1SNL A;  4D1E A;  2FCD A;  4CPV A;  2NCP A;  1YVL A;  2OTG B;  2JC2 A;  1XFW O;  3SIA A;  5B8I B;  1MUX A;  2PAS A;  1ZAC A;  3PSR A;  3HX4 A;  2ZKM X;  1HT9 A;  3ICB A;  4F0Z B;  1S3P A;  2BBN A;  4MSP A;  2M8U A;  2BEC A;  2KBI A;  1QX7 A;  2WOR A;  3A8R A;  3I5G B;  1QIV A;  2JNX A;  4YI8 A;  4OCI A;  5D7F A;  1S36 A;  3QRX A;  2F33 A;  3EVU A;  3IF7 A;  4PHK A;  1BF5 A;  3BOW B;  3BXK A;  3EKH A;  5HYD A;  1MXE A;  3FIA A;  3TUY B;  1M46 A;  1RK9 A;  4MZK A;  1KFU S;  1WLM A;  4YGD B;  5KU1 A;  1SL7 A;  1F71 A;  2K8M B;  4CLN A;  1NCY A;  2O60 A;  1U5I A;  3OX5 A;  1C07 A;  2AUC A;  1AVS A;  1YVH A;  2QAC A;  3DVM A;  1DJZ A;  3LCP C;  4PHJ A;  3AKA A;  5BPJ A;  1A03 A;  2KAX A;  4GBA A;  2DOQ A;  1BOD A;  1SL8 A;  1H4B A;  1B9A A;  2VRG A;  5CSF A;  1YX8 A;  1Y6W A;  2LMV A;  1PAL A;  3PFV A;  1H8B A;  2BKI B;  1KWO C;  3PM8 A;  2LVK A;  3JTD B;  4GGF A;  1OQP A;  2HET A;  1QAT A;  2GGM A;  2G2B A;  4U8D A;  2OS8 C;  4ORC B;  1B8C A;  1QIW A;  5GQQ C;  1F55 A;  4P5O E;  2M0R A;  3VGO A;  3WNX B;  4HRE E;  2M29 A;  1JFK A;  5AAN A;  1D1O A;  5HLO A;  2WC8 A;  1EL4 A;  1Y0V H;  1A29 A;  2V53 A;  5JOL A;  1JC2 A;  2ZN9 A;  1LIN A;  2LVI A;  4PE7 A;  4YRU A;  2K2A A;  1SRA A;  1FPW A;  1S1E A;  1DMO A;  1L7Z A;  2PMY A;  5JJG A;  1MXL C;  1KFX L;  1CFP A;  3KF9 A;  4NDD A;  4DIR A;  4USL A;  1CMG A;  1K9P A;  1KWO B;  2KI6 D;  3E3R A;  3TDU A;  1JFJ A;  1TNP A;  2ZNE A;  2NLN A;  3EK7 A;  5DKN A;  2KFG A;  1Y1A A;  2OS8 B;  4PCW A;  1EJ3 A;  4MLW A;  1LKJ A;  1UUS A;  1YRU B;  1SK6 D;  4ORA B;  1YRT B;  1QS7 A;  3WXA A;  1NX3 A;  1LA3 A;  1EH2 A;  2JT3 A;  1OMD A;  4GFT A;  1A4P A;  1JBA A;  1KQM C;  1DGV A;  2K61 A;  1A2X A;  3SG6 A;  1N2D A;  2ZN8 A;  3AAK A;  4DRW A;  4CFR A;  1DF0 A;  1DJI A;  1QTX A;  4GPL B;  4I5L B;  2IS9 A;  4NDC A;  1Y1U A;  1IWQ A;  1NWD A;  1F8H A;  1FF1 A;  4PE4 A;  5AEQ A;  1J55 A;  1FI5 A;  1A75 B;  1LXF C;  4NDB A;  1K9K A;  2LUX A;  3NXA A;  1X02 A;  2MHH A;  1YX7 A;  3GOF A;  1AHR A;  1L2O B;  1TIZ A;  3GK2 A;  4JPZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...