1SW8A

Solution structure of the n-terminal domain of human n60d calmodulin refined with paramagnetism based strategy
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin
publication title Experimentally exploring the conformational space sampled by domain reorientation in calmodulin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Calcium-binding protein
total genus 21
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sw8A00
1C07A 2MLEC 4OV2A 1YX8A 2E30A 1ZFSA 1EG4A 1XFYO 2I7AA 2JZIA 2HF5A 1ALWA 4WQ3A 1AK8A 4MN0A 4C0LA 3M0WA 2M1KB 4GGNA 5D7FA 1B47A 4CPVA 1GQMA 1SCVA 1TTXA 1QLSA 2D8NA 1TIZA 2LMTA 2GGZA 4JPZB 3LK0A 2K7CA 1LVCD 3TS5B 4R1EA 3EK4A 2HPSA 5JJGA 5K89A 1E8AA 4GUKA 1M31A 1XFUO 2LLUA 1TCFA 3SJSA 2M1UA 1D1OA 1WRLA 1OMDA 1SL9A 2F3YA 1KK7Y 3E3RA 1TNXA 3I5IC 4FQOA 1M45A 2LC5A 1IGVA 4FTGA 3SIAA 3I5HB 1UHIA 1OOJA 1K90D 1S26D 2KFHA 2H61C 2L51A 2JC2A 3OP0A 3PM8A 1DJYA 5TNCA 3D0YB 4OVNF 1SCMC 2EHBA 2P6BB 2WC8A 2HQ8A 1YVHA 1L2OC 1TNQA 1CDNA 1PSBA 1WRZA 4JQ0D 1C7VA 2KFFA 1DGUA 1CFDA 4WQ2A 2G2BA 1LA3A 2MLFC 3OB1B 3FS7A 4IL1A 4GBAA 4ORBB 1NCYA 1WDCC 2PALA 4ORAB 1IJ5A 4DRWA 4CLNA 1KK7Z 2F2PA 4HRHA 1XYDA 2JNFA 1TOPA 1A29A 1MUXA 4PHJA 4C0JA 2L5XB 1QVIZ 3O2PA 4N5XA 2LUXA 2GV5A 1BOCA 1KK8B 1PALA 4OCIA 3EVRA 2BECA 2KI6D 3KEVA 4CIDA 1KQVA 1CM1A 1PRWA 2BCAA 1W7IB 1NSHA 2BE4A 2FCEA 1CNPA 3PFVA 1AVSA 1YUSA 2NCPA 1DTLA 5J3XA 2H2KA 3KPXA 4MVFA 3CWGA 1SR6C 4YBHB 1XFZO 2Q4UA 2ISDA 2NXQA 1J55A 4BY5A 4YI8A 1MXEA 2JXLA 1NCZA 2K7OA 2KI4B 5KTYA 1CFCA 2KQ6A 1XFWO 1CLMA 2HQWA 1BR1B 4YI9A 4XJKB 3BYAA 2FJUB 1QV1A 1WLMA 5I2OA 3NXAA 1S6JA 2JXCA 1SL7A 1FI6A 2A4JA 1J7QA 2BCXA 3A4UB 4MZJA 1LINA 2LUCA 2JTZA 3BUXB 3I5FB 1IWQA 1K9UA 1F4QA 4WRIA 4GNKB 1B9AA 1XO5A 5JOLA 1AP4A 4N1GA 1YR5A 4U8DA 2LAPA 3VRNA 2BCBA 2L98A 3EK8A 2WCBA 2PVBA 1DT7B 1SY9A 2BKHB 1QX7A 5AANA 1A75B 1RWYA 3A8RA 3AKBA 1M63B 5KU1A 1IG5A 1BJFA 5G08A 1V1FA 2BBNA 4I5LB 2EGDA 3EKJA 4I5JA 2MRDA 1BT6A 3OHMB 3H4SE 1J7OA 1EH2A 1XA5A 2LV7A 4P5OE 2K0JA 1FF1A 1PVAA 2JU0A 4DS7A 5HKYA 2KOTA 1B7TZ 2F3ZA 2BL0B 3CR4X 1JWDA 3ZNIA 1BG1A 2F33A 3EKHA 1CFFA 3GK4X 5I2QA 1N2DA 1OMRA 4DCKA 2KSPA 1B8RA 4USLA 1ALVA 2EC6C 3PSRA 2AMIA 2KFGA 4NDCA 1ZMZA 1F71A 1FBVA 1YX7A 2K7BA 2MAZA 1CDMA 2I94A 3DF0B 2KI4C 3D0YA 4N1FA 3JVTC 1J7RA 2LANA 5CPVA 1IRJA 2SCPA 2JWWA 1EG3A 2LP2A 3CZTX 1K2HA 2MJWB 4ORCB 5CSIA 4MSPA 1QIVA 1CMFA 2JT0A 3TUYC 5CSFA 1FW4A 1SW8A 3SIBA 3BUWB 3I5FC 1UUSA 3JTDB 1G8IA 2KHNA 1DJGA 4GPLB 3WXAA 2I18A 1UHKA 1YRTB 2PSRA 3ICBA 5IBWA 3HCMA 1SK6D 2OS8B 3NSLA 3AAJA 2F2OA 2ZFDA 2TN4A 2CCMA 2LVJA 2L50A 1KFUL 1SYMA 2M8UA 1CFPA 1B8LA 2JOJA 4XYNA 5BPJA 1JF2A 1BODA 1KWOB 3FWCA 4YGDB 1CLLA 1JFKA 3CS1A 1Y6WA 1K94A 1KSMA 3CR5X 4YGBB 1S6IA 1K95A 1J1DA 1DF0A 4PDZA 1R6PA 3PN7B 2LMVA 2MHHA 3EK7A 2JT8A 2JRFA 2KYCA 3IF7A 1OZSA 1XVJA 2RGIA 1F70A 1Q80A 2IS9A 3O4YA 2QACA 3I5GB 3GK1A 4MEWA 4PE1A 4PHNA 2MBXA 2NZ0A 2ZN9A 1MQ1A 1YUTA 1V1GA 5HLVA 1F55A 1W7JB 1ZUZA 3PATA 4UPGA 4OR9B 3WHTB 4XJKA 1A4PA 1M39A 1NCXA 2LMUA 3AKAA 3VRRA 1GGWA 1NX2A 1S1EA 1IQ3A 2K61A 4L9MA 1YRUB 1DMOA 1SNLA 4Q04A 4PHKA 3TS5C 5AEQA 1TNWA 4D1EA 4MZLA 2KBMA 1WRKA 1GJYA 3ZWHA 2PASA 1BLQA 1MWNA 2OS8C 4ZCUA 3SG7A 5ER4X 3DVKA 3I5HC 5DKRA 2KI6C 1VRKA 1SRAA 3KF9A 3D10A 1S36A 4QJ5B 2K2FA 1S3PA 3TDUA 2ZN8A 1BR4B 1MXLC 2OTGB 3TZ1A 4I5KA 2VRGA 2LVIA 1QJTA 2R2IA 1DVIA 2LM5A 1B8CA 1RFJA 3DD4A 4PCWA 1YTZC 1UHHA 4GFTA 2FCDA 2KGBC 1TN4A 1AJ4A 1N65A 1DJZA 3EVUA 1QXPA 4YGAA 1H8BA 2I2RE 3DF0A 2O5GA 3VRQA 1NPQA 1XK4C 4JWQA 1SMGA 4C0KA 1ZOTB 2CXJA 2LVKA 1NUBA 1KK8C 1QX5B 2Y1NA 3LLEA 1QV0A 2L4IA 3DVJA 4ZCVA 2JPTA 2K7DA 4AQIA 1NX3A 1DGVA 3I5IB 1KFXS 1G33A 2M3WA 1OE9B 1K9KA 2F8PA 4CFRA 1Y1XA 4MRYA 2V53A 3IQQA 1LA0A 3IQOA 1UWOA 2KGRA 3QRXA 1SCMB 4AQJA 2WCFA 3SG4A 1QLKA 1RECA 1PVBA 2NLNA 5AXIA 4A4BA 2OTGC 1L2OB 4BY4A 2LLSA 3O6BA 3PALA 1DJIA 4M2PA 5ER5A 3VROA 1JBAA 2K8MB 5D69A 1S6CA 2AAOA 2LVVA 1FI5A 3CR2A 1WDCB 3HX4A 1XFVO 1RROA 1G4YR 2KQYA 3K21A 5KSZA 1CMGA 1AJ5A 1RTP1 1K96A 2M9GA 3NSOA 4M2QA 5FYXA 2M7NA 1S5GY 1DJWA 1XK4A 2CBLA 2CTNA 1OZOA 4ETOA 3GK2A 2KNEA 1NP8A 3BXKA 2HETA 1A2XA 1QTXA 2M29A 2WNDA 1UHJA 2LCPA 1QS7A 1CM4A 2WCEA 2PMYA 2JNXA 3KHEA 5HYDA 3BOWB 1JFJA 3DVEA 4YGEB 2AUCA 3CGAA 1AHRA 1SBJA 1SL8A 1L7ZA 4YRUA 2JULA 1NYAA 3VRPA 1BMOA 1H4BA 1M46A 1OSAA 5I2LA 2JQ6A 1YURA 1U5IB 2ZNDA 2ZRSA 4DUQA 1EL4A 5HKWA 1IKUA 1DJXA 3LK1A 1SR6B 4E68A 2BL0C 2QPTA 1CTRA 3GOFA 2G9BA 3KO0A 3TDIA 1IQ5A 1QVIY 1QIWA 1S5GZ 2BE6A 4P2YB 1B1GA 3FIAA 4MLWA 1BF5A 2KYFA 1BU3A 4QJ3B 3SG6A 2K2AA 1CB1A 1IJ6A 1UURA 2M97A 5GQQC 1K9PA 1MHOA 2Q91A 4HREE 2KBIA 1RJVA 5F6TA 3CTNA 1F54A 5CSNA 2LLTA 2Y5IA 1KFUS 1OMVA 3MSEB 2KAXA 4GGFC 5DKNA 1KQMB 1B4CA 1HQVA 1QASA 1CDLA 1Y1AA 1A03A 1NX0A 3BUOB 4NQGA 1MR8A 4NDDA 4PE7A 5AFPA 3JTDC 1MF8B 1JSAA 3BUMB 4TNCA 1A75A 1C7WA 2Y4QA 1QATA 2ZRTA 1NIWA 2M49B 4GAOA 3WHUB 3NSIA 1EJ3A 2OPOA 4PHMA 4F0ZB 1UHNA 1YUUA 4QJ4B 1RK9A 1XFXO 2M0RA 1FPWA 3CLNA 4AOMA 2CT9A 4PE0A 1F8HA 3RLZA 5AERA 1KWOC 1Y0VH 2Y1MA 4NDBA 2PRUA 1DF0B 3TDZA 1KCYA 2JTTA 2MA2A 2LNKA 1CDPA 3PN7C 1K8UA 1HT9A 1EXRA 2O60A 4M2OA 2EC6B 1KSOA 2KDHA 3DVMA 1CKKA 3OX6A 2ZNEA 4PALA 1LKJA 2H61A 3FWBA 3I5GC 3SG5A 1Y1UA 1JC2A 1J1EA 1CLBA 3JVTB 3BQ3A 2BKIB 4ICBA 1NX1A 2LHLA 1JF0A 1OQPA 2M7LA 2L0PA 1WY9A 2L4HA 1KFXL 2E6WA 4GGFA 3TUYB 4CFQA 1SPYA 5CSJA 3AAKA 4OKHA 3EVVA 1B7TY 2WORA 5HKZA 2NCOA 4MRXA 2ZKMX 3SG2A 1KQMC 1UP5A 1GGZA 2BBMA 3OB2B 3OX5A 2COLB 3SG3A 4MBEA 4HRGA 2GGMA 4YGCB 5I8NA 2L2EA 5HLOA 3LL8B 2KAYA 2KAVA 5B8IB 1QX2A 2B1UA 1WLZA 3VGOA 4MZKA 4A4CA 1PSRA 1YVLA 1IH0A 2DOQA 1DJHA 1N0YA 1TNPA 2LP3A 3C1VA 3BOWA 3F45A 1ODBA 2WOSA 1TRFA 4HSZA 1TCOB 2LE9B 3O78A 1AUIB 2SASA 5DKQA 1PK0D 1F4OA 1JUOA 1J7PA 1PULA 4DIRA 2CNPA 2LHIA 1X02A 1ZACA 1LXFC 1U5IA 5PALA 4I5NB 1K93D 1SKTA 3RM1A 4PE4A 2FOTA 1R2UA 2JT3A 3BUNB 3WNXB 3LCPC 3NSKA 3PLFB 1NWDA
chains in the Genus database with same CATH superfamily
1C07A 2MLEC 4OV2A 1YX8A 2E30A 1ZFSA 1EG4A 1XFYO 2I7AA 3S0FA 2JZIA 2HF5A 1ALWA 3IVTA 4WQ3A 1AK8A 3O4XA 4MN0A 4C0LA 3M0WA 2M1KB 1T14A 4GGNA 5D7FA 1B47A 4CPVA 1GQMA 1SCVA 1TTXA 1QLSA 2D8NA 1TIZA 2LMTA 2GGZA 4JPZB 3LK0A 2K7CA 1LVCD 3TS5B 4R1EA 3EK4A 2HPSA 5JJGA 5K89A 1E8AA 4GUKA 1M31A 1XFUO 2LLUA 1TCFA 2QEHA 2M1UA 4PT1A 3SJSA 1D1OA 1WRLA 1OMDA 1SL9A 2F3YA 1KK7Y 1Z2CB 3OGNA 3E3RA 5DICA 1TNXA 3I5IC 4FQOA 1M45A 2LC5A 1IGVA 4FTGA 2PYQA 2FJYA 1UHIA 3I5HB 1OOJA 3SIAA 1K90D 1S26D 2KFHA 2H61C 2L51A 2JC2A 3R1PA 3OP0A 3PM8A 1DJYA 5TNCA 3D0YB 3NHIA 4OVNF 1SCMC 2EHBA 2P6BB 2WC8A 2HQ8A 1YVHA 1L2OC 1TNQA 1CDNA 1PSBA 1WRZA 4JQ0D 1C7VA 2KFFA 1DGUA 1CFDA 4WQ2A 2G2BA 1LA3A 2MLFC 2WC6A 3OB1B 3FS7A 3S0DA 4IL1A 4GBAA 4ORBB 1NCYA 1WDCC 2PALA 4ORAB 1IJ5A 4DRWA 4CLNA 1KK7Z 4INXA 2F2PA 4HRHA 1XYDA 2JNFA 1TOPA 1A29A 1MUXA 4PHJA 4C0JA 2L5XB 3BJHA 1QVIZ 3O2PA 4N5XA 2LUXA 2GV5A 1BOCA 1KK8B 1PALA 4OCIA 3EVRA 2BECA 2KI6D 3DZTA 3KEVA 4CIDA 2WC5A 1CM1A 1KQVA 1PRWA 3RZSA 2BCAA 1W7IB 1NSHA 2BE4A 2FCEA 5D3OA 3CZ1A 3S0AA 1QWVA 1CNPA 3PFVA 1AVSA 1YUSA 2NCPA 1DTLA 5J3XA 2H2KA 3KPXA 4MVFA 3CWGA 1SR6C 4YBHB 1XFZO 2Q4UA 2ISDA 2NXQA 1J55A 4BY5A 4YI8A 1MXEA 2JXLA 1NCZA 2K7OA 2KI4B 5KTYA 1CFCA 2KQ6A 1XFWO 2KLEA 1CLMA 2HQWA 1BR1B 4YI9A 3UO9A 4XJKB 3BYAA 2FJUB 1QV1A 1WLMA 5I2OA 3NXAA 1S6JA 2JXCA 1SL7A 1FI6A 2A4JA 1J7QA 2BCXA 3A4UB 4MZJA 1LINA 2LUCA 2JTZA 3BUXB 3I5FB 1IWQA 1K9UA 1F4QA 4WRIA 4GNKB 1B9AA 1XO5A 5JOLA 1AP4A 4N1GA 1YR5A 4U8DA 2LAPA 3VRNA 4INWA 2BCBA 1TUZA 2L98A 3EK8A 2WCBA 3D73A 2PVBA 1DT7B 1SY9A 2BKHB 1QX7A 5AANA 1A75B 1RWYA 3A8RA 1TWOA 3AKBA 1M63B 5KU1A 2GTEA 2P70A 1IG5A 1BJFA 2QEBA 1V1FA 2BBNA 5G08A 4I5LB 2EGDA 1OW4A 3EKJA 1SSEB 3D74A 4I5JA 2MRDA 1BT6A 3OHMB 3H4SE 1J7OA 1EH2A 1XA5A 2LV7A 3L4LA 4P5OE 2K0JA 3D78A 1FF1A 1PVAA 2WCJA 2JU0A 4DS7A 5HKYA 2KOTA 1B7TZ 2F3ZA 2BL0B 3CR4X 1JWDA 3ZNIA 1BG1A 2F33A 3EKHA 1CFFA 3GK4X 5I2QA 1N2DA 1TUJA 1OMRA 2P71A 4DCKA 2KSPA 1B8RA 4USLA 1ALVA 2EC6C 3PSRA 1DELA 1OOHA 2AMIA 2KFGA 3L47A 1ZMZA 4NDCA 1F71A 1FBVA 3K1EA 1YX7A 2K7BA 2MAZA 1CDMA 2I94A 3DF0B 2KI4C 3FE6A 3D0YA 4N1FA 3JVTC 1J7RA 2LANA 5CPVA 1IRJA 2SCPA 2JWWA 1EG3A 2LP2A 3FE8A 3CZTX 1K2HA 2MJWB 4ORCB 5CSIA 4MSPA 1QIVA 1CMFA 2JT0A 3TUYC 5CSFA 1FW4A 1SW8A 3SIBA 3BUWB 3I5FC 1UUSA 3JTDB 1G8IA 1W9ZA 2KHNA 1DJGA 4GPLB 3WXAA 2I18A 1UHKA 1YRTB 2PSRA 3ICBA 5IBWA 1Z4HA 3HCMA 1SK6D 2OS8B 3NSLA 1LS8A 3AAJA 2F2OA 2ZFDA 2TN4A 2CCMA 2LVJA 2L50A 1KFUL 1SYMA 2M8UA 3Q8IA 1B8LA 5I94A 2JOJA 4XYNA 5BPJA 1CFPA 1JF2A 1BODA 2ERBA 1KWOB 3FWCA 4YGDB 1CLLA 1JFKA 3CS1A 1Y6WA 1K94A 3EG5B 1KSMA 3CR5X 4YGBB 1S6IA 1K95A 1J1DA 1DF0A 3VB1A 4PDZA 1R6PA 3DXLA 3PN7B 2LMVA 2MHHA 2QDIA 3EK7A 2JT8A 1P28A 2BNXA 2JRFA 4IJ7A 2KYCA 3IF7A 1OZSA 1XVJA 2RGIA 1F70A 1Q80A 2IS9A 3O4YA 2QACA 3I5GB 3GK1A 3DYEA 4MEWA 4PE1A 4PHNA 2MBXA 2NZ0A 2WCHA 3FE9A 2KPHA 2ZN9A 1MQ1A 1YUTA 1V1GA 2L2CA 5HLVA 1F55A 1W7JB 1ZUZA 3PATA 4UPGA 4OR9B 3WHTB 4XJKA 1A4PA 1M39A 1NCXA 2LMUA 3AKAA 3VRRA 1GGWA 1NX2A 2PQLA 1S1EA 1IQ3A 2K61A 4L9MA 3N7HA 1YRUB 1DMOA 1SNLA 4Q04A 4PHKA 3TS5C 5AEQA 3B7AA 3SS4A 1TNWA 3B6XA 4D1EA 4MZLA 2KBMA 1WRKA 1GJYA 3ZWHA 2PASA 1BLQA 1MWNA 2OS8C 4ZCUA 4JKTA 3D77A 2WCMA 4OZDA 3SG7A 5ER4X 3DVKA 3I5HC 5DKRA 2KI6C 1VRKA 1SRAA 3KF9A 3D10A 1S36A 4QJ5B 2K2FA 1S3PA 3NGVA 2ZN8A 3TDUA 1BR4B 1MXLC 2OTGB 3NHTA 3TZ1A 4I5KA 2VRGA 2LVIA 1QJTA 2R2IA 3B88A 1DVIA 2LM5A 1B8CA 1RFJA 3DD4A 4PCWA 1YTZC 1OOFA 1UHHA 2WCKA 4GFTA 2FCDA 2KGBC 1TN4A 1AJ4A 1N65A 1DJZA 3S0BA 3EVUA 1QXPA 2H8VA 4YGAA 3PJIA 2I2RE 3B87A 1H8BA 1OOIX 3DF0A 2O5GA 3VRQA 1NPQA 1XK4C 3B86A 4JWQA 1SMGA 4C0KA 3SS5A 1ZOTB 2CXJA 2LVKA 1NUBA 1KK8C 1QX5B 2Y1NA 3LLEA 1QV0A 3CZ2A 2L4IA 3DVJA 4ZCVA 2JPTA 2K7DA 4AQIA 1NX3A 1DGVA 1C3ZA 3PM2A 1C3YA 3CDNA 3I5IB 1KFXS 3S0EA 1G33A 2M3WA 1OE9B 1K9KA 2QEOA 4FQTA 2F8PA 1DEKA 4CFRA 1Y1XA 4MRYA 1IIOA 2V53A 3IQQA 3R1VA 1LA0A 3IQOA 1UWOA 3CZ0A 2KGRA 3QRXA 1SCMB 4AQJA 2WCFA 3SG4A 1QLKA 1RECA 1OOGA 1PVBA 2NLNA 5AXIA 4A4BA 2OTGC 1L2OB 4BY4A 2LLSA 3O6BA 3PALA 1DJIA 1ORGA 4M2PA 5ER5A 3VROA 1JBAA 2K8MB 5D69A 1S6CA 2AAOA 2LVVA 1FI5A 3CR2A 1WDCB 3HX4A 1XFVO 1RROA 1G4YR 2KQYA 3K21A 5KSZA 1CMGA 1AJ5A 1RTP1 1K96A 2M9GA 3NSOA 4M2QA 5FYXA 2M7NA 1S5GY 3SS3A 1DJWA 3V2LA 1XK4A 2CBLA 2CTNA 1OZOA 4ETOA 3GK2A 4JD9A 3D76A 2YGUA 1XFRA 2KNEA 5FI2A 1NP8A 3BXKA 3D75A 2HETA 1A2XA 1QTXA 2M29A 2WNDA 1UHJA 2LCPA 1QS7A 1CM4A 2WCEA 2PMYA 2JNXA 3KHEA 5HYDA 3BOWB 1JFJA 3DVEA 4YGEB 2AUCA 3CGAA 1AHRA 1SBJA 1SL8A 1L7ZA 4YRUA 2JULA 1NYAA 3VRPA 1BMOA 5FI7A 1H4BA 1M46A 1OSAA 5I2LA 2JQ6A 1YURA 1U5IB 2ZNDA 2ZRSA 4DUQA 1EL4A 5HKWA 1IKUA 1DJXA 3LK1A 1SR6B 2L5YA 4E68A 2BL0C 2QPTA 1CTRA 3GOFA 2G9BA 3KO0A 3TDIA 1IQ5A 1QVIY 1QIWA 1S5GZ 2BE6A 4P2YB 1B1GA 3FIAA 4MLWA 1BF5A 2KYFA 1BU3A 4QJ3B 3SG6A 2K2AA 1CB1A 1IJ6A 1UURA 2M97A 5GQQC 1K9PA 1MHOA 2Q91A 4HREE 2KBIA 1RJVA 1DC1A 5F6TA 3CTNA 1F54A 5CSNA 2LLTA 2Y5IA 1KFUS 1OMVA 3MSEB 4F7FA 2KAXA 4GGFC 5DKNA 1KQMB 1B4CA 1HQVA 1QASA 2BAPA 1CDLA 1Y1AA 3L4AA 1A03A 1NX0A 3BUOB 2KLDA 4NQGA 5HL1A 1MR8A 2QEVA 4NDDA 4PE7A 5AFPA 3JTDC 1MF8B 1JSAA 2K60A 3BUMB 4TNCA 1A75A 1C7WA 2Y4QA 1QATA 2ZRTA 1NIWA 2M49B 4GAOA 3WHUB 3NSIA 3QMEA 1EJ3A 3DY9A 2OPOA 4PHMA 4F0ZB 1UHNA 1YUUA 4QJ4B 1GM0A 1RK9A 4KYNA 1XFXO 2M0RA 1FPWA 3CLNA 3CYZA 4AOMA 2CT9A 4PE0A 1F8HA 3RLZA 2JPOA 1KWOC 1Y0VH 2Y1MA 4NDBA 5AERA 2PRUA 1DF0B 3TDZA 1KCYA 2JTTA 2MA2A 2LNKA 1CDPA 3PN7C 1K8UA 1HT9A 1EXRA 2O60A 3CABA 4M2OA 2EC6B 1KSOA 2KDHA 3DVMA 1CKKA 3OX6A 2ZNEA 4PALA 1LKJA 2H61A 3FWBA 3I5GC 3SG5A 1Y1UA 1JC2A 1J1EA 3R1OA 1CLBA 3OBVA 3JVTB 3BQ3A 2BKIB 4ICBA 1NX1A 2LHLA 1JF0A 1OQPA 2M7LA 2L0PA 1WY9A 2L4HA 1KFXL 2E6WA 4GGFA 3TUYB 4CFQA 1SPYA 5CSJA 3AAKA 4OKHA 3EVVA 1B7TY 2WORA 5HKZA 2NCOA 4MRXA 2ZKMX 3BFAA 3SG2A 1KQMC 1UP5A 1GGZA 2BBMA 3OB2B 3OX5A 2COLB 3SG3A 5EL2A 4MBEA 4HRGA 2GGMA 4YGCB 5I8NA 2L2EA 5HLOA 3LL8B 2KAYA 2KAVA 5B8IB 3BFHA 1QX2A 1DQEA 2B1UA 1WLZA 3VGOA 4MZKA 4A4CA 1PSRA 3S0GA 1YVLA 1IH0A 2DOQA 1DJHA 1N0YA 1TNPA 2LP3A 3C1VA 3BOWA 3F45A 5FI6A 3UNWA 1ODBA 2WOSA 1TRFA 4HSZA 1TCOB 2LE9B 3O78A 1AUIB 2SASA 5DKQA 1PK0D 1F4OA 1JUOA 1J7PA 2WCLA 1PULA 4DIRA 2CNPA 3R72A 2LHIA 1X02A 1ZACA 1LXFC 1U5IA 3BFBA 4I5NB 5PALA 1K93D 1SKTA 3RM1A 4PE4A 2FOTA 1R2UA 2JT3A 3BUNB 3WNXB 3LCPC 3NSKA 3PLFB 1NWDA
chains in the Genus database with same CATH topology
1C07A 2MLEC 4OV2A 1YX8A 2E30A 1ZFSA 1EG4A 1XFYO 2I7AA 2JZIA 2HF5A 1ALWA 4WQ3A 1AK8A 4MN0A 4C0LA 3M0WA 2M1KB 4GGNA 5D7FA 1B47A 4CPVA 1GQMA 1SCVA 1TTXA 1QLSA 2D8NA 1TIZA 2LMTA 2GGZA 4JPZB 3LK0A 2K7CA 1LVCD 3TS5B 4R1EA 3EK4A 2HPSA 5JJGA 5K89A 1E8AA 4GUKA 1M31A 1XFUO 2LLUA 1TCFA 3SJSA 2M1UA 1D1OA 1WRLA 1OMDA 1SL9A 2F3YA 1KK7Y 3E3RA 1TNXA 3I5IC 4FQOA 1M45A 2LC5A 1IGVA 4FTGA 3SIAA 3I5HB 1UHIA 1OOJA 1K90D 1S26D 2KFHA 2H61C 2L51A 2JC2A 3OP0A 3PM8A 1DJYA 5TNCA 3D0YB 4OVNF 1SCMC 2EHBA 2P6BB 2WC8A 2HQ8A 1YVHA 1L2OC 1TNQA 1CDNA 1PSBA 1WRZA 4JQ0D 1C7VA 2KFFA 1DGUA 1CFDA 4WQ2A 2G2BA 1LA3A 2MLFC 3OB1B 3FS7A 4IL1A 4GBAA 4ORBB 1NCYA 1WDCC 2PALA 4ORAB 1IJ5A 4DRWA 4CLNA 1KK7Z 2F2PA 4HRHA 1XYDA 2JNFA 1TOPA 1A29A 1MUXA 4PHJA 4C0JA 2L5XB 1QVIZ 3O2PA 4N5XA 2LUXA 2GV5A 1BOCA 1KK8B 1PALA 4OCIA 3EVRA 2BECA 2KI6D 3KEVA 4CIDA 1KQVA 1CM1A 1PRWA 2BCAA 1W7IB 1NSHA 2BE4A 2FCEA 1CNPA 3PFVA 1AVSA 1YUSA 2NCPA 1DTLA 5J3XA 2H2KA 3KPXA 4MVFA 3CWGA 1SR6C 4YBHB 1XFZO 2Q4UA 2ISDA 2NXQA 1J55A 4BY5A 4YI8A 1MXEA 2JXLA 1NCZA 2K7OA 2KI4B 5KTYA 1CFCA 2KQ6A 1XFWO 1CLMA 2HQWA 1BR1B 4YI9A 4XJKB 3BYAA 2FJUB 1QV1A 1WLMA 5I2OA 3NXAA 1S6JA 2JXCA 1SL7A 1FI6A 2A4JA 1J7QA 2BCXA 3A4UB 4MZJA 1LINA 2LUCA 2JTZA 3BUXB 3I5FB 1IWQA 1K9UA 1F4QA 4WRIA 4GNKB 1B9AA 1XO5A 5JOLA 1AP4A 4N1GA 1YR5A 4U8DA 2LAPA 3VRNA 2BCBA 2L98A 3EK8A 2WCBA 2PVBA 1DT7B 1SY9A 2BKHB 1QX7A 5AANA 1A75B 1RWYA 3A8RA 3AKBA 1M63B 5KU1A 1IG5A 1BJFA 5G08A 1V1FA 2BBNA 4I5LB 2EGDA 3EKJA 4I5JA 2MRDA 1BT6A 3OHMB 3H4SE 1J7OA 1EH2A 1XA5A 2LV7A 4P5OE 2K0JA 1FF1A 1PVAA 2JU0A 4DS7A 5HKYA 2KOTA 1B7TZ 2F3ZA 2BL0B 3CR4X 1JWDA 3ZNIA 1BG1A 2F33A 3EKHA 1CFFA 3GK4X 5I2QA 1N2DA 1OMRA 4DCKA 2KSPA 1B8RA 4USLA 1ALVA 2EC6C 3PSRA 2AMIA 2KFGA 4NDCA 1ZMZA 1F71A 1FBVA 1YX7A 2K7BA 2MAZA 1CDMA 2I94A 3DF0B 2KI4C 3D0YA 4N1FA 3JVTC 1J7RA 2LANA 5CPVA 1IRJA 2SCPA 2JWWA 1EG3A 2LP2A 3CZTX 1K2HA 2MJWB 4ORCB 5CSIA 4MSPA 1QIVA 1CMFA 2JT0A 3TUYC 5CSFA 1FW4A 1SW8A 3SIBA 3BUWB 3I5FC 1UUSA 3JTDB 1G8IA 2KHNA 1DJGA 4GPLB 3WXAA 2I18A 1UHKA 1YRTB 2PSRA 3ICBA 5IBWA 3HCMA 1SK6D 2OS8B 3NSLA 3AAJA 2F2OA 2ZFDA 2TN4A 2CCMA 2LVJA 2L50A 1KFUL 1SYMA 2M8UA 1CFPA 1B8LA 2JOJA 4XYNA 5BPJA 1JF2A 1BODA 1KWOB 3FWCA 4YGDB 1CLLA 1JFKA 3CS1A 1Y6WA 1K94A 1KSMA 3CR5X 4YGBB 1S6IA 1K95A 1J1DA 1DF0A 4PDZA 1R6PA 3PN7B 2LMVA 2MHHA 3EK7A 2JT8A 2JRFA 2KYCA 3IF7A 1OZSA 1XVJA 2RGIA 1F70A 1Q80A 2IS9A 3O4YA 2QACA 3I5GB 3GK1A 4MEWA 4PE1A 4PHNA 2MBXA 2NZ0A 2ZN9A 1MQ1A 1YUTA 1V1GA 5HLVA 1F55A 1W7JB 1ZUZA 3PATA 4UPGA 4OR9B 3WHTB 4XJKA 1A4PA 1M39A 1NCXA 2LMUA 3AKAA 3VRRA 1GGWA 1NX2A 1S1EA 1IQ3A 2K61A 4L9MA 1YRUB 1DMOA 1SNLA 4Q04A 4PHKA 3TS5C 5AEQA 1TNWA 4D1EA 4MZLA 2KBMA 1WRKA 1GJYA 3ZWHA 2PASA 1BLQA 1MWNA 2OS8C 4ZCUA 3SG7A 5ER4X 3DVKA 3I5HC 5DKRA 2KI6C 1VRKA 1SRAA 3KF9A 3D10A 1S36A 4QJ5B 2K2FA 1S3PA 3TDUA 2ZN8A 1BR4B 1MXLC 2OTGB 3TZ1A 4I5KA 2VRGA 2LVIA 1QJTA 2R2IA 1DVIA 2LM5A 1B8CA 1RFJA 3DD4A 4PCWA 1YTZC 1UHHA 4GFTA 2FCDA 2KGBC 1TN4A 1AJ4A 1N65A 1DJZA 3EVUA 1QXPA 4YGAA 1H8BA 2I2RE 3DF0A 2O5GA 3VRQA 1NPQA 1XK4C 4JWQA 1SMGA 4C0KA 1ZOTB 2CXJA 2LVKA 1NUBA 1KK8C 1QX5B 2Y1NA 3LLEA 1QV0A 2L4IA 3DVJA 4ZCVA 2JPTA 2K7DA 4AQIA 1NX3A 1DGVA 3I5IB 1KFXS 1G33A 2M3WA 1OE9B 1K9KA 2F8PA 4CFRA 1Y1XA 4MRYA 2V53A 3IQQA 1LA0A 3IQOA 1UWOA 2KGRA 3QRXA 1SCMB 4AQJA 2WCFA 3SG4A 1QLKA 1RECA 1PVBA 2NLNA 5AXIA 4A4BA 2OTGC 1L2OB 4BY4A 2LLSA 3O6BA 3PALA 1DJIA 4M2PA 5ER5A 3VROA 1JBAA 2K8MB 5D69A 1S6CA 2AAOA 2LVVA 1FI5A 3CR2A 1WDCB 3HX4A 1XFVO 1RROA 1G4YR 2KQYA 3K21A 5KSZA 1CMGA 1AJ5A 1RTP1 1K96A 2M9GA 3NSOA 4M2QA 5FYXA 2M7NA 1S5GY 1DJWA 1XK4A 2CBLA 2CTNA 1OZOA 4ETOA 3GK2A 2KNEA 1NP8A 3BXKA 2HETA 1A2XA 1QTXA 2M29A 2WNDA 1UHJA 2LCPA 1QS7A 1CM4A 2WCEA 2PMYA 2JNXA 3KHEA 5HYDA 3BOWB 1JFJA 3DVEA 4YGEB 2AUCA 3CGAA 1AHRA 1SBJA 1SL8A 1L7ZA 4YRUA 2JULA 1NYAA 3VRPA 1BMOA 1H4BA 1M46A 1OSAA 5I2LA 2JQ6A 1YURA 1U5IB 2ZNDA 2ZRSA 4DUQA 1EL4A 5HKWA 1IKUA 1DJXA 3LK1A 1SR6B 4E68A 2BL0C 2QPTA 1CTRA 3GOFA 2G9BA 3KO0A 3TDIA 1IQ5A 1QVIY 1QIWA 1S5GZ 2BE6A 4P2YB 1B1GA 3FIAA 4MLWA 1BF5A 2KYFA 1BU3A 4QJ3B 3SG6A 2K2AA 1CB1A 1IJ6A 1UURA 2M97A 5GQQC 1K9PA 1MHOA 2Q91A 4HREE 2KBIA 1RJVA 5F6TA 3CTNA 1F54A 5CSNA 2LLTA 2Y5IA 1KFUS 1OMVA 3MSEB 2KAXA 4GGFC 5DKNA 1KQMB 1B4CA 1HQVA 1QASA 1CDLA 1Y1AA 1A03A 1NX0A 3BUOB 4NQGA 1MR8A 4NDDA 4PE7A 5AFPA 3JTDC 1MF8B 1JSAA 3BUMB 4TNCA 1A75A 1C7WA 2Y4QA 1QATA 2ZRTA 1NIWA 2M49B 4GAOA 3WHUB 3NSIA 1EJ3A 2OPOA 4PHMA 4F0ZB 1UHNA 1YUUA 4QJ4B 1RK9A 1XFXO 2M0RA 1FPWA 3CLNA 4AOMA 2CT9A 4PE0A 1F8HA 3RLZA 5AERA 1KWOC 1Y0VH 2Y1MA 4NDBA 2PRUA 1DF0B 3TDZA 1KCYA 2JTTA 2MA2A 2LNKA 1CDPA 3PN7C 1K8UA 1HT9A 1EXRA 2O60A 4M2OA 2EC6B 1KSOA 2KDHA 3DVMA 1CKKA 3OX6A 2ZNEA 4PALA 1LKJA 2H61A 3FWBA 3I5GC 3SG5A 1Y1UA 1JC2A 1J1EA 1CLBA 3JVTB 3BQ3A 2BKIB 4ICBA 1NX1A 2LHLA 1JF0A 1OQPA 2M7LA 2L0PA 1WY9A 2L4HA 1KFXL 2E6WA 4GGFA 3TUYB 4CFQA 1SPYA 5CSJA 3AAKA 4OKHA 3EVVA 1B7TY 2WORA 5HKZA 2NCOA 4MRXA 2ZKMX 3SG2A 1KQMC 1UP5A 1GGZA 2BBMA 3OB2B 3OX5A 2COLB 3SG3A 4MBEA 4HRGA 2GGMA 4YGCB 5I8NA 2L2EA 5HLOA 3LL8B 2KAYA 2KAVA 5B8IB 1QX2A 2B1UA 1WLZA 3VGOA 4MZKA 4A4CA 1PSRA 1YVLA 1IH0A 2DOQA 1DJHA 1N0YA 1TNPA 2LP3A 3C1VA 3BOWA 3F45A 1ODBA 2WOSA 1TRFA 4HSZA 1TCOB 2LE9B 3O78A 1AUIB 2SASA 5DKQA 1PK0D 1F4OA 1JUOA 1J7PA 1PULA 4DIRA 2CNPA 2LHIA 1X02A 1ZACA 1LXFC 1U5IA 5PALA 4I5NB 1K93D 1SKTA 3RM1A 4PE4A 2FOTA 1R2UA 2JT3A 3BUNB 3WNXB 3LCPC 3NSKA 3PLFB 1NWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C07 A;  2MLE C;  4OV2 A;  1YX8 A;  2E30 A;  1ZFS A;  1EG4 A;  1XFY O;  2I7A A;  2JZI A;  2HF5 A;  1ALW A;  4WQ3 A;  1AK8 A;  4MN0 A;  4C0L A;  3M0W A;  2M1K B;  4GGN A;  5D7F A;  1B47 A;  4CPV A;  1GQM A;  1SCV A;  1TTX A;  1QLS A;  2D8N A;  1TIZ A;  2LMT A;  2GGZ A;  4JPZ B;  3LK0 A;  2K7C A;  1LVC D;  3TS5 B;  4R1E A;  3EK4 A;  2HPS A;  5JJG A;  5K89 A;  1E8A A;  4GUK A;  1M31 A;  1XFU O;  2LLU A;  1TCF A;  3SJS A;  2M1U A;  1D1O A;  1WRL A;  1OMD A;  1SL9 A;  2F3Y A;  1KK7 Y;  3E3R A;  1TNX A;  3I5I C;  4FQO A;  1M45 A;  2LC5 A;  1IGV A;  4FTG A;  3SIA A;  3I5H B;  1UHI A;  1OOJ A;  1K90 D;  1S26 D;  2KFH A;  2H61 C;  2L51 A;  2JC2 A;  3OP0 A;  3PM8 A;  1DJY A;  5TNC A;  3D0Y B;  4OVN F;  1SCM C;  2EHB A;  2P6B B;  2WC8 A;  2HQ8 A;  1YVH A;  1L2O C;  1TNQ A;  1CDN A;  1PSB A;  1WRZ A;  4JQ0 D;  1C7V A;  2KFF A;  1DGU A;  1CFD A;  4WQ2 A;  2G2B A;  1LA3 A;  2MLF C;  3OB1 B;  3FS7 A;  4IL1 A;  4GBA A;  4ORB B;  1NCY A;  1WDC C;  2PAL A;  4ORA B;  1IJ5 A;  4DRW A;  4CLN A;  1KK7 Z;  2F2P A;  4HRH A;  1XYD A;  2JNF A;  1TOP A;  1A29 A;  1MUX A;  4PHJ A;  4C0J A;  2L5X B;  1QVI Z;  3O2P A;  4N5X A;  2LUX A;  2GV5 A;  1BOC A;  1KK8 B;  1PAL A;  4OCI A;  3EVR A;  2BEC A;  2KI6 D;  3KEV A;  4CID A;  1KQV A;  1CM1 A;  1PRW A;  2BCA A;  1W7I B;  1NSH A;  2BE4 A;  2FCE A;  1CNP A;  3PFV A;  1AVS A;  1YUS A;  2NCP A;  1DTL A;  5J3X A;  2H2K A;  3KPX A;  4MVF A;  3CWG A;  1SR6 C;  4YBH B;  1XFZ O;  2Q4U A;  2ISD A;  2NXQ A;  1J55 A;  4BY5 A;  4YI8 A;  1MXE A;  2JXL A;  1NCZ A;  2K7O A;  2KI4 B;  5KTY A;  1CFC A;  2KQ6 A;  1XFW O;  1CLM A;  2HQW A;  1BR1 B;  4YI9 A;  4XJK B;  3BYA A;  2FJU B;  1QV1 A;  1WLM A;  5I2O A;  3NXA A;  1S6J A;  2JXC A;  1SL7 A;  1FI6 A;  2A4J A;  1J7Q A;  2BCX A;  3A4U B;  4MZJ A;  1LIN A;  2LUC A;  2JTZ A;  3BUX B;  3I5F B;  1IWQ A;  1K9U A;  1F4Q A;  4WRI A;  4GNK B;  1B9A A;  1XO5 A;  5JOL A;  1AP4 A;  4N1G A;  1YR5 A;  4U8D A;  2LAP A;  3VRN A;  2BCB A;  2L98 A;  3EK8 A;  2WCB A;  2PVB A;  1DT7 B;  1SY9 A;  2BKH B;  1QX7 A;  5AAN A;  1A75 B;  1RWY A;  3A8R A;  3AKB A;  1M63 B;  5KU1 A;  1IG5 A;  1BJF A;  5G08 A;  1V1F A;  2BBN A;  4I5L B;  2EGD A;  3EKJ A;  4I5J A;  2MRD A;  1BT6 A;  3OHM B;  3H4S E;  1J7O A;  1EH2 A;  1XA5 A;  2LV7 A;  4P5O E;  2K0J A;  1FF1 A;  1PVA A;  2JU0 A;  4DS7 A;  5HKY A;  2KOT A;  1B7T Z;  2F3Z A;  2BL0 B;  3CR4 X;  1JWD A;  3ZNI A;  1BG1 A;  2F33 A;  3EKH A;  1CFF A;  3GK4 X;  5I2Q A;  1N2D A;  1OMR A;  4DCK A;  2KSP A;  1B8R A;  4USL A;  1ALV A;  2EC6 C;  3PSR A;  2AMI A;  2KFG A;  4NDC A;  1ZMZ A;  1F71 A;  1FBV A;  1YX7 A;  2K7B A;  2MAZ A;  1CDM A;  2I94 A;  3DF0 B;  2KI4 C;  3D0Y A;  4N1F A;  3JVT C;  1J7R A;  2LAN A;  5CPV A;  1IRJ A;  2SCP A;  2JWW A;  1EG3 A;  2LP2 A;  3CZT X;  1K2H A;  2MJW B;  4ORC B;  5CSI A;  4MSP A;  1QIV A;  1CMF A;  2JT0 A;  3TUY C;  5CSF A;  1FW4 A;  1SW8 A;  3SIB A;  3BUW B;  3I5F C;  1UUS A;  3JTD B;  1G8I A;  2KHN A;  1DJG A;  4GPL B;  3WXA A;  2I18 A;  1UHK A;  1YRT B;  2PSR A;  3ICB A;  5IBW A;  3HCM A;  1SK6 D;  2OS8 B;  3NSL A;  3AAJ A;  2F2O A;  2ZFD A;  2TN4 A;  2CCM A;  2LVJ A;  2L50 A;  1KFU L;  1SYM A;  2M8U A;  1CFP A;  1B8L A;  2JOJ A;  4XYN A;  5BPJ A;  1JF2 A;  1BOD A;  1KWO B;  3FWC A;  4YGD B;  1CLL A;  1JFK A;  3CS1 A;  1Y6W A;  1K94 A;  1KSM A;  3CR5 X;  4YGB B;  1S6I A;  1K95 A;  1J1D A;  1DF0 A;  4PDZ A;  1R6P A;  3PN7 B;  2LMV A;  2MHH A;  3EK7 A;  2JT8 A;  2JRF A;  2KYC A;  3IF7 A;  1OZS A;  1XVJ A;  2RGI A;  1F70 A;  1Q80 A;  2IS9 A;  3O4Y A;  2QAC A;  3I5G B;  3GK1 A;  4MEW A;  4PE1 A;  4PHN A;  2MBX A;  2NZ0 A;  2ZN9 A;  1MQ1 A;  1YUT A;  1V1G A;  5HLV A;  1F55 A;  1W7J B;  1ZUZ A;  3PAT A;  4UPG A;  4OR9 B;  3WHT B;  4XJK A;  1A4P A;  1M39 A;  1NCX A;  2LMU A;  3AKA A;  3VRR A;  1GGW A;  1NX2 A;  1S1E A;  1IQ3 A;  2K61 A;  4L9M A;  1YRU B;  1DMO A;  1SNL A;  4Q04 A;  4PHK A;  3TS5 C;  5AEQ A;  1TNW A;  4D1E A;  4MZL A;  2KBM A;  1WRK A;  1GJY A;  3ZWH A;  2PAS A;  1BLQ A;  1MWN A;  2OS8 C;  4ZCU A;  3SG7 A;  5ER4 X;  3DVK A;  3I5H C;  5DKR A;  2KI6 C;  1VRK A;  1SRA A;  3KF9 A;  3D10 A;  1S36 A;  4QJ5 B;  2K2F A;  1S3P A;  3TDU A;  2ZN8 A;  1BR4 B;  1MXL C;  2OTG B;  3TZ1 A;  4I5K A;  2VRG A;  2LVI A;  1QJT A;  2R2I A;  1DVI A;  2LM5 A;  1B8C A;  1RFJ A;  3DD4 A;  4PCW A;  1YTZ C;  1UHH A;  4GFT A;  2FCD A;  2KGB C;  1TN4 A;  1AJ4 A;  1N65 A;  1DJZ A;  3EVU A;  1QXP A;  4YGA A;  1H8B A;  2I2R E;  3DF0 A;  2O5G A;  3VRQ A;  1NPQ A;  1XK4 C;  4JWQ A;  1SMG A;  4C0K A;  1ZOT B;  2CXJ A;  2LVK A;  1NUB A;  1KK8 C;  1QX5 B;  2Y1N A;  3LLE A;  1QV0 A;  2L4I A;  3DVJ A;  4ZCV A;  2JPT A;  2K7D A;  4AQI A;  1NX3 A;  1DGV A;  3I5I B;  1KFX S;  1G33 A;  2M3W A;  1OE9 B;  1K9K A;  2F8P A;  4CFR A;  1Y1X A;  4MRY A;  2V53 A;  3IQQ A;  1LA0 A;  3IQO A;  1UWO A;  2KGR A;  3QRX A;  1SCM B;  4AQJ A;  2WCF A;  3SG4 A;  1QLK A;  1REC A;  1PVB A;  2NLN A;  5AXI A;  4A4B A;  2OTG C;  1L2O B;  4BY4 A;  2LLS A;  3O6B A;  3PAL A;  1DJI A;  4M2P A;  5ER5 A;  3VRO A;  1JBA A;  2K8M B;  5D69 A;  1S6C A;  2AAO A;  2LVV A;  1FI5 A;  3CR2 A;  1WDC B;  3HX4 A;  1XFV O;  1RRO A;  1G4Y R;  2KQY A;  3K21 A;  5KSZ A;  1CMG A;  1AJ5 A;  1RTP 1;  1K96 A;  2M9G A;  3NSO A;  4M2Q A;  5FYX A;  2M7N A;  1S5G Y;  1DJW A;  1XK4 A;  2CBL A;  2CTN A;  1OZO A;  4ETO A;  3GK2 A;  2KNE A;  1NP8 A;  3BXK A;  2HET A;  1A2X A;  1QTX A;  2M29 A;  2WND A;  1UHJ A;  2LCP A;  1QS7 A;  1CM4 A;  2WCE A;  2PMY A;  2JNX A;  3KHE A;  5HYD A;  3BOW B;  1JFJ A;  3DVE A;  4YGE B;  2AUC A;  3CGA A;  1AHR A;  1SBJ A;  1SL8 A;  1L7Z A;  4YRU A;  2JUL A;  1NYA A;  3VRP A;  1BMO A;  1H4B A;  1M46 A;  1OSA A;  5I2L A;  2JQ6 A;  1YUR A;  1U5I B;  2ZND A;  2ZRS A;  4DUQ A;  1EL4 A;  5HKW A;  1IKU A;  1DJX A;  3LK1 A;  1SR6 B;  4E68 A;  2BL0 C;  2QPT A;  1CTR A;  3GOF A;  2G9B A;  3KO0 A;  3TDI A;  1IQ5 A;  1QVI Y;  1QIW A;  1S5G Z;  2BE6 A;  4P2Y B;  1B1G A;  3FIA A;  4MLW A;  1BF5 A;  2KYF A;  1BU3 A;  4QJ3 B;  3SG6 A;  2K2A A;  1CB1 A;  1IJ6 A;  1UUR A;  2M97 A;  5GQQ C;  1K9P A;  1MHO A;  2Q91 A;  4HRE E;  2KBI A;  1RJV A;  5F6T A;  3CTN A;  1F54 A;  5CSN A;  2LLT A;  2Y5I A;  1KFU S;  1OMV A;  3MSE B;  2KAX A;  4GGF C;  5DKN A;  1KQM B;  1B4C A;  1HQV A;  1QAS A;  1CDL A;  1Y1A A;  1A03 A;  1NX0 A;  3BUO B;  4NQG A;  1MR8 A;  4NDD A;  4PE7 A;  5AFP A;  3JTD C;  1MF8 B;  1JSA A;  3BUM B;  4TNC A;  1A75 A;  1C7W A;  2Y4Q A;  1QAT A;  2ZRT A;  1NIW A;  2M49 B;  4GAO A;  3WHU B;  3NSI A;  1EJ3 A;  2OPO A;  4PHM A;  4F0Z B;  1UHN A;  1YUU A;  4QJ4 B;  1RK9 A;  1XFX O;  2M0R A;  1FPW A;  3CLN A;  4AOM A;  2CT9 A;  4PE0 A;  1F8H A;  3RLZ A;  5AER A;  1KWO C;  1Y0V H;  2Y1M A;  4NDB A;  2PRU A;  1DF0 B;  3TDZ A;  1KCY A;  2JTT A;  2MA2 A;  2LNK A;  1CDP A;  3PN7 C;  1K8U A;  1HT9 A;  1EXR A;  2O60 A;  4M2O A;  2EC6 B;  1KSO A;  2KDH A;  3DVM A;  1CKK A;  3OX6 A;  2ZNE A;  4PAL A;  1LKJ A;  2H61 A;  3FWB A;  3I5G C;  3SG5 A;  1Y1U A;  1JC2 A;  1J1E A;  1CLB A;  3JVT B;  3BQ3 A;  2BKI B;  4ICB A;  1NX1 A;  2LHL A;  1JF0 A;  1OQP A;  2M7L A;  2L0P A;  1WY9 A;  2L4H A;  1KFX L;  2E6W A;  4GGF A;  3TUY B;  4CFQ A;  1SPY A;  5CSJ A;  3AAK A;  4OKH A;  3EVV A;  1B7T Y;  2WOR A;  5HKZ A;  2NCO A;  4MRX A;  2ZKM X;  3SG2 A;  1KQM C;  1UP5 A;  1GGZ A;  2BBM A;  3OB2 B;  3OX5 A;  2COL B;  3SG3 A;  4MBE A;  4HRG A;  2GGM A;  4YGC B;  5I8N A;  2L2E A;  5HLO A;  3LL8 B;  2KAY A;  2KAV A;  5B8I B;  1QX2 A;  2B1U A;  1WLZ A;  3VGO A;  4MZK A;  4A4C A;  1PSR A;  1YVL A;  1IH0 A;  2DOQ A;  1DJH A;  1N0Y A;  1TNP A;  2LP3 A;  3C1V A;  3BOW A;  3F45 A;  1ODB A;  2WOS A;  1TRF A;  4HSZ A;  1TCO B;  2LE9 B;  3O78 A;  1AUI B;  2SAS A;  5DKQ A;  1PK0 D;  1F4O A;  1JUO A;  1J7P A;  1PUL A;  4DIR A;  2CNP A;  2LHI A;  1X02 A;  1ZAC A;  1LXF C;  1U5I A;  5PAL A;  4I5N B;  1K93 D;  1SKT A;  3RM1 A;  4PE4 A;  2FOT A;  1R2U A;  2JT3 A;  3BUN B;  3WNX B;  3LCP C;  3NSK A;  3PLF B;  1NWD A; 
#chains in the Genus database with same CATH topology
 1C07 A;  2MLE C;  4OV2 A;  1YX8 A;  2E30 A;  1ZFS A;  1EG4 A;  1XFY O;  2I7A A;  3S0F A;  2JZI A;  2HF5 A;  1ALW A;  3IVT A;  4WQ3 A;  1AK8 A;  3O4X A;  4MN0 A;  4C0L A;  3M0W A;  2M1K B;  1T14 A;  4GGN A;  5D7F A;  1B47 A;  4CPV A;  1GQM A;  1SCV A;  1TTX A;  1QLS A;  2D8N A;  1TIZ A;  2LMT A;  2GGZ A;  4JPZ B;  3LK0 A;  2K7C A;  1LVC D;  3TS5 B;  4R1E A;  3EK4 A;  2HPS A;  5JJG A;  5K89 A;  1E8A A;  4GUK A;  1M31 A;  1XFU O;  2LLU A;  1TCF A;  2QEH A;  2M1U A;  4PT1 A;  3SJS A;  1D1O A;  1WRL A;  1OMD A;  1SL9 A;  2F3Y A;  1KK7 Y;  1Z2C B;  3OGN A;  3E3R A;  5DIC A;  1TNX A;  3I5I C;  4FQO A;  1M45 A;  2LC5 A;  1IGV A;  4FTG A;  2PYQ A;  2FJY A;  1UHI A;  3I5H B;  1OOJ A;  3SIA A;  1K90 D;  1S26 D;  2KFH A;  2H61 C;  2L51 A;  2JC2 A;  3R1P A;  3OP0 A;  3PM8 A;  1DJY A;  5TNC A;  3D0Y B;  3NHI A;  4OVN F;  1SCM C;  2EHB A;  2P6B B;  2WC8 A;  2HQ8 A;  1YVH A;  1L2O C;  1TNQ A;  1CDN A;  1PSB A;  1WRZ A;  4JQ0 D;  1C7V A;  2KFF A;  1DGU A;  1CFD A;  4WQ2 A;  2G2B A;  1LA3 A;  2MLF C;  2WC6 A;  3OB1 B;  3FS7 A;  3S0D A;  4IL1 A;  4GBA A;  4ORB B;  1NCY A;  1WDC C;  2PAL A;  4ORA B;  1IJ5 A;  4DRW A;  4CLN A;  1KK7 Z;  4INX A;  2F2P A;  4HRH A;  1XYD A;  2JNF A;  1TOP A;  1A29 A;  1MUX A;  4PHJ A;  4C0J A;  2L5X B;  3BJH A;  1QVI Z;  3O2P A;  4N5X A;  2LUX A;  2GV5 A;  1BOC A;  1KK8 B;  1PAL A;  4OCI A;  3EVR A;  2BEC A;  2KI6 D;  3DZT A;  3KEV A;  4CID A;  2WC5 A;  1CM1 A;  1KQV A;  1PRW A;  3RZS A;  2BCA A;  1W7I B;  1NSH A;  2BE4 A;  2FCE A;  5D3O A;  3CZ1 A;  3S0A A;  1QWV A;  1CNP A;  3PFV A;  1AVS A;  1YUS A;  2NCP A;  1DTL A;  5J3X A;  2H2K A;  3KPX A;  4MVF A;  3CWG A;  1SR6 C;  4YBH B;  1XFZ O;  2Q4U A;  2ISD A;  2NXQ A;  1J55 A;  4BY5 A;  4YI8 A;  1MXE A;  2JXL A;  1NCZ A;  2K7O A;  2KI4 B;  5KTY A;  1CFC A;  2KQ6 A;  1XFW O;  2KLE A;  1CLM A;  2HQW A;  1BR1 B;  4YI9 A;  3UO9 A;  4XJK B;  3BYA A;  2FJU B;  1QV1 A;  1WLM A;  5I2O A;  3NXA A;  1S6J A;  2JXC A;  1SL7 A;  1FI6 A;  2A4J A;  1J7Q A;  2BCX A;  3A4U B;  4MZJ A;  1LIN A;  2LUC A;  2JTZ A;  3BUX B;  3I5F B;  1IWQ A;  1K9U A;  1F4Q A;  4WRI A;  4GNK B;  1B9A A;  1XO5 A;  5JOL A;  1AP4 A;  4N1G A;  1YR5 A;  4U8D A;  2LAP A;  3VRN A;  4INW A;  2BCB A;  1TUZ A;  2L98 A;  3EK8 A;  2WCB A;  3D73 A;  2PVB A;  1DT7 B;  1SY9 A;  2BKH B;  1QX7 A;  5AAN A;  1A75 B;  1RWY A;  3A8R A;  1TWO A;  3AKB A;  1M63 B;  5KU1 A;  2GTE A;  2P70 A;  1IG5 A;  1BJF A;  2QEB A;  1V1F A;  2BBN A;  5G08 A;  4I5L B;  2EGD A;  1OW4 A;  3EKJ A;  1SSE B;  3D74 A;  4I5J A;  2MRD A;  1BT6 A;  3OHM B;  3H4S E;  1J7O A;  1EH2 A;  1XA5 A;  2LV7 A;  3L4L A;  4P5O E;  2K0J A;  3D78 A;  1FF1 A;  1PVA A;  2WCJ A;  2JU0 A;  4DS7 A;  5HKY A;  2KOT A;  1B7T Z;  2F3Z A;  2BL0 B;  3CR4 X;  1JWD A;  3ZNI A;  1BG1 A;  2F33 A;  3EKH A;  1CFF A;  3GK4 X;  5I2Q A;  1N2D A;  1TUJ A;  1OMR A;  2P71 A;  4DCK A;  2KSP A;  1B8R A;  4USL A;  1ALV A;  2EC6 C;  3PSR A;  1DEL A;  1OOH A;  2AMI A;  2KFG A;  3L47 A;  1ZMZ A;  4NDC A;  1F71 A;  1FBV A;  3K1E A;  1YX7 A;  2K7B A;  2MAZ A;  1CDM A;  2I94 A;  3DF0 B;  2KI4 C;  3FE6 A;  3D0Y A;  4N1F A;  3JVT C;  1J7R A;  2LAN A;  5CPV A;  1IRJ A;  2SCP A;  2JWW A;  1EG3 A;  2LP2 A;  3FE8 A;  3CZT X;  1K2H A;  2MJW B;  4ORC B;  5CSI A;  4MSP A;  1QIV A;  1CMF A;  2JT0 A;  3TUY C;  5CSF A;  1FW4 A;  1SW8 A;  3SIB A;  3BUW B;  3I5F C;  1UUS A;  3JTD B;  1G8I A;  1W9Z A;  2KHN A;  1DJG A;  4GPL B;  3WXA A;  2I18 A;  1UHK A;  1YRT B;  2PSR A;  3ICB A;  5IBW A;  1Z4H A;  3HCM A;  1SK6 D;  2OS8 B;  3NSL A;  1LS8 A;  3AAJ A;  2F2O A;  2ZFD A;  2TN4 A;  2CCM A;  2LVJ A;  2L50 A;  1KFU L;  1SYM A;  2M8U A;  3Q8I A;  1B8L A;  5I94 A;  2JOJ A;  4XYN A;  5BPJ A;  1CFP A;  1JF2 A;  1BOD A;  2ERB A;  1KWO B;  3FWC A;  4YGD B;  1CLL A;  1JFK A;  3CS1 A;  1Y6W A;  1K94 A;  3EG5 B;  1KSM A;  3CR5 X;  4YGB B;  1S6I A;  1K95 A;  1J1D A;  1DF0 A;  3VB1 A;  4PDZ A;  1R6P A;  3DXL A;  3PN7 B;  2LMV A;  2MHH A;  2QDI A;  3EK7 A;  2JT8 A;  1P28 A;  2BNX A;  2JRF A;  4IJ7 A;  2KYC A;  3IF7 A;  1OZS A;  1XVJ A;  2RGI A;  1F70 A;  1Q80 A;  2IS9 A;  3O4Y A;  2QAC A;  3I5G B;  3GK1 A;  3DYE A;  4MEW A;  4PE1 A;  4PHN A;  2MBX A;  2NZ0 A;  2WCH A;  3FE9 A;  2KPH A;  2ZN9 A;  1MQ1 A;  1YUT A;  1V1G A;  2L2C A;  5HLV A;  1F55 A;  1W7J B;  1ZUZ A;  3PAT A;  4UPG A;  4OR9 B;  3WHT B;  4XJK A;  1A4P A;  1M39 A;  1NCX A;  2LMU A;  3AKA A;  3VRR A;  1GGW A;  1NX2 A;  2PQL A;  1S1E A;  1IQ3 A;  2K61 A;  4L9M A;  3N7H A;  1YRU B;  1DMO A;  1SNL A;  4Q04 A;  4PHK A;  3TS5 C;  5AEQ A;  3B7A A;  3SS4 A;  1TNW A;  3B6X A;  4D1E A;  4MZL A;  2KBM A;  1WRK A;  1GJY A;  3ZWH A;  2PAS A;  1BLQ A;  1MWN A;  2OS8 C;  4ZCU A;  4JKT A;  3D77 A;  2WCM A;  4OZD A;  3SG7 A;  5ER4 X;  3DVK A;  3I5H C;  5DKR A;  2KI6 C;  1VRK A;  1SRA A;  3KF9 A;  3D10 A;  1S36 A;  4QJ5 B;  2K2F A;  1S3P A;  3NGV A;  2ZN8 A;  3TDU A;  1BR4 B;  1MXL C;  2OTG B;  3NHT A;  3TZ1 A;  4I5K A;  2VRG A;  2LVI A;  1QJT A;  2R2I A;  3B88 A;  1DVI A;  2LM5 A;  1B8C A;  1RFJ A;  3DD4 A;  4PCW A;  1YTZ C;  1OOF A;  1UHH A;  2WCK A;  4GFT A;  2FCD A;  2KGB C;  1TN4 A;  1AJ4 A;  1N65 A;  1DJZ A;  3S0B A;  3EVU A;  1QXP A;  2H8V A;  4YGA A;  3PJI A;  2I2R E;  3B87 A;  1H8B A;  1OOI X;  3DF0 A;  2O5G A;  3VRQ A;  1NPQ A;  1XK4 C;  3B86 A;  4JWQ A;  1SMG A;  4C0K A;  3SS5 A;  1ZOT B;  2CXJ A;  2LVK A;  1NUB A;  1KK8 C;  1QX5 B;  2Y1N A;  3LLE A;  1QV0 A;  3CZ2 A;  2L4I A;  3DVJ A;  4ZCV A;  2JPT A;  2K7D A;  4AQI A;  1NX3 A;  1DGV A;  1C3Z A;  3PM2 A;  1C3Y A;  3CDN A;  3I5I B;  1KFX S;  3S0E A;  1G33 A;  2M3W A;  1OE9 B;  1K9K A;  2QEO A;  4FQT A;  2F8P A;  1DEK A;  4CFR A;  1Y1X A;  4MRY A;  1IIO A;  2V53 A;  3IQQ A;  3R1V A;  1LA0 A;  3IQO A;  1UWO A;  3CZ0 A;  2KGR A;  3QRX A;  1SCM B;  4AQJ A;  2WCF A;  3SG4 A;  1QLK A;  1REC A;  1OOG A;  1PVB A;  2NLN A;  5AXI A;  4A4B A;  2OTG C;  1L2O B;  4BY4 A;  2LLS A;  3O6B A;  3PAL A;  1DJI A;  1ORG A;  4M2P A;  5ER5 A;  3VRO A;  1JBA A;  2K8M B;  5D69 A;  1S6C A;  2AAO A;  2LVV A;  1FI5 A;  3CR2 A;  1WDC B;  3HX4 A;  1XFV O;  1RRO A;  1G4Y R;  2KQY A;  3K21 A;  5KSZ A;  1CMG A;  1AJ5 A;  1RTP 1;  1K96 A;  2M9G A;  3NSO A;  4M2Q A;  5FYX A;  2M7N A;  1S5G Y;  3SS3 A;  1DJW A;  3V2L A;  1XK4 A;  2CBL A;  2CTN A;  1OZO A;  4ETO A;  3GK2 A;  4JD9 A;  3D76 A;  2YGU A;  1XFR A;  2KNE A;  5FI2 A;  1NP8 A;  3BXK A;  3D75 A;  2HET A;  1A2X A;  1QTX A;  2M29 A;  2WND A;  1UHJ A;  2LCP A;  1QS7 A;  1CM4 A;  2WCE A;  2PMY A;  2JNX A;  3KHE A;  5HYD A;  3BOW B;  1JFJ A;  3DVE A;  4YGE B;  2AUC A;  3CGA A;  1AHR A;  1SBJ A;  1SL8 A;  1L7Z A;  4YRU A;  2JUL A;  1NYA A;  3VRP A;  1BMO A;  5FI7 A;  1H4B A;  1M46 A;  1OSA A;  5I2L A;  2JQ6 A;  1YUR A;  1U5I B;  2ZND A;  2ZRS A;  4DUQ A;  1EL4 A;  5HKW A;  1IKU A;  1DJX A;  3LK1 A;  1SR6 B;  2L5Y A;  4E68 A;  2BL0 C;  2QPT A;  1CTR A;  3GOF A;  2G9B A;  3KO0 A;  3TDI A;  1IQ5 A;  1QVI Y;  1QIW A;  1S5G Z;  2BE6 A;  4P2Y B;  1B1G A;  3FIA A;  4MLW A;  1BF5 A;  2KYF A;  1BU3 A;  4QJ3 B;  3SG6 A;  2K2A A;  1CB1 A;  1IJ6 A;  1UUR A;  2M97 A;  5GQQ C;  1K9P A;  1MHO A;  2Q91 A;  4HRE E;  2KBI A;  1RJV A;  1DC1 A;  5F6T A;  3CTN A;  1F54 A;  5CSN A;  2LLT A;  2Y5I A;  1KFU S;  1OMV A;  3MSE B;  4F7F A;  2KAX A;  4GGF C;  5DKN A;  1KQM B;  1B4C A;  1HQV A;  1QAS A;  2BAP A;  1CDL A;  1Y1A A;  3L4A A;  1A03 A;  1NX0 A;  3BUO B;  2KLD A;  4NQG A;  5HL1 A;  1MR8 A;  2QEV A;  4NDD A;  4PE7 A;  5AFP A;  3JTD C;  1MF8 B;  1JSA A;  2K60 A;  3BUM B;  4TNC A;  1A75 A;  1C7W A;  2Y4Q A;  1QAT A;  2ZRT A;  1NIW A;  2M49 B;  4GAO A;  3WHU B;  3NSI A;  3QME A;  1EJ3 A;  3DY9 A;  2OPO A;  4PHM A;  4F0Z B;  1UHN A;  1YUU A;  4QJ4 B;  1GM0 A;  1RK9 A;  4KYN A;  1XFX O;  2M0R A;  1FPW A;  3CLN A;  3CYZ A;  4AOM A;  2CT9 A;  4PE0 A;  1F8H A;  3RLZ A;  2JPO A;  1KWO C;  1Y0V H;  2Y1M A;  4NDB A;  5AER A;  2PRU A;  1DF0 B;  3TDZ A;  1KCY A;  2JTT A;  2MA2 A;  2LNK A;  1CDP A;  3PN7 C;  1K8U A;  1HT9 A;  1EXR A;  2O60 A;  3CAB A;  4M2O A;  2EC6 B;  1KSO A;  2KDH A;  3DVM A;  1CKK A;  3OX6 A;  2ZNE A;  4PAL A;  1LKJ A;  2H61 A;  3FWB A;  3I5G C;  3SG5 A;  1Y1U A;  1JC2 A;  1J1E A;  3R1O A;  1CLB A;  3OBV A;  3JVT B;  3BQ3 A;  2BKI B;  4ICB A;  1NX1 A;  2LHL A;  1JF0 A;  1OQP A;  2M7L A;  2L0P A;  1WY9 A;  2L4H A;  1KFX L;  2E6W A;  4GGF A;  3TUY B;  4CFQ A;  1SPY A;  5CSJ A;  3AAK A;  4OKH A;  3EVV A;  1B7T Y;  2WOR A;  5HKZ A;  2NCO A;  4MRX A;  2ZKM X;  3BFA A;  3SG2 A;  1KQM C;  1UP5 A;  1GGZ A;  2BBM A;  3OB2 B;  3OX5 A;  2COL B;  3SG3 A;  5EL2 A;  4MBE A;  4HRG A;  2GGM A;  4YGC B;  5I8N A;  2L2E A;  5HLO A;  3LL8 B;  2KAY A;  2KAV A;  5B8I B;  3BFH A;  1QX2 A;  1DQE A;  2B1U A;  1WLZ A;  3VGO A;  4MZK A;  4A4C A;  1PSR A;  3S0G A;  1YVL A;  1IH0 A;  2DOQ A;  1DJH A;  1N0Y A;  1TNP A;  2LP3 A;  3C1V A;  3BOW A;  3F45 A;  5FI6 A;  3UNW A;  1ODB A;  2WOS A;  1TRF A;  4HSZ A;  1TCO B;  2LE9 B;  3O78 A;  1AUI B;  2SAS A;  5DKQ A;  1PK0 D;  1F4O A;  1JUO A;  1J7P A;  2WCL A;  1PUL A;  4DIR A;  2CNP A;  3R72 A;  2LHI A;  1X02 A;  1ZAC A;  1LXF C;  1U5I A;  3BFB A;  4I5N B;  5PAL A;  1K93 D;  1SKT A;  3RM1 A;  4PE4 A;  2FOT A;  1R2U A;  2JT3 A;  3BUN B;  3WNX B;  3LCP C;  3NSK A;  3PLF B;  1NWD A; 
#chains in the Genus database with same CATH homology
 1C07 A;  2MLE C;  4OV2 A;  1YX8 A;  2E30 A;  1ZFS A;  1EG4 A;  1XFY O;  2I7A A;  2JZI A;  2HF5 A;  1ALW A;  4WQ3 A;  1AK8 A;  4MN0 A;  4C0L A;  3M0W A;  2M1K B;  4GGN A;  5D7F A;  1B47 A;  4CPV A;  1GQM A;  1SCV A;  1TTX A;  1QLS A;  2D8N A;  1TIZ A;  2LMT A;  2GGZ A;  4JPZ B;  3LK0 A;  2K7C A;  1LVC D;  3TS5 B;  4R1E A;  3EK4 A;  2HPS A;  5JJG A;  5K89 A;  1E8A A;  4GUK A;  1M31 A;  1XFU O;  2LLU A;  1TCF A;  3SJS A;  2M1U A;  1D1O A;  1WRL A;  1OMD A;  1SL9 A;  2F3Y A;  1KK7 Y;  3E3R A;  1TNX A;  3I5I C;  4FQO A;  1M45 A;  2LC5 A;  1IGV A;  4FTG A;  3SIA A;  3I5H B;  1UHI A;  1OOJ A;  1K90 D;  1S26 D;  2KFH A;  2H61 C;  2L51 A;  2JC2 A;  3OP0 A;  3PM8 A;  1DJY A;  5TNC A;  3D0Y B;  4OVN F;  1SCM C;  2EHB A;  2P6B B;  2WC8 A;  2HQ8 A;  1YVH A;  1L2O C;  1TNQ A;  1CDN A;  1PSB A;  1WRZ A;  4JQ0 D;  1C7V A;  2KFF A;  1DGU A;  1CFD A;  4WQ2 A;  2G2B A;  1LA3 A;  2MLF C;  3OB1 B;  3FS7 A;  4IL1 A;  4GBA A;  4ORB B;  1NCY A;  1WDC C;  2PAL A;  4ORA B;  1IJ5 A;  4DRW A;  4CLN A;  1KK7 Z;  2F2P A;  4HRH A;  1XYD A;  2JNF A;  1TOP A;  1A29 A;  1MUX A;  4PHJ A;  4C0J A;  2L5X B;  1QVI Z;  3O2P A;  4N5X A;  2LUX A;  2GV5 A;  1BOC A;  1KK8 B;  1PAL A;  4OCI A;  3EVR A;  2BEC A;  2KI6 D;  3KEV A;  4CID A;  1KQV A;  1CM1 A;  1PRW A;  2BCA A;  1W7I B;  1NSH A;  2BE4 A;  2FCE A;  1CNP A;  3PFV A;  1AVS A;  1YUS A;  2NCP A;  1DTL A;  5J3X A;  2H2K A;  3KPX A;  4MVF A;  3CWG A;  1SR6 C;  4YBH B;  1XFZ O;  2Q4U A;  2ISD A;  2NXQ A;  1J55 A;  4BY5 A;  4YI8 A;  1MXE A;  2JXL A;  1NCZ A;  2K7O A;  2KI4 B;  5KTY A;  1CFC A;  2KQ6 A;  1XFW O;  1CLM A;  2HQW A;  1BR1 B;  4YI9 A;  4XJK B;  3BYA A;  2FJU B;  1QV1 A;  1WLM A;  5I2O A;  3NXA A;  1S6J A;  2JXC A;  1SL7 A;  1FI6 A;  2A4J A;  1J7Q A;  2BCX A;  3A4U B;  4MZJ A;  1LIN A;  2LUC A;  2JTZ A;  3BUX B;  3I5F B;  1IWQ A;  1K9U A;  1F4Q A;  4WRI A;  4GNK B;  1B9A A;  1XO5 A;  5JOL A;  1AP4 A;  4N1G A;  1YR5 A;  4U8D A;  2LAP A;  3VRN A;  2BCB A;  2L98 A;  3EK8 A;  2WCB A;  2PVB A;  1DT7 B;  1SY9 A;  2BKH B;  1QX7 A;  5AAN A;  1A75 B;  1RWY A;  3A8R A;  3AKB A;  1M63 B;  5KU1 A;  1IG5 A;  1BJF A;  5G08 A;  1V1F A;  2BBN A;  4I5L B;  2EGD A;  3EKJ A;  4I5J A;  2MRD A;  1BT6 A;  3OHM B;  3H4S E;  1J7O A;  1EH2 A;  1XA5 A;  2LV7 A;  4P5O E;  2K0J A;  1FF1 A;  1PVA A;  2JU0 A;  4DS7 A;  5HKY A;  2KOT A;  1B7T Z;  2F3Z A;  2BL0 B;  3CR4 X;  1JWD A;  3ZNI A;  1BG1 A;  2F33 A;  3EKH A;  1CFF A;  3GK4 X;  5I2Q A;  1N2D A;  1OMR A;  4DCK A;  2KSP A;  1B8R A;  4USL A;  1ALV A;  2EC6 C;  3PSR A;  2AMI A;  2KFG A;  4NDC A;  1ZMZ A;  1F71 A;  1FBV A;  1YX7 A;  2K7B A;  2MAZ A;  1CDM A;  2I94 A;  3DF0 B;  2KI4 C;  3D0Y A;  4N1F A;  3JVT C;  1J7R A;  2LAN A;  5CPV A;  1IRJ A;  2SCP A;  2JWW A;  1EG3 A;  2LP2 A;  3CZT X;  1K2H A;  2MJW B;  4ORC B;  5CSI A;  4MSP A;  1QIV A;  1CMF A;  2JT0 A;  3TUY C;  5CSF A;  1FW4 A;  1SW8 A;  3SIB A;  3BUW B;  3I5F C;  1UUS A;  3JTD B;  1G8I A;  2KHN A;  1DJG A;  4GPL B;  3WXA A;  2I18 A;  1UHK A;  1YRT B;  2PSR A;  3ICB A;  5IBW A;  3HCM A;  1SK6 D;  2OS8 B;  3NSL A;  3AAJ A;  2F2O A;  2ZFD A;  2TN4 A;  2CCM A;  2LVJ A;  2L50 A;  1KFU L;  1SYM A;  2M8U A;  1CFP A;  1B8L A;  2JOJ A;  4XYN A;  5BPJ A;  1JF2 A;  1BOD A;  1KWO B;  3FWC A;  4YGD B;  1CLL A;  1JFK A;  3CS1 A;  1Y6W A;  1K94 A;  1KSM A;  3CR5 X;  4YGB B;  1S6I A;  1K95 A;  1J1D A;  1DF0 A;  4PDZ A;  1R6P A;  3PN7 B;  2LMV A;  2MHH A;  3EK7 A;  2JT8 A;  2JRF A;  2KYC A;  3IF7 A;  1OZS A;  1XVJ A;  2RGI A;  1F70 A;  1Q80 A;  2IS9 A;  3O4Y A;  2QAC A;  3I5G B;  3GK1 A;  4MEW A;  4PE1 A;  4PHN A;  2MBX A;  2NZ0 A;  2ZN9 A;  1MQ1 A;  1YUT A;  1V1G A;  5HLV A;  1F55 A;  1W7J B;  1ZUZ A;  3PAT A;  4UPG A;  4OR9 B;  3WHT B;  4XJK A;  1A4P A;  1M39 A;  1NCX A;  2LMU A;  3AKA A;  3VRR A;  1GGW A;  1NX2 A;  1S1E A;  1IQ3 A;  2K61 A;  4L9M A;  1YRU B;  1DMO A;  1SNL A;  4Q04 A;  4PHK A;  3TS5 C;  5AEQ A;  1TNW A;  4D1E A;  4MZL A;  2KBM A;  1WRK A;  1GJY A;  3ZWH A;  2PAS A;  1BLQ A;  1MWN A;  2OS8 C;  4ZCU A;  3SG7 A;  5ER4 X;  3DVK A;  3I5H C;  5DKR A;  2KI6 C;  1VRK A;  1SRA A;  3KF9 A;  3D10 A;  1S36 A;  4QJ5 B;  2K2F A;  1S3P A;  3TDU A;  2ZN8 A;  1BR4 B;  1MXL C;  2OTG B;  3TZ1 A;  4I5K A;  2VRG A;  2LVI A;  1QJT A;  2R2I A;  1DVI A;  2LM5 A;  1B8C A;  1RFJ A;  3DD4 A;  4PCW A;  1YTZ C;  1UHH A;  4GFT A;  2FCD A;  2KGB C;  1TN4 A;  1AJ4 A;  1N65 A;  1DJZ A;  3EVU A;  1QXP A;  4YGA A;  1H8B A;  2I2R E;  3DF0 A;  2O5G A;  3VRQ A;  1NPQ A;  1XK4 C;  4JWQ A;  1SMG A;  4C0K A;  1ZOT B;  2CXJ A;  2LVK A;  1NUB A;  1KK8 C;  1QX5 B;  2Y1N A;  3LLE A;  1QV0 A;  2L4I A;  3DVJ A;  4ZCV A;  2JPT A;  2K7D A;  4AQI A;  1NX3 A;  1DGV A;  3I5I B;  1KFX S;  1G33 A;  2M3W A;  1OE9 B;  1K9K A;  2F8P A;  4CFR A;  1Y1X A;  4MRY A;  2V53 A;  3IQQ A;  1LA0 A;  3IQO A;  1UWO A;  2KGR A;  3QRX A;  1SCM B;  4AQJ A;  2WCF A;  3SG4 A;  1QLK A;  1REC A;  1PVB A;  2NLN A;  5AXI A;  4A4B A;  2OTG C;  1L2O B;  4BY4 A;  2LLS A;  3O6B A;  3PAL A;  1DJI A;  4M2P A;  5ER5 A;  3VRO A;  1JBA A;  2K8M B;  5D69 A;  1S6C A;  2AAO A;  2LVV A;  1FI5 A;  3CR2 A;  1WDC B;  3HX4 A;  1XFV O;  1RRO A;  1G4Y R;  2KQY A;  3K21 A;  5KSZ A;  1CMG A;  1AJ5 A;  1RTP 1;  1K96 A;  2M9G A;  3NSO A;  4M2Q A;  5FYX A;  2M7N A;  1S5G Y;  1DJW A;  1XK4 A;  2CBL A;  2CTN A;  1OZO A;  4ETO A;  3GK2 A;  2KNE A;  1NP8 A;  3BXK A;  2HET A;  1A2X A;  1QTX A;  2M29 A;  2WND A;  1UHJ A;  2LCP A;  1QS7 A;  1CM4 A;  2WCE A;  2PMY A;  2JNX A;  3KHE A;  5HYD A;  3BOW B;  1JFJ A;  3DVE A;  4YGE B;  2AUC A;  3CGA A;  1AHR A;  1SBJ A;  1SL8 A;  1L7Z A;  4YRU A;  2JUL A;  1NYA A;  3VRP A;  1BMO A;  1H4B A;  1M46 A;  1OSA A;  5I2L A;  2JQ6 A;  1YUR A;  1U5I B;  2ZND A;  2ZRS A;  4DUQ A;  1EL4 A;  5HKW A;  1IKU A;  1DJX A;  3LK1 A;  1SR6 B;  4E68 A;  2BL0 C;  2QPT A;  1CTR A;  3GOF A;  2G9B A;  3KO0 A;  3TDI A;  1IQ5 A;  1QVI Y;  1QIW A;  1S5G Z;  2BE6 A;  4P2Y B;  1B1G A;  3FIA A;  4MLW A;  1BF5 A;  2KYF A;  1BU3 A;  4QJ3 B;  3SG6 A;  2K2A A;  1CB1 A;  1IJ6 A;  1UUR A;  2M97 A;  5GQQ C;  1K9P A;  1MHO A;  2Q91 A;  4HRE E;  2KBI A;  1RJV A;  5F6T A;  3CTN A;  1F54 A;  5CSN A;  2LLT A;  2Y5I A;  1KFU S;  1OMV A;  3MSE B;  2KAX A;  4GGF C;  5DKN A;  1KQM B;  1B4C A;  1HQV A;  1QAS A;  1CDL A;  1Y1A A;  1A03 A;  1NX0 A;  3BUO B;  4NQG A;  1MR8 A;  4NDD A;  4PE7 A;  5AFP A;  3JTD C;  1MF8 B;  1JSA A;  3BUM B;  4TNC A;  1A75 A;  1C7W A;  2Y4Q A;  1QAT A;  2ZRT A;  1NIW A;  2M49 B;  4GAO A;  3WHU B;  3NSI A;  1EJ3 A;  2OPO A;  4PHM A;  4F0Z B;  1UHN A;  1YUU A;  4QJ4 B;  1RK9 A;  1XFX O;  2M0R A;  1FPW A;  3CLN A;  4AOM A;  2CT9 A;  4PE0 A;  1F8H A;  3RLZ A;  5AER A;  1KWO C;  1Y0V H;  2Y1M A;  4NDB A;  2PRU A;  1DF0 B;  3TDZ A;  1KCY A;  2JTT A;  2MA2 A;  2LNK A;  1CDP A;  3PN7 C;  1K8U A;  1HT9 A;  1EXR A;  2O60 A;  4M2O A;  2EC6 B;  1KSO A;  2KDH A;  3DVM A;  1CKK A;  3OX6 A;  2ZNE A;  4PAL A;  1LKJ A;  2H61 A;  3FWB A;  3I5G C;  3SG5 A;  1Y1U A;  1JC2 A;  1J1E A;  1CLB A;  3JVT B;  3BQ3 A;  2BKI B;  4ICB A;  1NX1 A;  2LHL A;  1JF0 A;  1OQP A;  2M7L A;  2L0P A;  1WY9 A;  2L4H A;  1KFX L;  2E6W A;  4GGF A;  3TUY B;  4CFQ A;  1SPY A;  5CSJ A;  3AAK A;  4OKH A;  3EVV A;  1B7T Y;  2WOR A;  5HKZ A;  2NCO A;  4MRX A;  2ZKM X;  3SG2 A;  1KQM C;  1UP5 A;  1GGZ A;  2BBM A;  3OB2 B;  3OX5 A;  2COL B;  3SG3 A;  4MBE A;  4HRG A;  2GGM A;  4YGC B;  5I8N A;  2L2E A;  5HLO A;  3LL8 B;  2KAY A;  2KAV A;  5B8I B;  1QX2 A;  2B1U A;  1WLZ A;  3VGO A;  4MZK A;  4A4C A;  1PSR A;  1YVL A;  1IH0 A;  2DOQ A;  1DJH A;  1N0Y A;  1TNP A;  2LP3 A;  3C1V A;  3BOW A;  3F45 A;  1ODB A;  2WOS A;  1TRF A;  4HSZ A;  1TCO B;  2LE9 B;  3O78 A;  1AUI B;  2SAS A;  5DKQ A;  1PK0 D;  1F4O A;  1JUO A;  1J7P A;  1PUL A;  4DIR A;  2CNP A;  2LHI A;  1X02 A;  1ZAC A;  1LXF C;  1U5I A;  5PAL A;  4I5N B;  1K93 D;  1SKT A;  3RM1 A;  4PE4 A;  2FOT A;  1R2U A;  2JT3 A;  3BUN B;  3WNX B;  3LCP C;  3NSK A;  3PLF B;  1NWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...