1XFRA

Solution structure of the bombyx mori pheromone-binding protein fragment bmpbp(1-128) at ph 6.5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Pheromone-binding protein
publication title Dynamic conformational equilibria in the physiological function of the Bombyx mori pheromone-binding protein.
pubmed doi rcsb
source organism Bombyx mori
total genus 43
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1xfrA00
3D75A 1P28A 3OGNA 1GM0A 2GTEA 3S0BA 3FE8A 1ORGA 3S0GA 3B86A 5DICA 1OOHA 1T14A 1XFRA 2P71A 2QEHA 2QEOA 3DZTA 3VB1A 4F7FA 1OOFA 1LS8A 1TUJA 3S0EA 3FE9A 3FE6A 2QDIA 1OW4A 3NHTA 3BJHA 3D78A 1OOIX 3CYZA 1OOGA 3CZ1A 3R72A 1DQEA 3CDNA 2WCLA 3K1EA 3B6XA 3Q8IA 3B7AA 3CZ2A 3D73A 4INXA 3L4LA 3R1PA 2WC5A 3V2LA 3DYEA 3DXLA 2H8VA 2WC6A 2FJYA 2WCMA 1C3YA 1QWVA 3S0DA 4FQTA 3N7HA 3D76A 2L2CA 3CZ0A 4OZDA 3NHIA 3D77A 4JD9A 3RZSA 4PT1A 3QMEA 2QEVA 2KPHA 3DY9A 5EL2A 3R1OA 3S0AA 2WCJA 2P70A 3B88A 3S0FA 3L47A 2JPOA 4INWA 3BFAA 2ERBA 1TWOA 2WCKA 3BFBA 3L4AA 3CABA 3NGVA 3D74A 2WCHA 2QEBA 2PQLA 3BFHA 3R1VA 1C3ZA 3PJIA 3B87A
chains in the Genus database with same CATH superfamily
3DVEA 3O4YA 1S3PA 4MZLA 1GM0A 3RM1A 1CLLA 1QATA 1QX5B 1KQVA 3HX4A 1R6PA 1QTXA 2OS8C 1ALVA 1ORGA 5CSNA 3CS1A 2L50A 2JZIA 1PALA 2LVVA 1D1OA 1MXLC 1J1DA 2WORA 3BUWB 2RGIA 2JNFA 5FI7A 2L2EA 1OOHA 1RFJA 3SJSA 1SW8A 2F8PA 1B9AA 2NLNA 2KLEA 3IQQA 2BL0C 2BNXA 1JC2A 1KK7Y 4P2YB 2QEOA 4PHJA 1LVCD 2LCPA 5B8IB 1BOCA 2LNKA 4F7FA 1MHOA 1SRAA 1RJVA 2FCDA 1TUJA 1A75A 2MHHA 3PSRA 2NCPA 1OMVA 3FE9A 1K2HA 2CNPA 1DJIA 1UURA 3NHTA 2JTTA 2WCFA 4I5NB 3CZ1A 1CM1A 1XFWO 2CT9A 4QJ3B 4M2OA 1SSEB 1EJ3A 3ZWHA 4N1FA 2JULA 4GFTA 2M97A 3CDNA 2WCLA 3K1EA 2AAOA 2OTGC 4ORAB 1K94A 1KFUS 5CSFA 3PN7B 4MVFA 1JF2A 1QVIZ 1V1FA 3B6XA 1KFXS 3OB2B 3SIAA 3B7AA 4ETOA 1CDNA 1DJGA 3AAJA 1U5IB 5I2LA 3TDIA 5I8NA 5D69A 2M1UA 5BPJA 3AAKA 3TZ1A 2LE9B 1B8CA 3KHEA 2EGDA 3EK4A 1UWOA 1SYMA 1YX7A 1SR6C 3EVRA 3GK1A 2KYFA 4I5JA 5HL1A 2H8VA 2KAXA 2GGZA 4BY5A 2O5GA 5F6TA 1DF0A 2PSRA 1F54A 4WQ3A 1YUUA 5D7FA 3S0DA 1M31A 2EC6C 1CB1A 2JXCA 2FJUB 4R1EA 3BOWB 3N7HA 3UNWA 2HPSA 2JOJA 1L2OC 4OZDA 1SY9A 3VRPA 2KFFA 3H4SE 4OR9B 3GK4X 2L98A 2HQ8A 1Q80A 5HLOA 1Y1XA 1IQ3A 2KNEA 1KQMB 1S6CA 4OVNF 3SG4A 1B1GA 3QMEA 1BU3A 5EL2A 3R1OA 1NUBA 2YGUA 4MN0A 1DJZA 1BLQA 1ZACA 2MLEC 3NSOA 2KGBC 2LP3A 4JPZB 1KK7Z 2I18A 2L5YA 1S5GY 3TDZA 2ZN8A 2ZRSA 3FWBA 1A03A 2LHLA 1CLBA 2EHBA 1AUIB 2LP2A 1J7QA 2JNXA 4ZCUA 1NCYA 2BKIB 1M45A 3PATA 1BG1A 1WRKA 1UHIA 1CM4A 3D74A 3TUYB 5J3XA 5CPVA 1RK9A 2KQ6A 4N1GA 1J7RA 1QX7A 5PALA 4GGFC 5HKYA 1S6JA 3LLEA 2JT3A 2QPTA 2L51A 1SL8A 3EK7A 3CWGA 1CDPA 1AK8A 1LA0A 1F71A 1B7TZ 1RROA 3R1VA 2KBMA 3KPXA 1OZSA 4CFQA 1XFUO 3CR4X 1EG4A 2ZN9A 4ORBB 1NCZA 3B87A 3O4XA 4CLNA 1YUTA 1CNPA 2K2AA 1IWQA 3OGNA 3S0BA 1CMGA 3I5GC 3FE8A 4I5KA 4YRUA 1IGVA 3OX6A 1LXFC 1S1EA 4DRWA 3B86A 1QIWA 1T14A 1EL4A 2BBMA 2KAVA 1Y6WA 2JT8A 2Q4UA 1KSOA 4QJ4B 5HYDA 3TUYC 5ER5A 1KWOB 3VB1A 1TIZA 1FPWA 1A2XA 1PSBA 2P6BB 5KTYA 1B8RA 1L7ZA 2BECA 2LV7A 3S0EA 1N2DA 1TCFA 2F3YA 2E30A 3SG7A 2L4IA 2WOSA 1DJWA 2LLSA 4D1EA 1OOIX 3CYZA 1YR5A 1DMOA 1G4YR 1MQ1A 1NCXA 3JTDB 2K7BA 1LKJA 1N65A 4NDBA 1IRJA 1SL9A 1S5GZ 1W7IB 1J7OA 5HLVA 2GV5A 1WY9A 1SNLA 1UHHA 2A4JA 2WNDA 4XJKB 4F0ZB 2QACA 1OZOA 1IJ6A 1EXRA 1F8HA 4INXA 5G08A 2WC5A 1X02A 2ZFDA 4BY4A 1SL7A 2AUCA 1DJXA 1K9UA 1SK6D 4UPGA 4GAOA 2F33A 4YI8A 4JWQA 3BUMB 3I5IB 3TS5B 3VROA 4C0JA 1J7PA 3NXAA 1PVBA 4YGAA 3SS5A 2KQYA 3IVTA 2BKHB 2MLFC 1CMFA 2KBIA 1XA5A 2M1KB 4HRHA 1MXEA 2M7LA 1NYAA 1QXPA 2I7AA 4PDZA 2JT0A 3D0YA 4GBAA 1M46A 3NSIA 3D77A 1OSAA 2H61A 4ZCVA 1SCMB 1CFCA 2JC2A 5TNCA 2H61C 4PT1A 1NWDA 4P5OE 1JF0A 2PMYA 3DY9A 3S0AA 1J1EA 4NDCA 3B88A 3OP0A 1DF0B 4PHMA 3I5FB 1V1GA 3QRXA 1TNQA 1Y0VH 5I2QA 3SG2A 3LK1A 1BMOA 3WXAA 4OCIA 3EKHA 3VGOA 1QS7A 3BFAA 4INWA 5FI2A 2JQ6A 1TWOA 5I94A 3BUOB 4CPVA 2KI4B 4YGCB 2M0RA 4Q04A 3CABA 1YX8A 1DC1A 3IF7A 1TOPA 2WCHA 2BCBA 4ORCB 2LUCA 4IL1A 1FI6A 1S6IA 2FOTA 1N0YA 1QV0A 3BFHA 4PHKA 1Y1UA 1H8BA 1J55A 3PN7C 3JVTB 3D10A 3OBVA 4GNKB 4I5LB 1U5IA 1UHJA 3BYAA 1PSRA 2MA2A 1YVHA 2MAZA 1YVLA 3LCPC 1SKTA 2R2IA 1TRFA 4MRXA 3PFVA 4YBHB 1B4CA 3PJIA 2Y1MA 2G9BA 1LINA 2LMTA 2GTEA 3I5FC 2LANA 4HREE 5DKQA 4AQJA 2BBNA 2LMUA 1UUSA 4KYNA 1TN4A 1MF8B 1DVIA 1W9ZA 2KYCA 3GOFA 4PCWA 2LVJA 1KK8B 3BOWA 5FYXA 1YRTB 1Z4HA 3SS3A 2NZ0A 3DF0A 1QX2A 4GGFA 4HRGA 4PE7A 1XFRA 1DTLA 5ER4X 2CTNA 4MZJA 2JPTA 2P71A 2L4HA 3DVMA 1JUOA 3DZTA 1ODBA 2E6WA 1M63B 1IH0A 1UHKA 1OOFA 1IJ5A 1KQMC 1G8IA 2KFHA 1C07A 1IQ5A 1K9KA 4C0LA 3CLNA 1FBVA 1SCVA 1OW4A 2L5XB 4PALA 3AKBA 3OB1B 1OOGA 1SPYA 1DGVA 1F4OA 3R72A 1TUZA 2LLTA 2M29A 3FS7A 3DVJA 1TTXA 3CTNA 5K89A 2LVIA 3O6BA 1CDLA 1BODA 2BE6A 2KLDA 1WDCB 2GGMA 1G33A 3Q8IA 4YI9A 5KU1A 3ZNIA 4XYNA 2FCEA 2MJWB 2Y1NA 3PM8A 1KFUL 2JTZA 2K7OA 1K93D 2I2RE 5AFPA 3L4LA 1DELA 2B1UA 1A29A 1KFXL 1SMGA 2ZRTA 3VRRA 5FI6A 1QV1A 4A4CA 1ALWA 3DYEA 5GQQC 2OS8B 3OHMB 2JU0A 1NPQA 5D3OA 1UP5A 5DKRA 2WCMA 1AJ5A 4WQ2A 5JOLA 2WCEA 1C3YA 3OX5A 3NSLA 4E68A 4FQTA 1XFZO 1NX1A 3D76A 2L2CA 3CZ0A 2BL0B 3O78A 3WNXB 4PE0A 2Y5IA 2K8MB 3KEVA 5DKNA 3NHIA 1WRZA 2OPOA 4MSPA 1Z2CB 1YTZC 2L0PA 1GGWA 4C0KA 1BF5A 2CCMA 4CFRA 1ZUZA 1CKKA 3SG6A 2QEVA 3I5HB 2KPHA 1K95A 2M9GA 1A75B 1XFXO 1QLKA 1OMRA 1QJTA 1OMDA 5AXIA 4IJ7A 1KWOC 2COLB 1YRUB 1XK4A 1FF1A 1XK4C 2OTGB 1M39A 2I94A 1QIVA 1DJHA 3D0YB 2KAYA 2PYQA 4USLA 1XVJA 4N5XA 2MBXA 3BFBA 3PLFB 1ZFSA 4DCKA 3NGVA 4NDDA 1Y1AA 1CFFA 3O2PA 4AQIA 1AVSA 3JTDC 4GPLB 3CZTX 4MRYA 1MR8A 2PQLA 3CR5X 2KDHA 1GJYA 2AMIA 2CXJA 4QJ5B 2LM5A 4HSZA 1SR6B 1PRWA 1IG5A 1NX2A 4XJKA 2LAPA 2JRFA 2BCAA 2KGRA 1HT9A 2ZNDA 3PALA 2LMVA 3I5HC 2Q91A 4A4BA 1B47A 1K8UA 2M49B 2ZKMX 1DT7B 1KCYA 1C3ZA 2EC6B 4ICBA 1FI5A 2KHNA 2LUXA 2K61A 1P28A 3D75A 3KO0A 4MBEA 1YUSA 2WCBA 2H2KA 1L2OB 1XO5A 3WHUB 5HKZA 4M2PA 3I5IC 1AJ4A 3TS5C 3S0GA 2DOQA 2BAPA 3DVKA 5DICA 1B7TY 1CDMA 3WHTB 4CIDA 3HCMA 1WLMA 1VRKA 2QEHA 5AANA 1WLZA 1K96A 1OOJA 3CGAA 3UO9A 2BCXA 1JSAA 1JFKA 1S26D 2HETA 1OE9B 1SCMC 3VRQA 1LS8A 1PULA 1TCOB 1NP8A 2JXLA 2LC5A 3DD4A 2LHIA 1GGZA 1JWDA 3FE6A 4YGEB 2QDIA 3EG5B 2KFGA 3BJHA 3D78A 1JBAA 1ZMZA 2M7NA 1HQVA 2V53A 1KSMA 3FIAA 5AERA 2K60A 1IKUA 2Y4QA 2HF5A 1DQEA 2SASA 1A4PA 3DF0B 2VRGA 3F45A 3GK2A 1F70A 1K90D 1PVAA 4U8DA 4DUQA 3MSEB 3RLZA 2M8UA 3CR2A 1AP4A 4MEWA 1OQPA 1BT6A 2KI4C 3BUNB 3BUXB 4OV2A 1JFJA 1NIWA 1TNPA 3CZ2A 2D8NA 3VRNA 3D73A 1BR1B 3LL8B 1EH2A 2F3ZA 2K7DA 2ISDA 2HQWA 3TDUA 2KSPA 1CLMA 4DIRA 3C1VA 3R1PA 4WRIA 1NX3A 1F4QA 1QASA 3V2LA 1S36A 4DS7A 3AKAA 3FWCA 3I5GB 3SIBA 2NCOA 3JVTC 1QLSA 5AEQA 1RWYA 1E8AA 3M0WA 3DXLA 3SS4A 1PK0D 2WC6A 4MLWA 2FJYA 1F55A 4PE4A 5IBWA 1NSHA 1LA3A 1TNWA 1QWVA 2PASA 1XFYO 1B8LA 4MZKA 3BXKA 1YURA 2PRUA 2PALA 3A4UB 2SCPA 1CFDA 2BE4A 3SG3A 2F2PA 4JD9A 2KOTA 2O60A 1R2UA 3RZSA 3BQ3A 2MRDA 3EVUA 1KK8C 1MUXA 4GUKA 1EG3A 2JWWA 1K9PA 2K2FA 2KI6C 1RTP1 5CSIA 1H4BA 1DJYA 1C7WA 1W7JB 1DEKA 2P70A 2WCJA 4M2QA 1MWNA 3S0FA 1C7VA 2F2OA 3L47A 2PVBA 1BJFA 3PM2A 2JPOA 3IQOA 2ZNEA 4FTGA 1DGUA 3EKJA 1QVIY 2NXQA 1XYDA 2LVKA 4GGNA 4YGDB 1NX0A 1BR4B 2ERBA 3A8RA 2WCKA 3KF9A 3LK0A 2G2BA 4JQ0D 4L9MA 4YGBB 2IS9A 2K0JA 5KSZA 3L4AA 1XFVO 4FQOA 4NQGA 3E3RA 2CBLA 2QEBA 4OKHA 1SBJA 1WRLA 1FW4A 1ZOTB 2M3WA 5JJGA 2WC8A 2KI6D 3ICBA 5CSJA 1GQMA 3EK8A 1CFPA 4PHNA 3NSKA 4JKTA 5I2OA 1WDCC 4TNCA 3EVVA 2TN4A 2K7CA 1UHNA 1CTRA 1TNXA 4PE1A 5HKWA 3SG5A 2LLUA 4AOMA 1IIOA 1RECA 3K21A 1AHRA
chains in the Genus database with same CATH topology
3D75A 1P28A 3OGNA 1GM0A 2GTEA 3S0BA 3FE8A 1ORGA 3S0GA 3B86A 5DICA 1OOHA 1T14A 1XFRA 2P71A 2QEHA 2QEOA 3DZTA 3VB1A 4F7FA 1OOFA 1LS8A 1TUJA 3S0EA 3FE9A 3FE6A 2QDIA 1OW4A 3NHTA 3BJHA 3D78A 1OOIX 3CYZA 1OOGA 3CZ1A 3R72A 1DQEA 3CDNA 2WCLA 3K1EA 3B6XA 3Q8IA 3B7AA 3CZ2A 3D73A 4INXA 3L4LA 3R1PA 2WC5A 3V2LA 3DYEA 3DXLA 2H8VA 2WC6A 2FJYA 2WCMA 1C3YA 1QWVA 3S0DA 4FQTA 3N7HA 3D76A 2L2CA 3CZ0A 4OZDA 3NHIA 3D77A 4JD9A 3RZSA 4PT1A 3QMEA 2QEVA 2KPHA 3DY9A 5EL2A 3R1OA 3S0AA 2WCJA 2P70A 3B88A 3S0FA 3L47A 2JPOA 4INWA 3BFAA 2ERBA 1TWOA 2WCKA 3BFBA 3L4AA 3CABA 3NGVA 3D74A 2WCHA 2QEBA 2PQLA 3BFHA 3R1VA 1C3ZA 3PJIA 3B87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D75 A;  1P28 A;  3OGN A;  1GM0 A;  2GTE A;  3S0B A;  3FE8 A;  1ORG A;  3S0G A;  3B86 A;  5DIC A;  1OOH A;  1T14 A;  1XFR A;  2P71 A;  2QEH A;  2QEO A;  3DZT A;  3VB1 A;  4F7F A;  1OOF A;  1LS8 A;  1TUJ A;  3S0E A;  3FE9 A;  3FE6 A;  2QDI A;  1OW4 A;  3NHT A;  3BJH A;  3D78 A;  1OOI X;  3CYZ A;  1OOG A;  3CZ1 A;  3R72 A;  1DQE A;  3CDN A;  2WCL A;  3K1E A;  3B6X A;  3Q8I A;  3B7A A;  3CZ2 A;  3D73 A;  4INX A;  3L4L A;  3R1P A;  2WC5 A;  3V2L A;  3DYE A;  3DXL A;  2H8V A;  2WC6 A;  2FJY A;  2WCM A;  1C3Y A;  1QWV A;  3S0D A;  4FQT A;  3N7H A;  3D76 A;  2L2C A;  3CZ0 A;  4OZD A;  3NHI A;  3D77 A;  4JD9 A;  3RZS A;  4PT1 A;  3QME A;  2QEV A;  2KPH A;  3DY9 A;  5EL2 A;  3R1O A;  3S0A A;  2WCJ A;  2P70 A;  3B88 A;  3S0F A;  3L47 A;  2JPO A;  4INW A;  3BFA A;  2ERB A;  1TWO A;  2WCK A;  3BFB A;  3L4A A;  3CAB A;  3NGV A;  3D74 A;  2WCH A;  2QEB A;  2PQL A;  3BFH A;  3R1V A;  1C3Z A;  3PJI A;  3B87 A; 
#chains in the Genus database with same CATH topology
 3DVE A;  3O4Y A;  1S3P A;  4MZL A;  1GM0 A;  3RM1 A;  1CLL A;  1QAT A;  1QX5 B;  1KQV A;  3HX4 A;  1R6P A;  1QTX A;  2OS8 C;  1ALV A;  1ORG A;  5CSN A;  3CS1 A;  2L50 A;  2JZI A;  1PAL A;  2LVV A;  1D1O A;  1MXL C;  1J1D A;  2WOR A;  3BUW B;  2RGI A;  2JNF A;  5FI7 A;  2L2E A;  1OOH A;  1RFJ A;  3SJS A;  1SW8 A;  2F8P A;  1B9A A;  2NLN A;  2KLE A;  3IQQ A;  2BL0 C;  2BNX A;  1JC2 A;  1KK7 Y;  4P2Y B;  2QEO A;  4PHJ A;  1LVC D;  2LCP A;  5B8I B;  1BOC A;  2LNK A;  4F7F A;  1MHO A;  1SRA A;  1RJV A;  2FCD A;  1TUJ A;  1A75 A;  2MHH A;  3PSR A;  2NCP A;  1OMV A;  3FE9 A;  1K2H A;  2CNP A;  1DJI A;  1UUR A;  3NHT A;  2JTT A;  2WCF A;  4I5N B;  3CZ1 A;  1CM1 A;  1XFW O;  2CT9 A;  4QJ3 B;  4M2O A;  1SSE B;  1EJ3 A;  3ZWH A;  4N1F A;  2JUL A;  4GFT A;  2M97 A;  3CDN A;  2WCL A;  3K1E A;  2AAO A;  2OTG C;  4ORA B;  1K94 A;  1KFU S;  5CSF A;  3PN7 B;  4MVF A;  1JF2 A;  1QVI Z;  1V1F A;  3B6X A;  1KFX S;  3OB2 B;  3SIA A;  3B7A A;  4ETO A;  1CDN A;  1DJG A;  3AAJ A;  1U5I B;  5I2L A;  3TDI A;  5I8N A;  5D69 A;  2M1U A;  5BPJ A;  3AAK A;  3TZ1 A;  2LE9 B;  1B8C A;  3KHE A;  2EGD A;  3EK4 A;  1UWO A;  1SYM A;  1YX7 A;  1SR6 C;  3EVR A;  3GK1 A;  2KYF A;  4I5J A;  5HL1 A;  2H8V A;  2KAX A;  2GGZ A;  4BY5 A;  2O5G A;  5F6T A;  1DF0 A;  2PSR A;  1F54 A;  4WQ3 A;  1YUU A;  5D7F A;  3S0D A;  1M31 A;  2EC6 C;  1CB1 A;  2JXC A;  2FJU B;  4R1E A;  3BOW B;  3N7H A;  3UNW A;  2HPS A;  2JOJ A;  1L2O C;  4OZD A;  1SY9 A;  3VRP A;  2KFF A;  3H4S E;  4OR9 B;  3GK4 X;  2L98 A;  2HQ8 A;  1Q80 A;  5HLO A;  1Y1X A;  1IQ3 A;  2KNE A;  1KQM B;  1S6C A;  4OVN F;  3SG4 A;  1B1G A;  3QME A;  1BU3 A;  5EL2 A;  3R1O A;  1NUB A;  2YGU A;  4MN0 A;  1DJZ A;  1BLQ A;  1ZAC A;  2MLE C;  3NSO A;  2KGB C;  2LP3 A;  4JPZ B;  1KK7 Z;  2I18 A;  2L5Y A;  1S5G Y;  3TDZ A;  2ZN8 A;  2ZRS A;  3FWB A;  1A03 A;  2LHL A;  1CLB A;  2EHB A;  1AUI B;  2LP2 A;  1J7Q A;  2JNX A;  4ZCU A;  1NCY A;  2BKI B;  1M45 A;  3PAT A;  1BG1 A;  1WRK A;  1UHI A;  1CM4 A;  3D74 A;  3TUY B;  5J3X A;  5CPV A;  1RK9 A;  2KQ6 A;  4N1G A;  1J7R A;  1QX7 A;  5PAL A;  4GGF C;  5HKY A;  1S6J A;  3LLE A;  2JT3 A;  2QPT A;  2L51 A;  1SL8 A;  3EK7 A;  3CWG A;  1CDP A;  1AK8 A;  1LA0 A;  1F71 A;  1B7T Z;  1RRO A;  3R1V A;  2KBM A;  3KPX A;  1OZS A;  4CFQ A;  1XFU O;  3CR4 X;  1EG4 A;  2ZN9 A;  4ORB B;  1NCZ A;  3B87 A;  3O4X A;  4CLN A;  1YUT A;  1CNP A;  2K2A A;  1IWQ A;  3OGN A;  3S0B A;  1CMG A;  3I5G C;  3FE8 A;  4I5K A;  4YRU A;  1IGV A;  3OX6 A;  1LXF C;  1S1E A;  4DRW A;  3B86 A;  1QIW A;  1T14 A;  1EL4 A;  2BBM A;  2KAV A;  1Y6W A;  2JT8 A;  2Q4U A;  1KSO A;  4QJ4 B;  5HYD A;  3TUY C;  5ER5 A;  1KWO B;  3VB1 A;  1TIZ A;  1FPW A;  1A2X A;  1PSB A;  2P6B B;  5KTY A;  1B8R A;  1L7Z A;  2BEC A;  2LV7 A;  3S0E A;  1N2D A;  1TCF A;  2F3Y A;  2E30 A;  3SG7 A;  2L4I A;  2WOS A;  1DJW A;  2LLS A;  4D1E A;  1OOI X;  3CYZ A;  1YR5 A;  1DMO A;  1G4Y R;  1MQ1 A;  1NCX A;  3JTD B;  2K7B A;  1LKJ A;  1N65 A;  4NDB A;  1IRJ A;  1SL9 A;  1S5G Z;  1W7I B;  1J7O A;  5HLV A;  2GV5 A;  1WY9 A;  1SNL A;  1UHH A;  2A4J A;  2WND A;  4XJK B;  4F0Z B;  2QAC A;  1OZO A;  1IJ6 A;  1EXR A;  1F8H A;  4INX A;  5G08 A;  2WC5 A;  1X02 A;  2ZFD A;  4BY4 A;  1SL7 A;  2AUC A;  1DJX A;  1K9U A;  1SK6 D;  4UPG A;  4GAO A;  2F33 A;  4YI8 A;  4JWQ A;  3BUM B;  3I5I B;  3TS5 B;  3VRO A;  4C0J A;  1J7P A;  3NXA A;  1PVB A;  4YGA A;  3SS5 A;  2KQY A;  3IVT A;  2BKH B;  2MLF C;  1CMF A;  2KBI A;  1XA5 A;  2M1K B;  4HRH A;  1MXE A;  2M7L A;  1NYA A;  1QXP A;  2I7A A;  4PDZ A;  2JT0 A;  3D0Y A;  4GBA A;  1M46 A;  3NSI A;  3D77 A;  1OSA A;  2H61 A;  4ZCV A;  1SCM B;  1CFC A;  2JC2 A;  5TNC A;  2H61 C;  4PT1 A;  1NWD A;  4P5O E;  1JF0 A;  2PMY A;  3DY9 A;  3S0A A;  1J1E A;  4NDC A;  3B88 A;  3OP0 A;  1DF0 B;  4PHM A;  3I5F B;  1V1G A;  3QRX A;  1TNQ A;  1Y0V H;  5I2Q A;  3SG2 A;  3LK1 A;  1BMO A;  3WXA A;  4OCI A;  3EKH A;  3VGO A;  1QS7 A;  3BFA A;  4INW A;  5FI2 A;  2JQ6 A;  1TWO A;  5I94 A;  3BUO B;  4CPV A;  2KI4 B;  4YGC B;  2M0R A;  4Q04 A;  3CAB A;  1YX8 A;  1DC1 A;  3IF7 A;  1TOP A;  2WCH A;  2BCB A;  4ORC B;  2LUC A;  4IL1 A;  1FI6 A;  1S6I A;  2FOT A;  1N0Y A;  1QV0 A;  3BFH A;  4PHK A;  1Y1U A;  1H8B A;  1J55 A;  3PN7 C;  3JVT B;  3D10 A;  3OBV A;  4GNK B;  4I5L B;  1U5I A;  1UHJ A;  3BYA A;  1PSR A;  2MA2 A;  1YVH A;  2MAZ A;  1YVL A;  3LCP C;  1SKT A;  2R2I A;  1TRF A;  4MRX A;  3PFV A;  4YBH B;  1B4C A;  3PJI A;  2Y1M A;  2G9B A;  1LIN A;  2LMT A;  2GTE A;  3I5F C;  2LAN A;  4HRE E;  5DKQ A;  4AQJ A;  2BBN A;  2LMU A;  1UUS A;  4KYN A;  1TN4 A;  1MF8 B;  1DVI A;  1W9Z A;  2KYC A;  3GOF A;  4PCW A;  2LVJ A;  1KK8 B;  3BOW A;  5FYX A;  1YRT B;  1Z4H A;  3SS3 A;  2NZ0 A;  3DF0 A;  1QX2 A;  4GGF A;  4HRG A;  4PE7 A;  1XFR A;  1DTL A;  5ER4 X;  2CTN A;  4MZJ A;  2JPT A;  2P71 A;  2L4H A;  3DVM A;  1JUO A;  3DZT A;  1ODB A;  2E6W A;  1M63 B;  1IH0 A;  1UHK A;  1OOF A;  1IJ5 A;  1KQM C;  1G8I A;  2KFH A;  1C07 A;  1IQ5 A;  1K9K A;  4C0L A;  3CLN A;  1FBV A;  1SCV A;  1OW4 A;  2L5X B;  4PAL A;  3AKB A;  3OB1 B;  1OOG A;  1SPY A;  1DGV A;  1F4O A;  3R72 A;  1TUZ A;  2LLT A;  2M29 A;  3FS7 A;  3DVJ A;  1TTX A;  3CTN A;  5K89 A;  2LVI A;  3O6B A;  1CDL A;  1BOD A;  2BE6 A;  2KLD A;  1WDC B;  2GGM A;  1G33 A;  3Q8I A;  4YI9 A;  5KU1 A;  3ZNI A;  4XYN A;  2FCE A;  2MJW B;  2Y1N A;  3PM8 A;  1KFU L;  2JTZ A;  2K7O A;  1K93 D;  2I2R E;  5AFP A;  3L4L A;  1DEL A;  2B1U A;  1A29 A;  1KFX L;  1SMG A;  2ZRT A;  3VRR A;  5FI6 A;  1QV1 A;  4A4C A;  1ALW A;  3DYE A;  5GQQ C;  2OS8 B;  3OHM B;  2JU0 A;  1NPQ A;  5D3O A;  1UP5 A;  5DKR A;  2WCM A;  1AJ5 A;  4WQ2 A;  5JOL A;  2WCE A;  1C3Y A;  3OX5 A;  3NSL A;  4E68 A;  4FQT A;  1XFZ O;  1NX1 A;  3D76 A;  2L2C A;  3CZ0 A;  2BL0 B;  3O78 A;  3WNX B;  4PE0 A;  2Y5I A;  2K8M B;  3KEV A;  5DKN A;  3NHI A;  1WRZ A;  2OPO A;  4MSP A;  1Z2C B;  1YTZ C;  2L0P A;  1GGW A;  4C0K A;  1BF5 A;  2CCM A;  4CFR A;  1ZUZ A;  1CKK A;  3SG6 A;  2QEV A;  3I5H B;  2KPH A;  1K95 A;  2M9G A;  1A75 B;  1XFX O;  1QLK A;  1OMR A;  1QJT A;  1OMD A;  5AXI A;  4IJ7 A;  1KWO C;  2COL B;  1YRU B;  1XK4 A;  1FF1 A;  1XK4 C;  2OTG B;  1M39 A;  2I94 A;  1QIV A;  1DJH A;  3D0Y B;  2KAY A;  2PYQ A;  4USL A;  1XVJ A;  4N5X A;  2MBX A;  3BFB A;  3PLF B;  1ZFS A;  4DCK A;  3NGV A;  4NDD A;  1Y1A A;  1CFF A;  3O2P A;  4AQI A;  1AVS A;  3JTD C;  4GPL B;  3CZT X;  4MRY A;  1MR8 A;  2PQL A;  3CR5 X;  2KDH A;  1GJY A;  2AMI A;  2CXJ A;  4QJ5 B;  2LM5 A;  4HSZ A;  1SR6 B;  1PRW A;  1IG5 A;  1NX2 A;  4XJK A;  2LAP A;  2JRF A;  2BCA A;  2KGR A;  1HT9 A;  2ZND A;  3PAL A;  2LMV A;  3I5H C;  2Q91 A;  4A4B A;  1B47 A;  1K8U A;  2M49 B;  2ZKM X;  1DT7 B;  1KCY A;  1C3Z A;  2EC6 B;  4ICB A;  1FI5 A;  2KHN A;  2LUX A;  2K61 A;  1P28 A;  3D75 A;  3KO0 A;  4MBE A;  1YUS A;  2WCB A;  2H2K A;  1L2O B;  1XO5 A;  3WHU B;  5HKZ A;  4M2P A;  3I5I C;  1AJ4 A;  3TS5 C;  3S0G A;  2DOQ A;  2BAP A;  3DVK A;  5DIC A;  1B7T Y;  1CDM A;  3WHT B;  4CID A;  3HCM A;  1WLM A;  1VRK A;  2QEH A;  5AAN A;  1WLZ A;  1K96 A;  1OOJ A;  3CGA A;  3UO9 A;  2BCX A;  1JSA A;  1JFK A;  1S26 D;  2HET A;  1OE9 B;  1SCM C;  3VRQ A;  1LS8 A;  1PUL A;  1TCO B;  1NP8 A;  2JXL A;  2LC5 A;  3DD4 A;  2LHI A;  1GGZ A;  1JWD A;  3FE6 A;  4YGE B;  2QDI A;  3EG5 B;  2KFG A;  3BJH A;  3D78 A;  1JBA A;  1ZMZ A;  2M7N A;  1HQV A;  2V53 A;  1KSM A;  3FIA A;  5AER A;  2K60 A;  1IKU A;  2Y4Q A;  2HF5 A;  1DQE A;  2SAS A;  1A4P A;  3DF0 B;  2VRG A;  3F45 A;  3GK2 A;  1F70 A;  1K90 D;  1PVA A;  4U8D A;  4DUQ A;  3MSE B;  3RLZ A;  2M8U A;  3CR2 A;  1AP4 A;  4MEW A;  1OQP A;  1BT6 A;  2KI4 C;  3BUN B;  3BUX B;  4OV2 A;  1JFJ A;  1NIW A;  1TNP A;  3CZ2 A;  2D8N A;  3VRN A;  3D73 A;  1BR1 B;  3LL8 B;  1EH2 A;  2F3Z A;  2K7D A;  2ISD A;  2HQW A;  3TDU A;  2KSP A;  1CLM A;  4DIR A;  3C1V A;  3R1P A;  4WRI A;  1NX3 A;  1F4Q A;  1QAS A;  3V2L A;  1S36 A;  4DS7 A;  3AKA A;  3FWC A;  3I5G B;  3SIB A;  2NCO A;  3JVT C;  1QLS A;  5AEQ A;  1RWY A;  1E8A A;  3M0W A;  3DXL A;  3SS4 A;  1PK0 D;  2WC6 A;  4MLW A;  2FJY A;  1F55 A;  4PE4 A;  5IBW A;  1NSH A;  1LA3 A;  1TNW A;  1QWV A;  2PAS A;  1XFY O;  1B8L A;  4MZK A;  3BXK A;  1YUR A;  2PRU A;  2PAL A;  3A4U B;  2SCP A;  1CFD A;  2BE4 A;  3SG3 A;  2F2P A;  4JD9 A;  2KOT A;  2O60 A;  1R2U A;  3RZS A;  3BQ3 A;  2MRD A;  3EVU A;  1KK8 C;  1MUX A;  4GUK A;  1EG3 A;  2JWW A;  1K9P A;  2K2F A;  2KI6 C;  1RTP 1;  5CSI A;  1H4B A;  1DJY A;  1C7W A;  1W7J B;  1DEK A;  2P70 A;  2WCJ A;  4M2Q A;  1MWN A;  3S0F A;  1C7V A;  2F2O A;  3L47 A;  2PVB A;  1BJF A;  3PM2 A;  2JPO A;  3IQO A;  2ZNE A;  4FTG A;  1DGU A;  3EKJ A;  1QVI Y;  2NXQ A;  1XYD A;  2LVK A;  4GGN A;  4YGD B;  1NX0 A;  1BR4 B;  2ERB A;  3A8R A;  2WCK A;  3KF9 A;  3LK0 A;  2G2B A;  4JQ0 D;  4L9M A;  4YGB B;  2IS9 A;  2K0J A;  5KSZ A;  3L4A A;  1XFV O;  4FQO A;  4NQG A;  3E3R A;  2CBL A;  2QEB A;  4OKH A;  1SBJ A;  1WRL A;  1FW4 A;  1ZOT B;  2M3W A;  5JJG A;  2WC8 A;  2KI6 D;  3ICB A;  5CSJ A;  1GQM A;  3EK8 A;  1CFP A;  4PHN A;  3NSK A;  4JKT A;  5I2O A;  1WDC C;  4TNC A;  3EVV A;  2TN4 A;  2K7C A;  1UHN A;  1CTR A;  1TNX A;  4PE1 A;  5HKW A;  3SG5 A;  2LLU A;  4AOM A;  1IIO A;  1REC A;  3K21 A;  1AHR A; 
#chains in the Genus database with same CATH homology
 3D75 A;  1P28 A;  3OGN A;  1GM0 A;  2GTE A;  3S0B A;  3FE8 A;  1ORG A;  3S0G A;  3B86 A;  5DIC A;  1OOH A;  1T14 A;  1XFR A;  2P71 A;  2QEH A;  2QEO A;  3DZT A;  3VB1 A;  4F7F A;  1OOF A;  1LS8 A;  1TUJ A;  3S0E A;  3FE9 A;  3FE6 A;  2QDI A;  1OW4 A;  3NHT A;  3BJH A;  3D78 A;  1OOI X;  3CYZ A;  1OOG A;  3CZ1 A;  3R72 A;  1DQE A;  3CDN A;  2WCL A;  3K1E A;  3B6X A;  3Q8I A;  3B7A A;  3CZ2 A;  3D73 A;  4INX A;  3L4L A;  3R1P A;  2WC5 A;  3V2L A;  3DYE A;  3DXL A;  2H8V A;  2WC6 A;  2FJY A;  2WCM A;  1C3Y A;  1QWV A;  3S0D A;  4FQT A;  3N7H A;  3D76 A;  2L2C A;  3CZ0 A;  4OZD A;  3NHI A;  3D77 A;  4JD9 A;  3RZS A;  4PT1 A;  3QME A;  2QEV A;  2KPH A;  3DY9 A;  5EL2 A;  3R1O A;  3S0A A;  2WCJ A;  2P70 A;  3B88 A;  3S0F A;  3L47 A;  2JPO A;  4INW A;  3BFA A;  2ERB A;  1TWO A;  2WCK A;  3BFB A;  3L4A A;  3CAB A;  3NGV A;  3D74 A;  2WCH A;  2QEB A;  2PQL A;  3BFH A;  3R1V A;  1C3Z A;  3PJI A;  3B87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...