1SW8A

Solution structure of the n-terminal domain of human n60d calmodulin refined with paramagnetism based strategy
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding protein
molecule keywords Calmodulin
publication title Experimentally exploring the conformational space sampled by domain reorientation in calmodulin
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1sw8A00
3EKJA 2BECA 2JWWA 2V53A 5CPVA 2WCBA 1SMGA 1JWDA 3RM1A 2KI4C 4C0JA 3SIAA 1TNXA 1FF1A 1R6PA 1B4CA 2BBNA 2JXLA 5F6TA 1PALA 2BCXA 3BUOB 2MHHA 4YGEB 1F4QA 1F8HA 2NCPA 3CWGA 3NSKA 2A4JA 1ZOTB 3GOFA 1OMVA 5HKYA 1WLMA 3CGAA 1QV0A 4M2PA 4DUQA 1DJXA 1AP4A 5I2QA 1KWOC 4HRHA 2FJUB 4WQ2A 5FYXA 2LP2A 3BOWA 2HQ8A 1JFJA 1NCYA 2QPTA 1C7WA 1NWDA 4GNKB 5I2OA 1SCMB 4MZJA 3EK4A 3PALA 2K7CA 1NX3A 1JUOA 2KOTA 1LA3A 2OPOA 1CM1A 1BMOA 3A4UB 1BR1B 1BT6A 1OMDA 2L98A 2JNFA 2KYCA 3AAJA 1Q80A 2CT9A 4M2OA 4C0KA 4YGDB 1A03A 3E3RA 1IQ3A 1AHRA 2D8NA 3CS1A 1UHNA 1D1OA 1CLMA 4R1EA 2K7DA 3I5GC 1WDCB 1B7TZ 2I2RE 2LVVA 1S1EA 1AUIB 4OVNF 4GGNA 5G08A 2O60A 4UPGA 5TNCA 4F0ZB 1QIVA 3BUNB 1M46A 1FI5A 4OCIA 1AJ5A 3BYAA 3I5FB 3I5IB 1KSOA 2EC6B 3EKHA 1LINA 1R2UA 5DKRA 1CNPA 1IG5A 1ZACA 1RK9A 1XYDA 2LCPA 1ZFSA 1Y1UA 1X02A 3IF7A 3PN7C 2G2BA 1NX1A 3O6BA 3NSIA 1FW4A 1K8UA 2KGRA 4HREE 3WNXB 5HLOA 2ZFDA 2PALA 4YRUA 4MZLA 3F45A 1Y1AA 3D10A 2BE6A 2OTGC 1TRFA 2Q91A 4ETOA 3LK0A 2COLB 2LNKA 1F71A 1RECA 1CFDA 1ALVA 1B47A 1W7JB 1LXFC 1KWOB 1OQPA 1A4PA 4JQ0D 4XJKA 1SCMC 1QVIZ 1S3PA 5AFPA 2GV5A 2K61A 2M97A 1DJZA 5GQQC 1K95A 1UP5A 3KPXA 1K9PA 4PDZA 1RWYA 2EHBA 3SIBA 1ZUZA 5D69A 4GAOA 4MRYA 3D0YA 1ZMZA 4PHMA 5PALA 4FTGA 4DRWA 1NCZA 2M9GA 1MUXA 2HQWA 1YTZC 1SNLA 4JPZB 2KSPA 2LUCA 1G8IA 1KK7Z 4YI8A 3PM8A 3KHEA 4C0LA 3MSEB 1CFFA 2L2EA 1EG3A 1A29A 1FBVA 2LVKA 2M1KB 3PLFB 3I5GB 1BF5A 4YGCB 3KEVA 3SG6A 1KFXS 1XFUO 2BL0C 3IQQA 4PE4A 2BKIB 1EL4A 3DVKA 2G9BA 3TDUA 1Y0VH 5BPJA 3NSOA 1DVIA 1K96A 1NIWA 2FCDA 3OHMB 3OX6A 5JOLA 1GQMA 1H8BA 4P2YB 1JC2A 1YX7A 1DGVA 1ODBA 2L4HA 2DOQA 5KSZA 1CDMA 3JTDC 3OX5A 1TN4A 3JVTB 4PE0A 1NP8A 4NDBA 2QACA 3BUWB 2R2IA 1J1EA 1CDLA 1DF0B 1XFZO 1B8LA 2MLEC 1MQ1A 1YUTA 2AMIA 2BCAA 1YR5A 3LL8B 1V1GA 2B1UA 1SL9A 2BBMA 3PN7B 2GGMA 2JQ6A 5KTYA 3C1VA 1S5GZ 1TCFA 2Y1NA 4N1GA 1DJHA 1QS7A 1XFYO 3FWCA 1RROA 2OTGB 4MBEA 4CFQA 4XYNA 3AAKA 2AUCA 3BUMB 1UHIA 3VROA 1IRJA 1SR6C 1TTXA 1MXLC 2AAOA 2CBLA 1BJFA 1UUSA 2ZKMX 2JTTA 3AKBA 4M2QA 2M29A 3ZWHA 1C7VA 1CFPA 4PALA 2KBIA 4P5OE 1XK4A 2OS8B 1E8AA 1KFXL 2I94A 4ORAB 1QTXA 2F2OA 3EVVA 3NXAA 1XK4C 2WCEA 3CR5X 4XJKB 2PASA 3GK2A 1TNQA 1KQVA 2KHNA 3RLZA 1QV1A 2CNPA 2ZRTA 1MR8A 5HLVA 2M7LA 1M39A 3SG3A 3D0YB 1U5IB 1OSAA 1QLSA 1ALWA 2LVJA 1M63B 1F4OA 4OKHA 1XA5A 1CTRA 1YRUB 2Q4UA 4GPLB 3EVRA 2LP3A 1J7QA 4YGAA 2LHLA 4E68A 1BODA 2F2PA 3CZTX 1FI6A 2E6WA 2BL0B 1UURA 3HX4A 1QX2A 3BQ3A 1XFVO 2JXCA 1KCYA 3DVJA 2MA2A 4GBAA 4A4BA 5CSIA 1DF0A 2MRDA 3JVTC 2LLSA 4HRGA 1K9UA 2F3YA 1EG4A 1XFWO 1UHHA 1SL7A 1KK8B 2K0JA 2K7OA 2Y1MA 3JTDB 1NX2A 2TN4A 3TUYC 1YVLA 4GUKA 1RTP1 2O5GA 3ZNIA 1WY9A 1DT7B 1LKJA 2H2KA 2FOTA 2HETA 2LMVA 2RGIA 3VRPA 1IGVA 3OP0A 3SG7A 2K7BA 2LVIA 4PCWA 5HYDA 4HSZA 2M3WA 2L5XB 3TS5B 3VRRA 1IWQA 4NDDA 1BG1A 1YVHA 2JZIA 3BUXB 1GJYA 4WRIA 2I18A 1SR6B 4ZCVA 4CFRA 1N65A 5ER4X 2OS8C 1N0YA 1FPWA 3FIAA 1Y1XA 2Y4QA 5B8IB 1IKUA 4IL1A 1S6JA 5DKNA 1CB1A 1TNWA 1KSMA 1TOPA 2BCBA 5CSJA 3WHUB 4D1EA 1A2XA 2ZN8A 1CKKA 2H61A 1QLKA 1NSHA 2WOSA 1DJIA 2H61C 1U5IA 2LMTA 4CPVA 1DMOA 1MF8B 1WLZA 3CLNA 4ZCUA 4AQJA 3TZ1A 4MSPA 2PVBA 1AJ4A 1DJYA 1PVAA 4YI9A 4CIDA 5JJGA 2NLNA 1WRKA 1CDPA 1SKTA 3O4YA 3I5HB 4MVFA 4JWQA 4OR9B 2LMUA 2SASA 2E30A 2LLUA 1B8CA 2KBMA 3DVMA 1OZOA 1H4BA 3TDZA 1HQVA 1W7IB 4QJ5B 2GGZA 2JT8A 2PMYA 1YUSA 1BR4B 3CTNA 3DF0B 1N2DA 1JF2A 1B7TY 1TNPA 2ZRSA 1KK8C 1IJ5A 1QX7A 1SK6D 4YBHB 1EXRA 5CSNA 2CCMA 4GFTA 3LK1A 4QJ4B 2LE9B 3TUYB 1S26D 4NDCA 2PSRA 2JC2A 5AERA 3TDIA 1OZSA 1S6CA 1M45A 3OB1B 1QATA 1OOJA 1PRWA 1HT9A 4PHJA 5I2LA 1UHKA 2WORA 1MHOA 3TS5C 1BLQA 1CLBA 3EVUA 2MLFC 1KFUS 3A8RA 4N1FA 1EJ3A 3LCPC 3FWBA 4ORBB 2JPTA 1PVBA 3IQOA 4GGFA 1G33A 3WXAA 1L7ZA 3KF9A 4PHKA 1Y6WA 1DJWA 3QRXA 2L50A 4GGFC 4AQIA 1GGWA 2KFHA 3DVEA 4MLWA 4Q04A 2M8UA 3EK8A 5AXIA 3CR2A 1DGUA 2JNXA 3H4SE 4MRXA 4MZKA 4I5NB 5AEQA 5I8NA 3PSRA 1QVIY 1RFJA 1SPYA 1TIZA 2NXQA 4BY5A 2JU0A 1UHJA 1VRKA 4I5KA 1XO5A 1YX8A 3HCMA 4DS7A 1EH2A 1K9KA 1IJ6A 2F33A 3OB2B 1B1GA 3I5HC 4QJ3B 1KQMC 1L2OC 1QIWA 1JF0A 3CR4X 3KO0A 5AANA 1CFCA 1XFXO 4BY4A 5KU1A 1NCXA 1A75B 1SW8A 1CDNA 4USLA 1KFUL 2HPSA 3VGOA 1IH0A 3DF0A 2P6BB 4FQOA 1CLLA 1KK7Y 1J55A 1QX5B 1K90D 1QJTA 1GGZA 2F8PA 4DIRA 5IBWA 2KI6C 5HKZA 4PHNA 1MWNA 3FS7A 3O78A 4PE7A 3WHTB 1DTLA 4ICBA 2ZN9A 1SCVA 4L9MA 1DJGA 1NYAA 1CM4A 1CMGA 1SL8A 1JBAA 2HF5A 2ZNEA 1J7RA 4PE1A 5CSFA 4NQGA 1IQ5A 1K93D 2WCFA 2ZNDA 1XVJA 5HKWA 2LANA 5K89A 2LAPA 4A4CA 1V1FA 2KQYA 2WNDA 1YUUA 1NX0A 2LM5A 2M49B 1MXEA 3GK4X 2LHIA 1AVSA 1QXPA 2LV7A 2K8MB 4ORCB 3SG5A 1S5GY 2KI4B 2BKHB 3VRNA 3VRQA 2F3ZA 2KFFA 4OV2A 3BXKA 2JOJA 4MN0A 2L4IA 1YRTB 2KAXA 1S6IA 1WRZA 1NPQA 2WC8A 2L0PA 2KGBC 1J7PA 3PFVA 3EK7A 2BE4A 5J3XA 2KFGA 1SY9A 1JFKA 2MBXA 2NCOA 3PATA 4WQ3A 2MJWB 1PK0D 4AOMA 2JRFA 1LA0A 1B9AA 1F54A 1PULA 1PSBA 2LUXA 1A75A 4U8DA 1NUBA 2KYFA 1KQMB 1L2OB 2K2FA 1RJVA 1CMFA 3BOWB 1F55A 3K21A 3SG4A 1BOCA 2KAYA 1J7OA 2JT0A 5ER5A 1S36A 4CLNA 4N5XA 3LLEA 1C07A 2EGDA 3M0WA 3SG2A 3SJSA 2LC5A 4I5JA 1SBJA 2ISDA 1BU3A 2SCPA 3AKAA 1G4YR 1K2HA 4TNCA 2MAZA 3NSLA 4MEWA 2JULA 1WRLA 1QASA 2KDHA 2CXJA 2I7AA 2JT3A 1J1DA 1SRAA 1PSRA 4YGBB 4DCKA 2FCEA 2KNEA 1WDCC 2M7NA 2LLTA 3GK1A 5D7FA 2K2AA 1AK8A 2NZ0A 2L51A 2VRGA 1OE9B 2KAVA 2M0RA 2IS9A 2JTZA 3O2PA 2KI6D 1OMRA 1UWOA 5DKQA 2CTNA 1SYMA 1YURA 2M1UA 4I5LB 1F70A 2Y5IA 1B8RA 2PRUA 1TCOB 1LVCD 3I5IC 2KQ6A 3I5FC 3ICBA 1JSAA 2EC6C 1K94A 3DD4A 1M31A
chains in the Genus database with same CATH superfamily
3EKJA 2BECA 2JWWA 2V53A 5CPVA 2WCBA 1SMGA 1JWDA 3RM1A 2KI4C 4C0JA 3SIAA 1TNXA 1FF1A 1R6PA 3L47A 1B4CA 2BBNA 2JXLA 3DYEA 5F6TA 1PALA 2BCXA 3BUOB 2MHHA 4YGEB 1F4QA 1F8HA 2NCPA 3CWGA 3NSKA 2A4JA 3R1PA 1ZOTB 3GOFA 1OMVA 5HKYA 1WLMA 3CGAA 1QV0A 4M2PA 4DUQA 1DJXA 1AP4A 5I2QA 1KWOC 4HRHA 2FJUB 5HL1A 4WQ2A 5FYXA 2LP2A 3BOWA 2HQ8A 1JFJA 3R1VA 1SSEB 4OZDA 1NCYA 2QPTA 1C7WA 1NWDA 4GNKB 5I2OA 1OOGA 1SCMB 4MZJA 3EK4A 3PALA 3DXLA 4FQTA 2K7CA 1NX3A 1JUOA 3OBVA 2KOTA 3D73A 1LA3A 1OOIX 3DZTA 2OPOA 1CM1A 1BMOA 3A4UB 2QEVA 1BR1B 1BT6A 1IIOA 1OMDA 2L98A 3PJIA 2JNFA 2KYCA 3AAJA 3UO9A 1Q80A 3UNWA 1Z2CB 2CT9A 4M2OA 2P71A 4C0KA 4YGDB 1A03A 2YGUA 3E3RA 1IQ3A 2KLDA 1AHRA 2D8NA 3CS1A 1UHNA 3FE9A 1CLMA 1D1OA 4R1EA 2K7DA 3I5GC 1WDCB 1B7TZ 2I2RE 2LVVA 3D74A 1S1EA 1AUIB 1P28A 4OVNF 3S0DA 4GGNA 5G08A 2O60A 4UPGA 5TNCA 4F0ZB 1QIVA 3BUNB 2WCHA 1M46A 3VB1A 1FI5A 4OCIA 1AJ5A 3BYAA 3I5FB 3I5IB 1KSOA 2EC6B 3EKHA 3CZ2A 1LINA 1R2UA 5DKRA 1CNPA 1IG5A 1ZACA 1RK9A 1XYDA 2LCPA 1ZFSA 3V2LA 1Y1UA 1X02A 3IF7A 3PN7C 2G2BA 3BFBA 1NX1A 3K1EA 3O6BA 3NSIA 1FW4A 1K8UA 2KGRA 4HREE 2KPHA 5HLOA 2ZFDA 2PALA 3WNXB 4MZLA 4YRUA 3F45A 1Y1AA 3D10A 2BE6A 2OTGC 1TRFA 2Q91A 2BNXA 4ETOA 3LK0A 2COLB 2LNKA 3BFHA 1F71A 1RECA 1CFDA 1ALVA 1B47A 1W7JB 1LXFC 1KWOB 2BAPA 1OQPA 1A4PA 3SS3A 4JQ0D 4XJKA 1SCMC 1QVIZ 1S3PA 5AFPA 2GV5A 2K61A 2M97A 1DJZA 2JPOA 1K95A 1UP5A 3KPXA 1K9PA 3NGVA 5GQQC 3O4XA 2WCJA 4PDZA 1RWYA 2EHBA 3SIBA 1ZUZA 5D69A 4GAOA 4MRYA 3D0YA 1ZMZA 4PHMA 5PALA 4FTGA 4DRWA 1NCZA 2M9GA 1MUXA 2HQWA 1YTZC 1SNLA 3NHTA 4JPZB 2KSPA 2LUCA 1G8IA 1KK7Z 4YI8A 3PM8A 3KHEA 4C0LA 3MSEB 1CFFA 2L2EA 1EG3A 1A29A 1FBVA 2L2CA 2LVKA 2M1KB 3PLFB 3I5GB 1BF5A 4YGCB 3KEVA 3SG6A 1KFXS 1XFUO 2BL0C 5DICA 4JD9A 3IQQA 4PE4A 2BKIB 1EL4A 3DVKA 2G9BA 3TDUA 1Y0VH 5BPJA 1C3YA 3B86A 3NSOA 1DVIA 1K96A 1NIWA 2FCDA 3OHMB 3OX6A 3CABA 5JOLA 1GQMA 1H8BA 4P2YB 1JC2A 1YX7A 1DGVA 1ODBA 2H8VA 2L4HA 2DOQA 5KSZA 1CDMA 3JTDC 3OX5A 1TN4A 3JVTB 4PE0A 1NP8A 3CYZA 4NDBA 2QACA 3BUWB 2R2IA 1J1EA 1CDLA 1DF0B 1XFZO 1B8LA 2MLEC 1MQ1A 1YUTA 2AMIA 2BCAA 1YR5A 3LL8B 1V1GA 2B1UA 1SL9A 2BBMA 3PN7B 2GGMA 2JQ6A 5KTYA 3C1VA 1S5GZ 1TCFA 2Y1NA 4N1GA 1DJHA 1QS7A 1XFYO 2GTEA 1RROA 2OTGB 3FE8A 3FWCA 4MBEA 4CFQA 5I94A 4XYNA 3N7HA 3AAKA 2AUCA 3BFAA 1UHIA 3BUMB 3VROA 1DC1A 1IRJA 1SR6C 1TTXA 1MXLC 2AAOA 2CBLA 1BJFA 1UUSA 2ZKMX 2JTTA 3AKBA 4M2QA 2M29A 3ZWHA 1C7VA 1CFPA 4PALA 2KBIA 4P5OE 1XK4A 2OS8B 1E8AA 1KFXL 2I94A 4ORAB 1QTXA 2F2OA 3EVVA 3NXAA 1XK4C 1T14A 2WCEA 3CR5X 4XJKB 2PASA 3GK2A 1TNQA 1KQVA 2KHNA 3RLZA 3D76A 1TUZA 1QV1A 2CNPA 2FJYA 2L5YA 2ZRTA 1MR8A 5HLVA 3CZ1A 2M7LA 1M39A 3SG3A 3D0YB 1U5IB 1OSAA 1QLSA 3S0FA 1ALWA 5D3OA 2LVJA 1M63B 1F4OA 3SS5A 4OKHA 1XA5A 1CTRA 1YRUB 2Q4UA 4GPLB 3EVRA 2LP3A 1J7QA 3SS4A 4YGAA 2LHLA 4E68A 1BODA 2F2PA 3CZTX 1FI6A 2E6WA 5EL2A 2WCLA 2BL0B 1UURA 3HX4A 1QX2A 3BQ3A 1XFVO 2JXCA 1KCYA 3DVJA 2MA2A 4GBAA 2P70A 4A4BA 5CSIA 1W9ZA 1DF0A 2MRDA 1TWOA 3JVTC 1DELA 2LLSA 4HRGA 1K9UA 2F3YA 1EG4A 1XFWO 1UHHA 1SL7A 1KK8B 2K0JA 2K7OA 2Y1MA 3JTDB 1NX2A 2TN4A 3TUYC 1YVLA 4INWA 4GUKA 1RTP1 2O5GA 3S0EA 3ZNIA 1WY9A 1DT7B 1LKJA 2H2KA 2FOTA 2HETA 3DY9A 3R1OA 2LMVA 2RGIA 3VRPA 1IGVA 3OP0A 3SG7A 2K7BA 2WCMA 2LVIA 4PCWA 5HYDA 4HSZA 2M3WA 2L5XB 3TS5B 5FI6A 3VRRA 1IWQA 4NDDA 1BG1A 1YVHA 2JZIA 3BUXB 1GJYA 4WRIA 2I18A 1SR6B 4ZCVA 4CFRA 1N65A 1C3ZA 2OS8C 1N0YA 5ER4X 3FIAA 1FPWA 1Y1XA 2Y4QA 5B8IB 1IKUA 4IL1A 1S6JA 5DKNA 1CB1A 1TNWA 1KSMA 1TOPA 2BCBA 5CSJA 3WHUB 4D1EA 1A2XA 2ZN8A 1CKKA 2H61A 1QLKA 1NSHA 2WOSA 1DJIA 2H61C 3D78A 1U5IA 1ORGA 2LMTA 4CPVA 2KLEA 1MF8B 1WLZA 3CLNA 4ZCUA 1DMOA 4AQJA 3TZ1A 4MSPA 2PVBA 1AJ4A 1DJYA 1PVAA 3B87A 4YI9A 4CIDA 5JJGA 5FI7A 2NLNA 1WRKA 2PQLA 1CDPA 1SKTA 3O4YA 3I5HB 4MVFA 4JWQA 4OR9B 2PYQA 2LMUA 2SASA 4KYNA 2E30A 2LLUA 1B8CA 2KBMA 3DVMA 1OZOA 1H4BA 3TDZA 1HQVA 2K60A 1W7IB 4QJ5B 2GGZA 2QEOA 2JT8A 2PMYA 2QEBA 1YUSA 1BR4B 3CTNA 3DF0B 1N2DA 1JF2A 1B7TY 1TNPA 2ZRSA 1KK8C 1IJ5A 1QX7A 1SK6D 2ERBA 1EXRA 4YBHB 3QMEA 5CSNA 2CCMA 4GFTA 3S0GA 3LK1A 4QJ4B 2LE9B 3FE6A 3TUYB 1S26D 4NDCA 2PSRA 2JC2A 5AERA 3NHIA 2QDIA 1TUJA 3TDIA 1OZSA 1S6CA 1M45A 3OB1B 1QATA 1OOJA 1PRWA 1HT9A 4PHJA 5I2LA 1UHKA 2WORA 1MHOA 3TS5C 1BLQA 1CLBA 3EVUA 2MLFC 1KFUS 3A8RA 4N1FA 1EJ3A 3LCPC 3B7AA 3FWBA 3Q8IA 4ORBB 2JPTA 1PVBA 1XFRA 3L4LA 3IQOA 4GGFA 1G33A 3WXAA 1L7ZA 3KF9A 3RZSA 4PHKA 1Y6WA 1DJWA 3QRXA 2L50A 3CDNA 4GGFC 4AQIA 1GGWA 2KFHA 3DVEA 4MLWA 4Q04A 2M8UA 3EK8A 5AXIA 3CR2A 1DGUA 2JNXA 2WC6A 3H4SE 4MRXA 4MZKA 4I5NB 5AEQA 5I8NA 1LS8A 4JKTA 3PSRA 1QVIY 1RFJA 1SPYA 1TIZA 2NXQA 4BY5A 2JU0A 1UHJA 1VRKA 4I5KA 4INXA 1XO5A 1YX8A 3PM2A 3S0AA 3HCMA 4DS7A 1EH2A 1K9KA 1IJ6A 2F33A 3OB2B 1B1GA 3I5HC 4QJ3B 1KQMC 1L2OC 1QIWA 1JF0A 3CR4X 3KO0A 5AANA 1CFCA 1XFXO 1DEKA 4BY4A 5KU1A 1NCXA 1A75B 1SW8A 1CDNA 4USLA 2WCKA 1KFUL 2HPSA 3VGOA 1IH0A 3DF0A 2P6BB 4FQOA 1CLLA 1KK7Y 1J55A 1QX5B 2QEHA 1K90D 3L4AA 1QJTA 3CZ0A 1GGZA 2F8PA 4DIRA 3BJHA 1GM0A 5IBWA 4IJ7A 2KI6C 5HKZA 4PHNA 1MWNA 3FS7A 3O78A 4PE7A 3WHTB 1DTLA 4ICBA 2ZN9A 1SCVA 4L9MA 1DJGA 1NYAA 1CM4A 1CMGA 1QWVA 1SL8A 1JBAA 2HF5A 2ZNEA 1J7RA 4PE1A 5CSFA 3D75A 4NQGA 1IQ5A 1K93D 2WCFA 2ZNDA 1XVJA 3B88A 5HKWA 2LANA 5K89A 2LAPA 4A4CA 3R72A 1V1FA 2KQYA 3IVTA 2WNDA 1YUUA 1NX0A 2LM5A 2M49B 1MXEA 3GK4X 2LHIA 1AVSA 1QXPA 1DQEA 2K8MB 2LV7A 4ORCB 1S5GY 2KI4B 2BKHB 3SG5A 3VRNA 2F3ZA 3VRQA 2KFFA 4OV2A 3BXKA 2JOJA 4MN0A 2L4IA 1YRTB 2KAXA 1S6IA 1WRZA 1NPQA 2WC5A 2WC8A 2L0PA 2KGBC 1J7PA 3PFVA 3EK7A 2BE4A 5J3XA 2KFGA 1SY9A 1JFKA 2MBXA 2NCOA 3PATA 4WQ3A 2MJWB 1Z4HA 1PK0D 4AOMA 2JRFA 1LA0A 1B9AA 1F54A 1PULA 1PSBA 2LUXA 1A75A 4U8DA 1NUBA 2KYFA 1KQMB 1L2OB 2K2FA 1RJVA 1CMFA 3B6XA 3BOWB 3K21A 1F55A 3SG4A 1BOCA 2KAYA 1J7OA 2JT0A 5ER5A 1S36A 4CLNA 4N5XA 3LLEA 5FI2A 1C07A 2EGDA 3M0WA 3SG2A 3SJSA 2LC5A 4I5JA 1SBJA 2ISDA 1BU3A 2SCPA 3AKAA 1G4YR 1K2HA 4TNCA 2MAZA 3NSLA 4MEWA 2JULA 3D77A 1WRLA 1QASA 2KDHA 2CXJA 2I7AA 2JT3A 1J1DA 1SRAA 1PSRA 4YGBB 4DCKA 1OW4A 2FCEA 2KNEA 1WDCC 2M7NA 2LLTA 3GK1A 5D7FA 2K2AA 1AK8A 2NZ0A 2L51A 2VRGA 3S0BA 1OE9B 2KAVA 2M0RA 2IS9A 2JTZA 3O2PA 3EG5B 4PT1A 2KI6D 1OMRA 1UWOA 5DKQA 2CTNA 1SYMA 1YURA 2M1UA 4I5LB 3OGNA 1F70A 2Y5IA 1B8RA 2PRUA 1OOHA 1TCOB 1LVCD 3I5IC 2KQ6A 3I5FC 3ICBA 4F7FA 2EC6C 1JSAA 1OOFA 1K94A 3DD4A 1M31A
chains in the Genus database with same CATH topology
3EKJA 2BECA 2JWWA 2V53A 5CPVA 2WCBA 1SMGA 1JWDA 3RM1A 2KI4C 4C0JA 3SIAA 1TNXA 1FF1A 1R6PA 1B4CA 2BBNA 2JXLA 5F6TA 1PALA 2BCXA 3BUOB 2MHHA 4YGEB 1F4QA 1F8HA 2NCPA 3CWGA 3NSKA 2A4JA 1ZOTB 3GOFA 1OMVA 5HKYA 1WLMA 3CGAA 1QV0A 4M2PA 4DUQA 1DJXA 1AP4A 5I2QA 1KWOC 4HRHA 2FJUB 4WQ2A 5FYXA 2LP2A 3BOWA 2HQ8A 1JFJA 1NCYA 2QPTA 1C7WA 1NWDA 4GNKB 5I2OA 1SCMB 4MZJA 3EK4A 3PALA 2K7CA 1NX3A 1JUOA 2KOTA 1LA3A 2OPOA 1CM1A 1BMOA 3A4UB 1BR1B 1BT6A 1OMDA 2L98A 2JNFA 2KYCA 3AAJA 1Q80A 2CT9A 4M2OA 4C0KA 4YGDB 1A03A 3E3RA 1IQ3A 1AHRA 2D8NA 3CS1A 1UHNA 1D1OA 1CLMA 4R1EA 2K7DA 3I5GC 1WDCB 1B7TZ 2I2RE 2LVVA 1S1EA 1AUIB 4OVNF 4GGNA 5G08A 2O60A 4UPGA 5TNCA 4F0ZB 1QIVA 3BUNB 1M46A 1FI5A 4OCIA 1AJ5A 3BYAA 3I5FB 3I5IB 1KSOA 2EC6B 3EKHA 1LINA 1R2UA 5DKRA 1CNPA 1IG5A 1ZACA 1RK9A 1XYDA 2LCPA 1ZFSA 1Y1UA 1X02A 3IF7A 3PN7C 2G2BA 1NX1A 3O6BA 3NSIA 1FW4A 1K8UA 2KGRA 4HREE 3WNXB 5HLOA 2ZFDA 2PALA 4YRUA 4MZLA 3F45A 1Y1AA 3D10A 2BE6A 2OTGC 1TRFA 2Q91A 4ETOA 3LK0A 2COLB 2LNKA 1F71A 1RECA 1CFDA 1ALVA 1B47A 1W7JB 1LXFC 1KWOB 1OQPA 1A4PA 4JQ0D 4XJKA 1SCMC 1QVIZ 1S3PA 5AFPA 2GV5A 2K61A 2M97A 1DJZA 5GQQC 1K95A 1UP5A 3KPXA 1K9PA 4PDZA 1RWYA 2EHBA 3SIBA 1ZUZA 5D69A 4GAOA 4MRYA 3D0YA 1ZMZA 4PHMA 5PALA 4FTGA 4DRWA 1NCZA 2M9GA 1MUXA 2HQWA 1YTZC 1SNLA 4JPZB 2KSPA 2LUCA 1G8IA 1KK7Z 4YI8A 3PM8A 3KHEA 4C0LA 3MSEB 1CFFA 2L2EA 1EG3A 1A29A 1FBVA 2LVKA 2M1KB 3PLFB 3I5GB 1BF5A 4YGCB 3KEVA 3SG6A 1KFXS 1XFUO 2BL0C 3IQQA 4PE4A 2BKIB 1EL4A 3DVKA 2G9BA 3TDUA 1Y0VH 5BPJA 3NSOA 1DVIA 1K96A 1NIWA 2FCDA 3OHMB 3OX6A 5JOLA 1GQMA 1H8BA 4P2YB 1JC2A 1YX7A 1DGVA 1ODBA 2L4HA 2DOQA 5KSZA 1CDMA 3JTDC 3OX5A 1TN4A 3JVTB 4PE0A 1NP8A 4NDBA 2QACA 3BUWB 2R2IA 1J1EA 1CDLA 1DF0B 1XFZO 1B8LA 2MLEC 1MQ1A 1YUTA 2AMIA 2BCAA 1YR5A 3LL8B 1V1GA 2B1UA 1SL9A 2BBMA 3PN7B 2GGMA 2JQ6A 5KTYA 3C1VA 1S5GZ 1TCFA 2Y1NA 4N1GA 1DJHA 1QS7A 1XFYO 3FWCA 1RROA 2OTGB 4MBEA 4CFQA 4XYNA 3AAKA 2AUCA 3BUMB 1UHIA 3VROA 1IRJA 1SR6C 1TTXA 1MXLC 2AAOA 2CBLA 1BJFA 1UUSA 2ZKMX 2JTTA 3AKBA 4M2QA 2M29A 3ZWHA 1C7VA 1CFPA 4PALA 2KBIA 4P5OE 1XK4A 2OS8B 1E8AA 1KFXL 2I94A 4ORAB 1QTXA 2F2OA 3EVVA 3NXAA 1XK4C 2WCEA 3CR5X 4XJKB 2PASA 3GK2A 1TNQA 1KQVA 2KHNA 3RLZA 1QV1A 2CNPA 2ZRTA 1MR8A 5HLVA 2M7LA 1M39A 3SG3A 3D0YB 1U5IB 1OSAA 1QLSA 1ALWA 2LVJA 1M63B 1F4OA 4OKHA 1XA5A 1CTRA 1YRUB 2Q4UA 4GPLB 3EVRA 2LP3A 1J7QA 4YGAA 2LHLA 4E68A 1BODA 2F2PA 3CZTX 1FI6A 2E6WA 2BL0B 1UURA 3HX4A 1QX2A 3BQ3A 1XFVO 2JXCA 1KCYA 3DVJA 2MA2A 4GBAA 4A4BA 5CSIA 1DF0A 2MRDA 3JVTC 2LLSA 4HRGA 1K9UA 2F3YA 1EG4A 1XFWO 1UHHA 1SL7A 1KK8B 2K0JA 2K7OA 2Y1MA 3JTDB 1NX2A 2TN4A 3TUYC 1YVLA 4GUKA 1RTP1 2O5GA 3ZNIA 1WY9A 1DT7B 1LKJA 2H2KA 2FOTA 2HETA 2LMVA 2RGIA 3VRPA 1IGVA 3OP0A 3SG7A 2K7BA 2LVIA 4PCWA 5HYDA 4HSZA 2M3WA 2L5XB 3TS5B 3VRRA 1IWQA 4NDDA 1BG1A 1YVHA 2JZIA 3BUXB 1GJYA 4WRIA 2I18A 1SR6B 4ZCVA 4CFRA 1N65A 5ER4X 2OS8C 1N0YA 1FPWA 3FIAA 1Y1XA 2Y4QA 5B8IB 1IKUA 4IL1A 1S6JA 5DKNA 1CB1A 1TNWA 1KSMA 1TOPA 2BCBA 5CSJA 3WHUB 4D1EA 1A2XA 2ZN8A 1CKKA 2H61A 1QLKA 1NSHA 2WOSA 1DJIA 2H61C 1U5IA 2LMTA 4CPVA 1DMOA 1MF8B 1WLZA 3CLNA 4ZCUA 4AQJA 3TZ1A 4MSPA 2PVBA 1AJ4A 1DJYA 1PVAA 4YI9A 4CIDA 5JJGA 2NLNA 1WRKA 1CDPA 1SKTA 3O4YA 3I5HB 4MVFA 4JWQA 4OR9B 2LMUA 2SASA 2E30A 2LLUA 1B8CA 2KBMA 3DVMA 1OZOA 1H4BA 3TDZA 1HQVA 1W7IB 4QJ5B 2GGZA 2JT8A 2PMYA 1YUSA 1BR4B 3CTNA 3DF0B 1N2DA 1JF2A 1B7TY 1TNPA 2ZRSA 1KK8C 1IJ5A 1QX7A 1SK6D 4YBHB 1EXRA 5CSNA 2CCMA 4GFTA 3LK1A 4QJ4B 2LE9B 3TUYB 1S26D 4NDCA 2PSRA 2JC2A 5AERA 3TDIA 1OZSA 1S6CA 1M45A 3OB1B 1QATA 1OOJA 1PRWA 1HT9A 4PHJA 5I2LA 1UHKA 2WORA 1MHOA 3TS5C 1BLQA 1CLBA 3EVUA 2MLFC 1KFUS 3A8RA 4N1FA 1EJ3A 3LCPC 3FWBA 4ORBB 2JPTA 1PVBA 3IQOA 4GGFA 1G33A 3WXAA 1L7ZA 3KF9A 4PHKA 1Y6WA 1DJWA 3QRXA 2L50A 4GGFC 4AQIA 1GGWA 2KFHA 3DVEA 4MLWA 4Q04A 2M8UA 3EK8A 5AXIA 3CR2A 1DGUA 2JNXA 3H4SE 4MRXA 4MZKA 4I5NB 5AEQA 5I8NA 3PSRA 1QVIY 1RFJA 1SPYA 1TIZA 2NXQA 4BY5A 2JU0A 1UHJA 1VRKA 4I5KA 1XO5A 1YX8A 3HCMA 4DS7A 1EH2A 1K9KA 1IJ6A 2F33A 3OB2B 1B1GA 3I5HC 4QJ3B 1KQMC 1L2OC 1QIWA 1JF0A 3CR4X 3KO0A 5AANA 1CFCA 1XFXO 4BY4A 5KU1A 1NCXA 1A75B 1SW8A 1CDNA 4USLA 1KFUL 2HPSA 3VGOA 1IH0A 3DF0A 2P6BB 4FQOA 1CLLA 1KK7Y 1J55A 1QX5B 1K90D 1QJTA 1GGZA 2F8PA 4DIRA 5IBWA 2KI6C 5HKZA 4PHNA 1MWNA 3FS7A 3O78A 4PE7A 3WHTB 1DTLA 4ICBA 2ZN9A 1SCVA 4L9MA 1DJGA 1NYAA 1CM4A 1CMGA 1SL8A 1JBAA 2HF5A 2ZNEA 1J7RA 4PE1A 5CSFA 4NQGA 1IQ5A 1K93D 2WCFA 2ZNDA 1XVJA 5HKWA 2LANA 5K89A 2LAPA 4A4CA 1V1FA 2KQYA 2WNDA 1YUUA 1NX0A 2LM5A 2M49B 1MXEA 3GK4X 2LHIA 1AVSA 1QXPA 2LV7A 2K8MB 4ORCB 3SG5A 1S5GY 2KI4B 2BKHB 3VRNA 3VRQA 2F3ZA 2KFFA 4OV2A 3BXKA 2JOJA 4MN0A 2L4IA 1YRTB 2KAXA 1S6IA 1WRZA 1NPQA 2WC8A 2L0PA 2KGBC 1J7PA 3PFVA 3EK7A 2BE4A 5J3XA 2KFGA 1SY9A 1JFKA 2MBXA 2NCOA 3PATA 4WQ3A 2MJWB 1PK0D 4AOMA 2JRFA 1LA0A 1B9AA 1F54A 1PULA 1PSBA 2LUXA 1A75A 4U8DA 1NUBA 2KYFA 1KQMB 1L2OB 2K2FA 1RJVA 1CMFA 3BOWB 1F55A 3K21A 3SG4A 1BOCA 2KAYA 1J7OA 2JT0A 5ER5A 1S36A 4CLNA 4N5XA 3LLEA 1C07A 2EGDA 3M0WA 3SG2A 3SJSA 2LC5A 4I5JA 1SBJA 2ISDA 1BU3A 2SCPA 3AKAA 1G4YR 1K2HA 4TNCA 2MAZA 3NSLA 4MEWA 2JULA 1WRLA 1QASA 2KDHA 2CXJA 2I7AA 2JT3A 1J1DA 1SRAA 1PSRA 4YGBB 4DCKA 2FCEA 2KNEA 1WDCC 2M7NA 2LLTA 3GK1A 5D7FA 2K2AA 1AK8A 2NZ0A 2L51A 2VRGA 1OE9B 2KAVA 2M0RA 2IS9A 2JTZA 3O2PA 2KI6D 1OMRA 1UWOA 5DKQA 2CTNA 1SYMA 1YURA 2M1UA 4I5LB 1F70A 2Y5IA 1B8RA 2PRUA 1TCOB 1LVCD 3I5IC 2KQ6A 3I5FC 3ICBA 1JSAA 2EC6C 1K94A 3DD4A 1M31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EKJ A;  2BEC A;  2JWW A;  2V53 A;  5CPV A;  2WCB A;  1SMG A;  1JWD A;  3RM1 A;  2KI4 C;  4C0J A;  3SIA A;  1TNX A;  1FF1 A;  1R6P A;  1B4C A;  2BBN A;  2JXL A;  5F6T A;  1PAL A;  2BCX A;  3BUO B;  2MHH A;  4YGE B;  1F4Q A;  1F8H A;  2NCP A;  3CWG A;  3NSK A;  2A4J A;  1ZOT B;  3GOF A;  1OMV A;  5HKY A;  1WLM A;  3CGA A;  1QV0 A;  4M2P A;  4DUQ A;  1DJX A;  1AP4 A;  5I2Q A;  1KWO C;  4HRH A;  2FJU B;  4WQ2 A;  5FYX A;  2LP2 A;  3BOW A;  2HQ8 A;  1JFJ A;  1NCY A;  2QPT A;  1C7W A;  1NWD A;  4GNK B;  5I2O A;  1SCM B;  4MZJ A;  3EK4 A;  3PAL A;  2K7C A;  1NX3 A;  1JUO A;  2KOT A;  1LA3 A;  2OPO A;  1CM1 A;  1BMO A;  3A4U B;  1BR1 B;  1BT6 A;  1OMD A;  2L98 A;  2JNF A;  2KYC A;  3AAJ A;  1Q80 A;  2CT9 A;  4M2O A;  4C0K A;  4YGD B;  1A03 A;  3E3R A;  1IQ3 A;  1AHR A;  2D8N A;  3CS1 A;  1UHN A;  1D1O A;  1CLM A;  4R1E A;  2K7D A;  3I5G C;  1WDC B;  1B7T Z;  2I2R E;  2LVV A;  1S1E A;  1AUI B;  4OVN F;  4GGN A;  5G08 A;  2O60 A;  4UPG A;  5TNC A;  4F0Z B;  1QIV A;  3BUN B;  1M46 A;  1FI5 A;  4OCI A;  1AJ5 A;  3BYA A;  3I5F B;  3I5I B;  1KSO A;  2EC6 B;  3EKH A;  1LIN A;  1R2U A;  5DKR A;  1CNP A;  1IG5 A;  1ZAC A;  1RK9 A;  1XYD A;  2LCP A;  1ZFS A;  1Y1U A;  1X02 A;  3IF7 A;  3PN7 C;  2G2B A;  1NX1 A;  3O6B A;  3NSI A;  1FW4 A;  1K8U A;  2KGR A;  4HRE E;  3WNX B;  5HLO A;  2ZFD A;  2PAL A;  4YRU A;  4MZL A;  3F45 A;  1Y1A A;  3D10 A;  2BE6 A;  2OTG C;  1TRF A;  2Q91 A;  4ETO A;  3LK0 A;  2COL B;  2LNK A;  1F71 A;  1REC A;  1CFD A;  1ALV A;  1B47 A;  1W7J B;  1LXF C;  1KWO B;  1OQP A;  1A4P A;  4JQ0 D;  4XJK A;  1SCM C;  1QVI Z;  1S3P A;  5AFP A;  2GV5 A;  2K61 A;  2M97 A;  1DJZ A;  5GQQ C;  1K95 A;  1UP5 A;  3KPX A;  1K9P A;  4PDZ A;  1RWY A;  2EHB A;  3SIB A;  1ZUZ A;  5D69 A;  4GAO A;  4MRY A;  3D0Y A;  1ZMZ A;  4PHM A;  5PAL A;  4FTG A;  4DRW A;  1NCZ A;  2M9G A;  1MUX A;  2HQW A;  1YTZ C;  1SNL A;  4JPZ B;  2KSP A;  2LUC A;  1G8I A;  1KK7 Z;  4YI8 A;  3PM8 A;  3KHE A;  4C0L A;  3MSE B;  1CFF A;  2L2E A;  1EG3 A;  1A29 A;  1FBV A;  2LVK A;  2M1K B;  3PLF B;  3I5G B;  1BF5 A;  4YGC B;  3KEV A;  3SG6 A;  1KFX S;  1XFU O;  2BL0 C;  3IQQ A;  4PE4 A;  2BKI B;  1EL4 A;  3DVK A;  2G9B A;  3TDU A;  1Y0V H;  5BPJ A;  3NSO A;  1DVI A;  1K96 A;  1NIW A;  2FCD A;  3OHM B;  3OX6 A;  5JOL A;  1GQM A;  1H8B A;  4P2Y B;  1JC2 A;  1YX7 A;  1DGV A;  1ODB A;  2L4H A;  2DOQ A;  5KSZ A;  1CDM A;  3JTD C;  3OX5 A;  1TN4 A;  3JVT B;  4PE0 A;  1NP8 A;  4NDB A;  2QAC A;  3BUW B;  2R2I A;  1J1E A;  1CDL A;  1DF0 B;  1XFZ O;  1B8L A;  2MLE C;  1MQ1 A;  1YUT A;  2AMI A;  2BCA A;  1YR5 A;  3LL8 B;  1V1G A;  2B1U A;  1SL9 A;  2BBM A;  3PN7 B;  2GGM A;  2JQ6 A;  5KTY A;  3C1V A;  1S5G Z;  1TCF A;  2Y1N A;  4N1G A;  1DJH A;  1QS7 A;  1XFY O;  3FWC A;  1RRO A;  2OTG B;  4MBE A;  4CFQ A;  4XYN A;  3AAK A;  2AUC A;  3BUM B;  1UHI A;  3VRO A;  1IRJ A;  1SR6 C;  1TTX A;  1MXL C;  2AAO A;  2CBL A;  1BJF A;  1UUS A;  2ZKM X;  2JTT A;  3AKB A;  4M2Q A;  2M29 A;  3ZWH A;  1C7V A;  1CFP A;  4PAL A;  2KBI A;  4P5O E;  1XK4 A;  2OS8 B;  1E8A A;  1KFX L;  2I94 A;  4ORA B;  1QTX A;  2F2O A;  3EVV A;  3NXA A;  1XK4 C;  2WCE A;  3CR5 X;  4XJK B;  2PAS A;  3GK2 A;  1TNQ A;  1KQV A;  2KHN A;  3RLZ A;  1QV1 A;  2CNP A;  2ZRT A;  1MR8 A;  5HLV A;  2M7L A;  1M39 A;  3SG3 A;  3D0Y B;  1U5I B;  1OSA A;  1QLS A;  1ALW A;  2LVJ A;  1M63 B;  1F4O A;  4OKH A;  1XA5 A;  1CTR A;  1YRU B;  2Q4U A;  4GPL B;  3EVR A;  2LP3 A;  1J7Q A;  4YGA A;  2LHL A;  4E68 A;  1BOD A;  2F2P A;  3CZT X;  1FI6 A;  2E6W A;  2BL0 B;  1UUR A;  3HX4 A;  1QX2 A;  3BQ3 A;  1XFV O;  2JXC A;  1KCY A;  3DVJ A;  2MA2 A;  4GBA A;  4A4B A;  5CSI A;  1DF0 A;  2MRD A;  3JVT C;  2LLS A;  4HRG A;  1K9U A;  2F3Y A;  1EG4 A;  1XFW O;  1UHH A;  1SL7 A;  1KK8 B;  2K0J A;  2K7O A;  2Y1M A;  3JTD B;  1NX2 A;  2TN4 A;  3TUY C;  1YVL A;  4GUK A;  1RTP 1;  2O5G A;  3ZNI A;  1WY9 A;  1DT7 B;  1LKJ A;  2H2K A;  2FOT A;  2HET A;  2LMV A;  2RGI A;  3VRP A;  1IGV A;  3OP0 A;  3SG7 A;  2K7B A;  2LVI A;  4PCW A;  5HYD A;  4HSZ A;  2M3W A;  2L5X B;  3TS5 B;  3VRR A;  1IWQ A;  4NDD A;  1BG1 A;  1YVH A;  2JZI A;  3BUX B;  1GJY A;  4WRI A;  2I18 A;  1SR6 B;  4ZCV A;  4CFR A;  1N65 A;  5ER4 X;  2OS8 C;  1N0Y A;  1FPW A;  3FIA A;  1Y1X A;  2Y4Q A;  5B8I B;  1IKU A;  4IL1 A;  1S6J A;  5DKN A;  1CB1 A;  1TNW A;  1KSM A;  1TOP A;  2BCB A;  5CSJ A;  3WHU B;  4D1E A;  1A2X A;  2ZN8 A;  1CKK A;  2H61 A;  1QLK A;  1NSH A;  2WOS A;  1DJI A;  2H61 C;  1U5I A;  2LMT A;  4CPV A;  1DMO A;  1MF8 B;  1WLZ A;  3CLN A;  4ZCU A;  4AQJ A;  3TZ1 A;  4MSP A;  2PVB A;  1AJ4 A;  1DJY A;  1PVA A;  4YI9 A;  4CID A;  5JJG A;  2NLN A;  1WRK A;  1CDP A;  1SKT A;  3O4Y A;  3I5H B;  4MVF A;  4JWQ A;  4OR9 B;  2LMU A;  2SAS A;  2E30 A;  2LLU A;  1B8C A;  2KBM A;  3DVM A;  1OZO A;  1H4B A;  3TDZ A;  1HQV A;  1W7I B;  4QJ5 B;  2GGZ A;  2JT8 A;  2PMY A;  1YUS A;  1BR4 B;  3CTN A;  3DF0 B;  1N2D A;  1JF2 A;  1B7T Y;  1TNP A;  2ZRS A;  1KK8 C;  1IJ5 A;  1QX7 A;  1SK6 D;  4YBH B;  1EXR A;  5CSN A;  2CCM A;  4GFT A;  3LK1 A;  4QJ4 B;  2LE9 B;  3TUY B;  1S26 D;  4NDC A;  2PSR A;  2JC2 A;  5AER A;  3TDI A;  1OZS A;  1S6C A;  1M45 A;  3OB1 B;  1QAT A;  1OOJ A;  1PRW A;  1HT9 A;  4PHJ A;  5I2L A;  1UHK A;  2WOR A;  1MHO A;  3TS5 C;  1BLQ A;  1CLB A;  3EVU A;  2MLF C;  1KFU S;  3A8R A;  4N1F A;  1EJ3 A;  3LCP C;  3FWB A;  4ORB B;  2JPT A;  1PVB A;  3IQO A;  4GGF A;  1G33 A;  3WXA A;  1L7Z A;  3KF9 A;  4PHK A;  1Y6W A;  1DJW A;  3QRX A;  2L50 A;  4GGF C;  4AQI A;  1GGW A;  2KFH A;  3DVE A;  4MLW A;  4Q04 A;  2M8U A;  3EK8 A;  5AXI A;  3CR2 A;  1DGU A;  2JNX A;  3H4S E;  4MRX A;  4MZK A;  4I5N B;  5AEQ A;  5I8N A;  3PSR A;  1QVI Y;  1RFJ A;  1SPY A;  1TIZ A;  2NXQ A;  4BY5 A;  2JU0 A;  1UHJ A;  1VRK A;  4I5K A;  1XO5 A;  1YX8 A;  3HCM A;  4DS7 A;  1EH2 A;  1K9K A;  1IJ6 A;  2F33 A;  3OB2 B;  1B1G A;  3I5H C;  4QJ3 B;  1KQM C;  1L2O C;  1QIW A;  1JF0 A;  3CR4 X;  3KO0 A;  5AAN A;  1CFC A;  1XFX O;  4BY4 A;  5KU1 A;  1NCX A;  1A75 B;  1SW8 A;  1CDN A;  4USL A;  1KFU L;  2HPS A;  3VGO A;  1IH0 A;  3DF0 A;  2P6B B;  4FQO A;  1CLL A;  1KK7 Y;  1J55 A;  1QX5 B;  1K90 D;  1QJT A;  1GGZ A;  2F8P A;  4DIR A;  5IBW A;  2KI6 C;  5HKZ A;  4PHN A;  1MWN A;  3FS7 A;  3O78 A;  4PE7 A;  3WHT B;  1DTL A;  4ICB A;  2ZN9 A;  1SCV A;  4L9M A;  1DJG A;  1NYA A;  1CM4 A;  1CMG A;  1SL8 A;  1JBA A;  2HF5 A;  2ZNE A;  1J7R A;  4PE1 A;  5CSF A;  4NQG A;  1IQ5 A;  1K93 D;  2WCF A;  2ZND A;  1XVJ A;  5HKW A;  2LAN A;  5K89 A;  2LAP A;  4A4C A;  1V1F A;  2KQY A;  2WND A;  1YUU A;  1NX0 A;  2LM5 A;  2M49 B;  1MXE A;  3GK4 X;  2LHI A;  1AVS A;  1QXP A;  2LV7 A;  2K8M B;  4ORC B;  3SG5 A;  1S5G Y;  2KI4 B;  2BKH B;  3VRN A;  3VRQ A;  2F3Z A;  2KFF A;  4OV2 A;  3BXK A;  2JOJ A;  4MN0 A;  2L4I A;  1YRT B;  2KAX A;  1S6I A;  1WRZ A;  1NPQ A;  2WC8 A;  2L0P A;  2KGB C;  1J7P A;  3PFV A;  3EK7 A;  2BE4 A;  5J3X A;  2KFG A;  1SY9 A;  1JFK A;  2MBX A;  2NCO A;  3PAT A;  4WQ3 A;  2MJW B;  1PK0 D;  4AOM A;  2JRF A;  1LA0 A;  1B9A A;  1F54 A;  1PUL A;  1PSB A;  2LUX A;  1A75 A;  4U8D A;  1NUB A;  2KYF A;  1KQM B;  1L2O B;  2K2F A;  1RJV A;  1CMF A;  3BOW B;  1F55 A;  3K21 A;  3SG4 A;  1BOC A;  2KAY A;  1J7O A;  2JT0 A;  5ER5 A;  1S36 A;  4CLN A;  4N5X A;  3LLE A;  1C07 A;  2EGD A;  3M0W A;  3SG2 A;  3SJS A;  2LC5 A;  4I5J A;  1SBJ A;  2ISD A;  1BU3 A;  2SCP A;  3AKA A;  1G4Y R;  1K2H A;  4TNC A;  2MAZ A;  3NSL A;  4MEW A;  2JUL A;  1WRL A;  1QAS A;  2KDH A;  2CXJ A;  2I7A A;  2JT3 A;  1J1D A;  1SRA A;  1PSR A;  4YGB B;  4DCK A;  2FCE A;  2KNE A;  1WDC C;  2M7N A;  2LLT A;  3GK1 A;  5D7F A;  2K2A A;  1AK8 A;  2NZ0 A;  2L51 A;  2VRG A;  1OE9 B;  2KAV A;  2M0R A;  2IS9 A;  2JTZ A;  3O2P A;  2KI6 D;  1OMR A;  1UWO A;  5DKQ A;  2CTN A;  1SYM A;  1YUR A;  2M1U A;  4I5L B;  1F70 A;  2Y5I A;  1B8R A;  2PRU A;  1TCO B;  1LVC D;  3I5I C;  2KQ6 A;  3I5F C;  3ICB A;  1JSA A;  2EC6 C;  1K94 A;  3DD4 A;  1M31 A; 
#chains in the Genus database with same CATH topology
 3EKJ A;  2BEC A;  2JWW A;  2V53 A;  5CPV A;  2WCB A;  1SMG A;  1JWD A;  3RM1 A;  2KI4 C;  4C0J A;  3SIA A;  1TNX A;  1FF1 A;  1R6P A;  3L47 A;  1B4C A;  2BBN A;  2JXL A;  3DYE A;  5F6T A;  1PAL A;  2BCX A;  3BUO B;  2MHH A;  4YGE B;  1F4Q A;  1F8H A;  2NCP A;  3CWG A;  3NSK A;  2A4J A;  3R1P A;  1ZOT B;  3GOF A;  1OMV A;  5HKY A;  1WLM A;  3CGA A;  1QV0 A;  4M2P A;  4DUQ A;  1DJX A;  1AP4 A;  5I2Q A;  1KWO C;  4HRH A;  2FJU B;  5HL1 A;  4WQ2 A;  5FYX A;  2LP2 A;  3BOW A;  2HQ8 A;  1JFJ A;  3R1V A;  1SSE B;  4OZD A;  1NCY A;  2QPT A;  1C7W A;  1NWD A;  4GNK B;  5I2O A;  1OOG A;  1SCM B;  4MZJ A;  3EK4 A;  3PAL A;  3DXL A;  4FQT A;  2K7C A;  1NX3 A;  1JUO A;  3OBV A;  2KOT A;  3D73 A;  1LA3 A;  1OOI X;  3DZT A;  2OPO A;  1CM1 A;  1BMO A;  3A4U B;  2QEV A;  1BR1 B;  1BT6 A;  1IIO A;  1OMD A;  2L98 A;  3PJI A;  2JNF A;  2KYC A;  3AAJ A;  3UO9 A;  1Q80 A;  3UNW A;  1Z2C B;  2CT9 A;  4M2O A;  2P71 A;  4C0K A;  4YGD B;  1A03 A;  2YGU A;  3E3R A;  1IQ3 A;  2KLD A;  1AHR A;  2D8N A;  3CS1 A;  1UHN A;  3FE9 A;  1CLM A;  1D1O A;  4R1E A;  2K7D A;  3I5G C;  1WDC B;  1B7T Z;  2I2R E;  2LVV A;  3D74 A;  1S1E A;  1AUI B;  1P28 A;  4OVN F;  3S0D A;  4GGN A;  5G08 A;  2O60 A;  4UPG A;  5TNC A;  4F0Z B;  1QIV A;  3BUN B;  2WCH A;  1M46 A;  3VB1 A;  1FI5 A;  4OCI A;  1AJ5 A;  3BYA A;  3I5F B;  3I5I B;  1KSO A;  2EC6 B;  3EKH A;  3CZ2 A;  1LIN A;  1R2U A;  5DKR A;  1CNP A;  1IG5 A;  1ZAC A;  1RK9 A;  1XYD A;  2LCP A;  1ZFS A;  3V2L A;  1Y1U A;  1X02 A;  3IF7 A;  3PN7 C;  2G2B A;  3BFB A;  1NX1 A;  3K1E A;  3O6B A;  3NSI A;  1FW4 A;  1K8U A;  2KGR A;  4HRE E;  2KPH A;  5HLO A;  2ZFD A;  2PAL A;  3WNX B;  4MZL A;  4YRU A;  3F45 A;  1Y1A A;  3D10 A;  2BE6 A;  2OTG C;  1TRF A;  2Q91 A;  2BNX A;  4ETO A;  3LK0 A;  2COL B;  2LNK A;  3BFH A;  1F71 A;  1REC A;  1CFD A;  1ALV A;  1B47 A;  1W7J B;  1LXF C;  1KWO B;  2BAP A;  1OQP A;  1A4P A;  3SS3 A;  4JQ0 D;  4XJK A;  1SCM C;  1QVI Z;  1S3P A;  5AFP A;  2GV5 A;  2K61 A;  2M97 A;  1DJZ A;  2JPO A;  1K95 A;  1UP5 A;  3KPX A;  1K9P A;  3NGV A;  5GQQ C;  3O4X A;  2WCJ A;  4PDZ A;  1RWY A;  2EHB A;  3SIB A;  1ZUZ A;  5D69 A;  4GAO A;  4MRY A;  3D0Y A;  1ZMZ A;  4PHM A;  5PAL A;  4FTG A;  4DRW A;  1NCZ A;  2M9G A;  1MUX A;  2HQW A;  1YTZ C;  1SNL A;  3NHT A;  4JPZ B;  2KSP A;  2LUC A;  1G8I A;  1KK7 Z;  4YI8 A;  3PM8 A;  3KHE A;  4C0L A;  3MSE B;  1CFF A;  2L2E A;  1EG3 A;  1A29 A;  1FBV A;  2L2C A;  2LVK A;  2M1K B;  3PLF B;  3I5G B;  1BF5 A;  4YGC B;  3KEV A;  3SG6 A;  1KFX S;  1XFU O;  2BL0 C;  5DIC A;  4JD9 A;  3IQQ A;  4PE4 A;  2BKI B;  1EL4 A;  3DVK A;  2G9B A;  3TDU A;  1Y0V H;  5BPJ A;  1C3Y A;  3B86 A;  3NSO A;  1DVI A;  1K96 A;  1NIW A;  2FCD A;  3OHM B;  3OX6 A;  3CAB A;  5JOL A;  1GQM A;  1H8B A;  4P2Y B;  1JC2 A;  1YX7 A;  1DGV A;  1ODB A;  2H8V A;  2L4H A;  2DOQ A;  5KSZ A;  1CDM A;  3JTD C;  3OX5 A;  1TN4 A;  3JVT B;  4PE0 A;  1NP8 A;  3CYZ A;  4NDB A;  2QAC A;  3BUW B;  2R2I A;  1J1E A;  1CDL A;  1DF0 B;  1XFZ O;  1B8L A;  2MLE C;  1MQ1 A;  1YUT A;  2AMI A;  2BCA A;  1YR5 A;  3LL8 B;  1V1G A;  2B1U A;  1SL9 A;  2BBM A;  3PN7 B;  2GGM A;  2JQ6 A;  5KTY A;  3C1V A;  1S5G Z;  1TCF A;  2Y1N A;  4N1G A;  1DJH A;  1QS7 A;  1XFY O;  2GTE A;  1RRO A;  2OTG B;  3FE8 A;  3FWC A;  4MBE A;  4CFQ A;  5I94 A;  4XYN A;  3N7H A;  3AAK A;  2AUC A;  3BFA A;  1UHI A;  3BUM B;  3VRO A;  1DC1 A;  1IRJ A;  1SR6 C;  1TTX A;  1MXL C;  2AAO A;  2CBL A;  1BJF A;  1UUS A;  2ZKM X;  2JTT A;  3AKB A;  4M2Q A;  2M29 A;  3ZWH A;  1C7V A;  1CFP A;  4PAL A;  2KBI A;  4P5O E;  1XK4 A;  2OS8 B;  1E8A A;  1KFX L;  2I94 A;  4ORA B;  1QTX A;  2F2O A;  3EVV A;  3NXA A;  1XK4 C;  1T14 A;  2WCE A;  3CR5 X;  4XJK B;  2PAS A;  3GK2 A;  1TNQ A;  1KQV A;  2KHN A;  3RLZ A;  3D76 A;  1TUZ A;  1QV1 A;  2CNP A;  2FJY A;  2L5Y A;  2ZRT A;  1MR8 A;  5HLV A;  3CZ1 A;  2M7L A;  1M39 A;  3SG3 A;  3D0Y B;  1U5I B;  1OSA A;  1QLS A;  3S0F A;  1ALW A;  5D3O A;  2LVJ A;  1M63 B;  1F4O A;  3SS5 A;  4OKH A;  1XA5 A;  1CTR A;  1YRU B;  2Q4U A;  4GPL B;  3EVR A;  2LP3 A;  1J7Q A;  3SS4 A;  4YGA A;  2LHL A;  4E68 A;  1BOD A;  2F2P A;  3CZT X;  1FI6 A;  2E6W A;  5EL2 A;  2WCL A;  2BL0 B;  1UUR A;  3HX4 A;  1QX2 A;  3BQ3 A;  1XFV O;  2JXC A;  1KCY A;  3DVJ A;  2MA2 A;  4GBA A;  2P70 A;  4A4B A;  5CSI A;  1W9Z A;  1DF0 A;  2MRD A;  1TWO A;  3JVT C;  1DEL A;  2LLS A;  4HRG A;  1K9U A;  2F3Y A;  1EG4 A;  1XFW O;  1UHH A;  1SL7 A;  1KK8 B;  2K0J A;  2K7O A;  2Y1M A;  3JTD B;  1NX2 A;  2TN4 A;  3TUY C;  1YVL A;  4INW A;  4GUK A;  1RTP 1;  2O5G A;  3S0E A;  3ZNI A;  1WY9 A;  1DT7 B;  1LKJ A;  2H2K A;  2FOT A;  2HET A;  3DY9 A;  3R1O A;  2LMV A;  2RGI A;  3VRP A;  1IGV A;  3OP0 A;  3SG7 A;  2K7B A;  2WCM A;  2LVI A;  4PCW A;  5HYD A;  4HSZ A;  2M3W A;  2L5X B;  3TS5 B;  5FI6 A;  3VRR A;  1IWQ A;  4NDD A;  1BG1 A;  1YVH A;  2JZI A;  3BUX B;  1GJY A;  4WRI A;  2I18 A;  1SR6 B;  4ZCV A;  4CFR A;  1N65 A;  1C3Z A;  2OS8 C;  1N0Y A;  5ER4 X;  3FIA A;  1FPW A;  1Y1X A;  2Y4Q A;  5B8I B;  1IKU A;  4IL1 A;  1S6J A;  5DKN A;  1CB1 A;  1TNW A;  1KSM A;  1TOP A;  2BCB A;  5CSJ A;  3WHU B;  4D1E A;  1A2X A;  2ZN8 A;  1CKK A;  2H61 A;  1QLK A;  1NSH A;  2WOS A;  1DJI A;  2H61 C;  3D78 A;  1U5I A;  1ORG A;  2LMT A;  4CPV A;  2KLE A;  1MF8 B;  1WLZ A;  3CLN A;  4ZCU A;  1DMO A;  4AQJ A;  3TZ1 A;  4MSP A;  2PVB A;  1AJ4 A;  1DJY A;  1PVA A;  3B87 A;  4YI9 A;  4CID A;  5JJG A;  5FI7 A;  2NLN A;  1WRK A;  2PQL A;  1CDP A;  1SKT A;  3O4Y A;  3I5H B;  4MVF A;  4JWQ A;  4OR9 B;  2PYQ A;  2LMU A;  2SAS A;  4KYN A;  2E30 A;  2LLU A;  1B8C A;  2KBM A;  3DVM A;  1OZO A;  1H4B A;  3TDZ A;  1HQV A;  2K60 A;  1W7I B;  4QJ5 B;  2GGZ A;  2QEO A;  2JT8 A;  2PMY A;  2QEB A;  1YUS A;  1BR4 B;  3CTN A;  3DF0 B;  1N2D A;  1JF2 A;  1B7T Y;  1TNP A;  2ZRS A;  1KK8 C;  1IJ5 A;  1QX7 A;  1SK6 D;  2ERB A;  1EXR A;  4YBH B;  3QME A;  5CSN A;  2CCM A;  4GFT A;  3S0G A;  3LK1 A;  4QJ4 B;  2LE9 B;  3FE6 A;  3TUY B;  1S26 D;  4NDC A;  2PSR A;  2JC2 A;  5AER A;  3NHI A;  2QDI A;  1TUJ A;  3TDI A;  1OZS A;  1S6C A;  1M45 A;  3OB1 B;  1QAT A;  1OOJ A;  1PRW A;  1HT9 A;  4PHJ A;  5I2L A;  1UHK A;  2WOR A;  1MHO A;  3TS5 C;  1BLQ A;  1CLB A;  3EVU A;  2MLF C;  1KFU S;  3A8R A;  4N1F A;  1EJ3 A;  3LCP C;  3B7A A;  3FWB A;  3Q8I A;  4ORB B;  2JPT A;  1PVB A;  1XFR A;  3L4L A;  3IQO A;  4GGF A;  1G33 A;  3WXA A;  1L7Z A;  3KF9 A;  3RZS A;  4PHK A;  1Y6W A;  1DJW A;  3QRX A;  2L50 A;  3CDN A;  4GGF C;  4AQI A;  1GGW A;  2KFH A;  3DVE A;  4MLW A;  4Q04 A;  2M8U A;  3EK8 A;  5AXI A;  3CR2 A;  1DGU A;  2JNX A;  2WC6 A;  3H4S E;  4MRX A;  4MZK A;  4I5N B;  5AEQ A;  5I8N A;  1LS8 A;  4JKT A;  3PSR A;  1QVI Y;  1RFJ A;  1SPY A;  1TIZ A;  2NXQ A;  4BY5 A;  2JU0 A;  1UHJ A;  1VRK A;  4I5K A;  4INX A;  1XO5 A;  1YX8 A;  3PM2 A;  3S0A A;  3HCM A;  4DS7 A;  1EH2 A;  1K9K A;  1IJ6 A;  2F33 A;  3OB2 B;  1B1G A;  3I5H C;  4QJ3 B;  1KQM C;  1L2O C;  1QIW A;  1JF0 A;  3CR4 X;  3KO0 A;  5AAN A;  1CFC A;  1XFX O;  1DEK A;  4BY4 A;  5KU1 A;  1NCX A;  1A75 B;  1SW8 A;  1CDN A;  4USL A;  2WCK A;  1KFU L;  2HPS A;  3VGO A;  1IH0 A;  3DF0 A;  2P6B B;  4FQO A;  1CLL A;  1KK7 Y;  1J55 A;  1QX5 B;  2QEH A;  1K90 D;  3L4A A;  1QJT A;  3CZ0 A;  1GGZ A;  2F8P A;  4DIR A;  3BJH A;  1GM0 A;  5IBW A;  4IJ7 A;  2KI6 C;  5HKZ A;  4PHN A;  1MWN A;  3FS7 A;  3O78 A;  4PE7 A;  3WHT B;  1DTL A;  4ICB A;  2ZN9 A;  1SCV A;  4L9M A;  1DJG A;  1NYA A;  1CM4 A;  1CMG A;  1QWV A;  1SL8 A;  1JBA A;  2HF5 A;  2ZNE A;  1J7R A;  4PE1 A;  5CSF A;  3D75 A;  4NQG A;  1IQ5 A;  1K93 D;  2WCF A;  2ZND A;  1XVJ A;  3B88 A;  5HKW A;  2LAN A;  5K89 A;  2LAP A;  4A4C A;  3R72 A;  1V1F A;  2KQY A;  3IVT A;  2WND A;  1YUU A;  1NX0 A;  2LM5 A;  2M49 B;  1MXE A;  3GK4 X;  2LHI A;  1AVS A;  1QXP A;  1DQE A;  2K8M B;  2LV7 A;  4ORC B;  1S5G Y;  2KI4 B;  2BKH B;  3SG5 A;  3VRN A;  2F3Z A;  3VRQ A;  2KFF A;  4OV2 A;  3BXK A;  2JOJ A;  4MN0 A;  2L4I A;  1YRT B;  2KAX A;  1S6I A;  1WRZ A;  1NPQ A;  2WC5 A;  2WC8 A;  2L0P A;  2KGB C;  1J7P A;  3PFV A;  3EK7 A;  2BE4 A;  5J3X A;  2KFG A;  1SY9 A;  1JFK A;  2MBX A;  2NCO A;  3PAT A;  4WQ3 A;  2MJW B;  1Z4H A;  1PK0 D;  4AOM A;  2JRF A;  1LA0 A;  1B9A A;  1F54 A;  1PUL A;  1PSB A;  2LUX A;  1A75 A;  4U8D A;  1NUB A;  2KYF A;  1KQM B;  1L2O B;  2K2F A;  1RJV A;  1CMF A;  3B6X A;  3BOW B;  3K21 A;  1F55 A;  3SG4 A;  1BOC A;  2KAY A;  1J7O A;  2JT0 A;  5ER5 A;  1S36 A;  4CLN A;  4N5X A;  3LLE A;  5FI2 A;  1C07 A;  2EGD A;  3M0W A;  3SG2 A;  3SJS A;  2LC5 A;  4I5J A;  1SBJ A;  2ISD A;  1BU3 A;  2SCP A;  3AKA A;  1G4Y R;  1K2H A;  4TNC A;  2MAZ A;  3NSL A;  4MEW A;  2JUL A;  3D77 A;  1WRL A;  1QAS A;  2KDH A;  2CXJ A;  2I7A A;  2JT3 A;  1J1D A;  1SRA A;  1PSR A;  4YGB B;  4DCK A;  1OW4 A;  2FCE A;  2KNE A;  1WDC C;  2M7N A;  2LLT A;  3GK1 A;  5D7F A;  2K2A A;  1AK8 A;  2NZ0 A;  2L51 A;  2VRG A;  3S0B A;  1OE9 B;  2KAV A;  2M0R A;  2IS9 A;  2JTZ A;  3O2P A;  3EG5 B;  4PT1 A;  2KI6 D;  1OMR A;  1UWO A;  5DKQ A;  2CTN A;  1SYM A;  1YUR A;  2M1U A;  4I5L B;  3OGN A;  1F70 A;  2Y5I A;  1B8R A;  2PRU A;  1OOH A;  1TCO B;  1LVC D;  3I5I C;  2KQ6 A;  3I5F C;  3ICB A;  4F7F A;  2EC6 C;  1JSA A;  1OOF A;  1K94 A;  3DD4 A;  1M31 A; 
#chains in the Genus database with same CATH homology
 3EKJ A;  2BEC A;  2JWW A;  2V53 A;  5CPV A;  2WCB A;  1SMG A;  1JWD A;  3RM1 A;  2KI4 C;  4C0J A;  3SIA A;  1TNX A;  1FF1 A;  1R6P A;  1B4C A;  2BBN A;  2JXL A;  5F6T A;  1PAL A;  2BCX A;  3BUO B;  2MHH A;  4YGE B;  1F4Q A;  1F8H A;  2NCP A;  3CWG A;  3NSK A;  2A4J A;  1ZOT B;  3GOF A;  1OMV A;  5HKY A;  1WLM A;  3CGA A;  1QV0 A;  4M2P A;  4DUQ A;  1DJX A;  1AP4 A;  5I2Q A;  1KWO C;  4HRH A;  2FJU B;  4WQ2 A;  5FYX A;  2LP2 A;  3BOW A;  2HQ8 A;  1JFJ A;  1NCY A;  2QPT A;  1C7W A;  1NWD A;  4GNK B;  5I2O A;  1SCM B;  4MZJ A;  3EK4 A;  3PAL A;  2K7C A;  1NX3 A;  1JUO A;  2KOT A;  1LA3 A;  2OPO A;  1CM1 A;  1BMO A;  3A4U B;  1BR1 B;  1BT6 A;  1OMD A;  2L98 A;  2JNF A;  2KYC A;  3AAJ A;  1Q80 A;  2CT9 A;  4M2O A;  4C0K A;  4YGD B;  1A03 A;  3E3R A;  1IQ3 A;  1AHR A;  2D8N A;  3CS1 A;  1UHN A;  1D1O A;  1CLM A;  4R1E A;  2K7D A;  3I5G C;  1WDC B;  1B7T Z;  2I2R E;  2LVV A;  1S1E A;  1AUI B;  4OVN F;  4GGN A;  5G08 A;  2O60 A;  4UPG A;  5TNC A;  4F0Z B;  1QIV A;  3BUN B;  1M46 A;  1FI5 A;  4OCI A;  1AJ5 A;  3BYA A;  3I5F B;  3I5I B;  1KSO A;  2EC6 B;  3EKH A;  1LIN A;  1R2U A;  5DKR A;  1CNP A;  1IG5 A;  1ZAC A;  1RK9 A;  1XYD A;  2LCP A;  1ZFS A;  1Y1U A;  1X02 A;  3IF7 A;  3PN7 C;  2G2B A;  1NX1 A;  3O6B A;  3NSI A;  1FW4 A;  1K8U A;  2KGR A;  4HRE E;  3WNX B;  5HLO A;  2ZFD A;  2PAL A;  4YRU A;  4MZL A;  3F45 A;  1Y1A A;  3D10 A;  2BE6 A;  2OTG C;  1TRF A;  2Q91 A;  4ETO A;  3LK0 A;  2COL B;  2LNK A;  1F71 A;  1REC A;  1CFD A;  1ALV A;  1B47 A;  1W7J B;  1LXF C;  1KWO B;  1OQP A;  1A4P A;  4JQ0 D;  4XJK A;  1SCM C;  1QVI Z;  1S3P A;  5AFP A;  2GV5 A;  2K61 A;  2M97 A;  1DJZ A;  5GQQ C;  1K95 A;  1UP5 A;  3KPX A;  1K9P A;  4PDZ A;  1RWY A;  2EHB A;  3SIB A;  1ZUZ A;  5D69 A;  4GAO A;  4MRY A;  3D0Y A;  1ZMZ A;  4PHM A;  5PAL A;  4FTG A;  4DRW A;  1NCZ A;  2M9G A;  1MUX A;  2HQW A;  1YTZ C;  1SNL A;  4JPZ B;  2KSP A;  2LUC A;  1G8I A;  1KK7 Z;  4YI8 A;  3PM8 A;  3KHE A;  4C0L A;  3MSE B;  1CFF A;  2L2E A;  1EG3 A;  1A29 A;  1FBV A;  2LVK A;  2M1K B;  3PLF B;  3I5G B;  1BF5 A;  4YGC B;  3KEV A;  3SG6 A;  1KFX S;  1XFU O;  2BL0 C;  3IQQ A;  4PE4 A;  2BKI B;  1EL4 A;  3DVK A;  2G9B A;  3TDU A;  1Y0V H;  5BPJ A;  3NSO A;  1DVI A;  1K96 A;  1NIW A;  2FCD A;  3OHM B;  3OX6 A;  5JOL A;  1GQM A;  1H8B A;  4P2Y B;  1JC2 A;  1YX7 A;  1DGV A;  1ODB A;  2L4H A;  2DOQ A;  5KSZ A;  1CDM A;  3JTD C;  3OX5 A;  1TN4 A;  3JVT B;  4PE0 A;  1NP8 A;  4NDB A;  2QAC A;  3BUW B;  2R2I A;  1J1E A;  1CDL A;  1DF0 B;  1XFZ O;  1B8L A;  2MLE C;  1MQ1 A;  1YUT A;  2AMI A;  2BCA A;  1YR5 A;  3LL8 B;  1V1G A;  2B1U A;  1SL9 A;  2BBM A;  3PN7 B;  2GGM A;  2JQ6 A;  5KTY A;  3C1V A;  1S5G Z;  1TCF A;  2Y1N A;  4N1G A;  1DJH A;  1QS7 A;  1XFY O;  3FWC A;  1RRO A;  2OTG B;  4MBE A;  4CFQ A;  4XYN A;  3AAK A;  2AUC A;  3BUM B;  1UHI A;  3VRO A;  1IRJ A;  1SR6 C;  1TTX A;  1MXL C;  2AAO A;  2CBL A;  1BJF A;  1UUS A;  2ZKM X;  2JTT A;  3AKB A;  4M2Q A;  2M29 A;  3ZWH A;  1C7V A;  1CFP A;  4PAL A;  2KBI A;  4P5O E;  1XK4 A;  2OS8 B;  1E8A A;  1KFX L;  2I94 A;  4ORA B;  1QTX A;  2F2O A;  3EVV A;  3NXA A;  1XK4 C;  2WCE A;  3CR5 X;  4XJK B;  2PAS A;  3GK2 A;  1TNQ A;  1KQV A;  2KHN A;  3RLZ A;  1QV1 A;  2CNP A;  2ZRT A;  1MR8 A;  5HLV A;  2M7L A;  1M39 A;  3SG3 A;  3D0Y B;  1U5I B;  1OSA A;  1QLS A;  1ALW A;  2LVJ A;  1M63 B;  1F4O A;  4OKH A;  1XA5 A;  1CTR A;  1YRU B;  2Q4U A;  4GPL B;  3EVR A;  2LP3 A;  1J7Q A;  4YGA A;  2LHL A;  4E68 A;  1BOD A;  2F2P A;  3CZT X;  1FI6 A;  2E6W A;  2BL0 B;  1UUR A;  3HX4 A;  1QX2 A;  3BQ3 A;  1XFV O;  2JXC A;  1KCY A;  3DVJ A;  2MA2 A;  4GBA A;  4A4B A;  5CSI A;  1DF0 A;  2MRD A;  3JVT C;  2LLS A;  4HRG A;  1K9U A;  2F3Y A;  1EG4 A;  1XFW O;  1UHH A;  1SL7 A;  1KK8 B;  2K0J A;  2K7O A;  2Y1M A;  3JTD B;  1NX2 A;  2TN4 A;  3TUY C;  1YVL A;  4GUK A;  1RTP 1;  2O5G A;  3ZNI A;  1WY9 A;  1DT7 B;  1LKJ A;  2H2K A;  2FOT A;  2HET A;  2LMV A;  2RGI A;  3VRP A;  1IGV A;  3OP0 A;  3SG7 A;  2K7B A;  2LVI A;  4PCW A;  5HYD A;  4HSZ A;  2M3W A;  2L5X B;  3TS5 B;  3VRR A;  1IWQ A;  4NDD A;  1BG1 A;  1YVH A;  2JZI A;  3BUX B;  1GJY A;  4WRI A;  2I18 A;  1SR6 B;  4ZCV A;  4CFR A;  1N65 A;  5ER4 X;  2OS8 C;  1N0Y A;  1FPW A;  3FIA A;  1Y1X A;  2Y4Q A;  5B8I B;  1IKU A;  4IL1 A;  1S6J A;  5DKN A;  1CB1 A;  1TNW A;  1KSM A;  1TOP A;  2BCB A;  5CSJ A;  3WHU B;  4D1E A;  1A2X A;  2ZN8 A;  1CKK A;  2H61 A;  1QLK A;  1NSH A;  2WOS A;  1DJI A;  2H61 C;  1U5I A;  2LMT A;  4CPV A;  1DMO A;  1MF8 B;  1WLZ A;  3CLN A;  4ZCU A;  4AQJ A;  3TZ1 A;  4MSP A;  2PVB A;  1AJ4 A;  1DJY A;  1PVA A;  4YI9 A;  4CID A;  5JJG A;  2NLN A;  1WRK A;  1CDP A;  1SKT A;  3O4Y A;  3I5H B;  4MVF A;  4JWQ A;  4OR9 B;  2LMU A;  2SAS A;  2E30 A;  2LLU A;  1B8C A;  2KBM A;  3DVM A;  1OZO A;  1H4B A;  3TDZ A;  1HQV A;  1W7I B;  4QJ5 B;  2GGZ A;  2JT8 A;  2PMY A;  1YUS A;  1BR4 B;  3CTN A;  3DF0 B;  1N2D A;  1JF2 A;  1B7T Y;  1TNP A;  2ZRS A;  1KK8 C;  1IJ5 A;  1QX7 A;  1SK6 D;  4YBH B;  1EXR A;  5CSN A;  2CCM A;  4GFT A;  3LK1 A;  4QJ4 B;  2LE9 B;  3TUY B;  1S26 D;  4NDC A;  2PSR A;  2JC2 A;  5AER A;  3TDI A;  1OZS A;  1S6C A;  1M45 A;  3OB1 B;  1QAT A;  1OOJ A;  1PRW A;  1HT9 A;  4PHJ A;  5I2L A;  1UHK A;  2WOR A;  1MHO A;  3TS5 C;  1BLQ A;  1CLB A;  3EVU A;  2MLF C;  1KFU S;  3A8R A;  4N1F A;  1EJ3 A;  3LCP C;  3FWB A;  4ORB B;  2JPT A;  1PVB A;  3IQO A;  4GGF A;  1G33 A;  3WXA A;  1L7Z A;  3KF9 A;  4PHK A;  1Y6W A;  1DJW A;  3QRX A;  2L50 A;  4GGF C;  4AQI A;  1GGW A;  2KFH A;  3DVE A;  4MLW A;  4Q04 A;  2M8U A;  3EK8 A;  5AXI A;  3CR2 A;  1DGU A;  2JNX A;  3H4S E;  4MRX A;  4MZK A;  4I5N B;  5AEQ A;  5I8N A;  3PSR A;  1QVI Y;  1RFJ A;  1SPY A;  1TIZ A;  2NXQ A;  4BY5 A;  2JU0 A;  1UHJ A;  1VRK A;  4I5K A;  1XO5 A;  1YX8 A;  3HCM A;  4DS7 A;  1EH2 A;  1K9K A;  1IJ6 A;  2F33 A;  3OB2 B;  1B1G A;  3I5H C;  4QJ3 B;  1KQM C;  1L2O C;  1QIW A;  1JF0 A;  3CR4 X;  3KO0 A;  5AAN A;  1CFC A;  1XFX O;  4BY4 A;  5KU1 A;  1NCX A;  1A75 B;  1SW8 A;  1CDN A;  4USL A;  1KFU L;  2HPS A;  3VGO A;  1IH0 A;  3DF0 A;  2P6B B;  4FQO A;  1CLL A;  1KK7 Y;  1J55 A;  1QX5 B;  1K90 D;  1QJT A;  1GGZ A;  2F8P A;  4DIR A;  5IBW A;  2KI6 C;  5HKZ A;  4PHN A;  1MWN A;  3FS7 A;  3O78 A;  4PE7 A;  3WHT B;  1DTL A;  4ICB A;  2ZN9 A;  1SCV A;  4L9M A;  1DJG A;  1NYA A;  1CM4 A;  1CMG A;  1SL8 A;  1JBA A;  2HF5 A;  2ZNE A;  1J7R A;  4PE1 A;  5CSF A;  4NQG A;  1IQ5 A;  1K93 D;  2WCF A;  2ZND A;  1XVJ A;  5HKW A;  2LAN A;  5K89 A;  2LAP A;  4A4C A;  1V1F A;  2KQY A;  2WND A;  1YUU A;  1NX0 A;  2LM5 A;  2M49 B;  1MXE A;  3GK4 X;  2LHI A;  1AVS A;  1QXP A;  2LV7 A;  2K8M B;  4ORC B;  3SG5 A;  1S5G Y;  2KI4 B;  2BKH B;  3VRN A;  3VRQ A;  2F3Z A;  2KFF A;  4OV2 A;  3BXK A;  2JOJ A;  4MN0 A;  2L4I A;  1YRT B;  2KAX A;  1S6I A;  1WRZ A;  1NPQ A;  2WC8 A;  2L0P A;  2KGB C;  1J7P A;  3PFV A;  3EK7 A;  2BE4 A;  5J3X A;  2KFG A;  1SY9 A;  1JFK A;  2MBX A;  2NCO A;  3PAT A;  4WQ3 A;  2MJW B;  1PK0 D;  4AOM A;  2JRF A;  1LA0 A;  1B9A A;  1F54 A;  1PUL A;  1PSB A;  2LUX A;  1A75 A;  4U8D A;  1NUB A;  2KYF A;  1KQM B;  1L2O B;  2K2F A;  1RJV A;  1CMF A;  3BOW B;  1F55 A;  3K21 A;  3SG4 A;  1BOC A;  2KAY A;  1J7O A;  2JT0 A;  5ER5 A;  1S36 A;  4CLN A;  4N5X A;  3LLE A;  1C07 A;  2EGD A;  3M0W A;  3SG2 A;  3SJS A;  2LC5 A;  4I5J A;  1SBJ A;  2ISD A;  1BU3 A;  2SCP A;  3AKA A;  1G4Y R;  1K2H A;  4TNC A;  2MAZ A;  3NSL A;  4MEW A;  2JUL A;  1WRL A;  1QAS A;  2KDH A;  2CXJ A;  2I7A A;  2JT3 A;  1J1D A;  1SRA A;  1PSR A;  4YGB B;  4DCK A;  2FCE A;  2KNE A;  1WDC C;  2M7N A;  2LLT A;  3GK1 A;  5D7F A;  2K2A A;  1AK8 A;  2NZ0 A;  2L51 A;  2VRG A;  1OE9 B;  2KAV A;  2M0R A;  2IS9 A;  2JTZ A;  3O2P A;  2KI6 D;  1OMR A;  1UWO A;  5DKQ A;  2CTN A;  1SYM A;  1YUR A;  2M1U A;  4I5L B;  1F70 A;  2Y5I A;  1B8R A;  2PRU A;  1TCO B;  1LVC D;  3I5I C;  2KQ6 A;  3I5F C;  3ICB A;  1JSA A;  2EC6 C;  1K94 A;  3DD4 A;  1M31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...