1XFRA

Solution structure of the bombyx mori pheromone-binding protein fragment bmpbp(1-128) at ph 6.5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein
publication title Dynamic conformational equilibria in the physiological function of the Bombyx mori pheromone-binding protein.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 43
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1xfrA00
3S0GA 3L4LA 3R72A 2WCJA 3CZ1A 1C3YA 3CYZA 5EL2A 3VB1A 3DXLA 2WCKA 2QEHA 2WC6A 1ORGA 3D75A 3PJIA 3V2LA 3CZ2A 4FQTA 3FE9A 3L47A 4INXA 3K1EA 3B6XA 2WCLA 3QMEA 3R1PA 3B86A 4INWA 4PT1A 2GTEA 4JD9A 2WCHA 2WC5A 3D78A 3NHTA 3DZTA 1C3ZA 3R1VA 4OZDA 3R1OA 1GM0A 3CDNA 3B7AA 3D76A 3FE6A 2PQLA 3DY9A 1LS8A 3B87A 3CABA 4F7FA 3OGNA 3BFAA 2QEBA 1T14A 1OOGA 3FE8A 3L4AA 3CZ0A 2ERBA 1TUJA 3RZSA 3NHIA 2QDIA 3S0AA 2JPOA 1OW4A 1OOFA 2P70A 3S0DA 3D73A 2KPHA 3BFBA 3BFHA 1DQEA 1XFRA 3BJHA 1OOIX 3S0EA 3S0FA 5DICA 3S0BA 3D77A 2H8VA 1QWVA 1P28A 2QEVA 3B88A 2L2CA 1OOHA 2QEOA 2WCMA 2FJYA 3Q8IA 1TWOA 3DYEA 3D74A 3NGVA 3N7HA 2P71A
chains in the Genus database with same CATH superfamily
2OTGB 1BLQA 2OTGC 3NSIA 3L4LA 2G9BA 2K7BA 2WCJA 3I5HB 2RGIA 5HKWA 3I5HC 1F71A 4MLWA 1RWYA 3EK4A 1UP5A 3TUYC 1WLZA 1C3YA 2LLSA 2KYCA 2L5YA 2L98A 1HT9A 1NWDA 1XVJA 1YX7A 2WCKA 1DT7B 3NXAA 2JXLA 4HSZA 1ORGA 3D75A 3PJIA 1XFWO 1JSAA 2IS9A 1WY9A 1AJ5A 2K60A 2JQ6A 3CZ2A 4FQTA 1DJWA 1CDMA 1CDLA 2K61A 1TNPA 3L47A 5I94A 1KK8B 1PVAA 2BKHB 1CLMA 1K96A 3B6XA 5FYXA 3RLZA 5AFPA 5JJGA 2WCLA 4I5LB 1MXEA 2KQ6A 4INWA 2BE4A 1QLKA 2PRUA 1XFXO 5GQQC 2KFGA 3D78A 2Y1MA 3NHTA 2KFHA 3BUWB 4OVNF 2EHBA 3PLFB 4N1FA 5PALA 5KU1A 1GGWA 4QJ3B 5B8IB 1S36A 2LLTA 3R1VA 1L7ZA 1OMRA 1QIVA 2GGZA 3O78A 3R1OA 3EVRA 2D8NA 4R1EA 1SCVA 5HKYA 1TCOB 1DGUA 4JQ0D 1XFUO 4JKTA 3B7AA 3SIAA 1XFYO 5FI2A 1GGZA 1DJGA 1K94A 2PQLA 3QRXA 3EKHA 1B8CA 1OZSA 4BY4A 1SYMA 1K93D 1OE9B 3H4SE 1XYDA 1SRAA 2NLNA 1NIWA 2JXCA 2JNFA 1NSHA 1EH2A 1OOGA 1YUTA 2JT0A 1A2XA 1AHRA 1KFXL 3L4AA 1S5GY 1ZFSA 1TOPA 1H8BA 5CSIA 2M29A 2ERBA 3DVJA 1SL8A 4A4BA 2MAZA 1BJFA 3AAKA 1BF5A 3M0WA 3CR2A 1PULA 1ALWA 4L9MA 1Y1XA 3VROA 1XK4C 1D1OA 2LMVA 1OW4A 1SCMB 2JT8A 2PYQA 2TN4A 3FWCA 1K9KA 3OX5A 4JPZB 1EL4A 1B8LA 3D73A 4DS7A 2EC6B 4XJKB 2F3ZA 2KOTA 1PK0D 3OHMB 5CSFA 1FI5A 2KAYA 2BAPA 4MRXA 1QTXA 1XFRA 2F2PA 3NSLA 3BJHA 1FPWA 4ZCUA 3I5FB 2JOJA 2SCPA 2MBXA 3I5FC 4PE7A 5DKRA 4M2OA 3S0EA 2L4IA 5HLVA 5DICA 1YR5A 1KQMC 3S0BA 3D77A 1Y1AA 1IQ5A 2QEVA 5AXIA 1YRUB 1PALA 1SMGA 3B88A 2H61C 1WDCB 1Z4HA 4CLNA 2O5GA 1OOHA 1IJ5A 1WDCC 2QEOA 1V1FA 2FJYA 2L51A 1CB1A 1DVIA 1V1GA 2LUCA 3A8RA 2MRDA 5K89A 1CDNA 1RJVA 3LL8B 1QX5B 3PN7B 3VRNA 4MBEA 4YGEB 2G2BA 1H4BA 5G08A 2L2EA 3VRQA 1QV1A 1XK4A 1KQVA 5FI7A 4AOMA 3EKJA 2JNXA 3CZ1A 4OV2A 2M1KB 4DCKA 3CYZA 2WORA 2ZRSA 1IWQA 4WQ2A 3UNWA 1IQ3A 4ORBB 1DEKA 2JULA 2KFFA 4CFRA 1B9AA 4XJKA 2CCMA 2WC6A 3LK1A 1G33A 3SG3A 3WHUB 2MHHA 3E3RA 1LKJA 2NXQA 2NZ0A 1ALVA 2BL0B 2SASA 1UHKA 4WRIA 4DRWA 4MZLA 3V2LA 2BL0C 1M39A 1IJ6A 3D10A 1KFUL 2PALA 3KHEA 1SR6B 5AEQA 4HRGA 4INXA 5I2LA 1C07A 2CXJA 4C0LA 3O6BA 3EG5B 1CM4A 2KYFA 3QMEA 1KFXS 4YBHB 1B8RA 1RFJA 2QACA 3DVMA 1B1GA 1KWOB 1KSOA 2WCHA 3BUXB 1Y1UA 1KWOC 1A29A 4AQIA 1YVHA 1HQVA 3TUYB 3ZNIA 1UUSA 1YX8A 3DZTA 3KEVA 4ETOA 2LHLA 3CWGA 5DKQA 1MQ1A 1A75B 2M9GA 2QPTA 2JU0A 4QJ5B 4ICBA 1GM0A 1TRFA 4FQOA 1CFPA 3I5GC 2VRGA 2YGUA 2KBMA 1IH0A 5AERA 2Y1NA 1EG4A 1U5IB 2KI4B 2EGDA 5J3XA 1YRTB 2KI4C 3FE6A 2K7DA 3SG7A 2MLEC 4GNKB 1LS8A 4GGFA 2ZKMX 3CABA 1S6IA 2JTZA 3IQOA 5D69A 4NDDA 1IRJA 2I94A 2WCBA 3BFAA 2L50A 1RTP1 3PATA 2QEBA 1PVBA 3O4YA 4UPGA 1PSRA 1EXRA 3BQ3A 1T14A 1NPQA 4MEWA 3HX4A 2ISDA 5DKNA 2M97A 4DUQA 2F3YA 2ZRTA 3FE8A 4TNCA 2CBLA 4QJ4B 2Y4QA 2LC5A 3PALA 1B4CA 2FOTA 3FIAA 1TUJA 3SS5A 5HKZA 5KSZA 1CLLA 4JWQA 1NCYA 2I18A 4N5XA 4P5OE 1L2OB 2QDIA 3TDUA 1YUUA 1L2OC 1F4QA 1TUZA 1TNWA 3IF7A 1K9PA 1OOFA 4YGDB 3SS3A 1OOJA 1VRKA 2WCFA 3IQQA 1J7QA 1DJIA 3BFBA 4NQGA 2L0PA 1G4YR 1M63B 1A75A 3I5IC 1CFFA 2K2FA 2HQWA 2B1UA 3KO0A 2Y5IA 4WQ3A 1QATA 1OOIX 4IL1A 1NP8A 1SBJA 3TDIA 4F0ZB 3S0FA 4PHMA 5BPJA 1UWOA 3O2PA 1BODA 1P28A 1U5IA 2H8VA 1DF0B 1R2UA 3GK4X 1CFCA 5HYDA 1AP4A 4GFTA 2LP2A 2WCMA 1KFUS 5D3OA 2OS8B 2GGMA 2OS8C 2HF5A 2ZNDA 1JWDA 1BG1A 2KGBC 3DYEA 1UHNA 1SK6D 1XFZO 1JF2A 3DVEA 3JVTB 2ZN8A 3JVTC 1M45A 1CMGA 2P71A 4OKHA 2JZIA 2M7LA 1WLMA 5I8NA 1OQPA 1YTZC 3ICBA 1MXLC 2KGRA 4YRUA 1Y6WA 1PRWA 1E8AA 1WRKA 4I5JA 1CTRA 2LCPA 4M2QA 4I5NB 1SPYA 3K21A 1QXPA 1KQMB 5EL2A 1WRLA 1S26D 3KPXA 1R6PA 3DVKA 1SL9A 1Z2CB 1J7OA 1DELA 3VB1A 2M1UA 3D0YB 1BT6A 3HCMA 1J1DA 2I7AA 4PE4A 3IVTA 3GK2A 1MUXA 3NSOA 1LXFC 4PALA 4USLA 3AKAA 1G8IA 1JBAA 3LLEA 2Q4UA 5KTYA 2L5XB 2PMYA 2V53A 1WRZA 4PHJA 2LLUA 3ZWHA 1CM1A 1DF0A 1NX2A 1NYAA 2GV5A 2KDHA 1QVIY 1TCFA 3R1PA 2LV7A 1J7PA 4PT1A 4MZJA 3GOFA 4JD9A 3DD4A 3A4UB 5CSJA 1K2HA 1DJZA 4PHKA 2LE9B 2NCOA 1CLBA 5ER4X 3TZ1A 1C3ZA 1QVIZ 2KI6D 1IKUA 4ORAB 2M8UA 2K2AA 2FCDA 3DF0B 4IJ7A 2CT9A 3VRPA 2KLDA 1TTXA 4OZDA 2KNEA 3SJSA 1S1EA 3PM8A 4HRHA 1OMVA 1S6CA 1SSEB 2WOSA 3CDNA 3PM2A 2M7NA 4GGNA 3D76A 1AK8A 2LHIA 3SG4A 4I5KA 2BBNA 3DY9A 4OCIA 1C7WA 1YUSA 1LINA 1UHIA 4NDCA 3LCPC 4PCWA 4ZCVA 5HLOA 2E6WA 1M31A 3SG2A 1F4OA 1JUOA 5AANA 2H61A 3D0YA 5TNCA 2K0JA 1NUBA 4NDBA 1F8HA 3AAJA 2LMTA 2BNXA 1XA5A 1B7TZ 2MLFC 1GJYA 3CZ0A 4U8DA 2BECA 5IBWA 4XYNA 3PSRA 4YI9A 1DC1A 3BUOB 4GUKA 3RZSA 3NHIA 1JFJA 2BE6A 3C1VA 1SW8A 1Q80A 1X02A 3I5GB 3S0AA 1CMFA 1ODBA 1DMOA 2M0RA 1LA3A 1UHJA 3OP0A 2I2RE 1B47A 1Y0VH 2P70A 1F54A 1FF1A 2JTTA 1W7IB 1TIZA 1ZUZA 4M2PA 2JT3A 3CR5X 1TN4A 1W7JB 2AUCA 1SL7A 2M3WA 3BFHA 2K8MB 3DF0A 4MSPA 4YI8A 3WNXB 5I2OA 2DOQA 2BCAA 2ZFDA 1IG5A 5CPVA 2HETA 1BR1B 4MN0A 1SY9A 3CGAA 2LVKA 3CS1A 1ZMZA 2BBMA 2NCPA 1C7VA 1J1EA 1QLSA 4C0KA 2L2CA 1K9UA 2LVIA 1AJ4A 3OB1B 5HL1A 1DJYA 1XFVO 1NCZA 2LANA 4MRYA 1N65A 2KSPA 2PSRA 1JC2A 3CTNA 1LVCD 2LAPA 1SNLA 4GPLB 3CR4X 1KK8C 3S0GA 1F55A 1QJTA 1F70A 1KCYA 3I5IB 3MSEB 1KSMA 3R72A 3WXAA 1QX7A 1NX1A 5ER5A 3OB2B 1A03A 2FJUB 2WCEA 1LA0A 1MF8B 2CTNA 2KI6C 2JPTA 2KHNA 5F6TA 2LNKA 3DXLA 4CPVA 1EJ3A 2QEHA 2WNDA 4ORCB 2LVJA 3VRRA 1JF0A 1NCXA 2LUXA 4MVFA 4E68A 1AVSA 1MWNA 4YGCB 4CFQA 3FE9A 1CFDA 2A4JA 2MJWB 1DTLA 1S3PA 3BOWB 1CNPA 3K1EA 3CLNA 4N1GA 4PDZA 1QS7A 2Q91A 1RK9A 1QV0A 2JC2A 2K7OA 3AKBA 1J55A 1DJHA 3B86A 4AQJA 2P6BB 4CIDA 2GTEA 1QX2A 2WC5A 1MR8A 1OZOA 4PHNA 4YGBB 5FI6A 1DJXA 3SS4A 1QIWA 1DGVA 1OMDA 2E30A 4OR9B 4C0JA 1BR4B 4P2YB 4MZKA 1S5GZ 2FCEA 1XO5A 2LMUA 4PE1A 1BU3A 2F8PA 1A4PA 4HREE 1UHHA 1IGVA 2BCXA 3BXKA 1SKTA 1SCMC 2F2OA 3EK7A 3RM1A 2AMIA 1K95A 1YURA 2ZN9A 1PSBA 1GQMA 3LK0A 1OSAA 2KBIA 1BMOA 2EC6C 5CSNA 3B87A 2H2KA 4F7FA 4GBAA 3OGNA 2JWWA 2KAVA 3NSKA 3EK8A 1CKKA 4Q04A 1IIOA 3WHTB 2BKIB 2AAOA 1M46A 1FW4A 3SG6A 1CDPA 2R2IA 2MA2A 1NX0A 1KK7Y 3EVVA 2K7CA 4GAOA 1FBVA 3PFVA 3BUNB 3OBVA 5D7FA 2HPSA 3BOWA 3OX6A 1NX3A 3O4XA 1K90D 1KK7Z 1N0YA 2JPOA 3F45A 2M49B 4KYNA 1YVLA 3SIBA 3BUMB 3FWBA 3S0DA 1FI6A 1S6JA 2KLEA 2KPHA 2L4HA 3TDZA 1TNXA 3PN7C 2BCBA 4A4CA 1MHOA 1DQEA 1RROA 2LM5A 1B7TY 1K8UA 2LVVA 1AUIB 2KQYA 3CZTX 5JOLA 5I2QA 1ZOTB 3EVUA 4GGFC 2HQ8A 3TS5B 2O60A 2PASA 1ZACA 1N2DA 3TS5C 1QWVA 2PVBA 2JRFA 2F33A 4PE0A 1RECA 1QASA 4BY5A 3JTDB 4YGAA 1UURA 3JTDC 3FS7A 3KF9A 1TNQA 4FTGA 3VGOA 3Q8IA 3UO9A 1BOCA 3GK1A 1TWOA 3BYAA 3SG5A 4DIRA 1W9ZA 3D74A 3NGVA 2ZNEA 2COLB 2OPOA 1EG3A 1SR6C 2WC8A 3N7HA 2CNPA 4D1EA 2LP3A 2KAXA 1JFKA 1J7RA
chains in the Genus database with same CATH topology
3S0GA 3L4LA 3R72A 2WCJA 3CZ1A 1C3YA 3CYZA 5EL2A 3VB1A 3DXLA 2WCKA 2QEHA 2WC6A 1ORGA 3D75A 3PJIA 3V2LA 3CZ2A 4FQTA 3FE9A 3L47A 4INXA 3K1EA 3B6XA 2WCLA 3QMEA 3R1PA 3B86A 4INWA 4PT1A 2GTEA 4JD9A 2WCHA 2WC5A 3D78A 3NHTA 3DZTA 1C3ZA 3R1VA 4OZDA 3R1OA 1GM0A 3CDNA 3B7AA 3D76A 3FE6A 2PQLA 3DY9A 1LS8A 3B87A 3CABA 4F7FA 3OGNA 3BFAA 2QEBA 1T14A 1OOGA 3FE8A 3L4AA 3CZ0A 2ERBA 1TUJA 3RZSA 3NHIA 2QDIA 3S0AA 2JPOA 1OW4A 1OOFA 2P70A 3S0DA 3D73A 2KPHA 3BFBA 3BFHA 1DQEA 1XFRA 3BJHA 1OOIX 3S0EA 3S0FA 5DICA 3S0BA 3D77A 2H8VA 1QWVA 1P28A 2QEVA 3B88A 2L2CA 1OOHA 2QEOA 2WCMA 2FJYA 3Q8IA 1TWOA 3DYEA 3D74A 3NGVA 3N7HA 2P71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0G A;  3L4L A;  3R72 A;  2WCJ A;  3CZ1 A;  1C3Y A;  3CYZ A;  5EL2 A;  3VB1 A;  3DXL A;  2WCK A;  2QEH A;  2WC6 A;  1ORG A;  3D75 A;  3PJI A;  3V2L A;  3CZ2 A;  4FQT A;  3FE9 A;  3L47 A;  4INX A;  3K1E A;  3B6X A;  2WCL A;  3QME A;  3R1P A;  3B86 A;  4INW A;  4PT1 A;  2GTE A;  4JD9 A;  2WCH A;  2WC5 A;  3D78 A;  3NHT A;  3DZT A;  1C3Z A;  3R1V A;  4OZD A;  3R1O A;  1GM0 A;  3CDN A;  3B7A A;  3D76 A;  3FE6 A;  2PQL A;  3DY9 A;  1LS8 A;  3B87 A;  3CAB A;  4F7F A;  3OGN A;  3BFA A;  2QEB A;  1T14 A;  1OOG A;  3FE8 A;  3L4A A;  3CZ0 A;  2ERB A;  1TUJ A;  3RZS A;  3NHI A;  2QDI A;  3S0A A;  2JPO A;  1OW4 A;  1OOF A;  2P70 A;  3S0D A;  3D73 A;  2KPH A;  3BFB A;  3BFH A;  1DQE A;  1XFR A;  3BJH A;  1OOI X;  3S0E A;  3S0F A;  5DIC A;  3S0B A;  3D77 A;  2H8V A;  1QWV A;  1P28 A;  2QEV A;  3B88 A;  2L2C A;  1OOH A;  2QEO A;  2WCM A;  2FJY A;  3Q8I A;  1TWO A;  3DYE A;  3D74 A;  3NGV A;  3N7H A;  2P71 A; 
#chains in the Genus database with same CATH topology
 2OTG B;  1BLQ A;  2OTG C;  3NSI A;  3L4L A;  2G9B A;  2K7B A;  2WCJ A;  3I5H B;  2RGI A;  5HKW A;  3I5H C;  1F71 A;  4MLW A;  1RWY A;  3EK4 A;  1UP5 A;  3TUY C;  1WLZ A;  1C3Y A;  2LLS A;  2KYC A;  2L5Y A;  2L98 A;  1HT9 A;  1NWD A;  1XVJ A;  1YX7 A;  2WCK A;  1DT7 B;  3NXA A;  2JXL A;  4HSZ A;  1ORG A;  3D75 A;  3PJI A;  1XFW O;  1JSA A;  2IS9 A;  1WY9 A;  1AJ5 A;  2K60 A;  2JQ6 A;  3CZ2 A;  4FQT A;  1DJW A;  1CDM A;  1CDL A;  2K61 A;  1TNP A;  3L47 A;  5I94 A;  1KK8 B;  1PVA A;  2BKH B;  1CLM A;  1K96 A;  3B6X A;  5FYX A;  3RLZ A;  5AFP A;  5JJG A;  2WCL A;  4I5L B;  1MXE A;  2KQ6 A;  4INW A;  2BE4 A;  1QLK A;  2PRU A;  1XFX O;  5GQQ C;  2KFG A;  3D78 A;  2Y1M A;  3NHT A;  2KFH A;  3BUW B;  4OVN F;  2EHB A;  3PLF B;  4N1F A;  5PAL A;  5KU1 A;  1GGW A;  4QJ3 B;  5B8I B;  1S36 A;  2LLT A;  3R1V A;  1L7Z A;  1OMR A;  1QIV A;  2GGZ A;  3O78 A;  3R1O A;  3EVR A;  2D8N A;  4R1E A;  1SCV A;  5HKY A;  1TCO B;  1DGU A;  4JQ0 D;  1XFU O;  4JKT A;  3B7A A;  3SIA A;  1XFY O;  5FI2 A;  1GGZ A;  1DJG A;  1K94 A;  2PQL A;  3QRX A;  3EKH A;  1B8C A;  1OZS A;  4BY4 A;  1SYM A;  1K93 D;  1OE9 B;  3H4S E;  1XYD A;  1SRA A;  2NLN A;  1NIW A;  2JXC A;  2JNF A;  1NSH A;  1EH2 A;  1OOG A;  1YUT A;  2JT0 A;  1A2X A;  1AHR A;  1KFX L;  3L4A A;  1S5G Y;  1ZFS A;  1TOP A;  1H8B A;  5CSI A;  2M29 A;  2ERB A;  3DVJ A;  1SL8 A;  4A4B A;  2MAZ A;  1BJF A;  3AAK A;  1BF5 A;  3M0W A;  3CR2 A;  1PUL A;  1ALW A;  4L9M A;  1Y1X A;  3VRO A;  1XK4 C;  1D1O A;  2LMV A;  1OW4 A;  1SCM B;  2JT8 A;  2PYQ A;  2TN4 A;  3FWC A;  1K9K A;  3OX5 A;  4JPZ B;  1EL4 A;  1B8L A;  3D73 A;  4DS7 A;  2EC6 B;  4XJK B;  2F3Z A;  2KOT A;  1PK0 D;  3OHM B;  5CSF A;  1FI5 A;  2KAY A;  2BAP A;  4MRX A;  1QTX A;  1XFR A;  2F2P A;  3NSL A;  3BJH A;  1FPW A;  4ZCU A;  3I5F B;  2JOJ A;  2SCP A;  2MBX A;  3I5F C;  4PE7 A;  5DKR A;  4M2O A;  3S0E A;  2L4I A;  5HLV A;  5DIC A;  1YR5 A;  1KQM C;  3S0B A;  3D77 A;  1Y1A A;  1IQ5 A;  2QEV A;  5AXI A;  1YRU B;  1PAL A;  1SMG A;  3B88 A;  2H61 C;  1WDC B;  1Z4H A;  4CLN A;  2O5G A;  1OOH A;  1IJ5 A;  1WDC C;  2QEO A;  1V1F A;  2FJY A;  2L51 A;  1CB1 A;  1DVI A;  1V1G A;  2LUC A;  3A8R A;  2MRD A;  5K89 A;  1CDN A;  1RJV A;  3LL8 B;  1QX5 B;  3PN7 B;  3VRN A;  4MBE A;  4YGE B;  2G2B A;  1H4B A;  5G08 A;  2L2E A;  3VRQ A;  1QV1 A;  1XK4 A;  1KQV A;  5FI7 A;  4AOM A;  3EKJ A;  2JNX A;  3CZ1 A;  4OV2 A;  2M1K B;  4DCK A;  3CYZ A;  2WOR A;  2ZRS A;  1IWQ A;  4WQ2 A;  3UNW A;  1IQ3 A;  4ORB B;  1DEK A;  2JUL A;  2KFF A;  4CFR A;  1B9A A;  4XJK A;  2CCM A;  2WC6 A;  3LK1 A;  1G33 A;  3SG3 A;  3WHU B;  2MHH A;  3E3R A;  1LKJ A;  2NXQ A;  2NZ0 A;  1ALV A;  2BL0 B;  2SAS A;  1UHK A;  4WRI A;  4DRW A;  4MZL A;  3V2L A;  2BL0 C;  1M39 A;  1IJ6 A;  3D10 A;  1KFU L;  2PAL A;  3KHE A;  1SR6 B;  5AEQ A;  4HRG A;  4INX A;  5I2L A;  1C07 A;  2CXJ A;  4C0L A;  3O6B A;  3EG5 B;  1CM4 A;  2KYF A;  3QME A;  1KFX S;  4YBH B;  1B8R A;  1RFJ A;  2QAC A;  3DVM A;  1B1G A;  1KWO B;  1KSO A;  2WCH A;  3BUX B;  1Y1U A;  1KWO C;  1A29 A;  4AQI A;  1YVH A;  1HQV A;  3TUY B;  3ZNI A;  1UUS A;  1YX8 A;  3DZT A;  3KEV A;  4ETO A;  2LHL A;  3CWG A;  5DKQ A;  1MQ1 A;  1A75 B;  2M9G A;  2QPT A;  2JU0 A;  4QJ5 B;  4ICB A;  1GM0 A;  1TRF A;  4FQO A;  1CFP A;  3I5G C;  2VRG A;  2YGU A;  2KBM A;  1IH0 A;  5AER A;  2Y1N A;  1EG4 A;  1U5I B;  2KI4 B;  2EGD A;  5J3X A;  1YRT B;  2KI4 C;  3FE6 A;  2K7D A;  3SG7 A;  2MLE C;  4GNK B;  1LS8 A;  4GGF A;  2ZKM X;  3CAB A;  1S6I A;  2JTZ A;  3IQO A;  5D69 A;  4NDD A;  1IRJ A;  2I94 A;  2WCB A;  3BFA A;  2L50 A;  1RTP 1;  3PAT A;  2QEB A;  1PVB A;  3O4Y A;  4UPG A;  1PSR A;  1EXR A;  3BQ3 A;  1T14 A;  1NPQ A;  4MEW A;  3HX4 A;  2ISD A;  5DKN A;  2M97 A;  4DUQ A;  2F3Y A;  2ZRT A;  3FE8 A;  4TNC A;  2CBL A;  4QJ4 B;  2Y4Q A;  2LC5 A;  3PAL A;  1B4C A;  2FOT A;  3FIA A;  1TUJ A;  3SS5 A;  5HKZ A;  5KSZ A;  1CLL A;  4JWQ A;  1NCY A;  2I18 A;  4N5X A;  4P5O E;  1L2O B;  2QDI A;  3TDU A;  1YUU A;  1L2O C;  1F4Q A;  1TUZ A;  1TNW A;  3IF7 A;  1K9P A;  1OOF A;  4YGD B;  3SS3 A;  1OOJ A;  1VRK A;  2WCF A;  3IQQ A;  1J7Q A;  1DJI A;  3BFB A;  4NQG A;  2L0P A;  1G4Y R;  1M63 B;  1A75 A;  3I5I C;  1CFF A;  2K2F A;  2HQW A;  2B1U A;  3KO0 A;  2Y5I A;  4WQ3 A;  1QAT A;  1OOI X;  4IL1 A;  1NP8 A;  1SBJ A;  3TDI A;  4F0Z B;  3S0F A;  4PHM A;  5BPJ A;  1UWO A;  3O2P A;  1BOD A;  1P28 A;  1U5I A;  2H8V A;  1DF0 B;  1R2U A;  3GK4 X;  1CFC A;  5HYD A;  1AP4 A;  4GFT A;  2LP2 A;  2WCM A;  1KFU S;  5D3O A;  2OS8 B;  2GGM A;  2OS8 C;  2HF5 A;  2ZND A;  1JWD A;  1BG1 A;  2KGB C;  3DYE A;  1UHN A;  1SK6 D;  1XFZ O;  1JF2 A;  3DVE A;  3JVT B;  2ZN8 A;  3JVT C;  1M45 A;  1CMG A;  2P71 A;  4OKH A;  2JZI A;  2M7L A;  1WLM A;  5I8N A;  1OQP A;  1YTZ C;  3ICB A;  1MXL C;  2KGR A;  4YRU A;  1Y6W A;  1PRW A;  1E8A A;  1WRK A;  4I5J A;  1CTR A;  2LCP A;  4M2Q A;  4I5N B;  1SPY A;  3K21 A;  1QXP A;  1KQM B;  5EL2 A;  1WRL A;  1S26 D;  3KPX A;  1R6P A;  3DVK A;  1SL9 A;  1Z2C B;  1J7O A;  1DEL A;  3VB1 A;  2M1U A;  3D0Y B;  1BT6 A;  3HCM A;  1J1D A;  2I7A A;  4PE4 A;  3IVT A;  3GK2 A;  1MUX A;  3NSO A;  1LXF C;  4PAL A;  4USL A;  3AKA A;  1G8I A;  1JBA A;  3LLE A;  2Q4U A;  5KTY A;  2L5X B;  2PMY A;  2V53 A;  1WRZ A;  4PHJ A;  2LLU A;  3ZWH A;  1CM1 A;  1DF0 A;  1NX2 A;  1NYA A;  2GV5 A;  2KDH A;  1QVI Y;  1TCF A;  3R1P A;  2LV7 A;  1J7P A;  4PT1 A;  4MZJ A;  3GOF A;  4JD9 A;  3DD4 A;  3A4U B;  5CSJ A;  1K2H A;  1DJZ A;  4PHK A;  2LE9 B;  2NCO A;  1CLB A;  5ER4 X;  3TZ1 A;  1C3Z A;  1QVI Z;  2KI6 D;  1IKU A;  4ORA B;  2M8U A;  2K2A A;  2FCD A;  3DF0 B;  4IJ7 A;  2CT9 A;  3VRP A;  2KLD A;  1TTX A;  4OZD A;  2KNE A;  3SJS A;  1S1E A;  3PM8 A;  4HRH A;  1OMV A;  1S6C A;  1SSE B;  2WOS A;  3CDN A;  3PM2 A;  2M7N A;  4GGN A;  3D76 A;  1AK8 A;  2LHI A;  3SG4 A;  4I5K A;  2BBN A;  3DY9 A;  4OCI A;  1C7W A;  1YUS A;  1LIN A;  1UHI A;  4NDC A;  3LCP C;  4PCW A;  4ZCV A;  5HLO A;  2E6W A;  1M31 A;  3SG2 A;  1F4O A;  1JUO A;  5AAN A;  2H61 A;  3D0Y A;  5TNC A;  2K0J A;  1NUB A;  4NDB A;  1F8H A;  3AAJ A;  2LMT A;  2BNX A;  1XA5 A;  1B7T Z;  2MLF C;  1GJY A;  3CZ0 A;  4U8D A;  2BEC A;  5IBW A;  4XYN A;  3PSR A;  4YI9 A;  1DC1 A;  3BUO B;  4GUK A;  3RZS A;  3NHI A;  1JFJ A;  2BE6 A;  3C1V A;  1SW8 A;  1Q80 A;  1X02 A;  3I5G B;  3S0A A;  1CMF A;  1ODB A;  1DMO A;  2M0R A;  1LA3 A;  1UHJ A;  3OP0 A;  2I2R E;  1B47 A;  1Y0V H;  2P70 A;  1F54 A;  1FF1 A;  2JTT A;  1W7I B;  1TIZ A;  1ZUZ A;  4M2P A;  2JT3 A;  3CR5 X;  1TN4 A;  1W7J B;  2AUC A;  1SL7 A;  2M3W A;  3BFH A;  2K8M B;  3DF0 A;  4MSP A;  4YI8 A;  3WNX B;  5I2O A;  2DOQ A;  2BCA A;  2ZFD A;  1IG5 A;  5CPV A;  2HET A;  1BR1 B;  4MN0 A;  1SY9 A;  3CGA A;  2LVK A;  3CS1 A;  1ZMZ A;  2BBM A;  2NCP A;  1C7V A;  1J1E A;  1QLS A;  4C0K A;  2L2C A;  1K9U A;  2LVI A;  1AJ4 A;  3OB1 B;  5HL1 A;  1DJY A;  1XFV O;  1NCZ A;  2LAN A;  4MRY A;  1N65 A;  2KSP A;  2PSR A;  1JC2 A;  3CTN A;  1LVC D;  2LAP A;  1SNL A;  4GPL B;  3CR4 X;  1KK8 C;  3S0G A;  1F55 A;  1QJT A;  1F70 A;  1KCY A;  3I5I B;  3MSE B;  1KSM A;  3R72 A;  3WXA A;  1QX7 A;  1NX1 A;  5ER5 A;  3OB2 B;  1A03 A;  2FJU B;  2WCE A;  1LA0 A;  1MF8 B;  2CTN A;  2KI6 C;  2JPT A;  2KHN A;  5F6T A;  2LNK A;  3DXL A;  4CPV A;  1EJ3 A;  2QEH A;  2WND A;  4ORC B;  2LVJ A;  3VRR A;  1JF0 A;  1NCX A;  2LUX A;  4MVF A;  4E68 A;  1AVS A;  1MWN A;  4YGC B;  4CFQ A;  3FE9 A;  1CFD A;  2A4J A;  2MJW B;  1DTL A;  1S3P A;  3BOW B;  1CNP A;  3K1E A;  3CLN A;  4N1G A;  4PDZ A;  1QS7 A;  2Q91 A;  1RK9 A;  1QV0 A;  2JC2 A;  2K7O A;  3AKB A;  1J55 A;  1DJH A;  3B86 A;  4AQJ A;  2P6B B;  4CID A;  2GTE A;  1QX2 A;  2WC5 A;  1MR8 A;  1OZO A;  4PHN A;  4YGB B;  5FI6 A;  1DJX A;  3SS4 A;  1QIW A;  1DGV A;  1OMD A;  2E30 A;  4OR9 B;  4C0J A;  1BR4 B;  4P2Y B;  4MZK A;  1S5G Z;  2FCE A;  1XO5 A;  2LMU A;  4PE1 A;  1BU3 A;  2F8P A;  1A4P A;  4HRE E;  1UHH A;  1IGV A;  2BCX A;  3BXK A;  1SKT A;  1SCM C;  2F2O A;  3EK7 A;  3RM1 A;  2AMI A;  1K95 A;  1YUR A;  2ZN9 A;  1PSB A;  1GQM A;  3LK0 A;  1OSA A;  2KBI A;  1BMO A;  2EC6 C;  5CSN A;  3B87 A;  2H2K A;  4F7F A;  4GBA A;  3OGN A;  2JWW A;  2KAV A;  3NSK A;  3EK8 A;  1CKK A;  4Q04 A;  1IIO A;  3WHT B;  2BKI B;  2AAO A;  1M46 A;  1FW4 A;  3SG6 A;  1CDP A;  2R2I A;  2MA2 A;  1NX0 A;  1KK7 Y;  3EVV A;  2K7C A;  4GAO A;  1FBV A;  3PFV A;  3BUN B;  3OBV A;  5D7F A;  2HPS A;  3BOW A;  3OX6 A;  1NX3 A;  3O4X A;  1K90 D;  1KK7 Z;  1N0Y A;  2JPO A;  3F45 A;  2M49 B;  4KYN A;  1YVL A;  3SIB A;  3BUM B;  3FWB A;  3S0D A;  1FI6 A;  1S6J A;  2KLE A;  2KPH A;  2L4H A;  3TDZ A;  1TNX A;  3PN7 C;  2BCB A;  4A4C A;  1MHO A;  1DQE A;  1RRO A;  2LM5 A;  1B7T Y;  1K8U A;  2LVV A;  1AUI B;  2KQY A;  3CZT X;  5JOL A;  5I2Q A;  1ZOT B;  3EVU A;  4GGF C;  2HQ8 A;  3TS5 B;  2O60 A;  2PAS A;  1ZAC A;  1N2D A;  3TS5 C;  1QWV A;  2PVB A;  2JRF A;  2F33 A;  4PE0 A;  1REC A;  1QAS A;  4BY5 A;  3JTD B;  4YGA A;  1UUR A;  3JTD C;  3FS7 A;  3KF9 A;  1TNQ A;  4FTG A;  3VGO A;  3Q8I A;  3UO9 A;  1BOC A;  3GK1 A;  1TWO A;  3BYA A;  3SG5 A;  4DIR A;  1W9Z A;  3D74 A;  3NGV A;  2ZNE A;  2COL B;  2OPO A;  1EG3 A;  1SR6 C;  2WC8 A;  3N7H A;  2CNP A;  4D1E A;  2LP3 A;  2KAX A;  1JFK A;  1J7R A; 
#chains in the Genus database with same CATH homology
 3S0G A;  3L4L A;  3R72 A;  2WCJ A;  3CZ1 A;  1C3Y A;  3CYZ A;  5EL2 A;  3VB1 A;  3DXL A;  2WCK A;  2QEH A;  2WC6 A;  1ORG A;  3D75 A;  3PJI A;  3V2L A;  3CZ2 A;  4FQT A;  3FE9 A;  3L47 A;  4INX A;  3K1E A;  3B6X A;  2WCL A;  3QME A;  3R1P A;  3B86 A;  4INW A;  4PT1 A;  2GTE A;  4JD9 A;  2WCH A;  2WC5 A;  3D78 A;  3NHT A;  3DZT A;  1C3Z A;  3R1V A;  4OZD A;  3R1O A;  1GM0 A;  3CDN A;  3B7A A;  3D76 A;  3FE6 A;  2PQL A;  3DY9 A;  1LS8 A;  3B87 A;  3CAB A;  4F7F A;  3OGN A;  3BFA A;  2QEB A;  1T14 A;  1OOG A;  3FE8 A;  3L4A A;  3CZ0 A;  2ERB A;  1TUJ A;  3RZS A;  3NHI A;  2QDI A;  3S0A A;  2JPO A;  1OW4 A;  1OOF A;  2P70 A;  3S0D A;  3D73 A;  2KPH A;  3BFB A;  3BFH A;  1DQE A;  1XFR A;  3BJH A;  1OOI X;  3S0E A;  3S0F A;  5DIC A;  3S0B A;  3D77 A;  2H8V A;  1QWV A;  1P28 A;  2QEV A;  3B88 A;  2L2C A;  1OOH A;  2QEO A;  2WCM A;  2FJY A;  3Q8I A;  1TWO A;  3DYE A;  3D74 A;  3NGV A;  3N7H A;  2P71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...