1XFRA

Solution structure of the bombyx mori pheromone-binding protein fragment bmpbp(1-128) at ph 6.5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
b'SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein
publication title Dynamic conformational equilibria in the physiological function of the Bombyx mori pheromone-binding protein.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 43
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1xfrA00
2P71A 3RZSA 1OOHA 2JPOA 2PQLA 3D76A 3CZ0A 3B86A 2QEBA 1OOFA 3R1VA 3L4LA 3OGNA 1QWVA 2WCKA 3Q8IA 3B7AA 1C3YA 3DY9A 3S0AA 2H8VA 1C3ZA 3BFAA 3R1OA 3R1PA 3CYZA 3L47A 3FE6A 1LS8A 2QEHA 4INXA 2WC6A 3NGVA 4INWA 3S0GA 3BFBA 3CABA 3QMEA 2ERBA 1DQEA 2WCMA 4F7FA 3NHIA 3V2LA 2L2CA 3D75A 1T14A 2QEOA 3CZ2A 1OOGA 4PT1A 3K1EA 3S0DA 3D73A 5DICA 3B6XA 3BJHA 3D78A 3CZ1A 3DZTA 2WCLA 1XFRA 2QDIA 2WCJA 2GTEA 1GM0A 3FE8A 1TWOA 2QEVA 3S0FA 5EL2A 3DYEA 1OW4A 3B88A 3CDNA 1TUJA 3R72A 4JD9A 1OOIX 3S0EA 2KPHA 3NHTA 4OZDA 2P70A 2FJYA 3DXLA 3BFHA 2WC5A 3B87A 3L4AA 3D74A 2WCHA 1P28A 1ORGA 3VB1A 3PJIA 3D77A 3N7HA 3FE9A 3S0BA 4FQTA
chains in the Genus database with same CATH superfamily
2KDHA 4YGDB 2KFHA 4QJ5B 5DKRA 5HLOA 2KQ6A 4YGBB 2LVVA 1WRKA 2K60A 2QACA 5D69A 4GBAA 1U5IB 1LA0A 3AAJA 1MHOA 1QVIY 5ER5A 1H4BA 1RECA 2Q4UA 3A8RA 3SG3A 2CXJA 3OGNA 3Q8IA 1DTLA 1KFUS 1NX2A 4DRWA 2BAPA 1S5GY 2HF5A 1SMGA 2R2IA 3SG4A 4M2QA 1F70A 4JKTA 1M63B 2ISDA 3R1OA 2BE4A 3R1PA 4I5NB 5FYXA 1DJGA 1PRWA 1BMOA 1U5IA 3TUYB 3KF9A 4IJ7A 1M45A 1QLKA 4N1GA 1XVJA 1IQ5A 1DJYA 4MN0A 3QRXA 2ZNDA 5AXIA 1E8AA 2LLTA 2K7CA 1C07A 4GFTA 3FS7A 4P2YB 1L2OB 1S1EA 2KBIA 2K61A 1J1DA 2LV7A 4MRXA 3SS4A 1RFJA 1B8CA 1BG1A 1J7QA 2Y1MA 1Y1AA 1SCMB 2BL0C 2CT9A 1DF0B 4DIRA 5AEQA 1KFUL 2JU0A 1YURA 3DF0A 2KAXA 3SG2A 1JF0A 5BPJA 4DUQA 1BT6A 1XO5A 4MZKA 3CZ2A 1OOGA 2L4IA 1SCMC 3ZNIA 2ZN8A 4GGNA 2BCBA 4WQ2A 1C7VA 1D1OA 3DD4A 1N0YA 4FQOA 3PFVA 3BJHA 1WY9A 2COLB 1IRJA 1A4PA 2CBLA 3OP0A 3CZ1A 1QV0A 1K93D 1XA5A 2WCLA 3BUWB 3SG7A 1W9ZA 1YRTB 3VRQA 2QDIA 1AUIB 1OMVA 3JVTC 5D3OA 2WCFA 1GM0A 2K7BA 1EL4A 4CFRA 1NIWA 1UHKA 2O60A 4CPVA 1UP5A 3BUXB 1TWOA 4MRYA 2H61C 4I5JA 2LCPA 5D7FA 3NSOA 1J55A 3DYEA 1F55A 1LA3A 1PK0D 1QS7A 1VRKA 3CDNA 1TCFA 1DT7B 2GGMA 1S3PA 4MBEA 2LLSA 1CDMA 1IGVA 4JD9A 1QVIZ 4P5OE 1DELA 4C0KA 1OOIX 1V1FA 2AMIA 3CTNA 4OZDA 1WLMA 2KI4B 2M3WA 2OPOA 1JBAA 3I5IB 3PSRA 1KWOB 2JXCA 2L51A 4Q04A 4YGAA 1M39A 2ZN9A 1OE9B 2JWWA 4A4CA 4XJKB 1A75B 3PN7B 2BKIB 2BECA 1B7TY 2WCHA 2LVIA 1MXEA 3VB1A 5I2OA 3AAKA 5CSFA 2LP3A 3SIBA 2LMTA 1IKUA 1YTZC 3N7HA 2LE9B 1LINA 4FQTA 1SCVA 4C0LA 4JPZB 1QX2A 1XYDA 1J7RA 2LC5A 3RZSA 4XJKA 1UHIA 3O2PA 5AFPA 4F0ZB 2NXQA 5B8IB 2G9BA 2PQLA 4MSPA 2I7AA 1RTP1 2LNKA 2NLNA 4BY5A 3D76A 3RM1A 1WRZA 3LK1A 1CDLA 1CMFA 1KFXS 1XFWO 1OOFA 1TNWA 2CNPA 3PM2A 1DJWA 1NX1A 2AUCA 1KQMB 3B7AA 3EG5B 1C3YA 2BBNA 2KBMA 2NCOA 3S0AA 2Y4QA 1SL8A 3SS5A 2H8VA 1J7PA 1TNPA 1QJTA 2CCMA 3BFAA 1NUBA 2F8PA 2E30A 1UHNA 2KI6C 2EHBA 2WNDA 3CYZA 3FE6A 1PSRA 4KYNA 2LANA 2BBMA 2K0JA 1XFVO 1YRUB 2NCPA 5CSNA 1JFJA 1F71A 2JULA 2Y5IA 1FW4A 3DVEA 3EVUA 2JTZA 4INXA 4ETOA 1JSAA 2JPTA 1MWNA 5GQQC 3IVTA 1ZACA 1TNQA 1Y1UA 2AAOA 2WC8A 1XFYO 2ZKMX 3BXKA 3VROA 1PVBA 2M8UA 4YI8A 5I2LA 1TN4A 2JOJA 2K7OA 4A4BA 1QTXA 1YX8A 4C0JA 2WCMA 1CB1A 3GK4X 2SCPA 1DC1A 3CLNA 1OMRA 3I5FC 2KAYA 1PVAA 2F2OA 1G4YR 1T14A 2F33A 4YGCB 1A03A 2WORA 3VGOA 1OOJA 2JZIA 1PALA 2PYQA 1SPYA 1IQ3A 3S0DA 4DS7A 1G33A 1Y1XA 4HREE 2LUXA 3JTDC 2MBXA 3CR5X 2PASA 1QATA 5HKYA 1PSBA 2BL0B 3EKHA 4CFQA 3C1VA 1QX7A 2KGBC 4R1EA 1B7TZ 1TIZA 3I5GC 1ZFSA 2BKHB 1EG3A 1TOPA 1NX0A 5HYDA 1NCZA 1DJXA 2L5XB 1FF1A 1RK9A 1MQ1A 1JFKA 1ZMZA 2ZFDA 4GAOA 3DVMA 1CTRA 1K90D 1SY9A 1K9PA 2PSRA 1TTXA 4HSZA 2MA2A 3OX6A 4D1EA 2F2PA 1F8HA 1DGVA 2JT0A 1SRAA 3TDIA 1TNXA 2KPHA 3NHTA 1DF0A 1XK4A 1MUXA 2MAZA 3JVTB 2HQ8A 3CGAA 3DXLA 1Z2CB 2H2KA 2PVBA 1NSHA 3OHMB 4YI9A 1NX3A 3BYAA 4OKHA 2P6BB 2K2AA 4MEWA 2FOTA 3FWCA 2JQ6A 2DOQA 1A29A 2LUCA 3RLZA 3TZ1A 4GNKB 1OMDA 1IWQA 2KLDA 3PJIA 4XYNA 4N5XA 1CLMA 3M0WA 1AHRA 2D8NA 5ER4X 3LL8B 1ZUZA 1LVCD 3FE9A 1N2DA 2JNFA 2KNEA 5G08A 2P71A 1M46A 3CWGA 1S6JA 2Y1NA 2OTGB 2ZNEA 3TDZA 2H61A 5CSJA 2PMYA 1OOHA 2BCAA 1R6PA 1HQVA 3VRNA 1CLBA 3CS1A 4I5KA 2JPOA 2F3ZA 1KSMA 1X02A 1YUUA 2ZRTA 3CZ0A 3PALA 4N1FA 1S26D 1YVHA 1BOCA 4UPGA 2K7DA 2OTGC 1S5GZ 2LVKA 1EH2A 1J7OA 3BOWB 2LMUA 2RGIA 1F4QA 1FPWA 3WHUB 3OX5A 3DY9A 1CMGA 5AANA 1SNLA 1C3ZA 2VRGA 2JTTA 4ICBA 1AJ4A 1BLQA 1MF8B 3OB1B 3TDUA 1XFXO 3L47A 1NYAA 1QASA 1LS8A 2BE6A 4PALA 1RWYA 2I18A 1GJYA 1SBJA 4ORCB 2LMVA 2QEHA 3O6BA 4PHMA 1W7JB 1A75A 2WC6A 1CNPA 1DJZA 2KSPA 4GGFC 4INWA 5DKQA 1CLLA 3EKJA 1KK8C 2K2FA 2OS8C 3QMEA 4ZCVA 2ERBA 4GUKA 4AQJA 1NPQA 2GGZA 4MLWA 1UURA 4L9MA 5I2QA 2JXLA 2M0RA 1JC2A 4WQ3A 1C7WA 2FJUB 1F4OA 2QPTA 3LCPC 3LLEA 4HRHA 1A2XA 5IBWA 1K95A 2M9GA 3NHIA 5KSZA 3V2LA 2L2CA 1DVIA 4AQIA 3O4YA 1QV1A 1QLSA 1EJ3A 1QIWA 3BUNB 5I94A 2L50A 2QEOA 2KFFA 2SASA 5FI6A 4PT1A 1BF5A 2KOTA 3D0YB 4NQGA 1KCYA 2JT3A 2JT8A 5HKWA 4WRIA 3SG6A 1B8LA 2KI6D 2M1KB 1YUTA 3O78A 2M7NA 1CFFA 1DMOA 2KGRA 2KQYA 2M49B 4GPLB 4MZJA 1K2HA 1GQMA 2BCXA 1L7ZA 2KYFA 3I5FB 2PRUA 2M1UA 3A4UB 4ZCUA 3EK4A 3MSEB 5I8NA 1K8UA 3NXAA 5KTYA 1FI6A 1ZOTB 4DCKA 2ZRSA 2EC6C 4ORBB 3VRRA 1KFXL 5JJGA 1AK8A 3VRPA 2M97A 1K96A 2BNXA 3FE8A 3SG5A 1CDPA 2MLFC 4YGEB 4USLA 1TUZA 2TN4A 3JTDB 4M2PA 2IS9A 1B1GA 3I5HC 1OW4A 4CIDA 5J3XA 3B88A 1IJ6A 1OZSA 4AOMA 3R72A 3I5GB 2MJWB 1CM4A 2P70A 2FJYA 1SR6B 2YGUA 3AKAA 3FWBA 3BFHA 2WC5A 1DEKA 1FI5A 3HX4A 1Y6WA 1B4CA 2MLEC 2NZ0A 1KK7Y 2LVJA 2WCBA 3KEVA 4YBHB 2HPSA 1P28A 1SR6C 3K21A 1WLZA 1V1GA 1SL9A 1UHHA 2MHHA 3BQ3A 5CPVA 2KAVA 1UWOA 1OSAA 1YX7A 4PE7A 1JF2A 1SK6D 2CTNA 1H8BA 3EVRA 3FIAA 4M2OA 4OV2A 5DKNA 1B47A 1IJ5A 1BJFA 4BY4A 2L98A 1TCOB 5FI2A 1CFPA 1B9AA 3DF0B 3GOFA 1DJIA 3TUYC 1CFDA 4NDDA 1ALVA 3ZWHA 1QIVA 2LHIA 1BODA 2E6WA 3B86A 4PE0A 2QEBA 2F3YA 1UHJA 5HLVA 1K9KA 3LK0A 3R1VA 2KLEA 3L4LA 1QWVA 2WCKA 2KYCA 4MZLA 3TS5B 1RROA 1YVLA 3O4XA 2L4HA 2O5GA 2GV5A 4FTGA 1LKJA 5FI7A 4PE1A 5CSIA 3SS3A 5K89A 1L2OC 2LHLA 2B1UA 4PCWA 3EK8A 2LP2A 3TS5C 1UUSA 4OCIA 2HETA 1AVSA 1XK4C 3EK7A 2L0PA 1QX5B 3IQQA 4PE4A 1NCYA 1K94A 3EVVA 2WOSA 1Z4HA 4I5LB 3CZTX 3NGVA 1HT9A 1QXPA 2JRFA 2PALA 5JOLA 2M7LA 3S0GA 1F54A 1YUSA 3BFBA 1J1EA 3CABA 3PM8A 1LXFC 4QJ3B 3ICBA 4OVNF 4JWQA 1IIOA 1Y0VH 4IL1A 1IH0A 2L2EA 5F6TA 1JUOA 1DQEA 3KPXA 1RJVA 3NSIA 3NSKA 4JQ0D 4F7FA 1PULA 1ALWA 1S36A 1R2UA 1GGWA 3PLFB 3NSLA 1SYMA 5HKZA 3KO0A 2FCEA 2KFGA 3D75A 2LM5A 1BR4B 1CM1A 3WXAA 2HQWA 3H4SE 4PHJA 4YRUA 2A4JA 1KK8B 2K8MB 2OS8B 3K1EA 1B8RA 1TRFA 3DVJA 3IF7A 3SJSA 3WNXB 5PALA 2M29A 3UNWA 3UO9A 4CLNA 2WCEA 1KQVA 3BOWA 1NCXA 1OQPA 3D73A 3E3RA 5DICA 4E68A 3AKBA 3B6XA 3IQOA 2JC2A 2LLUA 4NDCA 3BUOB 5KU1A 1NWDA 1KK7Z 3D78A 1CKKA 3DZTA 5TNCA 3F45A 5HL1A 1AJ5A 1XFRA 2MRDA 4GGFA 1ODBA 1DGUA 4PDZA 1S6IA 1EG4A 2KI4C 3HCMA 2WCJA 2GTEA 1SW8A 2LAPA 2I94A 3I5IC 4HRGA 3DVKA 1KWOC 3KHEA 1FBVA 1S6CA 1MXLC 2QEVA 3GK2A 3PN7C 3D10A 4NDBA 4U8DA 3S0FA 5EL2A 3SIAA 1EXRA 5AERA 1SKTA 1XFUO 1NP8A 1M31A 1Q80A 1TUJA 1MR8A 2G2BA 1AP4A 3BUMB 3S0EA 1CFCA 1WDCB 2EC6B 3CR2A 1N65A 2EGDA 1WRLA 1IG5A 1W7IB 2L5YA 4TNCA 3CR4X 1XFZO 2Q91A 1OZOA 4QJ4B 4PHKA 2KHNA 1CDNA 1JWDA 1BU3A 3OB2B 1KSOA 1DJHA 1YR5A 2FCDA 3B87A 3D74A 3L4AA 4PHNA 3WHTB 2V53A 1GGZA 2I2RE 3D0YA 1WDCC 1SSEB 3PATA 3I5HB 1BR1B 1ORGA 2JNXA 4ORAB 1K9UA 1SL7A 1KQMC 3OBVA 3D77A 4MVFA 1G8IA 3S0BA 3GK1A 4OR9B
chains in the Genus database with same CATH topology
2P71A 3RZSA 1OOHA 2JPOA 2PQLA 3D76A 3CZ0A 3B86A 2QEBA 1OOFA 3R1VA 3L4LA 3OGNA 1QWVA 2WCKA 3Q8IA 3B7AA 1C3YA 3DY9A 3S0AA 2H8VA 1C3ZA 3BFAA 3R1OA 3R1PA 3CYZA 3L47A 3FE6A 1LS8A 2QEHA 4INXA 2WC6A 3NGVA 4INWA 3S0GA 3BFBA 3CABA 3QMEA 2ERBA 1DQEA 2WCMA 4F7FA 3NHIA 3V2LA 2L2CA 3D75A 1T14A 2QEOA 3CZ2A 1OOGA 4PT1A 3K1EA 3S0DA 3D73A 5DICA 3B6XA 3BJHA 3D78A 3CZ1A 3DZTA 2WCLA 1XFRA 2QDIA 2WCJA 2GTEA 1GM0A 3FE8A 1TWOA 2QEVA 3S0FA 5EL2A 3DYEA 1OW4A 3B88A 3CDNA 1TUJA 3R72A 4JD9A 1OOIX 3S0EA 2KPHA 3NHTA 4OZDA 2P70A 2FJYA 3DXLA 3BFHA 2WC5A 3B87A 3L4AA 3D74A 2WCHA 1P28A 1ORGA 3VB1A 3PJIA 3D77A 3N7HA 3FE9A 3S0BA 4FQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P71 A;  3RZS A;  1OOH A;  2JPO A;  2PQL A;  3D76 A;  3CZ0 A;  3B86 A;  2QEB A;  1OOF A;  3R1V A;  3L4L A;  3OGN A;  1QWV A;  2WCK A;  3Q8I A;  3B7A A;  1C3Y A;  3DY9 A;  3S0A A;  2H8V A;  1C3Z A;  3BFA A;  3R1O A;  3R1P A;  3CYZ A;  3L47 A;  3FE6 A;  1LS8 A;  2QEH A;  4INX A;  2WC6 A;  3NGV A;  4INW A;  3S0G A;  3BFB A;  3CAB A;  3QME A;  2ERB A;  1DQE A;  2WCM A;  4F7F A;  3NHI A;  3V2L A;  2L2C A;  3D75 A;  1T14 A;  2QEO A;  3CZ2 A;  1OOG A;  4PT1 A;  3K1E A;  3S0D A;  3D73 A;  5DIC A;  3B6X A;  3BJH A;  3D78 A;  3CZ1 A;  3DZT A;  2WCL A;  1XFR A;  2QDI A;  2WCJ A;  2GTE A;  1GM0 A;  3FE8 A;  1TWO A;  2QEV A;  3S0F A;  5EL2 A;  3DYE A;  1OW4 A;  3B88 A;  3CDN A;  1TUJ A;  3R72 A;  4JD9 A;  1OOI X;  3S0E A;  2KPH A;  3NHT A;  4OZD A;  2P70 A;  2FJY A;  3DXL A;  3BFH A;  2WC5 A;  3B87 A;  3L4A A;  3D74 A;  2WCH A;  1P28 A;  1ORG A;  3VB1 A;  3PJI A;  3D77 A;  3N7H A;  3FE9 A;  3S0B A;  4FQT A; 
#chains in the Genus database with same CATH topology
 2KDH A;  4YGD B;  2KFH A;  4QJ5 B;  5DKR A;  5HLO A;  2KQ6 A;  4YGB B;  2LVV A;  1WRK A;  2K60 A;  2QAC A;  5D69 A;  4GBA A;  1U5I B;  1LA0 A;  3AAJ A;  1MHO A;  1QVI Y;  5ER5 A;  1H4B A;  1REC A;  2Q4U A;  3A8R A;  3SG3 A;  2CXJ A;  3OGN A;  3Q8I A;  1DTL A;  1KFU S;  1NX2 A;  4DRW A;  2BAP A;  1S5G Y;  2HF5 A;  1SMG A;  2R2I A;  3SG4 A;  4M2Q A;  1F70 A;  4JKT A;  1M63 B;  2ISD A;  3R1O A;  2BE4 A;  3R1P A;  4I5N B;  5FYX A;  1DJG A;  1PRW A;  1BMO A;  1U5I A;  3TUY B;  3KF9 A;  4IJ7 A;  1M45 A;  1QLK A;  4N1G A;  1XVJ A;  1IQ5 A;  1DJY A;  4MN0 A;  3QRX A;  2ZND A;  5AXI A;  1E8A A;  2LLT A;  2K7C A;  1C07 A;  4GFT A;  3FS7 A;  4P2Y B;  1L2O B;  1S1E A;  2KBI A;  2K61 A;  1J1D A;  2LV7 A;  4MRX A;  3SS4 A;  1RFJ A;  1B8C A;  1BG1 A;  1J7Q A;  2Y1M A;  1Y1A A;  1SCM B;  2BL0 C;  2CT9 A;  1DF0 B;  4DIR A;  5AEQ A;  1KFU L;  2JU0 A;  1YUR A;  3DF0 A;  2KAX A;  3SG2 A;  1JF0 A;  5BPJ A;  4DUQ A;  1BT6 A;  1XO5 A;  4MZK A;  3CZ2 A;  1OOG A;  2L4I A;  1SCM C;  3ZNI A;  2ZN8 A;  4GGN A;  2BCB A;  4WQ2 A;  1C7V A;  1D1O A;  3DD4 A;  1N0Y A;  4FQO A;  3PFV A;  3BJH A;  1WY9 A;  2COL B;  1IRJ A;  1A4P A;  2CBL A;  3OP0 A;  3CZ1 A;  1QV0 A;  1K93 D;  1XA5 A;  2WCL A;  3BUW B;  3SG7 A;  1W9Z A;  1YRT B;  3VRQ A;  2QDI A;  1AUI B;  1OMV A;  3JVT C;  5D3O A;  2WCF A;  1GM0 A;  2K7B A;  1EL4 A;  4CFR A;  1NIW A;  1UHK A;  2O60 A;  4CPV A;  1UP5 A;  3BUX B;  1TWO A;  4MRY A;  2H61 C;  4I5J A;  2LCP A;  5D7F A;  3NSO A;  1J55 A;  3DYE A;  1F55 A;  1LA3 A;  1PK0 D;  1QS7 A;  1VRK A;  3CDN A;  1TCF A;  1DT7 B;  2GGM A;  1S3P A;  4MBE A;  2LLS A;  1CDM A;  1IGV A;  4JD9 A;  1QVI Z;  4P5O E;  1DEL A;  4C0K A;  1OOI X;  1V1F A;  2AMI A;  3CTN A;  4OZD A;  1WLM A;  2KI4 B;  2M3W A;  2OPO A;  1JBA A;  3I5I B;  3PSR A;  1KWO B;  2JXC A;  2L51 A;  4Q04 A;  4YGA A;  1M39 A;  2ZN9 A;  1OE9 B;  2JWW A;  4A4C A;  4XJK B;  1A75 B;  3PN7 B;  2BKI B;  2BEC A;  1B7T Y;  2WCH A;  2LVI A;  1MXE A;  3VB1 A;  5I2O A;  3AAK A;  5CSF A;  2LP3 A;  3SIB A;  2LMT A;  1IKU A;  1YTZ C;  3N7H A;  2LE9 B;  1LIN A;  4FQT A;  1SCV A;  4C0L A;  4JPZ B;  1QX2 A;  1XYD A;  1J7R A;  2LC5 A;  3RZS A;  4XJK A;  1UHI A;  3O2P A;  5AFP A;  4F0Z B;  2NXQ A;  5B8I B;  2G9B A;  2PQL A;  4MSP A;  2I7A A;  1RTP 1;  2LNK A;  2NLN A;  4BY5 A;  3D76 A;  3RM1 A;  1WRZ A;  3LK1 A;  1CDL A;  1CMF A;  1KFX S;  1XFW O;  1OOF A;  1TNW A;  2CNP A;  3PM2 A;  1DJW A;  1NX1 A;  2AUC A;  1KQM B;  3B7A A;  3EG5 B;  1C3Y A;  2BBN A;  2KBM A;  2NCO A;  3S0A A;  2Y4Q A;  1SL8 A;  3SS5 A;  2H8V A;  1J7P A;  1TNP A;  1QJT A;  2CCM A;  3BFA A;  1NUB A;  2F8P A;  2E30 A;  1UHN A;  2KI6 C;  2EHB A;  2WND A;  3CYZ A;  3FE6 A;  1PSR A;  4KYN A;  2LAN A;  2BBM A;  2K0J A;  1XFV O;  1YRU B;  2NCP A;  5CSN A;  1JFJ A;  1F71 A;  2JUL A;  2Y5I A;  1FW4 A;  3DVE A;  3EVU A;  2JTZ A;  4INX A;  4ETO A;  1JSA A;  2JPT A;  1MWN A;  5GQQ C;  3IVT A;  1ZAC A;  1TNQ A;  1Y1U A;  2AAO A;  2WC8 A;  1XFY O;  2ZKM X;  3BXK A;  3VRO A;  1PVB A;  2M8U A;  4YI8 A;  5I2L A;  1TN4 A;  2JOJ A;  2K7O A;  4A4B A;  1QTX A;  1YX8 A;  4C0J A;  2WCM A;  1CB1 A;  3GK4 X;  2SCP A;  1DC1 A;  3CLN A;  1OMR A;  3I5F C;  2KAY A;  1PVA A;  2F2O A;  1G4Y R;  1T14 A;  2F33 A;  4YGC B;  1A03 A;  2WOR A;  3VGO A;  1OOJ A;  2JZI A;  1PAL A;  2PYQ A;  1SPY A;  1IQ3 A;  3S0D A;  4DS7 A;  1G33 A;  1Y1X A;  4HRE E;  2LUX A;  3JTD C;  2MBX A;  3CR5 X;  2PAS A;  1QAT A;  5HKY A;  1PSB A;  2BL0 B;  3EKH A;  4CFQ A;  3C1V A;  1QX7 A;  2KGB C;  4R1E A;  1B7T Z;  1TIZ A;  3I5G C;  1ZFS A;  2BKH B;  1EG3 A;  1TOP A;  1NX0 A;  5HYD A;  1NCZ A;  1DJX A;  2L5X B;  1FF1 A;  1RK9 A;  1MQ1 A;  1JFK A;  1ZMZ A;  2ZFD A;  4GAO A;  3DVM A;  1CTR A;  1K90 D;  1SY9 A;  1K9P A;  2PSR A;  1TTX A;  4HSZ A;  2MA2 A;  3OX6 A;  4D1E A;  2F2P A;  1F8H A;  1DGV A;  2JT0 A;  1SRA A;  3TDI A;  1TNX A;  2KPH A;  3NHT A;  1DF0 A;  1XK4 A;  1MUX A;  2MAZ A;  3JVT B;  2HQ8 A;  3CGA A;  3DXL A;  1Z2C B;  2H2K A;  2PVB A;  1NSH A;  3OHM B;  4YI9 A;  1NX3 A;  3BYA A;  4OKH A;  2P6B B;  2K2A A;  4MEW A;  2FOT A;  3FWC A;  2JQ6 A;  2DOQ A;  1A29 A;  2LUC A;  3RLZ A;  3TZ1 A;  4GNK B;  1OMD A;  1IWQ A;  2KLD A;  3PJI A;  4XYN A;  4N5X A;  1CLM A;  3M0W A;  1AHR A;  2D8N A;  5ER4 X;  3LL8 B;  1ZUZ A;  1LVC D;  3FE9 A;  1N2D A;  2JNF A;  2KNE A;  5G08 A;  2P71 A;  1M46 A;  3CWG A;  1S6J A;  2Y1N A;  2OTG B;  2ZNE A;  3TDZ A;  2H61 A;  5CSJ A;  2PMY A;  1OOH A;  2BCA A;  1R6P A;  1HQV A;  3VRN A;  1CLB A;  3CS1 A;  4I5K A;  2JPO A;  2F3Z A;  1KSM A;  1X02 A;  1YUU A;  2ZRT A;  3CZ0 A;  3PAL A;  4N1F A;  1S26 D;  1YVH A;  1BOC A;  4UPG A;  2K7D A;  2OTG C;  1S5G Z;  2LVK A;  1EH2 A;  1J7O A;  3BOW B;  2LMU A;  2RGI A;  1F4Q A;  1FPW A;  3WHU B;  3OX5 A;  3DY9 A;  1CMG A;  5AAN A;  1SNL A;  1C3Z A;  2VRG A;  2JTT A;  4ICB A;  1AJ4 A;  1BLQ A;  1MF8 B;  3OB1 B;  3TDU A;  1XFX O;  3L47 A;  1NYA A;  1QAS A;  1LS8 A;  2BE6 A;  4PAL A;  1RWY A;  2I18 A;  1GJY A;  1SBJ A;  4ORC B;  2LMV A;  2QEH A;  3O6B A;  4PHM A;  1W7J B;  1A75 A;  2WC6 A;  1CNP A;  1DJZ A;  2KSP A;  4GGF C;  4INW A;  5DKQ A;  1CLL A;  3EKJ A;  1KK8 C;  2K2F A;  2OS8 C;  3QME A;  4ZCV A;  2ERB A;  4GUK A;  4AQJ A;  1NPQ A;  2GGZ A;  4MLW A;  1UUR A;  4L9M A;  5I2Q A;  2JXL A;  2M0R A;  1JC2 A;  4WQ3 A;  1C7W A;  2FJU B;  1F4O A;  2QPT A;  3LCP C;  3LLE A;  4HRH A;  1A2X A;  5IBW A;  1K95 A;  2M9G A;  3NHI A;  5KSZ A;  3V2L A;  2L2C A;  1DVI A;  4AQI A;  3O4Y A;  1QV1 A;  1QLS A;  1EJ3 A;  1QIW A;  3BUN B;  5I94 A;  2L50 A;  2QEO A;  2KFF A;  2SAS A;  5FI6 A;  4PT1 A;  1BF5 A;  2KOT A;  3D0Y B;  4NQG A;  1KCY A;  2JT3 A;  2JT8 A;  5HKW A;  4WRI A;  3SG6 A;  1B8L A;  2KI6 D;  2M1K B;  1YUT A;  3O78 A;  2M7N A;  1CFF A;  1DMO A;  2KGR A;  2KQY A;  2M49 B;  4GPL B;  4MZJ A;  1K2H A;  1GQM A;  2BCX A;  1L7Z A;  2KYF A;  3I5F B;  2PRU A;  2M1U A;  3A4U B;  4ZCU A;  3EK4 A;  3MSE B;  5I8N A;  1K8U A;  3NXA A;  5KTY A;  1FI6 A;  1ZOT B;  4DCK A;  2ZRS A;  2EC6 C;  4ORB B;  3VRR A;  1KFX L;  5JJG A;  1AK8 A;  3VRP A;  2M97 A;  1K96 A;  2BNX A;  3FE8 A;  3SG5 A;  1CDP A;  2MLF C;  4YGE B;  4USL A;  1TUZ A;  2TN4 A;  3JTD B;  4M2P A;  2IS9 A;  1B1G A;  3I5H C;  1OW4 A;  4CID A;  5J3X A;  3B88 A;  1IJ6 A;  1OZS A;  4AOM A;  3R72 A;  3I5G B;  2MJW B;  1CM4 A;  2P70 A;  2FJY A;  1SR6 B;  2YGU A;  3AKA A;  3FWB A;  3BFH A;  2WC5 A;  1DEK A;  1FI5 A;  3HX4 A;  1Y6W A;  1B4C A;  2MLE C;  2NZ0 A;  1KK7 Y;  2LVJ A;  2WCB A;  3KEV A;  4YBH B;  2HPS A;  1P28 A;  1SR6 C;  3K21 A;  1WLZ A;  1V1G A;  1SL9 A;  1UHH A;  2MHH A;  3BQ3 A;  5CPV A;  2KAV A;  1UWO A;  1OSA A;  1YX7 A;  4PE7 A;  1JF2 A;  1SK6 D;  2CTN A;  1H8B A;  3EVR A;  3FIA A;  4M2O A;  4OV2 A;  5DKN A;  1B47 A;  1IJ5 A;  1BJF A;  4BY4 A;  2L98 A;  1TCO B;  5FI2 A;  1CFP A;  1B9A A;  3DF0 B;  3GOF A;  1DJI A;  3TUY C;  1CFD A;  4NDD A;  1ALV A;  3ZWH A;  1QIV A;  2LHI A;  1BOD A;  2E6W A;  3B86 A;  4PE0 A;  2QEB A;  2F3Y A;  1UHJ A;  5HLV A;  1K9K A;  3LK0 A;  3R1V A;  2KLE A;  3L4L A;  1QWV A;  2WCK A;  2KYC A;  4MZL A;  3TS5 B;  1RRO A;  1YVL A;  3O4X A;  2L4H A;  2O5G A;  2GV5 A;  4FTG A;  1LKJ A;  5FI7 A;  4PE1 A;  5CSI A;  3SS3 A;  5K89 A;  1L2O C;  2LHL A;  2B1U A;  4PCW A;  3EK8 A;  2LP2 A;  3TS5 C;  1UUS A;  4OCI A;  2HET A;  1AVS A;  1XK4 C;  3EK7 A;  2L0P A;  1QX5 B;  3IQQ A;  4PE4 A;  1NCY A;  1K94 A;  3EVV A;  2WOS A;  1Z4H A;  4I5L B;  3CZT X;  3NGV A;  1HT9 A;  1QXP A;  2JRF A;  2PAL A;  5JOL A;  2M7L A;  3S0G A;  1F54 A;  1YUS A;  3BFB A;  1J1E A;  3CAB A;  3PM8 A;  1LXF C;  4QJ3 B;  3ICB A;  4OVN F;  4JWQ A;  1IIO A;  1Y0V H;  4IL1 A;  1IH0 A;  2L2E A;  5F6T A;  1JUO A;  1DQE A;  3KPX A;  1RJV A;  3NSI A;  3NSK A;  4JQ0 D;  4F7F A;  1PUL A;  1ALW A;  1S36 A;  1R2U A;  1GGW A;  3PLF B;  3NSL A;  1SYM A;  5HKZ A;  3KO0 A;  2FCE A;  2KFG A;  3D75 A;  2LM5 A;  1BR4 B;  1CM1 A;  3WXA A;  2HQW A;  3H4S E;  4PHJ A;  4YRU A;  2A4J A;  1KK8 B;  2K8M B;  2OS8 B;  3K1E A;  1B8R A;  1TRF A;  3DVJ A;  3IF7 A;  3SJS A;  3WNX B;  5PAL A;  2M29 A;  3UNW A;  3UO9 A;  4CLN A;  2WCE A;  1KQV A;  3BOW A;  1NCX A;  1OQP A;  3D73 A;  3E3R A;  5DIC A;  4E68 A;  3AKB A;  3B6X A;  3IQO A;  2JC2 A;  2LLU A;  4NDC A;  3BUO B;  5KU1 A;  1NWD A;  1KK7 Z;  3D78 A;  1CKK A;  3DZT A;  5TNC A;  3F45 A;  5HL1 A;  1AJ5 A;  1XFR A;  2MRD A;  4GGF A;  1ODB A;  1DGU A;  4PDZ A;  1S6I A;  1EG4 A;  2KI4 C;  3HCM A;  2WCJ A;  2GTE A;  1SW8 A;  2LAP A;  2I94 A;  3I5I C;  4HRG A;  3DVK A;  1KWO C;  3KHE A;  1FBV A;  1S6C A;  1MXL C;  2QEV A;  3GK2 A;  3PN7 C;  3D10 A;  4NDB A;  4U8D A;  3S0F A;  5EL2 A;  3SIA A;  1EXR A;  5AER A;  1SKT A;  1XFU O;  1NP8 A;  1M31 A;  1Q80 A;  1TUJ A;  1MR8 A;  2G2B A;  1AP4 A;  3BUM B;  3S0E A;  1CFC A;  1WDC B;  2EC6 B;  3CR2 A;  1N65 A;  2EGD A;  1WRL A;  1IG5 A;  1W7I B;  2L5Y A;  4TNC A;  3CR4 X;  1XFZ O;  2Q91 A;  1OZO A;  4QJ4 B;  4PHK A;  2KHN A;  1CDN A;  1JWD A;  1BU3 A;  3OB2 B;  1KSO A;  1DJH A;  1YR5 A;  2FCD A;  3B87 A;  3D74 A;  3L4A A;  4PHN A;  3WHT B;  2V53 A;  1GGZ A;  2I2R E;  3D0Y A;  1WDC C;  1SSE B;  3PAT A;  3I5H B;  1BR1 B;  1ORG A;  2JNX A;  4ORA B;  1K9U A;  1SL7 A;  1KQM C;  3OBV A;  3D77 A;  4MVF A;  1G8I A;  3S0B A;  3GK1 A;  4OR9 B; 
#chains in the Genus database with same CATH homology
 2P71 A;  3RZS A;  1OOH A;  2JPO A;  2PQL A;  3D76 A;  3CZ0 A;  3B86 A;  2QEB A;  1OOF A;  3R1V A;  3L4L A;  3OGN A;  1QWV A;  2WCK A;  3Q8I A;  3B7A A;  1C3Y A;  3DY9 A;  3S0A A;  2H8V A;  1C3Z A;  3BFA A;  3R1O A;  3R1P A;  3CYZ A;  3L47 A;  3FE6 A;  1LS8 A;  2QEH A;  4INX A;  2WC6 A;  3NGV A;  4INW A;  3S0G A;  3BFB A;  3CAB A;  3QME A;  2ERB A;  1DQE A;  2WCM A;  4F7F A;  3NHI A;  3V2L A;  2L2C A;  3D75 A;  1T14 A;  2QEO A;  3CZ2 A;  1OOG A;  4PT1 A;  3K1E A;  3S0D A;  3D73 A;  5DIC A;  3B6X A;  3BJH A;  3D78 A;  3CZ1 A;  3DZT A;  2WCL A;  1XFR A;  2QDI A;  2WCJ A;  2GTE A;  1GM0 A;  3FE8 A;  1TWO A;  2QEV A;  3S0F A;  5EL2 A;  3DYE A;  1OW4 A;  3B88 A;  3CDN A;  1TUJ A;  3R72 A;  4JD9 A;  1OOI X;  3S0E A;  2KPH A;  3NHT A;  4OZD A;  2P70 A;  2FJY A;  3DXL A;  3BFH A;  2WC5 A;  3B87 A;  3L4A A;  3D74 A;  2WCH A;  1P28 A;  1ORG A;  3VB1 A;  3PJI A;  3D77 A;  3N7H A;  3FE9 A;  3S0B A;  4FQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...