1AK8A

Nmr solution structure of cerium-loaded calmodulin amino-terminal domain (ce2-tr1c), 23 structures
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
76
Chain Sequence
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords CALMODULIN
publication title Solution structure of the paramagnetic complex of the N-terminal domain of calmodulin with two Ce3+ ions by 1H NMR.
pubmed doi rcsb
source organism Bos taurus
total genus 13
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1997-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ak8A00
4ORAB 1WY9A 1IRJA 2JULA 3CS1A 1X02A 1SL9A 4I5JA 3AKAA 1HQVA 5TNCA 3QRXA 1KSOA 2M7NA 1JWDA 1SL7A 1ALWA 1QASA 1QX7A 1AJ4A 1B7TY 5ER4X 3WHUB 5J3XA 4R1EA 2K7OA 2GGMA 4D1EA 2LLUA 3KPXA 1SNLA 2CT9A 1XA5A 2O5GA 4C0LA 4A4CA 2K2AA 3MSEB 3K21A 1CFFA 5CSNA 1XO5A 3E3RA 2EHBA 3CR2A 2KOTA 2BECA 4YGAA 2OS8C 1QLSA 1XK4A 1BMOA 3BUWB 1CKKA 1J55A 1IG5A 1KQMC 1QVIZ 2KNEA 1CFCA 1M31A 1A2XA 1DJIA 4MEWA 1RTP1 3OX6A 2PSRA 2BCXA 4NDDA 2NCOA 5JJGA 1DGUA 1BR1B 1DTLA 1SR6C 1TNPA 2GGZA 2KSPA 3D0YB 3GK2A 3LK1A 3RM1A 1Y0VH 1PULA 4HRGA 4GUKA 4DCKA 2L0PA 2VRGA 1UHHA 2M0RA 2KAXA 1AJ5A 1Y1UA 1G4YR 1PVAA 1ZMZA 4QJ4B 2KGRA 1OQPA 3TUYC 1SL8A 1SK6D 2LC5A 1XK4C 1C7WA 4C0KA 3PN7C 3TS5C 1FW4A 1DF0A 3DVKA 2F8PA 3EK7A 4OCIA 3FS7A 1JC2A 2KAVA 1W7IB 2KGBC 2KQ6A 1K9PA 1R2UA 1XFXO 1RFJA 2JXLA 2QPTA 2PASA 5JOLA 3VRNA 3OHMB 2E30A 1S26D 2M9GA 1DJZA 1AP4A 2KYCA 3PLFB 1NCXA 2WCEA 2LVJA 4ORBB 2LP3A 2ZNEA 4YGBB 4GPLB 5HLOA 1IJ5A 4YGDB 5I2LA 4PALA 5AFPA 1BR4B 1L2OC 1BF5A 1JF2A 3FWBA 4N5XA 1QX2A 3NXAA 2L98A 1K9UA 1NWDA 1XFVO 1F54A 1KK8C 2RGIA 1BOCA 3KEVA 3DF0A 3OP0A 1YURA 3PFVA 4PHKA 1NP8A 5CSIA 4WRIA 1BLQA 2BL0C 2K7DA 3GK4X 2E6WA 4MZKA 2NZ0A 1IH0A 3SG5A 4GGFA 3CLNA 1DJYA 3NSIA 1NUBA 4F0ZB 3KF9A 1WRLA 1NX3A 3IQQA 2G2BA 3FWCA 5D7FA 3EVUA 1ZUZA 1ZACA 2LHLA 1SKTA 4PE0A 2LP2A 2K7CA 1SPYA 3ICBA 1LA3A 2BCAA 4GNKB 3SG2A 1AK8A 2JQ6A 2AUCA 3A4UB 2WOSA 1S5GZ 4OR9B 1WDCB 1TCOB 2KAYA 2BBNA 1ODBA 5HLVA 2WORA 4P5OE 2MLEC 2MAZA 4MBEA 2K2FA 3NSKA 3SIBA 1BODA 1S6CA 4USLA 2SCPA 4ZCVA 4MRYA 1SRAA 1DF0B 4NDBA 4GGFC 2WNDA 2BL0B 1B7TZ 2SASA 4L9MA 1Y1XA 3A8RA 1M45A 5AERA 1W7JB 3EVRA 3D10A 3PATA 1KWOB 1B47A 1KSMA 1NSHA 3CWGA 1K90D 2K0JA 1F4OA 4GGNA 1NPQA 2MJWB 1RJVA 1OE9B 1K8UA 1FI5A 2F3YA 2JU0A 3SG4A 1KK7Z 3ZWHA 1TNXA 1GQMA 2JZIA 1JUOA 2M8UA 2OTGB 5K89A 5DKQA 1CLLA 1QLKA 1CFDA 1F4QA 1OSAA 2ZNDA 1IQ3A 2JT0A 3DF0B 1N0YA 2LV7A 5ER5A 1RWYA 1CB1A 4QJ3B 3AAJA 1YRTB 1B4CA 4QJ5B 1JBAA 1DJWA 3SG6A 2M1UA 2PVBA 2CTNA 1Q80A 2LMVA 1CLBA 1PSRA 4WQ2A 1TOPA 2KQYA 2LVVA 1KCYA 4CIDA 2F2OA 1BG1A 1MQ1A 2LCPA 2ZRTA 2ZKMX 1TIZA 1SCMC 4WQ3A 1FPWA 1QIWA 1A75A 1OMRA 1CDLA 1H8BA 1YRUB 2HPSA 4YGEB 4PHNA 5KU1A 4P2YB 2EC6B 4MSPA 3SG7A 2ZRSA 1EL4A 2Q91A 4CLNA 3TDZA 1V1FA 1PSBA 1OMDA 2M1KB 4CPVA 3DVMA 3BUNB 2KFGA 1WLZA 1CNPA 2ZN9A 1C07A 2LVKA 4I5KA 3H4SE 4MZJA 4FTGA 4ICBA 1KQVA 3JTDC 2MHHA 5CPVA 1SBJA 2DOQA 1KFXL 2L4HA 2I7AA 1LA0A 2L2EA 1QVIY 3KHEA 4M2QA 4YI9A 1DGVA 2JT3A 3VGOA 3TDIA 1IGVA 3I5IB 1CMFA 1YUSA 3I5GB 4BY5A 1Y6WA 4PCWA 2BCBA 2BKIB 3M0WA 4GAOA 1SCMB 1RK9A 1BJFA 1GJYA 3F45A 4Q04A 1UURA 1D1OA 1WDCC 2KI6C 4YGCB 3HX4A 1B1GA 1PRWA 2JXCA 2KBIA 4N1FA 1QATA 1F71A 4HREE 1J7PA 2L4IA 5AANA 2V53A 4I5LB 1PALA 1S36A 4AQIA 3CTNA 1K2HA 4NQGA 1TNQA 3CR5X 4JQ0D 1IQ5A 2HQ8A 3RLZA 3SJSA 5HKYA 2FOTA 2JT8A 2ISDA 1MUXA 1B9AA 4CFRA 2LM5A 1QX5B 2Q4UA 1F55A 3JTDB 2JC2A 5CSJA 2I2RE 1NX1A 2CBLA 2R2IA 1KWOC 1M39A 3BUXB 3BXKA 2LAPA 1VRKA 3JVTB 4FQOA 1FF1A 1KFXS 2M97A 1A29A 1Y1AA 2JOJA 2H2KA 2HF5A 1A75B 2LMTA 3GOFA 3LK0A 4PHJA 1MXEA 1JF0A 4UPGA 3PSRA 3O78A 2KI4B 2OTGC 1XFYO 5HKZA 2QACA 4N1GA 1EG3A 4AQJA 5KTYA 1WRKA 4MRXA 1QTXA 4BY4A 1SCVA 1QV0A 1YX7A 2KDHA 2M3WA 3AKBA 1MWNA 1DJXA 2JNFA 2CNPA 3I5HB 5CSFA 1YVHA 3BOWA 1G33A 5AEQA 4ORCB 2G9BA 3VRQA 1WLMA 1EH2A 1PK0D 1AHRA 1SMGA 1J7QA 1LINA 2BE6A 2F2PA 2I18A 3DD4A 4AOMA 3SIAA 1UHNA 2F33A 3VROA 4GBAA 2JWWA 4M2OA 1NX2A 2M29A 2COLB 4PDZA 1QIVA 3TDUA 1FI6A 2NLNA 3BQ3A 2MRDA 1J1DA 1QXPA 4MVFA 2KFHA 4PE7A 2EC6C 3LLEA 4PE1A 1TRFA 3AAKA 2MBXA 1S5GY 2KI6D 3BYAA 2LVIA 2KYFA 1SW8A 2WCFA 3KO0A 4I5NB 1FBVA 1K96A 3DVEA 1H4BA 4PHMA 3NSLA 5G08A 2KBMA 1ZFSA 2I94A 3OX5A 1CM4A 2H61A 1N65A 1IWQA 2Y4QA 4DS7A 3I5FB 1WRZA 2LUXA 3WHTB 1CM1A 3I5IC 3I5GC 2AAOA 1ZOTB 4XYNA 3WXAA 4YI8A 3IF7A 1KFUL 1UHIA 5AXIA 1B8LA 2B1UA 1TCFA 4E68A 1C7VA 1UP5A 3LCPC 3CZTX 2K7BA 1RECA 2FCEA 1J7OA 1QS7A 3C1VA 5IBWA 1R6PA 1KK7Y 1LVCD 5BPJA 3EK8A 2JTTA 1CMGA 1YUUA 3O2PA 1DT7B 4XJKA 1B8RA 1U5IA 3VRRA 2JTZA 4XJKB 1DMOA 2EGDA 1TTXA 4JPZB 1DVIA 2JPTA 2H61C 1GGWA 2JNXA 1SYMA 2NXQA 1YR5A 1TNWA 4HSZA 2WC8A 1LKJA 3BOWB 2MA2A 2LNKA 1BU3A 1E8AA 2PALA 1DJGA 5FYXA 2K61A 2CXJA 5HYDA 1K95A 1F8HA 1GGZA 3EK4A 2BKHB 3JVTC 2BBMA 2FJUB 2O60A 1IKUA 4MN0A 4U8DA 1XFWO 1RROA 1J7RA 2WCBA 3IQOA 2Y1NA 1YX8A 5DKRA 2KI4C 2LE9B 1M46A 3GK1A 4DUQA 1JSAA 1KFUS 2CCMA 1UHJA 5KSZA 5F6TA 5GQQC 4ZCUA 4HRHA 4IL1A 1A4PA 4DRWA 4YRUA 1UUSA 1DJHA 1MF8B 2PRUA 1NIWA 4YBHB 2LUCA 2KHNA 2KFFA 2LMUA 2OS8B 2L51A 3I5HC 4CFQA 1NCZA 1CDPA 3SG3A 1MR8A 1JFJA 5DKNA 3BUOB 1S1EA 1NCYA 1KQMB 1OMVA 1S6IA 2GV5A 2IS9A 3FIAA 4GFTA 1M63B 2PMYA 3TS5B 2D8NA 1OOJA 3ZNIA 2HQWA 2LLSA 1V1GA 1SR6B 1SY9A 3O4YA 4PE4A 4DIRA 2ZFDA 1CDNA 4MZLA 4OV2A 1NX0A 1F70A 1EG4A 5HKWA 1PVBA 1G8IA 2K8MB 3O6BA 1QV1A 1MHOA 2M7LA 2F3ZA 1AUIB 2AMIA 1LXFC 1S6JA 4NDCA 4MLWA 4JWQA 2MLFC 1TN4A 3TUYB 1U5IB 1YVLA 1JFKA 1NYAA 3OB2B 1EXRA 2A4JA 2BE4A 2L50A 3CGAA 2M49B 1MXLC 1QJTA 3CR4X 1OZOA 1IJ6A 3EKJA 1BT6A 2NCPA 2TN4A 1J1EA 3PN7B 1YTZC 2P6BB 3HCMA 4C0JA 2Y5IA 2Y1MA 4OKHA 2LANA 3DVJA 3EKHA 3TZ1A 5I8NA 3I5FC 1CFPA 3PM8A 2LHIA 1K93D 1XFUO 1CDMA 3LL8B 1CLMA 2HETA 1A03A 3D0YA 4ETOA 3EVVA 1L7ZA 1XVJA 1XYDA 1N2DA 2ZN8A 3VRPA 1HT9A 1UHKA 3OB1B 2JRFA 1CTRA 1AVSA 5PALA 3WNXB 5I2OA 1EJ3A 1K9KA 2OPOA 1L2OB 3PALA 5B8IB 1UWOA 3NSOA 1XFZO 1ALVA 1YUTA 2L5XB 1K94A 5I2QA 4TNCA 1KK8B 1B8CA 4A4BA 2FCDA 1S3PA 4OVNF 3BUMB 1OZSA 2LLTA 4M2PA 5D69A
chains in the Genus database with same CATH superfamily
4ORAB 1WY9A 3S0FA 1IRJA 2JULA 5FI6A 3CS1A 1X02A 1SL9A 4I5JA 2WCMA 3AKAA 1HQVA 5TNCA 3QRXA 3OGNA 1KSOA 2M7NA 1JWDA 1SL7A 1ALWA 1T14A 1QASA 1QX7A 1AJ4A 1B7TY 5ER4X 3WHUB 2QDIA 4R1EA 5J3XA 2K7OA 2GGMA 4D1EA 3Q8IA 2LLUA 3DXLA 3KPXA 1SNLA 2CT9A 1XA5A 2O5GA 4C0LA 4A4CA 2K2AA 3MSEB 3K21A 1CFFA 5CSNA 1XO5A 3E3RA 2EHBA 3CR2A 2KOTA 2BECA 4YGAA 5I94A 2OS8C 1QLSA 3CYZA 1XK4A 1BMOA 3BUWB 1CKKA 1J55A 1IG5A 3UNWA 1KQMC 1QVIZ 2KNEA 1CFCA 1M31A 1A2XA 1DJIA 4MEWA 1RTP1 1DC1A 3OX6A 2PSRA 2BCXA 3FE9A 4NDDA 2NCOA 5JJGA 1DGUA 1BR1B 1DTLA 1SR6C 1TNPA 2GGZA 2KSPA 3D0YB 3GK2A 3LK1A 3RM1A 1Y0VH 1PULA 4HRGA 4GUKA 4DCKA 2L0PA 2VRGA 1UHHA 2M0RA 2KAXA 1AJ5A 1Y1UA 3NHTA 1G4YR 1PVAA 1ZMZA 4QJ4B 1TWOA 2KGRA 1OQPA 3TUYC 1SL8A 1SK6D 2LC5A 1XK4C 1C7WA 4C0KA 3PN7C 3TS5C 1XFRA 1FW4A 1DF0A 4F7FA 3DVKA 2F8PA 3EK7A 4OCIA 3FS7A 1JC2A 2KAVA 2WCLA 1W7IB 2KGBC 2KQ6A 1K9PA 1R2UA 1XFXO 1RFJA 2JXLA 2QPTA 2PASA 5JOLA 3VRNA 3OHMB 2E30A 5DICA 1S26D 2M9GA 1DJZA 1AP4A 1OW4A 2KYCA 3PLFB 1NCXA 2WCEA 2LVJA 4ORBB 2LP3A 2ZNEA 4YGBB 4GPLB 5HLOA 1IJ5A 4YGDB 5I2LA 3IVTA 4PALA 1BR4B 1L2OC 5AFPA 1BF5A 1JF2A 3FWBA 4N5XA 1QX2A 3R1VA 3NXAA 2L98A 1K9UA 1NWDA 1XFVO 1F54A 1KK8C 2RGIA 1BOCA 3KEVA 2PYQA 3DF0A 1YURA 3OP0A 3PFVA 4PHKA 3DYEA 1NP8A 5CSIA 4WRIA 1BLQA 2BL0C 2K7DA 3GK4X 2FJYA 2E6WA 4MZKA 2NZ0A 1IH0A 3SG5A 4GGFA 3CLNA 1DJYA 3NSIA 1NUBA 4F0ZB 3KF9A 1WRLA 1NX3A 3IQQA 2G2BA 3FWCA 2QEVA 5D7FA 3EVUA 1ZUZA 1ZACA 2LHLA 1SKTA 4PE0A 2LP2A 2K7CA 1SPYA 3ICBA 1LA3A 2BCAA 4GNKB 3SG2A 1AK8A 2JQ6A 2AUCA 3A4UB 2WOSA 1S5GZ 4OR9B 1WDCB 1TCOB 2KAYA 2BBNA 1ODBA 3D78A 3S0EA 5HLVA 2WORA 4P5OE 2MLEC 1W9ZA 2MAZA 4MBEA 2K2FA 3NSKA 3SIBA 1BODA 3S0GA 1S6CA 4USLA 2SCPA 4ZCVA 4MRYA 1SRAA 1DF0B 4NDBA 4GGFC 2WNDA 2BL0B 1B7TZ 2SASA 4L9MA 3RZSA 1Y1XA 3A8RA 1M45A 3BFAA 5AERA 1W7JB 1IIOA 3EVRA 3D10A 3PATA 1KWOB 1B47A 1KSMA 1NSHA 3CWGA 1K90D 2K0JA 1F4OA 4GGNA 1NPQA 2MJWB 1RJVA 1C3YA 1OE9B 3CDNA 1K8UA 3CZ2A 1FI5A 2F3YA 2JU0A 3SG4A 1KK7Z 3ZWHA 1TNXA 1GQMA 3BFHA 2JZIA 1JUOA 2M8UA 3S0DA 3UO9A 2OTGB 5K89A 5DKQA 1CLLA 1QLKA 1CFDA 1F4QA 1OSAA 2ZNDA 1IQ3A 2JT0A 1GM0A 3DF0B 2ERBA 1N0YA 2LV7A 5ER5A 1RWYA 1CB1A 4QJ3B 3AAJA 1YRTB 1B4CA 4QJ5B 1JBAA 1DJWA 3SG6A 2KLDA 2M1UA 2P70A 2CTNA 2PVBA 1Q80A 2LMVA 1CLBA 1PSRA 4WQ2A 1TOPA 2BNXA 2KQYA 2LVVA 1KCYA 4CIDA 1Z2CB 2F2OA 1BG1A 1MQ1A 2LCPA 2ZRTA 2ZKMX 3K1EA 2P71A 5FI7A 2WC6A 2L5YA 3B87A 1TIZA 1SCMC 4WQ3A 1FPWA 1QIWA 3CZ1A 1A75A 1OMRA 1CDLA 1H8BA 1YRUB 2HPSA 4YGEB 4PHNA 5KU1A 4P2YB 3R1OA 2EC6B 4MSPA 3SG7A 3SS3A 2ZRSA 2L2CA 1EL4A 2Q91A 3L4AA 4CLNA 3TDZA 1TUJA 1V1FA 1PSBA 1OMDA 2M1KB 4CPVA 3D73A 3DVMA 3BUNB 2KFGA 1WLZA 1CNPA 2ZN9A 1C07A 1LS8A 2LVKA 4I5KA 3H4SE 3S0AA 4MZJA 4FTGA 4ICBA 1KQVA 3JTDC 3O4XA 2MHHA 5CPVA 1SBJA 2DOQA 1KFXL 2L4HA 2I7AA 1LA0A 2L2EA 1QVIY 3KHEA 4M2QA 4YI9A 1DGVA 2JT3A 3VGOA 3TDIA 1IGVA 3I5IB 1CMFA 1YUSA 3I5GB 4BY5A 1Y6WA 4PCWA 2BCBA 2BKIB 3M0WA 1OOGA 4GAOA 1SCMB 1RK9A 1BJFA 2K60A 1GJYA 3F45A 4Q04A 1UURA 1D1OA 1WDCC 2KI6C 4YGCB 3HX4A 1B1GA 1PRWA 2JXCA 2KBIA 3DY9A 4N1FA 1QATA 1F71A 4HREE 3PM2A 2L4IA 5AANA 1C3ZA 2V53A 3B6XA 1PALA 4I5LB 1J7PA 1S36A 4AQIA 3CTNA 1K2HA 4NQGA 1TNQA 3CR5X 4JQ0D 3SS4A 1IQ5A 1TUZA 2HQ8A 3RLZA 3SJSA 5HKYA 2FOTA 2JT8A 2ISDA 1MUXA 1B9AA 4CFRA 4INWA 2LM5A 1QX5B 2Q4UA 1F55A 3JTDB 2JC2A 5CSJA 2I2RE 3D75A 1NX1A 2CBLA 4PT1A 2R2IA 1KWOC 1M39A 3BUXB 2PQLA 2LAPA 3BXKA 1VRKA 3JVTB 4FQOA 1FF1A 2QEOA 1KFXS 2M97A 1A29A 1Y1AA 2H8VA 2JOJA 2H2KA 2HF5A 1A75B 2LMTA 3GOFA 1Z4HA 3LK0A 4PHJA 1MXEA 1JF0A 4UPGA 3PSRA 3O78A 2KI4B 2OTGC 1XFYO 3B88A 5HKZA 2QACA 4N1GA 3R72A 1EG3A 4AQJA 5KTYA 1WRKA 4MRXA 1QTXA 4BY4A 1SCVA 1QV0A 1YX7A 2KDHA 2M3WA 3AKBA 4JD9A 1OOFA 1MWNA 1QWVA 1DJXA 2JNFA 2CNPA 3I5HB 3N7HA 1YVHA 3BOWA 1G33A 3CZ0A 3R1PA 5CSFA 5AEQA 4ORCB 2G9BA 3VRQA 1WLMA 4OZDA 1EH2A 1PK0D 1AHRA 3EG5B 1SMGA 3QMEA 1J7QA 1LINA 2BE6A 2F2PA 2I18A 3DD4A 4AOMA 3SIAA 1UHNA 2F33A 3VROA 4GBAA 3VB1A 3B7AA 2JWWA 4M2OA 1NX2A 2M29A 2COLB 4PDZA 1QIVA 3TDUA 1FI6A 2NLNA 3BQ3A 3V2LA 2MRDA 1J1DA 1QXPA 4MVFA 2KFHA 3BFBA 2EC6C 3LLEA 4PE7A 4PE1A 1TRFA 3AAKA 4JKTA 2MBXA 5FI2A 3CABA 1S5GY 2KI6D 3BYAA 2LVIA 2KYFA 1SW8A 2WCFA 1DQEA 3KO0A 4I5NB 1FBVA 1K96A 3DVEA 1H4BA 3OBVA 4PHMA 3NSLA 5G08A 2KBMA 1ZFSA 2I94A 4KYNA 3OX5A 1CM4A 2H61A 2WCKA 1N65A 1IWQA 2Y4QA 3DZTA 4DS7A 3I5FB 3PN7B 1WRZA 2LUXA 3B86A 3WHTB 1CM1A 3I5IC 3NGVA 3I5GC 3NHIA 2AAOA 1ZOTB 3D74A 4XYNA 3WXAA 4YI8A 3SS5A 3IF7A 5D3OA 1KFUL 1UHIA 5AXIA 1B8LA 2B1UA 1TCFA 5HL1A 4E68A 1C7VA 1UP5A 3D77A 3LCPC 3CZTX 2K7BA 1RECA 2FCEA 1J7OA 1QS7A 3C1VA 5IBWA 1R6PA 1KK7Y 1LVCD 5BPJA 3EK8A 2JTTA 2WC5A 1YUUA 1CMGA 3O2PA 1DT7B 4XJKA 1B8RA 1U5IA 3VRRA 2JTZA 4XJKB 1DMOA 2EGDA 1TTXA 4JPZB 1DVIA 2JPTA 2KPHA 2H61C 1GGWA 2JNXA 1SYMA 2NXQA 1YR5A 1P28A 1TNWA 4HSZA 2WC8A 1LKJA 3BOWB 2MA2A 4IJ7A 2LNKA 1BU3A 1E8AA 2GTEA 2PALA 1DJGA 5FYXA 2K61A 2CXJA 5HYDA 1K95A 1F8HA 1GGZA 3EK4A 2BKHB 3FE6A 3JVTC 2BBMA 2FJUB 3D76A 3S0BA 2O60A 1IKUA 4MN0A 4U8DA 1XFWO 1RROA 1J7RA 2WCBA 3IQOA 2Y1NA 1YX8A 5DKRA 2KI4C 2LE9B 1M46A 3GK1A 4DUQA 1JSAA 1KFUS 2CCMA 1UHJA 5KSZA 5F6TA 5GQQC 1DEKA 4ZCUA 4HRHA 4IL1A 1A4PA 4DRWA 4YRUA 1UUSA 1DJHA 1MF8B 2PRUA 1NIWA 4FQTA 4YBHB 2LUCA 2KHNA 2KFFA 2LMUA 2OS8B 2L51A 3I5HC 4CFQA 4INXA 1NCZA 1CDPA 2QEBA 1MR8A 3SG3A 1JFJA 5DKNA 2JPOA 1S1EA 1NCYA 1KQMB 1OMVA 1S6IA 2GV5A 2IS9A 3BUOB 3FIAA 4GFTA 1M63B 2PMYA 3TS5B 2D8NA 1OOJA 2KLEA 3L4LA 1ORGA 2HQWA 3ZNIA 2LLSA 2BAPA 1V1GA 1SR6B 1SY9A 3O4YA 4PE4A 4DIRA 2ZFDA 1CDNA 4MZLA 4OV2A 1NX0A 1F70A 1EG4A 5HKWA 3BJHA 1PVBA 1G8IA 2K8MB 3O6BA 1QV1A 1MHOA 2M7LA 2F3ZA 1AUIB 2AMIA 1LXFC 1S6JA 4NDCA 4MLWA 2WCHA 4JWQA 2MLFC 1TN4A 3TUYB 1U5IB 1YVLA 1JFKA 1NYAA 3OB2B 1EXRA 2A4JA 2BE4A 2L50A 3CGAA 1OOHA 1MXLC 1QJTA 2M49B 1OZOA 1IJ6A 3CR4X 1BT6A 2NCPA 2TN4A 1J1EA 3EKJA 1YTZC 2P6BB 3HCMA 3PJIA 4C0JA 2Y5IA 1OOIX 2Y1MA 4OKHA 2LANA 2WCJA 3DVJA 3EKHA 3TZ1A 5I8NA 3I5FC 1CFPA 3PM8A 2LHIA 1K93D 1XFUO 1CDMA 3LL8B 1CLMA 2HETA 1A03A 3D0YA 4ETOA 3EVVA 1L7ZA 1XVJA 1XYDA 1N2DA 2ZN8A 3VRPA 1HT9A 1UHKA 3OB1B 2JRFA 1CTRA 1AVSA 2QEHA 5PALA 3WNXB 5I2OA 1EJ3A 1K9KA 2OPOA 1L2OB 1DELA 3PALA 1UWOA 3NSOA 1XFZO 5B8IB 5EL2A 1ALVA 1YUTA 1SSEB 2L5XB 1K94A 5I2QA 2YGUA 4TNCA 1KK8B 1B8CA 3FE8A 4A4BA 2FCDA 1S3PA 4OVNF 3BUMB 3L47A 1OZSA 2LLTA 4M2PA 5D69A
chains in the Genus database with same CATH topology
4ORAB 1WY9A 1IRJA 2JULA 3CS1A 1X02A 1SL9A 4I5JA 3AKAA 1HQVA 5TNCA 3QRXA 1KSOA 2M7NA 1JWDA 1SL7A 1ALWA 1QASA 1QX7A 1AJ4A 1B7TY 5ER4X 3WHUB 5J3XA 4R1EA 2K7OA 2GGMA 4D1EA 2LLUA 3KPXA 1SNLA 2CT9A 1XA5A 2O5GA 4C0LA 4A4CA 2K2AA 3MSEB 3K21A 1CFFA 5CSNA 1XO5A 3E3RA 2EHBA 3CR2A 2KOTA 2BECA 4YGAA 2OS8C 1QLSA 1XK4A 1BMOA 3BUWB 1CKKA 1J55A 1IG5A 1KQMC 1QVIZ 2KNEA 1CFCA 1M31A 1A2XA 1DJIA 4MEWA 1RTP1 3OX6A 2PSRA 2BCXA 4NDDA 2NCOA 5JJGA 1DGUA 1BR1B 1DTLA 1SR6C 1TNPA 2GGZA 2KSPA 3D0YB 3GK2A 3LK1A 3RM1A 1Y0VH 1PULA 4HRGA 4GUKA 4DCKA 2L0PA 2VRGA 1UHHA 2M0RA 2KAXA 1AJ5A 1Y1UA 1G4YR 1PVAA 1ZMZA 4QJ4B 2KGRA 1OQPA 3TUYC 1SL8A 1SK6D 2LC5A 1XK4C 1C7WA 4C0KA 3PN7C 3TS5C 1FW4A 1DF0A 3DVKA 2F8PA 3EK7A 4OCIA 3FS7A 1JC2A 2KAVA 1W7IB 2KGBC 2KQ6A 1K9PA 1R2UA 1XFXO 1RFJA 2JXLA 2QPTA 2PASA 5JOLA 3VRNA 3OHMB 2E30A 1S26D 2M9GA 1DJZA 1AP4A 2KYCA 3PLFB 1NCXA 2WCEA 2LVJA 4ORBB 2LP3A 2ZNEA 4YGBB 4GPLB 5HLOA 1IJ5A 4YGDB 5I2LA 4PALA 5AFPA 1BR4B 1L2OC 1BF5A 1JF2A 3FWBA 4N5XA 1QX2A 3NXAA 2L98A 1K9UA 1NWDA 1XFVO 1F54A 1KK8C 2RGIA 1BOCA 3KEVA 3DF0A 3OP0A 1YURA 3PFVA 4PHKA 1NP8A 5CSIA 4WRIA 1BLQA 2BL0C 2K7DA 3GK4X 2E6WA 4MZKA 2NZ0A 1IH0A 3SG5A 4GGFA 3CLNA 1DJYA 3NSIA 1NUBA 4F0ZB 3KF9A 1WRLA 1NX3A 3IQQA 2G2BA 3FWCA 5D7FA 3EVUA 1ZUZA 1ZACA 2LHLA 1SKTA 4PE0A 2LP2A 2K7CA 1SPYA 3ICBA 1LA3A 2BCAA 4GNKB 3SG2A 1AK8A 2JQ6A 2AUCA 3A4UB 2WOSA 1S5GZ 4OR9B 1WDCB 1TCOB 2KAYA 2BBNA 1ODBA 5HLVA 2WORA 4P5OE 2MLEC 2MAZA 4MBEA 2K2FA 3NSKA 3SIBA 1BODA 1S6CA 4USLA 2SCPA 4ZCVA 4MRYA 1SRAA 1DF0B 4NDBA 4GGFC 2WNDA 2BL0B 1B7TZ 2SASA 4L9MA 1Y1XA 3A8RA 1M45A 5AERA 1W7JB 3EVRA 3D10A 3PATA 1KWOB 1B47A 1KSMA 1NSHA 3CWGA 1K90D 2K0JA 1F4OA 4GGNA 1NPQA 2MJWB 1RJVA 1OE9B 1K8UA 1FI5A 2F3YA 2JU0A 3SG4A 1KK7Z 3ZWHA 1TNXA 1GQMA 2JZIA 1JUOA 2M8UA 2OTGB 5K89A 5DKQA 1CLLA 1QLKA 1CFDA 1F4QA 1OSAA 2ZNDA 1IQ3A 2JT0A 3DF0B 1N0YA 2LV7A 5ER5A 1RWYA 1CB1A 4QJ3B 3AAJA 1YRTB 1B4CA 4QJ5B 1JBAA 1DJWA 3SG6A 2M1UA 2PVBA 2CTNA 1Q80A 2LMVA 1CLBA 1PSRA 4WQ2A 1TOPA 2KQYA 2LVVA 1KCYA 4CIDA 2F2OA 1BG1A 1MQ1A 2LCPA 2ZRTA 2ZKMX 1TIZA 1SCMC 4WQ3A 1FPWA 1QIWA 1A75A 1OMRA 1CDLA 1H8BA 1YRUB 2HPSA 4YGEB 4PHNA 5KU1A 4P2YB 2EC6B 4MSPA 3SG7A 2ZRSA 1EL4A 2Q91A 4CLNA 3TDZA 1V1FA 1PSBA 1OMDA 2M1KB 4CPVA 3DVMA 3BUNB 2KFGA 1WLZA 1CNPA 2ZN9A 1C07A 2LVKA 4I5KA 3H4SE 4MZJA 4FTGA 4ICBA 1KQVA 3JTDC 2MHHA 5CPVA 1SBJA 2DOQA 1KFXL 2L4HA 2I7AA 1LA0A 2L2EA 1QVIY 3KHEA 4M2QA 4YI9A 1DGVA 2JT3A 3VGOA 3TDIA 1IGVA 3I5IB 1CMFA 1YUSA 3I5GB 4BY5A 1Y6WA 4PCWA 2BCBA 2BKIB 3M0WA 4GAOA 1SCMB 1RK9A 1BJFA 1GJYA 3F45A 4Q04A 1UURA 1D1OA 1WDCC 2KI6C 4YGCB 3HX4A 1B1GA 1PRWA 2JXCA 2KBIA 4N1FA 1QATA 1F71A 4HREE 1J7PA 2L4IA 5AANA 2V53A 4I5LB 1PALA 1S36A 4AQIA 3CTNA 1K2HA 4NQGA 1TNQA 3CR5X 4JQ0D 1IQ5A 2HQ8A 3RLZA 3SJSA 5HKYA 2FOTA 2JT8A 2ISDA 1MUXA 1B9AA 4CFRA 2LM5A 1QX5B 2Q4UA 1F55A 3JTDB 2JC2A 5CSJA 2I2RE 1NX1A 2CBLA 2R2IA 1KWOC 1M39A 3BUXB 3BXKA 2LAPA 1VRKA 3JVTB 4FQOA 1FF1A 1KFXS 2M97A 1A29A 1Y1AA 2JOJA 2H2KA 2HF5A 1A75B 2LMTA 3GOFA 3LK0A 4PHJA 1MXEA 1JF0A 4UPGA 3PSRA 3O78A 2KI4B 2OTGC 1XFYO 5HKZA 2QACA 4N1GA 1EG3A 4AQJA 5KTYA 1WRKA 4MRXA 1QTXA 4BY4A 1SCVA 1QV0A 1YX7A 2KDHA 2M3WA 3AKBA 1MWNA 1DJXA 2JNFA 2CNPA 3I5HB 5CSFA 1YVHA 3BOWA 1G33A 5AEQA 4ORCB 2G9BA 3VRQA 1WLMA 1EH2A 1PK0D 1AHRA 1SMGA 1J7QA 1LINA 2BE6A 2F2PA 2I18A 3DD4A 4AOMA 3SIAA 1UHNA 2F33A 3VROA 4GBAA 2JWWA 4M2OA 1NX2A 2M29A 2COLB 4PDZA 1QIVA 3TDUA 1FI6A 2NLNA 3BQ3A 2MRDA 1J1DA 1QXPA 4MVFA 2KFHA 4PE7A 2EC6C 3LLEA 4PE1A 1TRFA 3AAKA 2MBXA 1S5GY 2KI6D 3BYAA 2LVIA 2KYFA 1SW8A 2WCFA 3KO0A 4I5NB 1FBVA 1K96A 3DVEA 1H4BA 4PHMA 3NSLA 5G08A 2KBMA 1ZFSA 2I94A 3OX5A 1CM4A 2H61A 1N65A 1IWQA 2Y4QA 4DS7A 3I5FB 1WRZA 2LUXA 3WHTB 1CM1A 3I5IC 3I5GC 2AAOA 1ZOTB 4XYNA 3WXAA 4YI8A 3IF7A 1KFUL 1UHIA 5AXIA 1B8LA 2B1UA 1TCFA 4E68A 1C7VA 1UP5A 3LCPC 3CZTX 2K7BA 1RECA 2FCEA 1J7OA 1QS7A 3C1VA 5IBWA 1R6PA 1KK7Y 1LVCD 5BPJA 3EK8A 2JTTA 1CMGA 1YUUA 3O2PA 1DT7B 4XJKA 1B8RA 1U5IA 3VRRA 2JTZA 4XJKB 1DMOA 2EGDA 1TTXA 4JPZB 1DVIA 2JPTA 2H61C 1GGWA 2JNXA 1SYMA 2NXQA 1YR5A 1TNWA 4HSZA 2WC8A 1LKJA 3BOWB 2MA2A 2LNKA 1BU3A 1E8AA 2PALA 1DJGA 5FYXA 2K61A 2CXJA 5HYDA 1K95A 1F8HA 1GGZA 3EK4A 2BKHB 3JVTC 2BBMA 2FJUB 2O60A 1IKUA 4MN0A 4U8DA 1XFWO 1RROA 1J7RA 2WCBA 3IQOA 2Y1NA 1YX8A 5DKRA 2KI4C 2LE9B 1M46A 3GK1A 4DUQA 1JSAA 1KFUS 2CCMA 1UHJA 5KSZA 5F6TA 5GQQC 4ZCUA 4HRHA 4IL1A 1A4PA 4DRWA 4YRUA 1UUSA 1DJHA 1MF8B 2PRUA 1NIWA 4YBHB 2LUCA 2KHNA 2KFFA 2LMUA 2OS8B 2L51A 3I5HC 4CFQA 1NCZA 1CDPA 3SG3A 1MR8A 1JFJA 5DKNA 3BUOB 1S1EA 1NCYA 1KQMB 1OMVA 1S6IA 2GV5A 2IS9A 3FIAA 4GFTA 1M63B 2PMYA 3TS5B 2D8NA 1OOJA 3ZNIA 2HQWA 2LLSA 1V1GA 1SR6B 1SY9A 3O4YA 4PE4A 4DIRA 2ZFDA 1CDNA 4MZLA 4OV2A 1NX0A 1F70A 1EG4A 5HKWA 1PVBA 1G8IA 2K8MB 3O6BA 1QV1A 1MHOA 2M7LA 2F3ZA 1AUIB 2AMIA 1LXFC 1S6JA 4NDCA 4MLWA 4JWQA 2MLFC 1TN4A 3TUYB 1U5IB 1YVLA 1JFKA 1NYAA 3OB2B 1EXRA 2A4JA 2BE4A 2L50A 3CGAA 2M49B 1MXLC 1QJTA 3CR4X 1OZOA 1IJ6A 3EKJA 1BT6A 2NCPA 2TN4A 1J1EA 3PN7B 1YTZC 2P6BB 3HCMA 4C0JA 2Y5IA 2Y1MA 4OKHA 2LANA 3DVJA 3EKHA 3TZ1A 5I8NA 3I5FC 1CFPA 3PM8A 2LHIA 1K93D 1XFUO 1CDMA 3LL8B 1CLMA 2HETA 1A03A 3D0YA 4ETOA 3EVVA 1L7ZA 1XVJA 1XYDA 1N2DA 2ZN8A 3VRPA 1HT9A 1UHKA 3OB1B 2JRFA 1CTRA 1AVSA 5PALA 3WNXB 5I2OA 1EJ3A 1K9KA 2OPOA 1L2OB 3PALA 5B8IB 1UWOA 3NSOA 1XFZO 1ALVA 1YUTA 2L5XB 1K94A 5I2QA 4TNCA 1KK8B 1B8CA 4A4BA 2FCDA 1S3PA 4OVNF 3BUMB 1OZSA 2LLTA 4M2PA 5D69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORA B;  1WY9 A;  1IRJ A;  2JUL A;  3CS1 A;  1X02 A;  1SL9 A;  4I5J A;  3AKA A;  1HQV A;  5TNC A;  3QRX A;  1KSO A;  2M7N A;  1JWD A;  1SL7 A;  1ALW A;  1QAS A;  1QX7 A;  1AJ4 A;  1B7T Y;  5ER4 X;  3WHU B;  5J3X A;  4R1E A;  2K7O A;  2GGM A;  4D1E A;  2LLU A;  3KPX A;  1SNL A;  2CT9 A;  1XA5 A;  2O5G A;  4C0L A;  4A4C A;  2K2A A;  3MSE B;  3K21 A;  1CFF A;  5CSN A;  1XO5 A;  3E3R A;  2EHB A;  3CR2 A;  2KOT A;  2BEC A;  4YGA A;  2OS8 C;  1QLS A;  1XK4 A;  1BMO A;  3BUW B;  1CKK A;  1J55 A;  1IG5 A;  1KQM C;  1QVI Z;  2KNE A;  1CFC A;  1M31 A;  1A2X A;  1DJI A;  4MEW A;  1RTP 1;  3OX6 A;  2PSR A;  2BCX A;  4NDD A;  2NCO A;  5JJG A;  1DGU A;  1BR1 B;  1DTL A;  1SR6 C;  1TNP A;  2GGZ A;  2KSP A;  3D0Y B;  3GK2 A;  3LK1 A;  3RM1 A;  1Y0V H;  1PUL A;  4HRG A;  4GUK A;  4DCK A;  2L0P A;  2VRG A;  1UHH A;  2M0R A;  2KAX A;  1AJ5 A;  1Y1U A;  1G4Y R;  1PVA A;  1ZMZ A;  4QJ4 B;  2KGR A;  1OQP A;  3TUY C;  1SL8 A;  1SK6 D;  2LC5 A;  1XK4 C;  1C7W A;  4C0K A;  3PN7 C;  3TS5 C;  1FW4 A;  1DF0 A;  3DVK A;  2F8P A;  3EK7 A;  4OCI A;  3FS7 A;  1JC2 A;  2KAV A;  1W7I B;  2KGB C;  2KQ6 A;  1K9P A;  1R2U A;  1XFX O;  1RFJ A;  2JXL A;  2QPT A;  2PAS A;  5JOL A;  3VRN A;  3OHM B;  2E30 A;  1S26 D;  2M9G A;  1DJZ A;  1AP4 A;  2KYC A;  3PLF B;  1NCX A;  2WCE A;  2LVJ A;  4ORB B;  2LP3 A;  2ZNE A;  4YGB B;  4GPL B;  5HLO A;  1IJ5 A;  4YGD B;  5I2L A;  4PAL A;  5AFP A;  1BR4 B;  1L2O C;  1BF5 A;  1JF2 A;  3FWB A;  4N5X A;  1QX2 A;  3NXA A;  2L98 A;  1K9U A;  1NWD A;  1XFV O;  1F54 A;  1KK8 C;  2RGI A;  1BOC A;  3KEV A;  3DF0 A;  3OP0 A;  1YUR A;  3PFV A;  4PHK A;  1NP8 A;  5CSI A;  4WRI A;  1BLQ A;  2BL0 C;  2K7D A;  3GK4 X;  2E6W A;  4MZK A;  2NZ0 A;  1IH0 A;  3SG5 A;  4GGF A;  3CLN A;  1DJY A;  3NSI A;  1NUB A;  4F0Z B;  3KF9 A;  1WRL A;  1NX3 A;  3IQQ A;  2G2B A;  3FWC A;  5D7F A;  3EVU A;  1ZUZ A;  1ZAC A;  2LHL A;  1SKT A;  4PE0 A;  2LP2 A;  2K7C A;  1SPY A;  3ICB A;  1LA3 A;  2BCA A;  4GNK B;  3SG2 A;  1AK8 A;  2JQ6 A;  2AUC A;  3A4U B;  2WOS A;  1S5G Z;  4OR9 B;  1WDC B;  1TCO B;  2KAY A;  2BBN A;  1ODB A;  5HLV A;  2WOR A;  4P5O E;  2MLE C;  2MAZ A;  4MBE A;  2K2F A;  3NSK A;  3SIB A;  1BOD A;  1S6C A;  4USL A;  2SCP A;  4ZCV A;  4MRY A;  1SRA A;  1DF0 B;  4NDB A;  4GGF C;  2WND A;  2BL0 B;  1B7T Z;  2SAS A;  4L9M A;  1Y1X A;  3A8R A;  1M45 A;  5AER A;  1W7J B;  3EVR A;  3D10 A;  3PAT A;  1KWO B;  1B47 A;  1KSM A;  1NSH A;  3CWG A;  1K90 D;  2K0J A;  1F4O A;  4GGN A;  1NPQ A;  2MJW B;  1RJV A;  1OE9 B;  1K8U A;  1FI5 A;  2F3Y A;  2JU0 A;  3SG4 A;  1KK7 Z;  3ZWH A;  1TNX A;  1GQM A;  2JZI A;  1JUO A;  2M8U A;  2OTG B;  5K89 A;  5DKQ A;  1CLL A;  1QLK A;  1CFD A;  1F4Q A;  1OSA A;  2ZND A;  1IQ3 A;  2JT0 A;  3DF0 B;  1N0Y A;  2LV7 A;  5ER5 A;  1RWY A;  1CB1 A;  4QJ3 B;  3AAJ A;  1YRT B;  1B4C A;  4QJ5 B;  1JBA A;  1DJW A;  3SG6 A;  2M1U A;  2PVB A;  2CTN A;  1Q80 A;  2LMV A;  1CLB A;  1PSR A;  4WQ2 A;  1TOP A;  2KQY A;  2LVV A;  1KCY A;  4CID A;  2F2O A;  1BG1 A;  1MQ1 A;  2LCP A;  2ZRT A;  2ZKM X;  1TIZ A;  1SCM C;  4WQ3 A;  1FPW A;  1QIW A;  1A75 A;  1OMR A;  1CDL A;  1H8B A;  1YRU B;  2HPS A;  4YGE B;  4PHN A;  5KU1 A;  4P2Y B;  2EC6 B;  4MSP A;  3SG7 A;  2ZRS A;  1EL4 A;  2Q91 A;  4CLN A;  3TDZ A;  1V1F A;  1PSB A;  1OMD A;  2M1K B;  4CPV A;  3DVM A;  3BUN B;  2KFG A;  1WLZ A;  1CNP A;  2ZN9 A;  1C07 A;  2LVK A;  4I5K A;  3H4S E;  4MZJ A;  4FTG A;  4ICB A;  1KQV A;  3JTD C;  2MHH A;  5CPV A;  1SBJ A;  2DOQ A;  1KFX L;  2L4H A;  2I7A A;  1LA0 A;  2L2E A;  1QVI Y;  3KHE A;  4M2Q A;  4YI9 A;  1DGV A;  2JT3 A;  3VGO A;  3TDI A;  1IGV A;  3I5I B;  1CMF A;  1YUS A;  3I5G B;  4BY5 A;  1Y6W A;  4PCW A;  2BCB A;  2BKI B;  3M0W A;  4GAO A;  1SCM B;  1RK9 A;  1BJF A;  1GJY A;  3F45 A;  4Q04 A;  1UUR A;  1D1O A;  1WDC C;  2KI6 C;  4YGC B;  3HX4 A;  1B1G A;  1PRW A;  2JXC A;  2KBI A;  4N1F A;  1QAT A;  1F71 A;  4HRE E;  1J7P A;  2L4I A;  5AAN A;  2V53 A;  4I5L B;  1PAL A;  1S36 A;  4AQI A;  3CTN A;  1K2H A;  4NQG A;  1TNQ A;  3CR5 X;  4JQ0 D;  1IQ5 A;  2HQ8 A;  3RLZ A;  3SJS A;  5HKY A;  2FOT A;  2JT8 A;  2ISD A;  1MUX A;  1B9A A;  4CFR A;  2LM5 A;  1QX5 B;  2Q4U A;  1F55 A;  3JTD B;  2JC2 A;  5CSJ A;  2I2R E;  1NX1 A;  2CBL A;  2R2I A;  1KWO C;  1M39 A;  3BUX B;  3BXK A;  2LAP A;  1VRK A;  3JVT B;  4FQO A;  1FF1 A;  1KFX S;  2M97 A;  1A29 A;  1Y1A A;  2JOJ A;  2H2K A;  2HF5 A;  1A75 B;  2LMT A;  3GOF A;  3LK0 A;  4PHJ A;  1MXE A;  1JF0 A;  4UPG A;  3PSR A;  3O78 A;  2KI4 B;  2OTG C;  1XFY O;  5HKZ A;  2QAC A;  4N1G A;  1EG3 A;  4AQJ A;  5KTY A;  1WRK A;  4MRX A;  1QTX A;  4BY4 A;  1SCV A;  1QV0 A;  1YX7 A;  2KDH A;  2M3W A;  3AKB A;  1MWN A;  1DJX A;  2JNF A;  2CNP A;  3I5H B;  5CSF A;  1YVH A;  3BOW A;  1G33 A;  5AEQ A;  4ORC B;  2G9B A;  3VRQ A;  1WLM A;  1EH2 A;  1PK0 D;  1AHR A;  1SMG A;  1J7Q A;  1LIN A;  2BE6 A;  2F2P A;  2I18 A;  3DD4 A;  4AOM A;  3SIA A;  1UHN A;  2F33 A;  3VRO A;  4GBA A;  2JWW A;  4M2O A;  1NX2 A;  2M29 A;  2COL B;  4PDZ A;  1QIV A;  3TDU A;  1FI6 A;  2NLN A;  3BQ3 A;  2MRD A;  1J1D A;  1QXP A;  4MVF A;  2KFH A;  4PE7 A;  2EC6 C;  3LLE A;  4PE1 A;  1TRF A;  3AAK A;  2MBX A;  1S5G Y;  2KI6 D;  3BYA A;  2LVI A;  2KYF A;  1SW8 A;  2WCF A;  3KO0 A;  4I5N B;  1FBV A;  1K96 A;  3DVE A;  1H4B A;  4PHM A;  3NSL A;  5G08 A;  2KBM A;  1ZFS A;  2I94 A;  3OX5 A;  1CM4 A;  2H61 A;  1N65 A;  1IWQ A;  2Y4Q A;  4DS7 A;  3I5F B;  1WRZ A;  2LUX A;  3WHT B;  1CM1 A;  3I5I C;  3I5G C;  2AAO A;  1ZOT B;  4XYN A;  3WXA A;  4YI8 A;  3IF7 A;  1KFU L;  1UHI A;  5AXI A;  1B8L A;  2B1U A;  1TCF A;  4E68 A;  1C7V A;  1UP5 A;  3LCP C;  3CZT X;  2K7B A;  1REC A;  2FCE A;  1J7O A;  1QS7 A;  3C1V A;  5IBW A;  1R6P A;  1KK7 Y;  1LVC D;  5BPJ A;  3EK8 A;  2JTT A;  1CMG A;  1YUU A;  3O2P A;  1DT7 B;  4XJK A;  1B8R A;  1U5I A;  3VRR A;  2JTZ A;  4XJK B;  1DMO A;  2EGD A;  1TTX A;  4JPZ B;  1DVI A;  2JPT A;  2H61 C;  1GGW A;  2JNX A;  1SYM A;  2NXQ A;  1YR5 A;  1TNW A;  4HSZ A;  2WC8 A;  1LKJ A;  3BOW B;  2MA2 A;  2LNK A;  1BU3 A;  1E8A A;  2PAL A;  1DJG A;  5FYX A;  2K61 A;  2CXJ A;  5HYD A;  1K95 A;  1F8H A;  1GGZ A;  3EK4 A;  2BKH B;  3JVT C;  2BBM A;  2FJU B;  2O60 A;  1IKU A;  4MN0 A;  4U8D A;  1XFW O;  1RRO A;  1J7R A;  2WCB A;  3IQO A;  2Y1N A;  1YX8 A;  5DKR A;  2KI4 C;  2LE9 B;  1M46 A;  3GK1 A;  4DUQ A;  1JSA A;  1KFU S;  2CCM A;  1UHJ A;  5KSZ A;  5F6T A;  5GQQ C;  4ZCU A;  4HRH A;  4IL1 A;  1A4P A;  4DRW A;  4YRU A;  1UUS A;  1DJH A;  1MF8 B;  2PRU A;  1NIW A;  4YBH B;  2LUC A;  2KHN A;  2KFF A;  2LMU A;  2OS8 B;  2L51 A;  3I5H C;  4CFQ A;  1NCZ A;  1CDP A;  3SG3 A;  1MR8 A;  1JFJ A;  5DKN A;  3BUO B;  1S1E A;  1NCY A;  1KQM B;  1OMV A;  1S6I A;  2GV5 A;  2IS9 A;  3FIA A;  4GFT A;  1M63 B;  2PMY A;  3TS5 B;  2D8N A;  1OOJ A;  3ZNI A;  2HQW A;  2LLS A;  1V1G A;  1SR6 B;  1SY9 A;  3O4Y A;  4PE4 A;  4DIR A;  2ZFD A;  1CDN A;  4MZL A;  4OV2 A;  1NX0 A;  1F70 A;  1EG4 A;  5HKW A;  1PVB A;  1G8I A;  2K8M B;  3O6B A;  1QV1 A;  1MHO A;  2M7L A;  2F3Z A;  1AUI B;  2AMI A;  1LXF C;  1S6J A;  4NDC A;  4MLW A;  4JWQ A;  2MLF C;  1TN4 A;  3TUY B;  1U5I B;  1YVL A;  1JFK A;  1NYA A;  3OB2 B;  1EXR A;  2A4J A;  2BE4 A;  2L50 A;  3CGA A;  2M49 B;  1MXL C;  1QJT A;  3CR4 X;  1OZO A;  1IJ6 A;  3EKJ A;  1BT6 A;  2NCP A;  2TN4 A;  1J1E A;  3PN7 B;  1YTZ C;  2P6B B;  3HCM A;  4C0J A;  2Y5I A;  2Y1M A;  4OKH A;  2LAN A;  3DVJ A;  3EKH A;  3TZ1 A;  5I8N A;  3I5F C;  1CFP A;  3PM8 A;  2LHI A;  1K93 D;  1XFU O;  1CDM A;  3LL8 B;  1CLM A;  2HET A;  1A03 A;  3D0Y A;  4ETO A;  3EVV A;  1L7Z A;  1XVJ A;  1XYD A;  1N2D A;  2ZN8 A;  3VRP A;  1HT9 A;  1UHK A;  3OB1 B;  2JRF A;  1CTR A;  1AVS A;  5PAL A;  3WNX B;  5I2O A;  1EJ3 A;  1K9K A;  2OPO A;  1L2O B;  3PAL A;  5B8I B;  1UWO A;  3NSO A;  1XFZ O;  1ALV A;  1YUT A;  2L5X B;  1K94 A;  5I2Q A;  4TNC A;  1KK8 B;  1B8C A;  4A4B A;  2FCD A;  1S3P A;  4OVN F;  3BUM B;  1OZS A;  2LLT A;  4M2P A;  5D69 A; 
#chains in the Genus database with same CATH topology
 4ORA B;  1WY9 A;  3S0F A;  1IRJ A;  2JUL A;  5FI6 A;  3CS1 A;  1X02 A;  1SL9 A;  4I5J A;  2WCM A;  3AKA A;  1HQV A;  5TNC A;  3QRX A;  3OGN A;  1KSO A;  2M7N A;  1JWD A;  1SL7 A;  1ALW A;  1T14 A;  1QAS A;  1QX7 A;  1AJ4 A;  1B7T Y;  5ER4 X;  3WHU B;  2QDI A;  4R1E A;  5J3X A;  2K7O A;  2GGM A;  4D1E A;  3Q8I A;  2LLU A;  3DXL A;  3KPX A;  1SNL A;  2CT9 A;  1XA5 A;  2O5G A;  4C0L A;  4A4C A;  2K2A A;  3MSE B;  3K21 A;  1CFF A;  5CSN A;  1XO5 A;  3E3R A;  2EHB A;  3CR2 A;  2KOT A;  2BEC A;  4YGA A;  5I94 A;  2OS8 C;  1QLS A;  3CYZ A;  1XK4 A;  1BMO A;  3BUW B;  1CKK A;  1J55 A;  1IG5 A;  3UNW A;  1KQM C;  1QVI Z;  2KNE A;  1CFC A;  1M31 A;  1A2X A;  1DJI A;  4MEW A;  1RTP 1;  1DC1 A;  3OX6 A;  2PSR A;  2BCX A;  3FE9 A;  4NDD A;  2NCO A;  5JJG A;  1DGU A;  1BR1 B;  1DTL A;  1SR6 C;  1TNP A;  2GGZ A;  2KSP A;  3D0Y B;  3GK2 A;  3LK1 A;  3RM1 A;  1Y0V H;  1PUL A;  4HRG A;  4GUK A;  4DCK A;  2L0P A;  2VRG A;  1UHH A;  2M0R A;  2KAX A;  1AJ5 A;  1Y1U A;  3NHT A;  1G4Y R;  1PVA A;  1ZMZ A;  4QJ4 B;  1TWO A;  2KGR A;  1OQP A;  3TUY C;  1SL8 A;  1SK6 D;  2LC5 A;  1XK4 C;  1C7W A;  4C0K A;  3PN7 C;  3TS5 C;  1XFR A;  1FW4 A;  1DF0 A;  4F7F A;  3DVK A;  2F8P A;  3EK7 A;  4OCI A;  3FS7 A;  1JC2 A;  2KAV A;  2WCL A;  1W7I B;  2KGB C;  2KQ6 A;  1K9P A;  1R2U A;  1XFX O;  1RFJ A;  2JXL A;  2QPT A;  2PAS A;  5JOL A;  3VRN A;  3OHM B;  2E30 A;  5DIC A;  1S26 D;  2M9G A;  1DJZ A;  1AP4 A;  1OW4 A;  2KYC A;  3PLF B;  1NCX A;  2WCE A;  2LVJ A;  4ORB B;  2LP3 A;  2ZNE A;  4YGB B;  4GPL B;  5HLO A;  1IJ5 A;  4YGD B;  5I2L A;  3IVT A;  4PAL A;  1BR4 B;  1L2O C;  5AFP A;  1BF5 A;  1JF2 A;  3FWB A;  4N5X A;  1QX2 A;  3R1V A;  3NXA A;  2L98 A;  1K9U A;  1NWD A;  1XFV O;  1F54 A;  1KK8 C;  2RGI A;  1BOC A;  3KEV A;  2PYQ A;  3DF0 A;  1YUR A;  3OP0 A;  3PFV A;  4PHK A;  3DYE A;  1NP8 A;  5CSI A;  4WRI A;  1BLQ A;  2BL0 C;  2K7D A;  3GK4 X;  2FJY A;  2E6W A;  4MZK A;  2NZ0 A;  1IH0 A;  3SG5 A;  4GGF A;  3CLN A;  1DJY A;  3NSI A;  1NUB A;  4F0Z B;  3KF9 A;  1WRL A;  1NX3 A;  3IQQ A;  2G2B A;  3FWC A;  2QEV A;  5D7F A;  3EVU A;  1ZUZ A;  1ZAC A;  2LHL A;  1SKT A;  4PE0 A;  2LP2 A;  2K7C A;  1SPY A;  3ICB A;  1LA3 A;  2BCA A;  4GNK B;  3SG2 A;  1AK8 A;  2JQ6 A;  2AUC A;  3A4U B;  2WOS A;  1S5G Z;  4OR9 B;  1WDC B;  1TCO B;  2KAY A;  2BBN A;  1ODB A;  3D78 A;  3S0E A;  5HLV A;  2WOR A;  4P5O E;  2MLE C;  1W9Z A;  2MAZ A;  4MBE A;  2K2F A;  3NSK A;  3SIB A;  1BOD A;  3S0G A;  1S6C A;  4USL A;  2SCP A;  4ZCV A;  4MRY A;  1SRA A;  1DF0 B;  4NDB A;  4GGF C;  2WND A;  2BL0 B;  1B7T Z;  2SAS A;  4L9M A;  3RZS A;  1Y1X A;  3A8R A;  1M45 A;  3BFA A;  5AER A;  1W7J B;  1IIO A;  3EVR A;  3D10 A;  3PAT A;  1KWO B;  1B47 A;  1KSM A;  1NSH A;  3CWG A;  1K90 D;  2K0J A;  1F4O A;  4GGN A;  1NPQ A;  2MJW B;  1RJV A;  1C3Y A;  1OE9 B;  3CDN A;  1K8U A;  3CZ2 A;  1FI5 A;  2F3Y A;  2JU0 A;  3SG4 A;  1KK7 Z;  3ZWH A;  1TNX A;  1GQM A;  3BFH A;  2JZI A;  1JUO A;  2M8U A;  3S0D A;  3UO9 A;  2OTG B;  5K89 A;  5DKQ A;  1CLL A;  1QLK A;  1CFD A;  1F4Q A;  1OSA A;  2ZND A;  1IQ3 A;  2JT0 A;  1GM0 A;  3DF0 B;  2ERB A;  1N0Y A;  2LV7 A;  5ER5 A;  1RWY A;  1CB1 A;  4QJ3 B;  3AAJ A;  1YRT B;  1B4C A;  4QJ5 B;  1JBA A;  1DJW A;  3SG6 A;  2KLD A;  2M1U A;  2P70 A;  2CTN A;  2PVB A;  1Q80 A;  2LMV A;  1CLB A;  1PSR A;  4WQ2 A;  1TOP A;  2BNX A;  2KQY A;  2LVV A;  1KCY A;  4CID A;  1Z2C B;  2F2O A;  1BG1 A;  1MQ1 A;  2LCP A;  2ZRT A;  2ZKM X;  3K1E A;  2P71 A;  5FI7 A;  2WC6 A;  2L5Y A;  3B87 A;  1TIZ A;  1SCM C;  4WQ3 A;  1FPW A;  1QIW A;  3CZ1 A;  1A75 A;  1OMR A;  1CDL A;  1H8B A;  1YRU B;  2HPS A;  4YGE B;  4PHN A;  5KU1 A;  4P2Y B;  3R1O A;  2EC6 B;  4MSP A;  3SG7 A;  3SS3 A;  2ZRS A;  2L2C A;  1EL4 A;  2Q91 A;  3L4A A;  4CLN A;  3TDZ A;  1TUJ A;  1V1F A;  1PSB A;  1OMD A;  2M1K B;  4CPV A;  3D73 A;  3DVM A;  3BUN B;  2KFG A;  1WLZ A;  1CNP A;  2ZN9 A;  1C07 A;  1LS8 A;  2LVK A;  4I5K A;  3H4S E;  3S0A A;  4MZJ A;  4FTG A;  4ICB A;  1KQV A;  3JTD C;  3O4X A;  2MHH A;  5CPV A;  1SBJ A;  2DOQ A;  1KFX L;  2L4H A;  2I7A A;  1LA0 A;  2L2E A;  1QVI Y;  3KHE A;  4M2Q A;  4YI9 A;  1DGV A;  2JT3 A;  3VGO A;  3TDI A;  1IGV A;  3I5I B;  1CMF A;  1YUS A;  3I5G B;  4BY5 A;  1Y6W A;  4PCW A;  2BCB A;  2BKI B;  3M0W A;  1OOG A;  4GAO A;  1SCM B;  1RK9 A;  1BJF A;  2K60 A;  1GJY A;  3F45 A;  4Q04 A;  1UUR A;  1D1O A;  1WDC C;  2KI6 C;  4YGC B;  3HX4 A;  1B1G A;  1PRW A;  2JXC A;  2KBI A;  3DY9 A;  4N1F A;  1QAT A;  1F71 A;  4HRE E;  3PM2 A;  2L4I A;  5AAN A;  1C3Z A;  2V53 A;  3B6X A;  1PAL A;  4I5L B;  1J7P A;  1S36 A;  4AQI A;  3CTN A;  1K2H A;  4NQG A;  1TNQ A;  3CR5 X;  4JQ0 D;  3SS4 A;  1IQ5 A;  1TUZ A;  2HQ8 A;  3RLZ A;  3SJS A;  5HKY A;  2FOT A;  2JT8 A;  2ISD A;  1MUX A;  1B9A A;  4CFR A;  4INW A;  2LM5 A;  1QX5 B;  2Q4U A;  1F55 A;  3JTD B;  2JC2 A;  5CSJ A;  2I2R E;  3D75 A;  1NX1 A;  2CBL A;  4PT1 A;  2R2I A;  1KWO C;  1M39 A;  3BUX B;  2PQL A;  2LAP A;  3BXK A;  1VRK A;  3JVT B;  4FQO A;  1FF1 A;  2QEO A;  1KFX S;  2M97 A;  1A29 A;  1Y1A A;  2H8V A;  2JOJ A;  2H2K A;  2HF5 A;  1A75 B;  2LMT A;  3GOF A;  1Z4H A;  3LK0 A;  4PHJ A;  1MXE A;  1JF0 A;  4UPG A;  3PSR A;  3O78 A;  2KI4 B;  2OTG C;  1XFY O;  3B88 A;  5HKZ A;  2QAC A;  4N1G A;  3R72 A;  1EG3 A;  4AQJ A;  5KTY A;  1WRK A;  4MRX A;  1QTX A;  4BY4 A;  1SCV A;  1QV0 A;  1YX7 A;  2KDH A;  2M3W A;  3AKB A;  4JD9 A;  1OOF A;  1MWN A;  1QWV A;  1DJX A;  2JNF A;  2CNP A;  3I5H B;  3N7H A;  1YVH A;  3BOW A;  1G33 A;  3CZ0 A;  3R1P A;  5CSF A;  5AEQ A;  4ORC B;  2G9B A;  3VRQ A;  1WLM A;  4OZD A;  1EH2 A;  1PK0 D;  1AHR A;  3EG5 B;  1SMG A;  3QME A;  1J7Q A;  1LIN A;  2BE6 A;  2F2P A;  2I18 A;  3DD4 A;  4AOM A;  3SIA A;  1UHN A;  2F33 A;  3VRO A;  4GBA A;  3VB1 A;  3B7A A;  2JWW A;  4M2O A;  1NX2 A;  2M29 A;  2COL B;  4PDZ A;  1QIV A;  3TDU A;  1FI6 A;  2NLN A;  3BQ3 A;  3V2L A;  2MRD A;  1J1D A;  1QXP A;  4MVF A;  2KFH A;  3BFB A;  2EC6 C;  3LLE A;  4PE7 A;  4PE1 A;  1TRF A;  3AAK A;  4JKT A;  2MBX A;  5FI2 A;  3CAB A;  1S5G Y;  2KI6 D;  3BYA A;  2LVI A;  2KYF A;  1SW8 A;  2WCF A;  1DQE A;  3KO0 A;  4I5N B;  1FBV A;  1K96 A;  3DVE A;  1H4B A;  3OBV A;  4PHM A;  3NSL A;  5G08 A;  2KBM A;  1ZFS A;  2I94 A;  4KYN A;  3OX5 A;  1CM4 A;  2H61 A;  2WCK A;  1N65 A;  1IWQ A;  2Y4Q A;  3DZT A;  4DS7 A;  3I5F B;  3PN7 B;  1WRZ A;  2LUX A;  3B86 A;  3WHT B;  1CM1 A;  3I5I C;  3NGV A;  3I5G C;  3NHI A;  2AAO A;  1ZOT B;  3D74 A;  4XYN A;  3WXA A;  4YI8 A;  3SS5 A;  3IF7 A;  5D3O A;  1KFU L;  1UHI A;  5AXI A;  1B8L A;  2B1U A;  1TCF A;  5HL1 A;  4E68 A;  1C7V A;  1UP5 A;  3D77 A;  3LCP C;  3CZT X;  2K7B A;  1REC A;  2FCE A;  1J7O A;  1QS7 A;  3C1V A;  5IBW A;  1R6P A;  1KK7 Y;  1LVC D;  5BPJ A;  3EK8 A;  2JTT A;  2WC5 A;  1YUU A;  1CMG A;  3O2P A;  1DT7 B;  4XJK A;  1B8R A;  1U5I A;  3VRR A;  2JTZ A;  4XJK B;  1DMO A;  2EGD A;  1TTX A;  4JPZ B;  1DVI A;  2JPT A;  2KPH A;  2H61 C;  1GGW A;  2JNX A;  1SYM A;  2NXQ A;  1YR5 A;  1P28 A;  1TNW A;  4HSZ A;  2WC8 A;  1LKJ A;  3BOW B;  2MA2 A;  4IJ7 A;  2LNK A;  1BU3 A;  1E8A A;  2GTE A;  2PAL A;  1DJG A;  5FYX A;  2K61 A;  2CXJ A;  5HYD A;  1K95 A;  1F8H A;  1GGZ A;  3EK4 A;  2BKH B;  3FE6 A;  3JVT C;  2BBM A;  2FJU B;  3D76 A;  3S0B A;  2O60 A;  1IKU A;  4MN0 A;  4U8D A;  1XFW O;  1RRO A;  1J7R A;  2WCB A;  3IQO A;  2Y1N A;  1YX8 A;  5DKR A;  2KI4 C;  2LE9 B;  1M46 A;  3GK1 A;  4DUQ A;  1JSA A;  1KFU S;  2CCM A;  1UHJ A;  5KSZ A;  5F6T A;  5GQQ C;  1DEK A;  4ZCU A;  4HRH A;  4IL1 A;  1A4P A;  4DRW A;  4YRU A;  1UUS A;  1DJH A;  1MF8 B;  2PRU A;  1NIW A;  4FQT A;  4YBH B;  2LUC A;  2KHN A;  2KFF A;  2LMU A;  2OS8 B;  2L51 A;  3I5H C;  4CFQ A;  4INX A;  1NCZ A;  1CDP A;  2QEB A;  1MR8 A;  3SG3 A;  1JFJ A;  5DKN A;  2JPO A;  1S1E A;  1NCY A;  1KQM B;  1OMV A;  1S6I A;  2GV5 A;  2IS9 A;  3BUO B;  3FIA A;  4GFT A;  1M63 B;  2PMY A;  3TS5 B;  2D8N A;  1OOJ A;  2KLE A;  3L4L A;  1ORG A;  2HQW A;  3ZNI A;  2LLS A;  2BAP A;  1V1G A;  1SR6 B;  1SY9 A;  3O4Y A;  4PE4 A;  4DIR A;  2ZFD A;  1CDN A;  4MZL A;  4OV2 A;  1NX0 A;  1F70 A;  1EG4 A;  5HKW A;  3BJH A;  1PVB A;  1G8I A;  2K8M B;  3O6B A;  1QV1 A;  1MHO A;  2M7L A;  2F3Z A;  1AUI B;  2AMI A;  1LXF C;  1S6J A;  4NDC A;  4MLW A;  2WCH A;  4JWQ A;  2MLF C;  1TN4 A;  3TUY B;  1U5I B;  1YVL A;  1JFK A;  1NYA A;  3OB2 B;  1EXR A;  2A4J A;  2BE4 A;  2L50 A;  3CGA A;  1OOH A;  1MXL C;  1QJT A;  2M49 B;  1OZO A;  1IJ6 A;  3CR4 X;  1BT6 A;  2NCP A;  2TN4 A;  1J1E A;  3EKJ A;  1YTZ C;  2P6B B;  3HCM A;  3PJI A;  4C0J A;  2Y5I A;  1OOI X;  2Y1M A;  4OKH A;  2LAN A;  2WCJ A;  3DVJ A;  3EKH A;  3TZ1 A;  5I8N A;  3I5F C;  1CFP A;  3PM8 A;  2LHI A;  1K93 D;  1XFU O;  1CDM A;  3LL8 B;  1CLM A;  2HET A;  1A03 A;  3D0Y A;  4ETO A;  3EVV A;  1L7Z A;  1XVJ A;  1XYD A;  1N2D A;  2ZN8 A;  3VRP A;  1HT9 A;  1UHK A;  3OB1 B;  2JRF A;  1CTR A;  1AVS A;  2QEH A;  5PAL A;  3WNX B;  5I2O A;  1EJ3 A;  1K9K A;  2OPO A;  1L2O B;  1DEL A;  3PAL A;  1UWO A;  3NSO A;  1XFZ O;  5B8I B;  5EL2 A;  1ALV A;  1YUT A;  1SSE B;  2L5X B;  1K94 A;  5I2Q A;  2YGU A;  4TNC A;  1KK8 B;  1B8C A;  3FE8 A;  4A4B A;  2FCD A;  1S3P A;  4OVN F;  3BUM B;  3L47 A;  1OZS A;  2LLT A;  4M2P A;  5D69 A; 
#chains in the Genus database with same CATH homology
 4ORA B;  1WY9 A;  1IRJ A;  2JUL A;  3CS1 A;  1X02 A;  1SL9 A;  4I5J A;  3AKA A;  1HQV A;  5TNC A;  3QRX A;  1KSO A;  2M7N A;  1JWD A;  1SL7 A;  1ALW A;  1QAS A;  1QX7 A;  1AJ4 A;  1B7T Y;  5ER4 X;  3WHU B;  5J3X A;  4R1E A;  2K7O A;  2GGM A;  4D1E A;  2LLU A;  3KPX A;  1SNL A;  2CT9 A;  1XA5 A;  2O5G A;  4C0L A;  4A4C A;  2K2A A;  3MSE B;  3K21 A;  1CFF A;  5CSN A;  1XO5 A;  3E3R A;  2EHB A;  3CR2 A;  2KOT A;  2BEC A;  4YGA A;  2OS8 C;  1QLS A;  1XK4 A;  1BMO A;  3BUW B;  1CKK A;  1J55 A;  1IG5 A;  1KQM C;  1QVI Z;  2KNE A;  1CFC A;  1M31 A;  1A2X A;  1DJI A;  4MEW A;  1RTP 1;  3OX6 A;  2PSR A;  2BCX A;  4NDD A;  2NCO A;  5JJG A;  1DGU A;  1BR1 B;  1DTL A;  1SR6 C;  1TNP A;  2GGZ A;  2KSP A;  3D0Y B;  3GK2 A;  3LK1 A;  3RM1 A;  1Y0V H;  1PUL A;  4HRG A;  4GUK A;  4DCK A;  2L0P A;  2VRG A;  1UHH A;  2M0R A;  2KAX A;  1AJ5 A;  1Y1U A;  1G4Y R;  1PVA A;  1ZMZ A;  4QJ4 B;  2KGR A;  1OQP A;  3TUY C;  1SL8 A;  1SK6 D;  2LC5 A;  1XK4 C;  1C7W A;  4C0K A;  3PN7 C;  3TS5 C;  1FW4 A;  1DF0 A;  3DVK A;  2F8P A;  3EK7 A;  4OCI A;  3FS7 A;  1JC2 A;  2KAV A;  1W7I B;  2KGB C;  2KQ6 A;  1K9P A;  1R2U A;  1XFX O;  1RFJ A;  2JXL A;  2QPT A;  2PAS A;  5JOL A;  3VRN A;  3OHM B;  2E30 A;  1S26 D;  2M9G A;  1DJZ A;  1AP4 A;  2KYC A;  3PLF B;  1NCX A;  2WCE A;  2LVJ A;  4ORB B;  2LP3 A;  2ZNE A;  4YGB B;  4GPL B;  5HLO A;  1IJ5 A;  4YGD B;  5I2L A;  4PAL A;  5AFP A;  1BR4 B;  1L2O C;  1BF5 A;  1JF2 A;  3FWB A;  4N5X A;  1QX2 A;  3NXA A;  2L98 A;  1K9U A;  1NWD A;  1XFV O;  1F54 A;  1KK8 C;  2RGI A;  1BOC A;  3KEV A;  3DF0 A;  3OP0 A;  1YUR A;  3PFV A;  4PHK A;  1NP8 A;  5CSI A;  4WRI A;  1BLQ A;  2BL0 C;  2K7D A;  3GK4 X;  2E6W A;  4MZK A;  2NZ0 A;  1IH0 A;  3SG5 A;  4GGF A;  3CLN A;  1DJY A;  3NSI A;  1NUB A;  4F0Z B;  3KF9 A;  1WRL A;  1NX3 A;  3IQQ A;  2G2B A;  3FWC A;  5D7F A;  3EVU A;  1ZUZ A;  1ZAC A;  2LHL A;  1SKT A;  4PE0 A;  2LP2 A;  2K7C A;  1SPY A;  3ICB A;  1LA3 A;  2BCA A;  4GNK B;  3SG2 A;  1AK8 A;  2JQ6 A;  2AUC A;  3A4U B;  2WOS A;  1S5G Z;  4OR9 B;  1WDC B;  1TCO B;  2KAY A;  2BBN A;  1ODB A;  5HLV A;  2WOR A;  4P5O E;  2MLE C;  2MAZ A;  4MBE A;  2K2F A;  3NSK A;  3SIB A;  1BOD A;  1S6C A;  4USL A;  2SCP A;  4ZCV A;  4MRY A;  1SRA A;  1DF0 B;  4NDB A;  4GGF C;  2WND A;  2BL0 B;  1B7T Z;  2SAS A;  4L9M A;  1Y1X A;  3A8R A;  1M45 A;  5AER A;  1W7J B;  3EVR A;  3D10 A;  3PAT A;  1KWO B;  1B47 A;  1KSM A;  1NSH A;  3CWG A;  1K90 D;  2K0J A;  1F4O A;  4GGN A;  1NPQ A;  2MJW B;  1RJV A;  1OE9 B;  1K8U A;  1FI5 A;  2F3Y A;  2JU0 A;  3SG4 A;  1KK7 Z;  3ZWH A;  1TNX A;  1GQM A;  2JZI A;  1JUO A;  2M8U A;  2OTG B;  5K89 A;  5DKQ A;  1CLL A;  1QLK A;  1CFD A;  1F4Q A;  1OSA A;  2ZND A;  1IQ3 A;  2JT0 A;  3DF0 B;  1N0Y A;  2LV7 A;  5ER5 A;  1RWY A;  1CB1 A;  4QJ3 B;  3AAJ A;  1YRT B;  1B4C A;  4QJ5 B;  1JBA A;  1DJW A;  3SG6 A;  2M1U A;  2PVB A;  2CTN A;  1Q80 A;  2LMV A;  1CLB A;  1PSR A;  4WQ2 A;  1TOP A;  2KQY A;  2LVV A;  1KCY A;  4CID A;  2F2O A;  1BG1 A;  1MQ1 A;  2LCP A;  2ZRT A;  2ZKM X;  1TIZ A;  1SCM C;  4WQ3 A;  1FPW A;  1QIW A;  1A75 A;  1OMR A;  1CDL A;  1H8B A;  1YRU B;  2HPS A;  4YGE B;  4PHN A;  5KU1 A;  4P2Y B;  2EC6 B;  4MSP A;  3SG7 A;  2ZRS A;  1EL4 A;  2Q91 A;  4CLN A;  3TDZ A;  1V1F A;  1PSB A;  1OMD A;  2M1K B;  4CPV A;  3DVM A;  3BUN B;  2KFG A;  1WLZ A;  1CNP A;  2ZN9 A;  1C07 A;  2LVK A;  4I5K A;  3H4S E;  4MZJ A;  4FTG A;  4ICB A;  1KQV A;  3JTD C;  2MHH A;  5CPV A;  1SBJ A;  2DOQ A;  1KFX L;  2L4H A;  2I7A A;  1LA0 A;  2L2E A;  1QVI Y;  3KHE A;  4M2Q A;  4YI9 A;  1DGV A;  2JT3 A;  3VGO A;  3TDI A;  1IGV A;  3I5I B;  1CMF A;  1YUS A;  3I5G B;  4BY5 A;  1Y6W A;  4PCW A;  2BCB A;  2BKI B;  3M0W A;  4GAO A;  1SCM B;  1RK9 A;  1BJF A;  1GJY A;  3F45 A;  4Q04 A;  1UUR A;  1D1O A;  1WDC C;  2KI6 C;  4YGC B;  3HX4 A;  1B1G A;  1PRW A;  2JXC A;  2KBI A;  4N1F A;  1QAT A;  1F71 A;  4HRE E;  1J7P A;  2L4I A;  5AAN A;  2V53 A;  4I5L B;  1PAL A;  1S36 A;  4AQI A;  3CTN A;  1K2H A;  4NQG A;  1TNQ A;  3CR5 X;  4JQ0 D;  1IQ5 A;  2HQ8 A;  3RLZ A;  3SJS A;  5HKY A;  2FOT A;  2JT8 A;  2ISD A;  1MUX A;  1B9A A;  4CFR A;  2LM5 A;  1QX5 B;  2Q4U A;  1F55 A;  3JTD B;  2JC2 A;  5CSJ A;  2I2R E;  1NX1 A;  2CBL A;  2R2I A;  1KWO C;  1M39 A;  3BUX B;  3BXK A;  2LAP A;  1VRK A;  3JVT B;  4FQO A;  1FF1 A;  1KFX S;  2M97 A;  1A29 A;  1Y1A A;  2JOJ A;  2H2K A;  2HF5 A;  1A75 B;  2LMT A;  3GOF A;  3LK0 A;  4PHJ A;  1MXE A;  1JF0 A;  4UPG A;  3PSR A;  3O78 A;  2KI4 B;  2OTG C;  1XFY O;  5HKZ A;  2QAC A;  4N1G A;  1EG3 A;  4AQJ A;  5KTY A;  1WRK A;  4MRX A;  1QTX A;  4BY4 A;  1SCV A;  1QV0 A;  1YX7 A;  2KDH A;  2M3W A;  3AKB A;  1MWN A;  1DJX A;  2JNF A;  2CNP A;  3I5H B;  5CSF A;  1YVH A;  3BOW A;  1G33 A;  5AEQ A;  4ORC B;  2G9B A;  3VRQ A;  1WLM A;  1EH2 A;  1PK0 D;  1AHR A;  1SMG A;  1J7Q A;  1LIN A;  2BE6 A;  2F2P A;  2I18 A;  3DD4 A;  4AOM A;  3SIA A;  1UHN A;  2F33 A;  3VRO A;  4GBA A;  2JWW A;  4M2O A;  1NX2 A;  2M29 A;  2COL B;  4PDZ A;  1QIV A;  3TDU A;  1FI6 A;  2NLN A;  3BQ3 A;  2MRD A;  1J1D A;  1QXP A;  4MVF A;  2KFH A;  4PE7 A;  2EC6 C;  3LLE A;  4PE1 A;  1TRF A;  3AAK A;  2MBX A;  1S5G Y;  2KI6 D;  3BYA A;  2LVI A;  2KYF A;  1SW8 A;  2WCF A;  3KO0 A;  4I5N B;  1FBV A;  1K96 A;  3DVE A;  1H4B A;  4PHM A;  3NSL A;  5G08 A;  2KBM A;  1ZFS A;  2I94 A;  3OX5 A;  1CM4 A;  2H61 A;  1N65 A;  1IWQ A;  2Y4Q A;  4DS7 A;  3I5F B;  1WRZ A;  2LUX A;  3WHT B;  1CM1 A;  3I5I C;  3I5G C;  2AAO A;  1ZOT B;  4XYN A;  3WXA A;  4YI8 A;  3IF7 A;  1KFU L;  1UHI A;  5AXI A;  1B8L A;  2B1U A;  1TCF A;  4E68 A;  1C7V A;  1UP5 A;  3LCP C;  3CZT X;  2K7B A;  1REC A;  2FCE A;  1J7O A;  1QS7 A;  3C1V A;  5IBW A;  1R6P A;  1KK7 Y;  1LVC D;  5BPJ A;  3EK8 A;  2JTT A;  1CMG A;  1YUU A;  3O2P A;  1DT7 B;  4XJK A;  1B8R A;  1U5I A;  3VRR A;  2JTZ A;  4XJK B;  1DMO A;  2EGD A;  1TTX A;  4JPZ B;  1DVI A;  2JPT A;  2H61 C;  1GGW A;  2JNX A;  1SYM A;  2NXQ A;  1YR5 A;  1TNW A;  4HSZ A;  2WC8 A;  1LKJ A;  3BOW B;  2MA2 A;  2LNK A;  1BU3 A;  1E8A A;  2PAL A;  1DJG A;  5FYX A;  2K61 A;  2CXJ A;  5HYD A;  1K95 A;  1F8H A;  1GGZ A;  3EK4 A;  2BKH B;  3JVT C;  2BBM A;  2FJU B;  2O60 A;  1IKU A;  4MN0 A;  4U8D A;  1XFW O;  1RRO A;  1J7R A;  2WCB A;  3IQO A;  2Y1N A;  1YX8 A;  5DKR A;  2KI4 C;  2LE9 B;  1M46 A;  3GK1 A;  4DUQ A;  1JSA A;  1KFU S;  2CCM A;  1UHJ A;  5KSZ A;  5F6T A;  5GQQ C;  4ZCU A;  4HRH A;  4IL1 A;  1A4P A;  4DRW A;  4YRU A;  1UUS A;  1DJH A;  1MF8 B;  2PRU A;  1NIW A;  4YBH B;  2LUC A;  2KHN A;  2KFF A;  2LMU A;  2OS8 B;  2L51 A;  3I5H C;  4CFQ A;  1NCZ A;  1CDP A;  3SG3 A;  1MR8 A;  1JFJ A;  5DKN A;  3BUO B;  1S1E A;  1NCY A;  1KQM B;  1OMV A;  1S6I A;  2GV5 A;  2IS9 A;  3FIA A;  4GFT A;  1M63 B;  2PMY A;  3TS5 B;  2D8N A;  1OOJ A;  3ZNI A;  2HQW A;  2LLS A;  1V1G A;  1SR6 B;  1SY9 A;  3O4Y A;  4PE4 A;  4DIR A;  2ZFD A;  1CDN A;  4MZL A;  4OV2 A;  1NX0 A;  1F70 A;  1EG4 A;  5HKW A;  1PVB A;  1G8I A;  2K8M B;  3O6B A;  1QV1 A;  1MHO A;  2M7L A;  2F3Z A;  1AUI B;  2AMI A;  1LXF C;  1S6J A;  4NDC A;  4MLW A;  4JWQ A;  2MLF C;  1TN4 A;  3TUY B;  1U5I B;  1YVL A;  1JFK A;  1NYA A;  3OB2 B;  1EXR A;  2A4J A;  2BE4 A;  2L50 A;  3CGA A;  2M49 B;  1MXL C;  1QJT A;  3CR4 X;  1OZO A;  1IJ6 A;  3EKJ A;  1BT6 A;  2NCP A;  2TN4 A;  1J1E A;  3PN7 B;  1YTZ C;  2P6B B;  3HCM A;  4C0J A;  2Y5I A;  2Y1M A;  4OKH A;  2LAN A;  3DVJ A;  3EKH A;  3TZ1 A;  5I8N A;  3I5F C;  1CFP A;  3PM8 A;  2LHI A;  1K93 D;  1XFU O;  1CDM A;  3LL8 B;  1CLM A;  2HET A;  1A03 A;  3D0Y A;  4ETO A;  3EVV A;  1L7Z A;  1XVJ A;  1XYD A;  1N2D A;  2ZN8 A;  3VRP A;  1HT9 A;  1UHK A;  3OB1 B;  2JRF A;  1CTR A;  1AVS A;  5PAL A;  3WNX B;  5I2O A;  1EJ3 A;  1K9K A;  2OPO A;  1L2O B;  3PAL A;  5B8I B;  1UWO A;  3NSO A;  1XFZ O;  1ALV A;  1YUT A;  2L5X B;  1K94 A;  5I2Q A;  4TNC A;  1KK8 B;  1B8C A;  4A4B A;  2FCD A;  1S3P A;  4OVN F;  3BUM B;  1OZS A;  2LLT A;  4M2P A;  5D69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...