1XFRA

Solution structure of the bombyx mori pheromone-binding protein fragment bmpbp(1-128) at ph 6.5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic conformational equilibria in the physiological function of the Bombyx mori pheromone-binding protein.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
molecule keywords Pheromone-binding protein
total genus 43
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1xfrA00
3L4LA 2WC6A 3CZ1A 4INWA 3QMEA 2P70A 3BJHA 3L47A 3R1OA 3S0EA 4PT1A 3L4AA 2L2CA 3DYEA 1OW4A 2H8VA 2QEVA 3OGNA 3B87A 3NHTA 3D73A 3BFAA 3S0AA 1LS8A 2ERBA 1OOGA 1OOHA 1ORGA 1T14A 3BFHA 3S0DA 3B88A 3S0FA 5EL2A 3DY9A 4JD9A 4FQTA 1TWOA 2KPHA 3D76A 3V2LA 1OOFA 3R1PA 3CYZA 3D74A 3B86A 3BFBA 2QEBA 3S0GA 3N7HA 3FE9A 2QEHA 3S0BA 4INXA 3PJIA 2JPOA 4F7FA 2PQLA 1P28A 1C3ZA 2GTEA 5DICA 3B7AA 2WCHA 3CABA 2QDIA 3K1EA 3CZ0A 1GM0A 2P71A 3DXLA 4OZDA 3D75A 1TUJA 3B6XA 2WCJA 3FE8A 2QEOA 1XFRA 3DZTA 3RZSA 1DQEA 3CDNA 3NGVA 2WCLA 2WCKA 3VB1A 2FJYA 3D78A 3Q8IA 1OOIX 2WCMA 3D77A 3R1VA 3R72A 3FE6A 1C3YA 1QWVA 2WC5A 3CZ2A 3NHIA
chains in the Genus database with same CATH superfamily
3I5FB 1QLKA 3I5IB 4MBEA 5FYXA 3DD4A 3VRPA 1S6CA 1Y6WA 4I5LB 4INWA 1G8IA 1NCYA 1N2DA 1YUTA 3SG2A 1KCYA 2ZNEA 1SYMA 1NCZA 3L47A 3A8RA 2LP3A 3BUOB 3R1OA 3DF0A 4ORAB 1IG5A 2L2EA 2M1KB 3LL8B 4QJ5B 3DYEA 2DOQA 2JOJA 5JOLA 2LNKA 2BNXA 3CLNA 2LHLA 3PM2A 5I2LA 1FBVA 4PE4A 3VRRA 3D73A 1YURA 2JT8A 1EL4A 1DMOA 3EKJA 1EG4A 2ERBA 1OOGA 2BKIB 4YI8A 4JWQA 5AEQA 1T14A 2KBIA 3BYAA 4P2YB 1FF1A 1V1FA 4DUQA 2LCPA 1EJ3A 2CNPA 3B88A 1Z4HA 2H2KA 2KDHA 1B1GA 4MRYA 4PHMA 1A29A 2KAYA 1LVCD 1QVIY 4FTGA 1OZSA 2JULA 4MVFA 4C0JA 3IVTA 1CDPA 4U8DA 5ER5A 5I94A 2PMYA 3NSOA 4MRXA 3UNWA 4FQTA 2LMUA 2OPOA 4PE0A 4A4BA 1SCMB 2E30A 1XO5A 2HETA 3SIBA 1GGWA 1B8CA 1VRKA 3KO0A 1BR4B 2O60A 1TNXA 2OS8B 1PSRA 2JNFA 4ORBB 5DKRA 2BL0C 2OTGC 4D1EA 3CR2A 1QX7A 1UHIA 1XFXO 4YI9A 3CYZA 2PASA 4BY4A 2JRFA 3KHEA 5G08A 1K96A 3BFBA 5HLVA 1MXLC 3AKAA 4KYNA 1SCMC 5DKQA 2M7NA 2KQYA 3JTDB 3FE9A 1V1GA 1SL8A 3O2PA 2K2AA 1A4PA 2M3WA 2MAZA 3DVJA 4MZLA 1J7RA 2BCXA 4HRHA 5KSZA 3S0BA 4WQ3A 1RFJA 3PJIA 4AQJA 1AUIB 3EVVA 5AANA 4NDBA 4E68A 1QASA 5FI7A 4MSPA 1C3ZA 2A4JA 1BODA 1F70A 1KWOC 1B47A 3B7AA 1DJXA 2M1UA 1NYAA 1NX1A 1SBJA 2O5GA 2L0PA 1OMVA 1DGVA 2K7OA 4CFQA 2LP2A 3SJSA 3SS3A 1WLMA 1GM0A 1Y1XA 2KAVA 4ZCUA 2KQ6A 4YGBB 1LINA 2F2OA 3B6XA 3NSIA 1NX2A 2KGRA 2WCJA 3FE8A 2QEOA 5F6TA 1ALWA 3RZSA 2JU0A 4PHJA 1AJ4A 2BAPA 2K7DA 4YGEB 3WXAA 2BE6A 4F0ZB 5K89A 2WCKA 1R2UA 1CMGA 2ZRTA 4JQ0D 1CM1A 3LK0A 3SIAA 1CFPA 1JC2A 4DCKA 1EH2A 2L5YA 3EVRA 1OOIX 1PVAA 1E8AA 4M2PA 4HRGA 2CCMA 3FWCA 3KF9A 1CNPA 3EKHA 1C7WA 1GQMA 1A75B 1TCFA 3JTDC 3FE6A 1TUZA 4YGDB 3PSRA 1MHOA 1K9PA 1RWYA 4OV2A 2VRGA 5CPVA 1S6IA 2LVIA 3ZWHA 3L4LA 4P5OE 2WC6A 1UWOA 1XFYO 3QMEA 2P70A 3O6BA 2EC6C 1QLSA 3BJHA 1AK8A 2K60A 1BF5A 1OMRA 2KGBC 2BE4A 4PT1A 2H61A 1MUXA 3VRNA 2NCPA 1OW4A 3DF0B 2QACA 3EK7A 2H8VA 2QEVA 5I2QA 2F3YA 5GQQC 1W7JB 1ZFSA 3BFAA 1B8LA 1UHNA 3S0AA 1OMDA 1OQPA 4FQOA 4DRWA 5HL1A 1SPYA 1J7QA 1Y1AA 1NP8A 4WQ2A 1X02A 1BMOA 1MF8B 2EC6B 2ZFDA 3PALA 5HLOA 3S0DA 2CBLA 3GK2A 2YGUA 5EL2A 3EG5B 1TCOB 3IQOA 1YX8A 2L50A 2WORA 2LUXA 1ODBA 2JT3A 3E3RA 4I5KA 4UPGA 1F8HA 1WLZA 3CR5X 2KPHA 1HT9A 1TNWA 3D76A 3H4SE 4JPZB 1SY9A 3QRXA 4PHNA 1OOFA 3GOFA 3CWGA 2ZN9A 2KFGA 1IQ5A 3KEVA 1SKTA 4MZJA 2KYFA 1CTRA 1DJGA 1OOJA 2BL0B 1DVIA 1PVBA 2OTGB 2QEBA 4OKHA 4M2QA 3S0GA 3TDUA 3FWBA 3N7HA 5TNCA 1DELA 1QX5B 4NQGA 1DJZA 1TRFA 1LA0A 4N1GA 2LLTA 3AKBA 1SRAA 2LVJA 1IKUA 4XYNA 4R1EA 4WRIA 1R6PA 2M7LA 2G9BA 1CFFA 3AAJA 3TUYC 3DVEA 1UUSA 2JPOA 1OSAA 2MHHA 4F7FA 2PQLA 2MJWB 1CB1A 5J3XA 2BBNA 2WCHA 1F4QA 2F2PA 4CIDA 1WRKA 1XFZO 2M29A 2B1UA 1QVIZ 3LLEA 2M97A 1CDNA 4PDZA 1KWOB 2QDIA 1QV1A 3K1EA 5ER4X 2MBXA 3CZ0A 1CFDA 1B7TZ 1K94A 1XK4C 3TUYB 1J7PA 2OS8C 1IGVA 2SCPA 5HKYA 2MRDA 3D0YB 2ISDA 1DF0B 1B7TY 1B8RA 3NXAA 1K8UA 1TN4A 1TTXA 2JWWA 2Y1NA 2K0JA 1K90D 3DZTA 5D3OA 1C7VA 1EG3A 2TN4A 3I5HC 4I5JA 1FI6A 1AJ5A 1KQMC 3NGVA 3HX4A 4HREE 2WCLA 4YGAA 3VRQA 2AMIA 3LCPC 4L9MA 1LKJA 2HF5A 4IL1A 5FI2A 2WCMA 1PRWA 3D77A 1DC1A 3DVMA 1MR8A 1SR6C 1SSEB 2PALA 4DS7A 3SG4A 2JZIA 3EK8A 3BOWA 1J1EA 3M0WA 4QJ3B 3OB1B 1RJVA 2P6BB 4USLA 1KSOA 3R72A 4GFTA 1JUOA 1IH0A 1CLMA 1DTLA 1W7IB 1QV0A 1FPWA 2HQWA 1QTXA 1KSMA 3SG5A 1KQMB 2GV5A 5IBWA 1EXRA 1M31A 2QPTA 3CZ1A 2MA2A 4GAOA 4OCIA 1BLQA 2CXJA 1IJ6A 2ZN8A 2AAOA 3S0EA 1YRUB 2HQ8A 1IJ5A 2BKHB 2PSRA 4OR9B 1NSHA 2KOTA 1M46A 1UHJA 2JNXA 3L4AA 2IS9A 3SS5A 1QATA 2ZNDA 3CZTX 1PK0D 1F55A 1XK4A 4GGFA 4MN0A 1JSAA 3B87A 1MWNA 3BUXB 5FI6A 2FCEA 3OHMB 1U5IB 4YBHB 3A4UB 4ORCB 1YUUA 2JTTA 2K61A 2LC5A 3BUWB 5AFPA 1OOHA 1SL9A 4HSZA 1XVJA 3LK1A 3PN7C 3HCMA 2CT9A 3BFHA 3SG6A 1M45A 1KQVA 3S0FA 2JT0A 2KI6D 2LANA 2KNEA 1KFUL 1WRZA 4GPLB 1KFUS 4NDCA 2LVVA 1AVSA 4CPVA 3V2LA 1N65A 1NCXA 2LMTA 2GGMA 1TOPA 2KFHA 3IQQA 3DVKA 3R1PA 5B8IB 4CFRA 1DEKA 3D0YA 5HKWA 1IWQA 3OX5A 3CGAA 3CR4X 4N5XA 1S6JA 1FI5A 2NXQA 5KTYA 1WY9A 3K21A 1YTZC 2NZ0A 2Y4QA 1WDCC 5KU1A 1DGUA 2QEHA 1ZUZA 2RGIA 1G4YR 3BOWB 5D69A 1GGZA 4ETOA 2KI4C 3MSEB 1JFJA 1Q80A 1CLBA 3ICBA 1WRLA 4XJKA 5CSFA 1P28A 1W9ZA 1J55A 4A4CA 4QJ4B 2JXLA 3TS5B 1DJIA 1QIWA 2I7AA 1MXEA 2K2FA 3BUNB 2ZRSA 1IQ3A 1RK9A 3I5IC 1BOCA 2WNDA 3TS5C 1N0YA 3CABA 1RROA 3SS4A 1AHRA 1SCVA 3PN7B 1L7ZA 1BT6A 4PHKA 1LXFC 2Q91A 3IF7A 1QS7A 2P71A 5HKZA 3DXLA 3JVTB 3CTNA 1KFXS 4ZCVA 2KI4B 3WHTB 1LA3A 3ZNIA 1BG1A 1F71A 3TDZA 1DJHA 2H61C 1TUJA 1QIVA 3RM1A 2JXCA 2LM5A 4ICBA 3SG3A 5BPJA 3GK1A 4N1FA 1NUBA 1YVLA 4GBAA 5JJGA 4GGNA 3PFVA 1UURA 4C0LA 5DKNA 1J1DA 4TNCA 2BCAA 1ZMZA 1JF2A 1L2OB 1B4CA 4PCWA 3BXKA 2L98A 1CMFA 3F45A 3D78A 1XFVO 1XYDA 2JTZA 3UO9A 3OX6A 2BCBA 3R1VA 2EGDA 1G33A 2I2RE 1CDMA 5CSIA 1UHKA 1XFUO 1WDCB 2WCEA 2L4IA 1H4BA 2I18A 1BJFA 3WHUB 1C07A 1BU3A 1OZOA 1DJWA 4BY5A 1JBAA 2FJUB 2SASA 3SG7A 1JWDA 2AUCA 1PULA 3I5GC 1XFWO 5CSJA 2KFFA 4YGCB 2V53A 2LLUA 1QXPA 1K2HA 1SL7A 1IIOA 2M8UA 2L2CA 1UP5A 1AP4A 2LAPA 2LLSA 2Y5IA 2F8PA 1JF0A 1M39A 3NHTA 3OGNA 4GUKA 3FS7A 3C1VA 2HPSA 2WCFA 4OVNF 1LS8A 2NLNA 2BBMA 3JVTC 2ZKMX 3WNXB 1A2XA 1ORGA 3I5GB 1QJTA 2PRUA 1NX3A 1CM4A 1SW8A 1CLLA 1BR1B 1KK7Y 2KBMA 1TIZA 1B9AA 3DY9A 1K93D 3EK4A 3NSKA 1SMGA 1A03A 3BUMB 2EHBA 2PVBA 3EVUA 1MQ1A 5AXIA 2LV7A 4JD9A 2CTNA 1S3PA 1J7OA 1TWOA 2JPTA 1NPQA 3OB2B 1K9UA 1K9KA 3GK4X 4MLWA 5PALA 2LE9B 3AAKA 3TZ1A 2KI6C 4GGFC 2M0RA 1NWDA 1S1EA 4YRUA 3VROA 2Q4UA 4Q04A 4MZKA 2JQ6A 3D74A 4GNKB 2R2IA 1K95A 1YVHA 3B86A 2GGZA 3TDIA 4CLNA 1ALVA 1YUSA 2F33A 2WOSA 1Y1UA 1S5GY 3O4XA 1YX7A 4NDDA 1TNQA 1SK6D 4AOMA 3OP0A 4AQIA 1XA5A 3I5FC 1A75A 3CS1A 5HYDA 2K7BA 1NIWA 1PALA 4XJKB 1CFCA 4INXA 4PE7A 1KK7Z 1ZOTB 1D1OA 2FOTA 2F3ZA 2LHIA 3OBVA 2D8NA 1GJYA 2G2BA 2GTEA 1KFXL 5DICA 1DJYA 1L2OC 5I8NA 1DF0A 2LVKA 2L51A 2BECA 1YR5A 3RLZA 1KK8C 4I5NB 1JFKA 1M63B 3VGOA 3D10A 1S26D 1ZACA 1PSBA 4MEWA 1TNPA 4OZDA 3D75A 3NSLA 1DT7B 3PATA 3O4YA 4DIRA 1YRTB 2KYCA 2I94A 5CSNA 1IRJA 1XFRA 2K7CA 2KLDA 2L5XB 2Y1MA 4PALA 2L4HA 1UHHA 2JC2A 1FW4A 1NX0A 1KK8B 2LUCA 3O78A 5I2OA 1DQEA 3CDNA 3I5HB 1OE9B 2MLFC 5D7FA 1QX2A 1HQVA 1CDLA 1Z2CB 2K8MB 3PLFB 4C0KA 1SNLA 2E6WA 2MLEC 3VB1A 1Y0VH 2KHNA 1RTP1 2FCDA 2FJYA 2WCBA 4IJ7A 4M2OA 3Q8IA 3BQ3A 2COLB 3FIAA 2M9GA 1F54A 5AERA 3PM8A 2KAXA 1SR6B 2M49B 2KLEA 2NCOA 4PE1A 4JKTA 1U5IA 3KPXA 1RECA 1S36A 1C3YA 1QWVA 2WC5A 2WC8A 3CZ2A 1S5GZ 2LMVA 3NHIA 1CKKA 1H8BA 2KSPA 1F4OA 2PYQA
chains in the Genus database with same CATH topology
3L4LA 2WC6A 3CZ1A 4INWA 3QMEA 2P70A 3BJHA 3L47A 3R1OA 3S0EA 4PT1A 3L4AA 2L2CA 3DYEA 1OW4A 2H8VA 2QEVA 3OGNA 3B87A 3NHTA 3D73A 3BFAA 3S0AA 1LS8A 2ERBA 1OOGA 1OOHA 1ORGA 1T14A 3BFHA 3S0DA 3B88A 3S0FA 5EL2A 3DY9A 4JD9A 4FQTA 1TWOA 2KPHA 3D76A 3V2LA 1OOFA 3R1PA 3CYZA 3D74A 3B86A 3BFBA 2QEBA 3S0GA 3N7HA 3FE9A 2QEHA 3S0BA 4INXA 3PJIA 2JPOA 4F7FA 2PQLA 1P28A 1C3ZA 2GTEA 5DICA 3B7AA 2WCHA 3CABA 2QDIA 3K1EA 3CZ0A 1GM0A 2P71A 3DXLA 4OZDA 3D75A 1TUJA 3B6XA 2WCJA 3FE8A 2QEOA 1XFRA 3DZTA 3RZSA 1DQEA 3CDNA 3NGVA 2WCLA 2WCKA 3VB1A 2FJYA 3D78A 3Q8IA 1OOIX 2WCMA 3D77A 3R1VA 3R72A 3FE6A 1C3YA 1QWVA 2WC5A 3CZ2A 3NHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4L A;  2WC6 A;  3CZ1 A;  4INW A;  3QME A;  2P70 A;  3BJH A;  3L47 A;  3R1O A;  3S0E A;  4PT1 A;  3L4A A;  2L2C A;  3DYE A;  1OW4 A;  2H8V A;  2QEV A;  3OGN A;  3B87 A;  3NHT A;  3D73 A;  3BFA A;  3S0A A;  1LS8 A;  2ERB A;  1OOG A;  1OOH A;  1ORG A;  1T14 A;  3BFH A;  3S0D A;  3B88 A;  3S0F A;  5EL2 A;  3DY9 A;  4JD9 A;  4FQT A;  1TWO A;  2KPH A;  3D76 A;  3V2L A;  1OOF A;  3R1P A;  3CYZ A;  3D74 A;  3B86 A;  3BFB A;  2QEB A;  3S0G A;  3N7H A;  3FE9 A;  2QEH A;  3S0B A;  4INX A;  3PJI A;  2JPO A;  4F7F A;  2PQL A;  1P28 A;  1C3Z A;  2GTE A;  5DIC A;  3B7A A;  2WCH A;  3CAB A;  2QDI A;  3K1E A;  3CZ0 A;  1GM0 A;  2P71 A;  3DXL A;  4OZD A;  3D75 A;  1TUJ A;  3B6X A;  2WCJ A;  3FE8 A;  2QEO A;  1XFR A;  3DZT A;  3RZS A;  1DQE A;  3CDN A;  3NGV A;  2WCL A;  2WCK A;  3VB1 A;  2FJY A;  3D78 A;  3Q8I A;  1OOI X;  2WCM A;  3D77 A;  3R1V A;  3R72 A;  3FE6 A;  1C3Y A;  1QWV A;  2WC5 A;  3CZ2 A;  3NHI A; 
#chains in the Genus database with same CATH topology
 3I5F B;  1QLK A;  3I5I B;  4MBE A;  5FYX A;  3DD4 A;  3VRP A;  1S6C A;  1Y6W A;  4I5L B;  4INW A;  1G8I A;  1NCY A;  1N2D A;  1YUT A;  3SG2 A;  1KCY A;  2ZNE A;  1SYM A;  1NCZ A;  3L47 A;  3A8R A;  2LP3 A;  3BUO B;  3R1O A;  3DF0 A;  4ORA B;  1IG5 A;  2L2E A;  2M1K B;  3LL8 B;  4QJ5 B;  3DYE A;  2DOQ A;  2JOJ A;  5JOL A;  2LNK A;  2BNX A;  3CLN A;  2LHL A;  3PM2 A;  5I2L A;  1FBV A;  4PE4 A;  3VRR A;  3D73 A;  1YUR A;  2JT8 A;  1EL4 A;  1DMO A;  3EKJ A;  1EG4 A;  2ERB A;  1OOG A;  2BKI B;  4YI8 A;  4JWQ A;  5AEQ A;  1T14 A;  2KBI A;  3BYA A;  4P2Y B;  1FF1 A;  1V1F A;  4DUQ A;  2LCP A;  1EJ3 A;  2CNP A;  3B88 A;  1Z4H A;  2H2K A;  2KDH A;  1B1G A;  4MRY A;  4PHM A;  1A29 A;  2KAY A;  1LVC D;  1QVI Y;  4FTG A;  1OZS A;  2JUL A;  4MVF A;  4C0J A;  3IVT A;  1CDP A;  4U8D A;  5ER5 A;  5I94 A;  2PMY A;  3NSO A;  4MRX A;  3UNW A;  4FQT A;  2LMU A;  2OPO A;  4PE0 A;  4A4B A;  1SCM B;  2E30 A;  1XO5 A;  2HET A;  3SIB A;  1GGW A;  1B8C A;  1VRK A;  3KO0 A;  1BR4 B;  2O60 A;  1TNX A;  2OS8 B;  1PSR A;  2JNF A;  4ORB B;  5DKR A;  2BL0 C;  2OTG C;  4D1E A;  3CR2 A;  1QX7 A;  1UHI A;  1XFX O;  4YI9 A;  3CYZ A;  2PAS A;  4BY4 A;  2JRF A;  3KHE A;  5G08 A;  1K96 A;  3BFB A;  5HLV A;  1MXL C;  3AKA A;  4KYN A;  1SCM C;  5DKQ A;  2M7N A;  2KQY A;  3JTD B;  3FE9 A;  1V1G A;  1SL8 A;  3O2P A;  2K2A A;  1A4P A;  2M3W A;  2MAZ A;  3DVJ A;  4MZL A;  1J7R A;  2BCX A;  4HRH A;  5KSZ A;  3S0B A;  4WQ3 A;  1RFJ A;  3PJI A;  4AQJ A;  1AUI B;  3EVV A;  5AAN A;  4NDB A;  4E68 A;  1QAS A;  5FI7 A;  4MSP A;  1C3Z A;  2A4J A;  1BOD A;  1F70 A;  1KWO C;  1B47 A;  3B7A A;  1DJX A;  2M1U A;  1NYA A;  1NX1 A;  1SBJ A;  2O5G A;  2L0P A;  1OMV A;  1DGV A;  2K7O A;  4CFQ A;  2LP2 A;  3SJS A;  3SS3 A;  1WLM A;  1GM0 A;  1Y1X A;  2KAV A;  4ZCU A;  2KQ6 A;  4YGB B;  1LIN A;  2F2O A;  3B6X A;  3NSI A;  1NX2 A;  2KGR A;  2WCJ A;  3FE8 A;  2QEO A;  5F6T A;  1ALW A;  3RZS A;  2JU0 A;  4PHJ A;  1AJ4 A;  2BAP A;  2K7D A;  4YGE B;  3WXA A;  2BE6 A;  4F0Z B;  5K89 A;  2WCK A;  1R2U A;  1CMG A;  2ZRT A;  4JQ0 D;  1CM1 A;  3LK0 A;  3SIA A;  1CFP A;  1JC2 A;  4DCK A;  1EH2 A;  2L5Y A;  3EVR A;  1OOI X;  1PVA A;  1E8A A;  4M2P A;  4HRG A;  2CCM A;  3FWC A;  3KF9 A;  1CNP A;  3EKH A;  1C7W A;  1GQM A;  1A75 B;  1TCF A;  3JTD C;  3FE6 A;  1TUZ A;  4YGD B;  3PSR A;  1MHO A;  1K9P A;  1RWY A;  4OV2 A;  2VRG A;  5CPV A;  1S6I A;  2LVI A;  3ZWH A;  3L4L A;  4P5O E;  2WC6 A;  1UWO A;  1XFY O;  3QME A;  2P70 A;  3O6B A;  2EC6 C;  1QLS A;  3BJH A;  1AK8 A;  2K60 A;  1BF5 A;  1OMR A;  2KGB C;  2BE4 A;  4PT1 A;  2H61 A;  1MUX A;  3VRN A;  2NCP A;  1OW4 A;  3DF0 B;  2QAC A;  3EK7 A;  2H8V A;  2QEV A;  5I2Q A;  2F3Y A;  5GQQ C;  1W7J B;  1ZFS A;  3BFA A;  1B8L A;  1UHN A;  3S0A A;  1OMD A;  1OQP A;  4FQO A;  4DRW A;  5HL1 A;  1SPY A;  1J7Q A;  1Y1A A;  1NP8 A;  4WQ2 A;  1X02 A;  1BMO A;  1MF8 B;  2EC6 B;  2ZFD A;  3PAL A;  5HLO A;  3S0D A;  2CBL A;  3GK2 A;  2YGU A;  5EL2 A;  3EG5 B;  1TCO B;  3IQO A;  1YX8 A;  2L50 A;  2WOR A;  2LUX A;  1ODB A;  2JT3 A;  3E3R A;  4I5K A;  4UPG A;  1F8H A;  1WLZ A;  3CR5 X;  2KPH A;  1HT9 A;  1TNW A;  3D76 A;  3H4S E;  4JPZ B;  1SY9 A;  3QRX A;  4PHN A;  1OOF A;  3GOF A;  3CWG A;  2ZN9 A;  2KFG A;  1IQ5 A;  3KEV A;  1SKT A;  4MZJ A;  2KYF A;  1CTR A;  1DJG A;  1OOJ A;  2BL0 B;  1DVI A;  1PVB A;  2OTG B;  2QEB A;  4OKH A;  4M2Q A;  3S0G A;  3TDU A;  3FWB A;  3N7H A;  5TNC A;  1DEL A;  1QX5 B;  4NQG A;  1DJZ A;  1TRF A;  1LA0 A;  4N1G A;  2LLT A;  3AKB A;  1SRA A;  2LVJ A;  1IKU A;  4XYN A;  4R1E A;  4WRI A;  1R6P A;  2M7L A;  2G9B A;  1CFF A;  3AAJ A;  3TUY C;  3DVE A;  1UUS A;  2JPO A;  1OSA A;  2MHH A;  4F7F A;  2PQL A;  2MJW B;  1CB1 A;  5J3X A;  2BBN A;  2WCH A;  1F4Q A;  2F2P A;  4CID A;  1WRK A;  1XFZ O;  2M29 A;  2B1U A;  1QVI Z;  3LLE A;  2M97 A;  1CDN A;  4PDZ A;  1KWO B;  2QDI A;  1QV1 A;  3K1E A;  5ER4 X;  2MBX A;  3CZ0 A;  1CFD A;  1B7T Z;  1K94 A;  1XK4 C;  3TUY B;  1J7P A;  2OS8 C;  1IGV A;  2SCP A;  5HKY A;  2MRD A;  3D0Y B;  2ISD A;  1DF0 B;  1B7T Y;  1B8R A;  3NXA A;  1K8U A;  1TN4 A;  1TTX A;  2JWW A;  2Y1N A;  2K0J A;  1K90 D;  3DZT A;  5D3O A;  1C7V A;  1EG3 A;  2TN4 A;  3I5H C;  4I5J A;  1FI6 A;  1AJ5 A;  1KQM C;  3NGV A;  3HX4 A;  4HRE E;  2WCL A;  4YGA A;  3VRQ A;  2AMI A;  3LCP C;  4L9M A;  1LKJ A;  2HF5 A;  4IL1 A;  5FI2 A;  2WCM A;  1PRW A;  3D77 A;  1DC1 A;  3DVM A;  1MR8 A;  1SR6 C;  1SSE B;  2PAL A;  4DS7 A;  3SG4 A;  2JZI A;  3EK8 A;  3BOW A;  1J1E A;  3M0W A;  4QJ3 B;  3OB1 B;  1RJV A;  2P6B B;  4USL A;  1KSO A;  3R72 A;  4GFT A;  1JUO A;  1IH0 A;  1CLM A;  1DTL A;  1W7I B;  1QV0 A;  1FPW A;  2HQW A;  1QTX A;  1KSM A;  3SG5 A;  1KQM B;  2GV5 A;  5IBW A;  1EXR A;  1M31 A;  2QPT A;  3CZ1 A;  2MA2 A;  4GAO A;  4OCI A;  1BLQ A;  2CXJ A;  1IJ6 A;  2ZN8 A;  2AAO A;  3S0E A;  1YRU B;  2HQ8 A;  1IJ5 A;  2BKH B;  2PSR A;  4OR9 B;  1NSH A;  2KOT A;  1M46 A;  1UHJ A;  2JNX A;  3L4A A;  2IS9 A;  3SS5 A;  1QAT A;  2ZND A;  3CZT X;  1PK0 D;  1F55 A;  1XK4 A;  4GGF A;  4MN0 A;  1JSA A;  3B87 A;  1MWN A;  3BUX B;  5FI6 A;  2FCE A;  3OHM B;  1U5I B;  4YBH B;  3A4U B;  4ORC B;  1YUU A;  2JTT A;  2K61 A;  2LC5 A;  3BUW B;  5AFP A;  1OOH A;  1SL9 A;  4HSZ A;  1XVJ A;  3LK1 A;  3PN7 C;  3HCM A;  2CT9 A;  3BFH A;  3SG6 A;  1M45 A;  1KQV A;  3S0F A;  2JT0 A;  2KI6 D;  2LAN A;  2KNE A;  1KFU L;  1WRZ A;  4GPL B;  1KFU S;  4NDC A;  2LVV A;  1AVS A;  4CPV A;  3V2L A;  1N65 A;  1NCX A;  2LMT A;  2GGM A;  1TOP A;  2KFH A;  3IQQ A;  3DVK A;  3R1P A;  5B8I B;  4CFR A;  1DEK A;  3D0Y A;  5HKW A;  1IWQ A;  3OX5 A;  3CGA A;  3CR4 X;  4N5X A;  1S6J A;  1FI5 A;  2NXQ A;  5KTY A;  1WY9 A;  3K21 A;  1YTZ C;  2NZ0 A;  2Y4Q A;  1WDC C;  5KU1 A;  1DGU A;  2QEH A;  1ZUZ A;  2RGI A;  1G4Y R;  3BOW B;  5D69 A;  1GGZ A;  4ETO A;  2KI4 C;  3MSE B;  1JFJ A;  1Q80 A;  1CLB A;  3ICB A;  1WRL A;  4XJK A;  5CSF A;  1P28 A;  1W9Z A;  1J55 A;  4A4C A;  4QJ4 B;  2JXL A;  3TS5 B;  1DJI A;  1QIW A;  2I7A A;  1MXE A;  2K2F A;  3BUN B;  2ZRS A;  1IQ3 A;  1RK9 A;  3I5I C;  1BOC A;  2WND A;  3TS5 C;  1N0Y A;  3CAB A;  1RRO A;  3SS4 A;  1AHR A;  1SCV A;  3PN7 B;  1L7Z A;  1BT6 A;  4PHK A;  1LXF C;  2Q91 A;  3IF7 A;  1QS7 A;  2P71 A;  5HKZ A;  3DXL A;  3JVT B;  3CTN A;  1KFX S;  4ZCV A;  2KI4 B;  3WHT B;  1LA3 A;  3ZNI A;  1BG1 A;  1F71 A;  3TDZ A;  1DJH A;  2H61 C;  1TUJ A;  1QIV A;  3RM1 A;  2JXC A;  2LM5 A;  4ICB A;  3SG3 A;  5BPJ A;  3GK1 A;  4N1F A;  1NUB A;  1YVL A;  4GBA A;  5JJG A;  4GGN A;  3PFV A;  1UUR A;  4C0L A;  5DKN A;  1J1D A;  4TNC A;  2BCA A;  1ZMZ A;  1JF2 A;  1L2O B;  1B4C A;  4PCW A;  3BXK A;  2L98 A;  1CMF A;  3F45 A;  3D78 A;  1XFV O;  1XYD A;  2JTZ A;  3UO9 A;  3OX6 A;  2BCB A;  3R1V A;  2EGD A;  1G33 A;  2I2R E;  1CDM A;  5CSI A;  1UHK A;  1XFU O;  1WDC B;  2WCE A;  2L4I A;  1H4B A;  2I18 A;  1BJF A;  3WHU B;  1C07 A;  1BU3 A;  1OZO A;  1DJW A;  4BY5 A;  1JBA A;  2FJU B;  2SAS A;  3SG7 A;  1JWD A;  2AUC A;  1PUL A;  3I5G C;  1XFW O;  5CSJ A;  2KFF A;  4YGC B;  2V53 A;  2LLU A;  1QXP A;  1K2H A;  1SL7 A;  1IIO A;  2M8U A;  2L2C A;  1UP5 A;  1AP4 A;  2LAP A;  2LLS A;  2Y5I A;  2F8P A;  1JF0 A;  1M39 A;  3NHT A;  3OGN A;  4GUK A;  3FS7 A;  3C1V A;  2HPS A;  2WCF A;  4OVN F;  1LS8 A;  2NLN A;  2BBM A;  3JVT C;  2ZKM X;  3WNX B;  1A2X A;  1ORG A;  3I5G B;  1QJT A;  2PRU A;  1NX3 A;  1CM4 A;  1SW8 A;  1CLL A;  1BR1 B;  1KK7 Y;  2KBM A;  1TIZ A;  1B9A A;  3DY9 A;  1K93 D;  3EK4 A;  3NSK A;  1SMG A;  1A03 A;  3BUM B;  2EHB A;  2PVB A;  3EVU A;  1MQ1 A;  5AXI A;  2LV7 A;  4JD9 A;  2CTN A;  1S3P A;  1J7O A;  1TWO A;  2JPT A;  1NPQ A;  3OB2 B;  1K9U A;  1K9K A;  3GK4 X;  4MLW A;  5PAL A;  2LE9 B;  3AAK A;  3TZ1 A;  2KI6 C;  4GGF C;  2M0R A;  1NWD A;  1S1E A;  4YRU A;  3VRO A;  2Q4U A;  4Q04 A;  4MZK A;  2JQ6 A;  3D74 A;  4GNK B;  2R2I A;  1K95 A;  1YVH A;  3B86 A;  2GGZ A;  3TDI A;  4CLN A;  1ALV A;  1YUS A;  2F33 A;  2WOS A;  1Y1U A;  1S5G Y;  3O4X A;  1YX7 A;  4NDD A;  1TNQ A;  1SK6 D;  4AOM A;  3OP0 A;  4AQI A;  1XA5 A;  3I5F C;  1A75 A;  3CS1 A;  5HYD A;  2K7B A;  1NIW A;  1PAL A;  4XJK B;  1CFC A;  4INX A;  4PE7 A;  1KK7 Z;  1ZOT B;  1D1O A;  2FOT A;  2F3Z A;  2LHI A;  3OBV A;  2D8N A;  1GJY A;  2G2B A;  2GTE A;  1KFX L;  5DIC A;  1DJY A;  1L2O C;  5I8N A;  1DF0 A;  2LVK A;  2L51 A;  2BEC A;  1YR5 A;  3RLZ A;  1KK8 C;  4I5N B;  1JFK A;  1M63 B;  3VGO A;  3D10 A;  1S26 D;  1ZAC A;  1PSB A;  4MEW A;  1TNP A;  4OZD A;  3D75 A;  3NSL A;  1DT7 B;  3PAT A;  3O4Y A;  4DIR A;  1YRT B;  2KYC A;  2I94 A;  5CSN A;  1IRJ A;  1XFR A;  2K7C A;  2KLD A;  2L5X B;  2Y1M A;  4PAL A;  2L4H A;  1UHH A;  2JC2 A;  1FW4 A;  1NX0 A;  1KK8 B;  2LUC A;  3O78 A;  5I2O A;  1DQE A;  3CDN A;  3I5H B;  1OE9 B;  2MLF C;  5D7F A;  1QX2 A;  1HQV A;  1CDL A;  1Z2C B;  2K8M B;  3PLF B;  4C0K A;  1SNL A;  2E6W A;  2MLE C;  3VB1 A;  1Y0V H;  2KHN A;  1RTP 1;  2FCD A;  2FJY A;  2WCB A;  4IJ7 A;  4M2O A;  3Q8I A;  3BQ3 A;  2COL B;  3FIA A;  2M9G A;  1F54 A;  5AER A;  3PM8 A;  2KAX A;  1SR6 B;  2M49 B;  2KLE A;  2NCO A;  4PE1 A;  4JKT A;  1U5I A;  3KPX A;  1REC A;  1S36 A;  1C3Y A;  1QWV A;  2WC5 A;  2WC8 A;  3CZ2 A;  1S5G Z;  2LMV A;  3NHI A;  1CKK A;  1H8B A;  2KSP A;  1F4O A;  2PYQ A; 
#chains in the Genus database with same CATH homology
 3L4L A;  2WC6 A;  3CZ1 A;  4INW A;  3QME A;  2P70 A;  3BJH A;  3L47 A;  3R1O A;  3S0E A;  4PT1 A;  3L4A A;  2L2C A;  3DYE A;  1OW4 A;  2H8V A;  2QEV A;  3OGN A;  3B87 A;  3NHT A;  3D73 A;  3BFA A;  3S0A A;  1LS8 A;  2ERB A;  1OOG A;  1OOH A;  1ORG A;  1T14 A;  3BFH A;  3S0D A;  3B88 A;  3S0F A;  5EL2 A;  3DY9 A;  4JD9 A;  4FQT A;  1TWO A;  2KPH A;  3D76 A;  3V2L A;  1OOF A;  3R1P A;  3CYZ A;  3D74 A;  3B86 A;  3BFB A;  2QEB A;  3S0G A;  3N7H A;  3FE9 A;  2QEH A;  3S0B A;  4INX A;  3PJI A;  2JPO A;  4F7F A;  2PQL A;  1P28 A;  1C3Z A;  2GTE A;  5DIC A;  3B7A A;  2WCH A;  3CAB A;  2QDI A;  3K1E A;  3CZ0 A;  1GM0 A;  2P71 A;  3DXL A;  4OZD A;  3D75 A;  1TUJ A;  3B6X A;  2WCJ A;  3FE8 A;  2QEO A;  1XFR A;  3DZT A;  3RZS A;  1DQE A;  3CDN A;  3NGV A;  2WCL A;  2WCK A;  3VB1 A;  2FJY A;  3D78 A;  3Q8I A;  1OOI X;  2WCM A;  3D77 A;  3R1V A;  3R72 A;  3FE6 A;  1C3Y A;  1QWV A;  2WC5 A;  3CZ2 A;  3NHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...