1XFRA

Solution structure of the bombyx mori pheromone-binding protein fragment bmpbp(1-128) at ph 6.5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
b'SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pheromone-binding protein
publication title Dynamic conformational equilibria in the physiological function of the Bombyx mori pheromone-binding protein.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 43
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1xfrA00
1GM0A 2WCJA 3S0BA 3L4AA 1OW4A 1TWOA 1TUJA 3L47A 3V2LA 2H8VA 3S0EA 3D77A 1OOIX 3B7AA 3FE9A 1DQEA 1P28A 2ERBA 3DZTA 1C3YA 3R1PA 3L4LA 4INXA 4OZDA 1C3ZA 3B88A 2QEBA 3D75A 2FJYA 1QWVA 3OGNA 3BFBA 2QDIA 5DICA 3CZ2A 3RZSA 3S0AA 3NGVA 3DY9A 1OOFA 3NHTA 2QEOA 2KPHA 3CABA 3B87A 3D73A 3CYZA 2P70A 3K1EA 2WCKA 2WCLA 1LS8A 3R1OA 2WCMA 3VB1A 2PQLA 5EL2A 3N7HA 3FE6A 2P71A 1XFRA 2WC6A 2QEHA 3B86A 3D74A 3QMEA 3B6XA 1ORGA 3FE8A 3CZ0A 3R1VA 4FQTA 4PT1A 3D76A 3S0GA 3D78A 3BJHA 2WC5A 2GTEA 3DXLA 2JPOA 4JD9A 3S0FA 3R72A 4INWA 2WCHA 3DYEA 1OOHA 3BFAA 3PJIA 3CZ1A 3CDNA 3Q8IA 3NHIA 4F7FA 2QEVA 1OOGA 3BFHA 2L2CA 1T14A 3S0DA
chains in the Genus database with same CATH superfamily
1TNPA 3OB2B 4E68A 1WLZA 4NDDA 1GM0A 1IQ3A 2KBMA 1LINA 1DT7B 1SYMA 5FI7A 1X02A 1SNLA 1HQVA 1K93D 1JUOA 4N1GA 4FQOA 3L47A 3RM1A 3GK4X 2L51A 2LUXA 2JT0A 1NUBA 3M0WA 5B8IB 2ERBA 1C3YA 1C7VA 2WORA 1RECA 4MSPA 4QJ3B 1QXPA 4WQ2A 1NX2A 2K60A 3C1VA 1DMOA 2RGIA 1DF0B 4GGFC 1J7RA 4PHJA 4ETOA 1DJYA 1WDCC 3BYAA 1CFPA 3TUYB 1B4CA 3L4LA 1TCOB 4INXA 1JF2A 1IGVA 3B88A 4P2YB 2FCEA 2KFGA 4M2OA 4DS7A 3PALA 2QEBA 1S6JA 4P5OE 3BXKA 1EG4A 1OZSA 2LE9B 1JF0A 2LVKA 3GK2A 3EVVA 2I7AA 3GK1A 3LK0A 3SIAA 3NSLA 2Y1MA 2F3YA 4R1EA 1S6IA 4MZJA 1XFXO 4BY4A 2LP2A 4GFTA 4DIRA 1OSAA 3S0AA 2E6WA 3OB1B 3DY9A 1LVCD 3VROA 1ZOTB 1TCFA 1V1FA 2KPHA 2Y5IA 3B87A 2SASA 2BL0C 1DJZA 2IS9A 3CGAA 2WCFA 1DC1A 3NSIA 1AP4A 1UHHA 1E8AA 1KFXL 2EC6C 2WCMA 1YURA 3DVKA 3LLEA 3NSKA 1U5IA 2PQLA 2KFHA 3EKJA 5EL2A 3GOFA 3N7HA 2ZRSA 1RTP1 1JWDA 4OV2A 4OR9B 1YRUB 1XFRA 2LP3A 1N2DA 2GGMA 2K7CA 5KU1A 1ODBA 1BG1A 1XK4A 1ORGA 1TIZA 2LHIA 3FE8A 1XFUO 2M49B 1CLLA 1ZFSA 1K9UA 4IJ7A 2ZFDA 3A8RA 1SK6D 1S26D 3BUWB 4FQTA 4PT1A 1Y1AA 2JRFA 4PALA 2KLEA 1SW8A 1AUIB 2LVVA 3OP0A 3BJHA 3CWGA 2QPTA 2JXCA 1NP8A 3EK8A 2GTEA 4MRXA 4JWQA 1CTRA 4OCIA 1SCMB 3KO0A 3TUYC 2TN4A 2HQWA 2OTGB 2JWWA 4USLA 5I2LA 4JD9A 3H4SE 3KHEA 1KQMB 2NLNA 2PYQA 2K8MB 1K90D 2F33A 2K7DA 1CLBA 2JZIA 2AMIA 2LAPA 5AANA 1FF1A 1NCXA 1NX0A 1QS7A 4WQ3A 1L2OB 2ZRTA 3CZ1A 2L5XB 3DVMA 3NXAA 1B8LA 3SG3A 3BUMB 1CM4A 3CTNA 1LKJA 1NYAA 3BUXB 2QEVA 4C0KA 4QJ5B 2ZNDA 1NCYA 1UHNA 2LNKA 2M7LA 5CSIA 4AQJA 1L7ZA 1TTXA 1PSRA 1KSMA 1XFWO 1M46A 3IF7A 2KI6D 1DVIA 4MN0A 2JTZA 2OS8B 1F71A 3QRXA 2WCEA 1R6PA 1XVJA 2HQ8A 4DUQA 3V2LA 3HCMA 3VRNA 2H8VA 3VRRA 2FJUB 2JNXA 1A03A 4MZLA 3D77A 3K21A 2L4HA 3FE9A 4GGNA 1JC2A 1BODA 1B7TY 3PFVA 3R1PA 1M45A 5AEQA 2JU0A 2L2EA 2O60A 4MEWA 2CNPA 1UHKA 2L98A 1W9ZA 1HT9A 3FIAA 1A2XA 1XYDA 2LLSA 2K2FA 4JQ0D 1XFVO 4MLWA 5I2QA 4M2QA 1SCMC 2JTTA 2KDHA 4A4CA 2OTGC 3D75A 1R2UA 2D8NA 2KYFA 2MLEC 2KQ6A 5AFPA 1BU3A 1UUSA 3I5IB 1WRLA 1KSOA 3BUNB 1KK7Y 1KQMC 1JSAA 1AVSA 4YI8A 4AOMA 3OHMB 4YGBB 1PALA 3RZSA 1K94A 2MAZA 4PHMA 3EVRA 1UWOA 3ZNIA 1L2OC 1TUZA 4NDCA 1KFUS 2JT8A 2K0JA 3CABA 1F55A 1JBAA 1KCYA 3RLZA 1ZACA 1XA5A 1S5GZ 2L50A 1DGVA 2BE6A 3TS5B 1LA0A 1AJ5A 2JOJA 4HRGA 1WLMA 5HKWA 1G33A 4CFRA 1QX2A 1W7JB 1SL7A 2KAXA 4N5XA 1A29A 3FE6A 1NX1A 1PVBA 2P71A 4C0JA 5HL1A 1MHOA 2OS8C 3DF0B 3JTDB 1SR6B 2MHHA 1KQVA 1SPYA 1U5IB 1AHRA 4BY5A 3TDUA 2H61A 1OMVA 1CDLA 2LC5A 1J1EA 1LA3A 1QVIY 1M63B 2BBMA 3D76A 3IQOA 1QX5B 1YX7A 2BCBA 2ZKMX 4JPZB 4TNCA 1IG5A 2MRDA 3KF9A 4HSZA 4MZKA 2HPSA 2JT3A 4YRUA 1WY9A 5TNCA 3O78A 1GJYA 1QV0A 1MXEA 3DF0A 2Y1NA 5F6TA 1F4QA 3DXLA 2JNFA 4FTGA 1SY9A 3O4XA 2ZN9A 5D69A 1TOPA 5IBWA 1S6CA 1AJ4A 3KPXA 2LV7A 3R72A 3I5FB 1CDNA 2LANA 1OOHA 3I5IC 3WHUB 1SKTA 2Q4UA 1EXRA 3TZ1A 3DVJA 1BMOA 2BCAA 1UP5A 3AKBA 2GGZA 4YGAA 5JJGA 1B7TZ 1IH0A 4F7FA 2FCDA 2G2BA 1C7WA 2KLDA 1OOGA 5FYXA 1OE9B 1T14A 2NCOA 1IQ5A 4XJKA 1CFCA 2LCPA 2M9GA 3IVTA 1SL8A 3TS5C 3VRQA 1GGWA 4AQIA 1M39A 5AERA 2WCJA 5J3XA 4PE1A 2M1UA 1DJXA 1QJTA 4XYNA 3WNXB 2PMYA 1N65A 3FS7A 1QASA 2KAYA 1CFDA 3EKHA 2AUCA 1CLMA 2FOTA 2F8PA 1WRKA 2L0PA 3S0EA 2A4JA 2KFFA 3JTDC 1SR6C 1OOIX 1YTZC 2M7NA 2LUCA 1P28A 2BE4A 1TNWA 3DZTA 1OOJA 2JC2A 1KK7Z 1K96A 2OPOA 2BCXA 2MBXA 1QV1A 1H8BA 2NZ0A 2CBLA 3D0YA 1TRFA 4QJ4B 1Y0VH 1SBJA 4JKTA 3CS1A 5FI6A 3VRPA 1XK4C 3SS5A 2ZNEA 4HREE 1JFKA 2WNDA 1GGZA 4DRWA 1PVAA 1KFXS 1QLSA 4MVFA 4L9MA 1C3ZA 1CM1A 1F70A 1RWYA 3BUOB 3ZWHA 1YUTA 1D1OA 1CB1A 2LVJA 2K7OA 2P6BB 1XO5A 3O2PA 4GBAA 1SSEB 2MJWB 1S1EA 1QIVA 2LLTA 1QWVA 1Y6WA 3BFBA 1ZMZA 4DCKA 2KOTA 3SG4A 2QDIA 3AAJA 1DJHA 3I5FC 5CSFA 5DICA 1PK0D 5DKNA 5HKYA 3CR2A 4IL1A 2NXQA 1CMFA 1IRJA 5G08A 1FBVA 1YX8A 2WOSA 2JULA 3O6BA 1SCVA 1OOFA 1FPWA 4CFQA 1YUSA 1Y1XA 3JVTB 2QEOA 3D73A 3CYZA 2M29A 2P70A 1TNXA 2I94A 2WCKA 1DGUA 2WCLA 1G4YR 3PSRA 2LMVA 2COLB 2KI6C 3VB1A 1MQ1A 4YBHB 1G8IA 4OVNF 4GNKB 1IKUA 2KYCA 3PM2A 2KBIA 4CIDA 5I2OA 5HKZA 1ALVA 1OQPA 2K61A 4YGCB 3B86A 1NIWA 1S3PA 1Z2CB 2M3WA 3D74A 4GGFA 5HLOA 5HLVA 3SG5A 3HX4A 1KWOB 1CKKA 3SS4A 1VRKA 1K9PA 2PVBA 1K2HA 1DEKA 2AAOA 2SCPA 3R1VA 4YI9A 3CZTX 1MUXA 3PN7B 3D78A 2LVIA 3WXAA 2JQ6A 2PALA 1Q80A 1TN4A 4PE0A 1PULA 4HRHA 1WRZA 5KSZA 1LXFC 1RROA 1V1GA 3LK1A 1MR8A 1MF8B 2BECA 1N0YA 3CR5X 1YVLA 4ORBB 2Y4QA 2F3ZA 3DVEA 4INWA 4MRYA 5DKRA 5DKQA 2WCHA 3OX5A 3DYEA 1RK9A 2BBNA 1YUUA 1K9KA 1NPQA 3BFAA 3PJIA 2BKHB 1J7PA 1DELA 2KI4B 1RFJA 2CTNA 2ZN8A 3EK4A 3I5GB 1UURA 1A75A 1ALWA 2F2OA 5D3OA 1NX3A 3NHIA 3KEVA 4GPLB 2EHBA 3JVTC 1SRAA 2E30A 1EG3A 3E3RA 1F54A 1TNQA 1DJWA 2ISDA 4ZCVA 3SG2A 2KGRA 4C0LA 3I5HB 2HETA 3D10A 4A4BA 3S0BA 1UHIA 3UO9A 3SIBA 2KQYA 3L4AA 1B1GA 4Q04A 1OMDA 1OW4A 1TWOA 1DTLA 1TUJA 3BQ3A 3EK7A 3NSOA 2PASA 1SMGA 4XJKB 5CSNA 1PSBA 4F0ZB 4GUKA 2LLUA 1DF0A 3DD4A 1IJ6A 4I5JA 1W7IB 3B7AA 1BJFA 1QATA 1QIWA 1DQEA 1NSHA 2I2RE 1KWOC 3MSEB 1J1DA 2YGUA 3AAKA 4ICBA 1OMRA 3OX6A 2CXJA 2K7BA 2M8UA 2PRUA 3SG6A 5AXIA 1F4OA 2M97A 4ORAB 2LMTA 2LM5A 3FWBA 4PHNA 2G9BA 3PN7C 3SS3A 2H61C 1Y1UA 4OZDA 4UPGA 4PCWA 3AKAA 3D0YB 3PLFB 1M31A 3F45A 4OKHA 3SG7A 2PSRA 2HF5A 4D1EA 1BLQA 4YGEB 4U8DA 1XFZO 2MLFC 1K8UA 5KTYA 2NCPA 5I94A 1J55A 1CNPA 2JPTA 2FJYA 3IQQA 3OGNA 2LHLA 1DJGA 2VRGA 2Q91A 1F8HA 3PATA 4NDBA 1CFFA 3CZ2A 5ER5A 1BT6A 1K95A 1MWNA 1CDMA 4N1FA 4WRIA 3NGVA 4PE4A 1CDPA 1QX7A 1YRTB 1Z4HA 2KI4C 4PHKA 5CPVA 3EG5B 3FWCA 1S5GY 2JXLA 4CPVA 2BNXA 2F2PA 2KGBC 3I5GC 1KK8B 1OZOA 3NHTA 5FI2A 4I5NB 4KYNA 1B47A 1YVHA 1QTXA 2M0RA 3K1EA 5PALA 1LS8A 1XFYO 3R1OA 1SL9A 2QACA 2LMUA 1BF5A 2M1KB 5JOLA 2KAVA 2CT9A 2O5GA 1IIOA 3BOWB 1RJVA 2EGDA 3CR4X 1B8CA 3I5HC 4I5KA 4PDZA 5CSJA 4CLNA 1ZUZA 1BR4B 1PRWA 2WC6A 2QEHA 2R2IA 3QMEA 1UHJA 4ORCB 3B6XA 3TDZA 3PM8A 2GV5A 2CCMA 1IJ5A 3CZ0A 1A4PA 2DOQA 3A4UB 2L4IA 2K2AA 4NQGA 1FI5A 3O4YA 2KHNA 2H2KA 1NCZA 2L5YA 2BKIB 2MA2A 5D7FA 1CMGA 1KFUL 2B1UA 3S0GA 5HYDA 1NWDA 1WDCB 1BR1B 1BOCA 3BOWA 1B9AA 1FI6A 1GQMA 1QVIZ 2WC5A 2KNEA 1EJ3A 3VGOA 1IWQA 5ER4X 4PE7A 2JPOA 1H4BA 3S0FA 5I8NA 5BPJA 1J7OA 2WCBA 3UNWA 1YR5A 2I18A 3WHTB 4ZCUA 5K89A 4M2PA 1S36A 1QLKA 1C07A 1FW4A 3LCPC 3ICBA 1EL4A 2KSPA 5GQQC 1J7QA 3CLNA 4GAOA 3LL8B 1EH2A 2BAPA 4MBEA 4YGDB 3OBVA 3CDNA 3Q8IA 2BL0B 4I5LB 1DJIA 2V53A 1B8RA 3S0DA 3EVUA 1KK8C 2WC8A 1AK8A 2EC6B 3SJSA 3BFHA 2L2CA 1MXLC 3TDIA 1A75B 1JFJA
chains in the Genus database with same CATH topology
1GM0A 2WCJA 3S0BA 3L4AA 1OW4A 1TWOA 1TUJA 3L47A 3V2LA 2H8VA 3S0EA 3D77A 1OOIX 3B7AA 3FE9A 1DQEA 1P28A 2ERBA 3DZTA 1C3YA 3R1PA 3L4LA 4INXA 4OZDA 1C3ZA 3B88A 2QEBA 3D75A 2FJYA 1QWVA 3OGNA 3BFBA 2QDIA 5DICA 3CZ2A 3RZSA 3S0AA 3NGVA 3DY9A 1OOFA 3NHTA 2QEOA 2KPHA 3CABA 3B87A 3D73A 3CYZA 2P70A 3K1EA 2WCKA 2WCLA 1LS8A 3R1OA 2WCMA 3VB1A 2PQLA 5EL2A 3N7HA 3FE6A 2P71A 1XFRA 2WC6A 2QEHA 3B86A 3D74A 3QMEA 3B6XA 1ORGA 3FE8A 3CZ0A 3R1VA 4FQTA 4PT1A 3D76A 3S0GA 3D78A 3BJHA 2WC5A 2GTEA 3DXLA 2JPOA 4JD9A 3S0FA 3R72A 4INWA 2WCHA 3DYEA 1OOHA 3BFAA 3PJIA 3CZ1A 3CDNA 3Q8IA 3NHIA 4F7FA 2QEVA 1OOGA 3BFHA 2L2CA 1T14A 3S0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GM0 A;  2WCJ A;  3S0B A;  3L4A A;  1OW4 A;  1TWO A;  1TUJ A;  3L47 A;  3V2L A;  2H8V A;  3S0E A;  3D77 A;  1OOI X;  3B7A A;  3FE9 A;  1DQE A;  1P28 A;  2ERB A;  3DZT A;  1C3Y A;  3R1P A;  3L4L A;  4INX A;  4OZD A;  1C3Z A;  3B88 A;  2QEB A;  3D75 A;  2FJY A;  1QWV A;  3OGN A;  3BFB A;  2QDI A;  5DIC A;  3CZ2 A;  3RZS A;  3S0A A;  3NGV A;  3DY9 A;  1OOF A;  3NHT A;  2QEO A;  2KPH A;  3CAB A;  3B87 A;  3D73 A;  3CYZ A;  2P70 A;  3K1E A;  2WCK A;  2WCL A;  1LS8 A;  3R1O A;  2WCM A;  3VB1 A;  2PQL A;  5EL2 A;  3N7H A;  3FE6 A;  2P71 A;  1XFR A;  2WC6 A;  2QEH A;  3B86 A;  3D74 A;  3QME A;  3B6X A;  1ORG A;  3FE8 A;  3CZ0 A;  3R1V A;  4FQT A;  4PT1 A;  3D76 A;  3S0G A;  3D78 A;  3BJH A;  2WC5 A;  2GTE A;  3DXL A;  2JPO A;  4JD9 A;  3S0F A;  3R72 A;  4INW A;  2WCH A;  3DYE A;  1OOH A;  3BFA A;  3PJI A;  3CZ1 A;  3CDN A;  3Q8I A;  3NHI A;  4F7F A;  2QEV A;  1OOG A;  3BFH A;  2L2C A;  1T14 A;  3S0D A; 
#chains in the Genus database with same CATH topology
 1TNP A;  3OB2 B;  4E68 A;  1WLZ A;  4NDD A;  1GM0 A;  1IQ3 A;  2KBM A;  1LIN A;  1DT7 B;  1SYM A;  5FI7 A;  1X02 A;  1SNL A;  1HQV A;  1K93 D;  1JUO A;  4N1G A;  4FQO A;  3L47 A;  3RM1 A;  3GK4 X;  2L51 A;  2LUX A;  2JT0 A;  1NUB A;  3M0W A;  5B8I B;  2ERB A;  1C3Y A;  1C7V A;  2WOR A;  1REC A;  4MSP A;  4QJ3 B;  1QXP A;  4WQ2 A;  1NX2 A;  2K60 A;  3C1V A;  1DMO A;  2RGI A;  1DF0 B;  4GGF C;  1J7R A;  4PHJ A;  4ETO A;  1DJY A;  1WDC C;  3BYA A;  1CFP A;  3TUY B;  1B4C A;  3L4L A;  1TCO B;  4INX A;  1JF2 A;  1IGV A;  3B88 A;  4P2Y B;  2FCE A;  2KFG A;  4M2O A;  4DS7 A;  3PAL A;  2QEB A;  1S6J A;  4P5O E;  3BXK A;  1EG4 A;  1OZS A;  2LE9 B;  1JF0 A;  2LVK A;  3GK2 A;  3EVV A;  2I7A A;  3GK1 A;  3LK0 A;  3SIA A;  3NSL A;  2Y1M A;  2F3Y A;  4R1E A;  1S6I A;  4MZJ A;  1XFX O;  4BY4 A;  2LP2 A;  4GFT A;  4DIR A;  1OSA A;  3S0A A;  2E6W A;  3OB1 B;  3DY9 A;  1LVC D;  3VRO A;  1ZOT B;  1TCF A;  1V1F A;  2KPH A;  2Y5I A;  3B87 A;  2SAS A;  2BL0 C;  1DJZ A;  2IS9 A;  3CGA A;  2WCF A;  1DC1 A;  3NSI A;  1AP4 A;  1UHH A;  1E8A A;  1KFX L;  2EC6 C;  2WCM A;  1YUR A;  3DVK A;  3LLE A;  3NSK A;  1U5I A;  2PQL A;  2KFH A;  3EKJ A;  5EL2 A;  3GOF A;  3N7H A;  2ZRS A;  1RTP 1;  1JWD A;  4OV2 A;  4OR9 B;  1YRU B;  1XFR A;  2LP3 A;  1N2D A;  2GGM A;  2K7C A;  5KU1 A;  1ODB A;  1BG1 A;  1XK4 A;  1ORG A;  1TIZ A;  2LHI A;  3FE8 A;  1XFU O;  2M49 B;  1CLL A;  1ZFS A;  1K9U A;  4IJ7 A;  2ZFD A;  3A8R A;  1SK6 D;  1S26 D;  3BUW B;  4FQT A;  4PT1 A;  1Y1A A;  2JRF A;  4PAL A;  2KLE A;  1SW8 A;  1AUI B;  2LVV A;  3OP0 A;  3BJH A;  3CWG A;  2QPT A;  2JXC A;  1NP8 A;  3EK8 A;  2GTE A;  4MRX A;  4JWQ A;  1CTR A;  4OCI A;  1SCM B;  3KO0 A;  3TUY C;  2TN4 A;  2HQW A;  2OTG B;  2JWW A;  4USL A;  5I2L A;  4JD9 A;  3H4S E;  3KHE A;  1KQM B;  2NLN A;  2PYQ A;  2K8M B;  1K90 D;  2F33 A;  2K7D A;  1CLB A;  2JZI A;  2AMI A;  2LAP A;  5AAN A;  1FF1 A;  1NCX A;  1NX0 A;  1QS7 A;  4WQ3 A;  1L2O B;  2ZRT A;  3CZ1 A;  2L5X B;  3DVM A;  3NXA A;  1B8L A;  3SG3 A;  3BUM B;  1CM4 A;  3CTN A;  1LKJ A;  1NYA A;  3BUX B;  2QEV A;  4C0K A;  4QJ5 B;  2ZND A;  1NCY A;  1UHN A;  2LNK A;  2M7L A;  5CSI A;  4AQJ A;  1L7Z A;  1TTX A;  1PSR A;  1KSM A;  1XFW O;  1M46 A;  3IF7 A;  2KI6 D;  1DVI A;  4MN0 A;  2JTZ A;  2OS8 B;  1F71 A;  3QRX A;  2WCE A;  1R6P A;  1XVJ A;  2HQ8 A;  4DUQ A;  3V2L A;  3HCM A;  3VRN A;  2H8V A;  3VRR A;  2FJU B;  2JNX A;  1A03 A;  4MZL A;  3D77 A;  3K21 A;  2L4H A;  3FE9 A;  4GGN A;  1JC2 A;  1BOD A;  1B7T Y;  3PFV A;  3R1P A;  1M45 A;  5AEQ A;  2JU0 A;  2L2E A;  2O60 A;  4MEW A;  2CNP A;  1UHK A;  2L98 A;  1W9Z A;  1HT9 A;  3FIA A;  1A2X A;  1XYD A;  2LLS A;  2K2F A;  4JQ0 D;  1XFV O;  4MLW A;  5I2Q A;  4M2Q A;  1SCM C;  2JTT A;  2KDH A;  4A4C A;  2OTG C;  3D75 A;  1R2U A;  2D8N A;  2KYF A;  2MLE C;  2KQ6 A;  5AFP A;  1BU3 A;  1UUS A;  3I5I B;  1WRL A;  1KSO A;  3BUN B;  1KK7 Y;  1KQM C;  1JSA A;  1AVS A;  4YI8 A;  4AOM A;  3OHM B;  4YGB B;  1PAL A;  3RZS A;  1K94 A;  2MAZ A;  4PHM A;  3EVR A;  1UWO A;  3ZNI A;  1L2O C;  1TUZ A;  4NDC A;  1KFU S;  2JT8 A;  2K0J A;  3CAB A;  1F55 A;  1JBA A;  1KCY A;  3RLZ A;  1ZAC A;  1XA5 A;  1S5G Z;  2L50 A;  1DGV A;  2BE6 A;  3TS5 B;  1LA0 A;  1AJ5 A;  2JOJ A;  4HRG A;  1WLM A;  5HKW A;  1G33 A;  4CFR A;  1QX2 A;  1W7J B;  1SL7 A;  2KAX A;  4N5X A;  1A29 A;  3FE6 A;  1NX1 A;  1PVB A;  2P71 A;  4C0J A;  5HL1 A;  1MHO A;  2OS8 C;  3DF0 B;  3JTD B;  1SR6 B;  2MHH A;  1KQV A;  1SPY A;  1U5I B;  1AHR A;  4BY5 A;  3TDU A;  2H61 A;  1OMV A;  1CDL A;  2LC5 A;  1J1E A;  1LA3 A;  1QVI Y;  1M63 B;  2BBM A;  3D76 A;  3IQO A;  1QX5 B;  1YX7 A;  2BCB A;  2ZKM X;  4JPZ B;  4TNC A;  1IG5 A;  2MRD A;  3KF9 A;  4HSZ A;  4MZK A;  2HPS A;  2JT3 A;  4YRU A;  1WY9 A;  5TNC A;  3O78 A;  1GJY A;  1QV0 A;  1MXE A;  3DF0 A;  2Y1N A;  5F6T A;  1F4Q A;  3DXL A;  2JNF A;  4FTG A;  1SY9 A;  3O4X A;  2ZN9 A;  5D69 A;  1TOP A;  5IBW A;  1S6C A;  1AJ4 A;  3KPX A;  2LV7 A;  3R72 A;  3I5F B;  1CDN A;  2LAN A;  1OOH A;  3I5I C;  3WHU B;  1SKT A;  2Q4U A;  1EXR A;  3TZ1 A;  3DVJ A;  1BMO A;  2BCA A;  1UP5 A;  3AKB A;  2GGZ A;  4YGA A;  5JJG A;  1B7T Z;  1IH0 A;  4F7F A;  2FCD A;  2G2B A;  1C7W A;  2KLD A;  1OOG A;  5FYX A;  1OE9 B;  1T14 A;  2NCO A;  1IQ5 A;  4XJK A;  1CFC A;  2LCP A;  2M9G A;  3IVT A;  1SL8 A;  3TS5 C;  3VRQ A;  1GGW A;  4AQI A;  1M39 A;  5AER A;  2WCJ A;  5J3X A;  4PE1 A;  2M1U A;  1DJX A;  1QJT A;  4XYN A;  3WNX B;  2PMY A;  1N65 A;  3FS7 A;  1QAS A;  2KAY A;  1CFD A;  3EKH A;  2AUC A;  1CLM A;  2FOT A;  2F8P A;  1WRK A;  2L0P A;  3S0E A;  2A4J A;  2KFF A;  3JTD C;  1SR6 C;  1OOI X;  1YTZ C;  2M7N A;  2LUC A;  1P28 A;  2BE4 A;  1TNW A;  3DZT A;  1OOJ A;  2JC2 A;  1KK7 Z;  1K96 A;  2OPO A;  2BCX A;  2MBX A;  1QV1 A;  1H8B A;  2NZ0 A;  2CBL A;  3D0Y A;  1TRF A;  4QJ4 B;  1Y0V H;  1SBJ A;  4JKT A;  3CS1 A;  5FI6 A;  3VRP A;  1XK4 C;  3SS5 A;  2ZNE A;  4HRE E;  1JFK A;  2WND A;  1GGZ A;  4DRW A;  1PVA A;  1KFX S;  1QLS A;  4MVF A;  4L9M A;  1C3Z A;  1CM1 A;  1F70 A;  1RWY A;  3BUO B;  3ZWH A;  1YUT A;  1D1O A;  1CB1 A;  2LVJ A;  2K7O A;  2P6B B;  1XO5 A;  3O2P A;  4GBA A;  1SSE B;  2MJW B;  1S1E A;  1QIV A;  2LLT A;  1QWV A;  1Y6W A;  3BFB A;  1ZMZ A;  4DCK A;  2KOT A;  3SG4 A;  2QDI A;  3AAJ A;  1DJH A;  3I5F C;  5CSF A;  5DIC A;  1PK0 D;  5DKN A;  5HKY A;  3CR2 A;  4IL1 A;  2NXQ A;  1CMF A;  1IRJ A;  5G08 A;  1FBV A;  1YX8 A;  2WOS A;  2JUL A;  3O6B A;  1SCV A;  1OOF A;  1FPW A;  4CFQ A;  1YUS A;  1Y1X A;  3JVT B;  2QEO A;  3D73 A;  3CYZ A;  2M29 A;  2P70 A;  1TNX A;  2I94 A;  2WCK A;  1DGU A;  2WCL A;  1G4Y R;  3PSR A;  2LMV A;  2COL B;  2KI6 C;  3VB1 A;  1MQ1 A;  4YBH B;  1G8I A;  4OVN F;  4GNK B;  1IKU A;  2KYC A;  3PM2 A;  2KBI A;  4CID A;  5I2O A;  5HKZ A;  1ALV A;  1OQP A;  2K61 A;  4YGC B;  3B86 A;  1NIW A;  1S3P A;  1Z2C B;  2M3W A;  3D74 A;  4GGF A;  5HLO A;  5HLV A;  3SG5 A;  3HX4 A;  1KWO B;  1CKK A;  3SS4 A;  1VRK A;  1K9P A;  2PVB A;  1K2H A;  1DEK A;  2AAO A;  2SCP A;  3R1V A;  4YI9 A;  3CZT X;  1MUX A;  3PN7 B;  3D78 A;  2LVI A;  3WXA A;  2JQ6 A;  2PAL A;  1Q80 A;  1TN4 A;  4PE0 A;  1PUL A;  4HRH A;  1WRZ A;  5KSZ A;  1LXF C;  1RRO A;  1V1G A;  3LK1 A;  1MR8 A;  1MF8 B;  2BEC A;  1N0Y A;  3CR5 X;  1YVL A;  4ORB B;  2Y4Q A;  2F3Z A;  3DVE A;  4INW A;  4MRY A;  5DKR A;  5DKQ A;  2WCH A;  3OX5 A;  3DYE A;  1RK9 A;  2BBN A;  1YUU A;  1K9K A;  1NPQ A;  3BFA A;  3PJI A;  2BKH B;  1J7P A;  1DEL A;  2KI4 B;  1RFJ A;  2CTN A;  2ZN8 A;  3EK4 A;  3I5G B;  1UUR A;  1A75 A;  1ALW A;  2F2O A;  5D3O A;  1NX3 A;  3NHI A;  3KEV A;  4GPL B;  2EHB A;  3JVT C;  1SRA A;  2E30 A;  1EG3 A;  3E3R A;  1F54 A;  1TNQ A;  1DJW A;  2ISD A;  4ZCV A;  3SG2 A;  2KGR A;  4C0L A;  3I5H B;  2HET A;  3D10 A;  4A4B A;  3S0B A;  1UHI A;  3UO9 A;  3SIB A;  2KQY A;  3L4A A;  1B1G A;  4Q04 A;  1OMD A;  1OW4 A;  1TWO A;  1DTL A;  1TUJ A;  3BQ3 A;  3EK7 A;  3NSO A;  2PAS A;  1SMG A;  4XJK B;  5CSN A;  1PSB A;  4F0Z B;  4GUK A;  2LLU A;  1DF0 A;  3DD4 A;  1IJ6 A;  4I5J A;  1W7I B;  3B7A A;  1BJF A;  1QAT A;  1QIW A;  1DQE A;  1NSH A;  2I2R E;  1KWO C;  3MSE B;  1J1D A;  2YGU A;  3AAK A;  4ICB A;  1OMR A;  3OX6 A;  2CXJ A;  2K7B A;  2M8U A;  2PRU A;  3SG6 A;  5AXI A;  1F4O A;  2M97 A;  4ORA B;  2LMT A;  2LM5 A;  3FWB A;  4PHN A;  2G9B A;  3PN7 C;  3SS3 A;  2H61 C;  1Y1U A;  4OZD A;  4UPG A;  4PCW A;  3AKA A;  3D0Y B;  3PLF B;  1M31 A;  3F45 A;  4OKH A;  3SG7 A;  2PSR A;  2HF5 A;  4D1E A;  1BLQ A;  4YGE B;  4U8D A;  1XFZ O;  2MLF C;  1K8U A;  5KTY A;  2NCP A;  5I94 A;  1J55 A;  1CNP A;  2JPT A;  2FJY A;  3IQQ A;  3OGN A;  2LHL A;  1DJG A;  2VRG A;  2Q91 A;  1F8H A;  3PAT A;  4NDB A;  1CFF A;  3CZ2 A;  5ER5 A;  1BT6 A;  1K95 A;  1MWN A;  1CDM A;  4N1F A;  4WRI A;  3NGV A;  4PE4 A;  1CDP A;  1QX7 A;  1YRT B;  1Z4H A;  2KI4 C;  4PHK A;  5CPV A;  3EG5 B;  3FWC A;  1S5G Y;  2JXL A;  4CPV A;  2BNX A;  2F2P A;  2KGB C;  3I5G C;  1KK8 B;  1OZO A;  3NHT A;  5FI2 A;  4I5N B;  4KYN A;  1B47 A;  1YVH A;  1QTX A;  2M0R A;  3K1E A;  5PAL A;  1LS8 A;  1XFY O;  3R1O A;  1SL9 A;  2QAC A;  2LMU A;  1BF5 A;  2M1K B;  5JOL A;  2KAV A;  2CT9 A;  2O5G A;  1IIO A;  3BOW B;  1RJV A;  2EGD A;  3CR4 X;  1B8C A;  3I5H C;  4I5K A;  4PDZ A;  5CSJ A;  4CLN A;  1ZUZ A;  1BR4 B;  1PRW A;  2WC6 A;  2QEH A;  2R2I A;  3QME A;  1UHJ A;  4ORC B;  3B6X A;  3TDZ A;  3PM8 A;  2GV5 A;  2CCM A;  1IJ5 A;  3CZ0 A;  1A4P A;  2DOQ A;  3A4U B;  2L4I A;  2K2A A;  4NQG A;  1FI5 A;  3O4Y A;  2KHN A;  2H2K A;  1NCZ A;  2L5Y A;  2BKI B;  2MA2 A;  5D7F A;  1CMG A;  1KFU L;  2B1U A;  3S0G A;  5HYD A;  1NWD A;  1WDC B;  1BR1 B;  1BOC A;  3BOW A;  1B9A A;  1FI6 A;  1GQM A;  1QVI Z;  2WC5 A;  2KNE A;  1EJ3 A;  3VGO A;  1IWQ A;  5ER4 X;  4PE7 A;  2JPO A;  1H4B A;  3S0F A;  5I8N A;  5BPJ A;  1J7O A;  2WCB A;  3UNW A;  1YR5 A;  2I18 A;  3WHT B;  4ZCU A;  5K89 A;  4M2P A;  1S36 A;  1QLK A;  1C07 A;  1FW4 A;  3LCP C;  3ICB A;  1EL4 A;  2KSP A;  5GQQ C;  1J7Q A;  3CLN A;  4GAO A;  3LL8 B;  1EH2 A;  2BAP A;  4MBE A;  4YGD B;  3OBV A;  3CDN A;  3Q8I A;  2BL0 B;  4I5L B;  1DJI A;  2V53 A;  1B8R A;  3S0D A;  3EVU A;  1KK8 C;  2WC8 A;  1AK8 A;  2EC6 B;  3SJS A;  3BFH A;  2L2C A;  1MXL C;  3TDI A;  1A75 B;  1JFJ A; 
#chains in the Genus database with same CATH homology
 1GM0 A;  2WCJ A;  3S0B A;  3L4A A;  1OW4 A;  1TWO A;  1TUJ A;  3L47 A;  3V2L A;  2H8V A;  3S0E A;  3D77 A;  1OOI X;  3B7A A;  3FE9 A;  1DQE A;  1P28 A;  2ERB A;  3DZT A;  1C3Y A;  3R1P A;  3L4L A;  4INX A;  4OZD A;  1C3Z A;  3B88 A;  2QEB A;  3D75 A;  2FJY A;  1QWV A;  3OGN A;  3BFB A;  2QDI A;  5DIC A;  3CZ2 A;  3RZS A;  3S0A A;  3NGV A;  3DY9 A;  1OOF A;  3NHT A;  2QEO A;  2KPH A;  3CAB A;  3B87 A;  3D73 A;  3CYZ A;  2P70 A;  3K1E A;  2WCK A;  2WCL A;  1LS8 A;  3R1O A;  2WCM A;  3VB1 A;  2PQL A;  5EL2 A;  3N7H A;  3FE6 A;  2P71 A;  1XFR A;  2WC6 A;  2QEH A;  3B86 A;  3D74 A;  3QME A;  3B6X A;  1ORG A;  3FE8 A;  3CZ0 A;  3R1V A;  4FQT A;  4PT1 A;  3D76 A;  3S0G A;  3D78 A;  3BJH A;  2WC5 A;  2GTE A;  3DXL A;  2JPO A;  4JD9 A;  3S0F A;  3R72 A;  4INW A;  2WCH A;  3DYE A;  1OOH A;  3BFA A;  3PJI A;  3CZ1 A;  3CDN A;  3Q8I A;  3NHI A;  4F7F A;  2QEV A;  1OOG A;  3BFH A;  2L2C A;  1T14 A;  3S0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...