1FF1A

Structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfl
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of NPF recognition by EH domains.
pubmed doi rcsb
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR SUBSTRATE 15
molecule tags Signaling protein
source organism Homo sapiens
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ff1A00
1YUUA 2LCPA 3OX5A 2HQ8A 1F4OA 4N1FA 4P5OE 2HPSA 1C7VA 1CLLA 1KK8B 1KFXS 1QV1A 1XK4A 1ZMZA 4PALA 2MRDA 1CDNA 1R6PA 1RECA 2GV5A 2WOSA 2KGRA 2OS8C 1QVIZ 3SG6A 1WY9A 2LAPA 4TNCA 1EL4A 2L2EA 3I5IC 2LMVA 2EHBA 1IWQA 2AAOA 1J1EA 4YGDB 5HKYA 4UPGA 4PHJA 1YX8A 4PE1A 1JBAA 5I2QA 1SNLA 4HRHA 5CSNA 1L2OC 3DVJA 1C07A 2FCEA 1SR6C 2AUCA 4GNKB 4WQ2A 3EVRA 1A2XA 2I94A 2SCPA 1Y1AA 2ZRSA 1K9PA 1IQ3A 2KBIA 1IGVA 2JNFA 4CFRA 4JWQA 1B9AA 2KFHA 4Q04A 1F8HA 2KI4C 2RGIA 4YGBB 2KQYA 3OX6A 3JTDC 2LVIA 5PALA 1SL9A 2ZRTA 3OP0A 1ZUZA 1J7PA 3D10A 2BKHB 5ER4X 2L50A 1K2HA 4I5LB 1CM4A 2GGZA 2LP2A 1KSMA 2KGBC 1OSAA 4MSPA 4DIRA 2F3ZA 1XK4C 5KU1A 4XJKB 5HKWA 1QX5B 1XFXO 2EC6B 3VRPA 3WNXB 3GOFA 4MZLA 3OB2B 1SMGA 1OE9B 2M0RA 2A4JA 1EXRA 1MUXA 1YUTA 2JC2A 3I5HC 3GK4X 2MJWB 3GK2A 4ICBA 4MEWA 1KQMB 1KFXL 2MBXA 1B4CA 1PK0D 1DMOA 4NDCA 3HX4A 5FYXA 4F0ZB 1JWDA 1AP4A 2K0JA 1UUSA 4R1EA 2WCEA 2JNXA 1NP8A 4MZKA 1H8BA 1CDPA 2F2PA 1OMVA 2EGDA 2KOTA 4OR9B 4CFQA 3EVVA 1IH0A 2LMUA 1ODBA 2SASA 1XFUO 3AKAA 2ZNEA 1S6CA 3EK4A 1QX7A 2FCDA 2QPTA 4L9MA 1GGWA 1MXLC 1FW4A 1YRTB 5KTYA 1IJ5A 1B8LA 2M3WA 1M63B 1K93D 3WHTB 5I2LA 1FF1A 3O78A 4GPLB 1DJZA 1IKUA 2PRUA 5CSIA 2B1UA 2KDHA 3VRNA 2ZN9A 1AJ4A 1UWOA 1QATA 5BPJA 1J1DA 1MHOA 1EG3A 1GQMA 2LVVA 4GAOA 1UHJA 1D1OA 2OS8B 1TIZA 1CDMA 4I5JA 2MAZA 3BUNB 1DGUA 1J7RA 1K94A 2EC6C 2GGMA 2JWWA 5CPVA 1JC2A 3I5IB 1JF0A 1PVBA 2Y5IA 4I5KA 2JXLA 1NPQA 1LVCD 1QLKA 2MLFC 3KPXA 3NSKA 1PRWA 3VRRA 1KQMC 2WCBA 1NX0A 2E6WA 1B47A 1WRZA 1L2OB 3EK8A 4GGNA 1SR6B 1S5GY 3GK1A 4MBEA 5J3XA 1EH2A 3KEVA 5AANA 2M9GA 1DJIA 2QACA 2NCPA 2JZIA 1OMRA 3ICBA 5I2OA 2KI4B 1BU3A 1A29A 3JTDB 1G4YR 1NCZA 1B7TZ 1DJGA 4YGCB 4DUQA 3AKBA 3RM1A 2BBMA 2H2KA 2CNPA 2K8MB 3WXAA 3CWGA 1EJ3A 1SBJA 1V1FA 2BE4A 2BL0B 4ETOA 5I8NA 1GJYA 2BE6A 1PVAA 1K8UA 1N2DA 4CIDA 1AHRA 2OPOA 4GBAA 4PDZA 5D7FA 1CNPA 2LVKA 1AJ5A 1PSBA 2PASA 4AQJA 3I5HB 2FJUB 5JOLA 3HCMA 3KF9A 1CMFA 1NX1A 2NLNA 1CFDA 2KYCA 3NSIA 1XFYO 1S5GZ 1ZFSA 2KFGA 1YRUB 1M46A 3BOWB 4M2OA 5KSZA 1LKJA 1AUIB 4ZCUA 2TN4A 4PHMA 2ZNDA 1B1GA 3QRXA 3BOWA 4YI8A 4GFTA 1RK9A 3TDUA 2F33A 1OOJA 1WLZA 4GUKA 4XYNA 5IBWA 3D0YB 1QTXA 4M2QA 4NQGA 3BYAA 3SG3A 1TCFA 3D0YA 3TZ1A 1NIWA 5JJGA 3IF7A 3DVMA 2KQ6A 3BUWB 5TNCA 5CSFA 2CT9A 4JQ0D 4YGEB 1W7IB 1SW8A 3PSRA 2M1KB 1S6IA 2LUXA 3I5FC 3JVTC 3NSOA 4YGAA 3SG4A 2NXQA 1QASA 2M8UA 2AMIA 3ZWHA 1UHNA 4FQOA 2BL0C 1Y1XA 3PN7B 1MF8B 3EKJA 4AQIA 4QJ3B 1GGZA 4OKHA 3O6BA 4OV2A 1SCMB 3LK0A 1CFPA 1RFJA 1CLMA 2KNEA 1MR8A 5CSJA 3A4UB 3LK1A 4U8DA 3IQOA 1MWNA 5K89A 5D69A 5DKNA 3F45A 2LV7A 1OZSA 2L51A 3CS1A 1DT7B 5HLOA 4OVNF 3EVUA 2KBMA 4C0JA 1K96A 4QJ5B 4A4CA 1OQPA 4D1EA 2CTNA 3PALA 1SRAA 1IG5A 4PE0A 1YR5A 1QV0A 2NCOA 3DVKA 3PM8A 2LLSA 1CMGA 5F6TA 1WDCB 2F3YA 1FI5A 3M0WA 1QLSA 5GQQC 4QJ4B 3FIAA 1TNXA 3DF0A 2JT8A 3PFVA 2BCAA 1WRKA 2WNDA 1BOCA 1A75A 4I5NB 1M39A 2M97A 1XO5A 2KSPA 1Y1UA 4WQ3A 1QXPA 1ALWA 1YVHA 1KFUS 2M1UA 1G33A 1KQVA 1NX3A 2O5GA 2KI6C 1SCVA 5AEQA 3PN7C 1WRLA 3O4YA 3TDIA 4C0KA 4CLNA 4IL1A 2JTZA 2LVJA 4YI9A 4E68A 1SCMC 1FI6A 1QIWA 4A4BA 5AXIA 1KK7Y 3CZTX 1DJHA 1UP5A 1ZOTB 2WCFA 1UHHA 5HYDA 1XFVO 2G9BA 1JFKA 4DRWA 3SG5A 1HQVA 2BECA 4P2YB 1CFFA 1MXEA 1NYAA 2VRGA 1DJYA 3KHEA 3K21A 3BUMB 1TRFA 4PHKA 2LM5A 2G2BA 1UHIA 1XVJA 1WDCC 4C0LA 2ZN8A 2JU0A 1TNWA 3BUOB 2JOJA 3FWBA 4HREE 4PHNA 2JRFA 2E30A 2D8NA 3BQ3A 1BG1A 3I5FB 3JVTB 1RJVA 3LCPC 1BJFA 4ORAB 5G08A 1K9KA 3RLZA 3SJSA 1QJTA 1F71A 2LNKA 1CB1A 3BUXB 1IRJA 1TNPA 2K7OA 2BKIB 2JT0A 2KFFA 3CTNA 1N65A 4ORCB 1R2UA 1CLBA 1K95A 2COLB 3OHMB 4OCIA 3EK7A 1QX2A 1C7WA 1KK7Z 2JPTA 2P6BB 1Y0VH 1M45A 4MN0A 3PLFB 5HKZA 2HETA 1BMOA 3ZNIA 1KFUL 1YVLA 2HQWA 1IJ6A 2H61A 1LA0A 2L0PA 2NZ0A 1DVIA 1CTRA 1J7OA 1Q80A 1F55A 3SG7A 1M31A 2Q91A 2M29A 3CR4X 4JPZB 3C1VA 1OMDA 4YRUA 1NSHA 1PALA 1TOPA 2PALA 2IS9A 3SG2A 2JT3A 1RWYA 1TTXA 2OTGB 1AVSA 1ALVA 2R2IA 1CM1A 2LC5A 1KSOA 2ISDA 2K7CA 2I7AA 3AAJA 2K61A 1YURA 2K7BA 5DKQA 3VRQA 3AAKA 1K90D 5AFPA 3BXKA 3TDZA 2K2FA 1BLQA 1CDLA 4DCKA 2BCBA 1QIVA 3SIAA 1YUSA 2PVBA 3I5GB 2WORA 2JQ6A 1BODA 1DTLA 2MA2A 4PCWA 4BY5A 2Y1MA 1XYDA 4WRIA 5B8IB 1S1EA 1TCOB 1VRKA 2LE9B 4PE4A 1UURA 4M2PA 1XA5A 3WHUB 1F4QA 1U5IB 3VGOA 2LLTA 1SL8A 4CPVA 1MQ1A 1FPWA 1JUOA 1NWDA 1U5IA 2KHNA 1YX7A 2Y1NA 2CBLA 4MZJA 1BR1B 1W7JB 2KI6D 1J55A 2MHHA 3O2PA 1BT6A 1AK8A 2L4IA 2H61C 1PULA 2DOQA 2ZFDA 2HF5A 2LHLA 1XFZO 4DS7A 3E3RA 1KWOC 3KO0A 3PATA 1OZOA 2FOTA 1XFWO 4YBHB 1SKTA 1SYMA 2JXCA 1SPYA 3LLEA 2M7LA 2LP3A 2KAYA 1KK8C 2M7NA 2JTTA 1JFJA 3DF0B 4XJKA 1RTP1 1E8AA 1S26D 2OTGC 2JULA 3EKHA 1TNQA 2LLUA 4FTGA 2I2RE 4NDBA 1QS7A 1N0YA 1B8CA 3CR2A 1A75B 1A03A 1CKKA 3CLNA 2K2AA 1FBVA 2L4HA 3A8RA 4ZCVA 1L7ZA 5ER5A 3LL8B 2KAXA 3VROA 4GGFA 3I5GC 1BF5A 2BBNA 1CFCA 1K9UA 4HSZA 1DJXA 3FS7A 4BY4A 1V1GA 3NXAA 2Y4QA 3NSLA 4MVFA 4MRXA 2F2OA 1B8RA 4HRGA 3TS5B 1HT9A 2CXJA 3TUYB 1J7QA 3OB1B 3DD4A 1LINA 4MRYA 1S6JA 1B7TY 1DJWA 1SL7A 4AOMA 1Y6WA 1S3PA 2O60A 5DKRA 1NX2A 1A4PA 1H4BA 1F54A 2K7DA 2LHIA 1JSAA 1WLMA 1DF0B 2M49B 1ZACA 1DF0A 1JF2A 1S36A 4NDDA 1F70A 4N1GA 3CR5X 1UHKA 1EG4A 1LA3A 1SY9A 1G8IA 1TN4A 2LUCA 1NCXA 1RROA 1KCYA 1QVIY 3H4SE 2CCMA 2LMTA 2PMYA 2BCXA 2V53A 1IQ5A 1BR4B 3IQQA 4N5XA 2F8PA 2L5XB 4GGFC 3SIBA 2KYFA 5HLVA 4ORBB 1DGVA 1NCYA 1YTZC 2Q4UA 4MLWA 2LANA 1PSRA 3FWCA 2L98A 4PE7A 1LXFC 1SK6D 3CGAA 1NUBA 3DVEA 1X02A 2MLEC 4USLA 2WC8A 2I18A 2PSRA 2ZKMX 3MSEB 1KWOB 2KAVA 3TS5C 3TUYC 5AERA
chains in the Genus database with same CATH superfamily
1YUUA 2LCPA 3OX5A 2HQ8A 1F4OA 3CZ0A 4N1FA 4P5OE 2HPSA 4OZDA 1C7VA 1CLLA 1KK8B 1KFXS 1QV1A 1XK4A 1ZMZA 2BAPA 4PALA 2MRDA 1CDNA 1R6PA 1RECA 2GV5A 2WOSA 2KGRA 2OS8C 1QVIZ 3SG6A 1WY9A 2LAPA 4TNCA 1EL4A 2L2EA 3I5IC 2LMVA 2EHBA 1IWQA 2AAOA 1J1EA 4YGDB 5HKYA 3R1OA 4UPGA 4PHJA 1YX8A 4PE1A 3DZTA 1JBAA 5I2QA 1SNLA 4HRHA 5CSNA 1L2OC 3DVJA 1C07A 2FCEA 1SR6C 1OOHA 2AUCA 4GNKB 4WQ2A 3EVRA 1A2XA 2I94A 2SCPA 1Y1AA 2ZRSA 1K9PA 1IQ3A 2KBIA 1IGVA 2JNFA 2WC6A 4JWQA 1B9AA 2KFHA 4Q04A 4CFRA 2KI4C 2RGIA 4YGBB 1F8HA 2KQYA 3OX6A 3JTDC 2LVIA 5PALA 1SL9A 2ZRTA 3OP0A 1ZUZA 1J7PA 1OOIX 3D10A 2BKHB 5ER4X 2L50A 1K2HA 4I5LB 1CM4A 2GGZA 2LP2A 1KSMA 2KGBC 1OSAA 4MSPA 4DIRA 2F3ZA 1XK4C 5KU1A 4XJKB 5HKWA 1QX5B 1XFXO 2EC6B 3VRPA 3WNXB 2L2CA 3GOFA 4MZLA 1C3YA 3OB2B 1SMGA 1OE9B 2M0RA 3L47A 2A4JA 1EXRA 1MUXA 1YUTA 2JC2A 3I5HC 3CDNA 3GK4X 2MJWB 3GK2A 4ICBA 4MEWA 1KQMB 1KFXL 2MBXA 1B4CA 1PK0D 1DMOA 4NDCA 3HX4A 5FYXA 4F0ZB 1JWDA 1AP4A 2K0JA 1GM0A 1UUSA 2WCLA 4R1EA 2WCEA 2JNXA 4JD9A 1DC1A 1NP8A 4MZKA 1H8BA 1CDPA 2F2PA 1OMVA 2EGDA 2KOTA 4OR9B 5DICA 3S0BA 2L5YA 4CFQA 3CZ1A 3EVVA 1IH0A 2LMUA 1ODBA 2SASA 3BFHA 1XFUO 2QEOA 3AKAA 2ZNEA 1S6CA 1TUZA 1QX7A 2FCDA 2QPTA 3EK4A 4L9MA 1MXLC 1FW4A 1YRTB 5KTYA 1GGWA 1C3ZA 1IJ5A 1B8LA 2M3WA 1M63B 3N7HA 1K93D 3WHTB 5I2LA 1FF1A 3O78A 2ERBA 3D74A 1DJZA 4GPLB 1IKUA 1QWVA 2PRUA 3DYEA 5CSIA 2B1UA 2KDHA 3VRNA 2ZN9A 2WCHA 4INXA 1AJ4A 1UWOA 1QATA 5BPJA 1J1DA 1MHOA 1EG3A 1GQMA 2LVVA 4GAOA 1UHJA 1D1OA 2OS8B 1TIZA 1CDMA 4I5JA 2MAZA 3BUNB 1DGUA 1OW4A 1J7RA 1K94A 2EC6C 2GGMA 2JWWA 5CPVA 1JC2A 3I5IB 1JF0A 1PVBA 2Y5IA 4F7FA 4I5KA 2JXLA 1NPQA 1LVCD 1QLKA 2MLFC 3KPXA 3NSKA 3QMEA 1PRWA 3VRRA 1KQMC 1DELA 1NX0A 2WCBA 2E6WA 1B47A 1WRZA 1L2OB 3EK8A 4INWA 4GGNA 1SR6B 1S5GY 3GK1A 4MBEA 3B6XA 5J3XA 1EH2A 3KEVA 5AANA 2M9GA 1DJIA 2QACA 2NCPA 2JZIA 1OMRA 3ICBA 5I2OA 2KI4B 1BU3A 1A29A 3JTDB 1G4YR 3S0DA 3B87A 1NCZA 1B7TZ 1DJGA 4YGCB 4DUQA 3AKBA 3RM1A 2BBMA 2H2KA 2K60A 3FE6A 2CNPA 2K8MB 3WXAA 3CWGA 1LS8A 1EJ3A 1SBJA 1V1FA 2BE4A 2BL0B 4ETOA 2PQLA 1GJYA 5I8NA 2BE6A 1PVAA 1K8UA 1N2DA 4CIDA 1AHRA 2OPOA 4GBAA 4PDZA 5D7FA 1CNPA 2LVKA 4IJ7A 1AJ5A 1PSBA 2PASA 2QEHA 3I5HB 2FJUB 4AQJA 3S0FA 5JOLA 3S0AA 3HCMA 3KF9A 1CMFA 1NX1A 2NLNA 1CFDA 2KYCA 3NSIA 1XFYO 1S5GZ 1ZFSA 4FQTA 2KFGA 1YRUB 1M46A 3BOWB 4M2OA 5KSZA 1LKJA 1W9ZA 1T14A 1AUIB 4ZCUA 2TN4A 4PHMA 2ZNDA 1B1GA 2YGUA 3BOWA 1TWOA 3QRXA 4GFTA 4YI8A 1RK9A 3TDUA 2F33A 1OOJA 1WLZA 4GUKA 2P70A 4XYNA 5IBWA 3R1VA 3D0YB 1QTXA 4M2QA 4NQGA 3BYAA 2QEBA 3SG3A 1TCFA 3BJHA 3D0YA 3TZ1A 1DQEA 1NIWA 5JJGA 3IF7A 3DVMA 2KQ6A 3BUWB 5TNCA 5CSFA 2CT9A 4JQ0D 4YGEB 5EL2A 1W7IB 1SW8A 3PSRA 2M1KB 1S6IA 2LUXA 3I5FC 3JVTC 3NSOA 4YGAA 3SG4A 2NXQA 1QASA 2M8UA 2AMIA 3ZWHA 1UHNA 3DXLA 4FQOA 2BL0C 1Y1XA 3PN7B 1MF8B 3EKJA 4AQIA 4QJ3B 1GGZA 4OKHA 3O6BA 4OV2A 1SCMB 3LK0A 1CFPA 1RFJA 2GTEA 2JPOA 1CLMA 2KNEA 1MR8A 1TUJA 5CSJA 3A4UB 3LK1A 4U8DA 3IQOA 3L4AA 3DY9A 1MWNA 5K89A 3Q8IA 5D69A 5DKNA 3F45A 2LV7A 1OZSA 2L51A 3CS1A 1DT7B 5HLOA 4OVNF 3EVUA 2KBMA 4C0JA 1K96A 4QJ5B 4A4CA 1OQPA 4D1EA 2CTNA 3PALA 1SRAA 5FI2A 1IG5A 4PE0A 1YR5A 1QV0A 2NCOA 3DVKA 3PM8A 2LLSA 3SS4A 5F6TA 1WDCB 2F3YA 1CMGA 1FI5A 3M0WA 1QLSA 5GQQC 3O4XA 4QJ4B 3EG5B 1Z4HA 3D78A 1ORGA 3FIAA 1TNXA 3DF0A 2JT8A 3PFVA 2BCAA 1WRKA 2WNDA 3D75A 1BOCA 1A75A 4I5NB 1M39A 2M97A 3B88A 1XO5A 2KSPA 1Y1UA 4WQ3A 3BFBA 1QXPA 1ALWA 1YVHA 1KFUS 2M1UA 1G33A 1KQVA 1NX3A 2O5GA 2KI6C 1SCVA 5AEQA 3PN7C 1WRLA 3O4YA 3TDIA 4C0KA 4CLNA 4IL1A 2JTZA 2LVJA 4YI9A 4E68A 1SCMC 1FI6A 2QEVA 3D76A 1QIWA 4A4BA 5AXIA 1KK7Y 3CZTX 1DJHA 1UP5A 1ZOTB 2WCFA 1UHHA 5HYDA 1XFVO 2G9BA 1JFKA 4DRWA 3SG5A 1HQVA 2BECA 4P2YB 1CFFA 1XFRA 1MXEA 1NYAA 2QDIA 2VRGA 5D3OA 1DJYA 3KHEA 2WCKA 3K21A 3BUMB 1TRFA 4PHKA 2LM5A 2G2BA 1UHIA 1XVJA 1WDCC 4C0LA 2ZN8A 2JU0A 1TNWA 3BUOB 2JOJA 3FWBA 4HREE 4PHNA 2JRFA 2E30A 2D8NA 3BQ3A 1BG1A 3I5FB 3JVTB 1RJVA 3R72A 3LCPC 1BJFA 3V2LA 4ORAB 5G08A 1K9KA 3RLZA 3SJSA 1QJTA 3UNWA 3OBVA 3VB1A 1F71A 2LNKA 1CB1A 3BUXB 1IRJA 1TNPA 2K7OA 2BKIB 2KLEA 2JT0A 2KFFA 1OOFA 3CTNA 1N65A 4ORCB 1R2UA 1CLBA 5FI6A 1K95A 2COLB 3OHMB 4OCIA 3EK7A 1QX2A 1C7WA 1KK7Z 2JPTA 2P6BB 1Y0VH 1M45A 4MN0A 3PLFB 5HKZA 2HETA 1BMOA 3ZNIA 1KFUL 1YVLA 3R1PA 2HQWA 1IJ6A 3FE8A 2H61A 1LA0A 2L0PA 2NZ0A 1DVIA 3L4LA 1CTRA 1J7OA 1Q80A 1F55A 3SG7A 1M31A 1OOGA 2Q91A 2M29A 3CR4X 4JPZB 3C1VA 2PYQA 1OMDA 4YRUA 1NSHA 1PALA 1TOPA 2PALA 3B7AA 2IS9A 3SG2A 2JT3A 1RWYA 1TTXA 2OTGB 1AVSA 1ALVA 2R2IA 5HL1A 1CM1A 2LC5A 1KSOA 3CYZA 2ISDA 2K7CA 2I7AA 3AAJA 2K61A 1YURA 2K7BA 5DKQA 3VRQA 3AAKA 1K90D 5AFPA 3BXKA 1DEKA 3TDZA 2K2FA 1BLQA 3D77A 1CDLA 4DCKA 2BCBA 1QIVA 3SIAA 1YUSA 2PVBA 3I5GB 2WORA 2JQ6A 1BODA 1DTLA 2MA2A 3UO9A 4PCWA 4BY5A 3RZSA 2Y1MA 1XYDA 4WRIA 5B8IB 1S1EA 1TCOB 1VRKA 2LE9B 4PE4A 1UURA 4M2PA 1XA5A 3WHUB 1F4QA 1U5IB 3VGOA 2LLTA 1SL8A 3PM2A 4CPVA 1MQ1A 1FPWA 1JUOA 1NWDA 1U5IA 2KHNA 1YX7A 2Y1NA 2CBLA 4MZJA 1BR1B 1W7JB 2KI6D 1J55A 2MHHA 3O2PA 1BT6A 4KYNA 1AK8A 2L4IA 2H61C 1PULA 2DOQA 2ZFDA 2HF5A 2LHLA 1XFZO 4DS7A 3CZ2A 3E3RA 1KWOC 3KO0A 3PATA 1OZOA 2FOTA 1IIOA 1XFWO 4YBHB 1SKTA 1SYMA 2JXCA 1SPYA 2WC5A 3LLEA 2M7LA 3NGVA 2LP3A 2KAYA 2FJYA 1KK8C 2M7NA 2JTTA 1JFJA 3DF0B 3IVTA 4XJKA 1RTP1 1E8AA 1S26D 2OTGC 2JULA 3EKHA 1TNQA 2LLUA 4FTGA 2I2RE 4NDBA 1QS7A 1N0YA 1B8CA 3CR2A 1A75B 1A03A 1CKKA 2KPHA 3CLNA 3FE9A 2K2AA 1FBVA 2L4HA 3A8RA 3OGNA 4ZCVA 3S0GA 1L7ZA 2WCJA 5ER5A 3LL8B 2KAXA 3K1EA 4GGFA 3VROA 3I5GC 1BF5A 2BBNA 1CFCA 1K9UA 4HSZA 2H8VA 1DJXA 3FS7A 3SS5A 1V1GA 3BFAA 4BY4A 3NXAA 2Y4QA 3NSLA 1SSEB 4MVFA 2WCMA 4MRXA 2F2OA 1B8RA 4HRGA 2P71A 3TS5B 1HT9A 2CXJA 4JKTA 3TUYB 3D73A 1J7QA 3OB1B 3NHTA 3DD4A 1LINA 4PT1A 3SS3A 4MRYA 1S6JA 1B7TY 1DJWA 1Z2CB 1SL7A 4AOMA 1Y6WA 1S3PA 2O60A 5DKRA 1NX2A 1A4PA 3PJIA 5I94A 1H4BA 1F54A 2K7DA 2LHIA 1JSAA 1WLMA 3NHIA 1DF0B 2M49B 1ZACA 1DF0A 1JF2A 1S36A 4NDDA 1F70A 4N1GA 3CR5X 1UHKA 1EG4A 1LA3A 1SY9A 1G8IA 1TN4A 2LUCA 1NCXA 1RROA 1KCYA 1QVIY 3H4SE 2CCMA 2LMTA 2PMYA 2BCXA 2V53A 1IQ5A 1BR4B 3IQQA 4N5XA 2F8PA 2L5XB 2BNXA 4GGFC 3SIBA 5FI7A 2KYFA 5HLVA 2KLDA 4ORBB 3CABA 1DGVA 1NCYA 1YTZC 2Q4UA 4MLWA 3B86A 2LANA 1PSRA 3FWCA 1P28A 2L98A 4PE7A 1LXFC 1SK6D 3CGAA 3S0EA 1NUBA 3DVEA 1X02A 2MLEC 4USLA 2WC8A 2I18A 2PSRA 2ZKMX 3MSEB 1KWOB 2KAVA 3TS5C 3TUYC 5AERA
chains in the Genus database with same CATH topology
1YUUA 2LCPA 3OX5A 2HQ8A 1F4OA 4N1FA 4P5OE 2HPSA 1C7VA 1CLLA 1KK8B 1KFXS 1QV1A 1XK4A 1ZMZA 4PALA 2MRDA 1CDNA 1R6PA 1RECA 2GV5A 2WOSA 2KGRA 2OS8C 1QVIZ 3SG6A 1WY9A 2LAPA 4TNCA 1EL4A 2L2EA 3I5IC 2LMVA 2EHBA 1IWQA 2AAOA 1J1EA 4YGDB 5HKYA 4UPGA 4PHJA 1YX8A 4PE1A 1JBAA 5I2QA 1SNLA 4HRHA 5CSNA 1L2OC 3DVJA 1C07A 2FCEA 1SR6C 2AUCA 4GNKB 4WQ2A 3EVRA 1A2XA 2I94A 2SCPA 1Y1AA 2ZRSA 1K9PA 1IQ3A 2KBIA 1IGVA 2JNFA 4CFRA 4JWQA 1B9AA 2KFHA 4Q04A 1F8HA 2KI4C 2RGIA 4YGBB 2KQYA 3OX6A 3JTDC 2LVIA 5PALA 1SL9A 2ZRTA 3OP0A 1ZUZA 1J7PA 3D10A 2BKHB 5ER4X 2L50A 1K2HA 4I5LB 1CM4A 2GGZA 2LP2A 1KSMA 2KGBC 1OSAA 4MSPA 4DIRA 2F3ZA 1XK4C 5KU1A 4XJKB 5HKWA 1QX5B 1XFXO 2EC6B 3VRPA 3WNXB 3GOFA 4MZLA 3OB2B 1SMGA 1OE9B 2M0RA 2A4JA 1EXRA 1MUXA 1YUTA 2JC2A 3I5HC 3GK4X 2MJWB 3GK2A 4ICBA 4MEWA 1KQMB 1KFXL 2MBXA 1B4CA 1PK0D 1DMOA 4NDCA 3HX4A 5FYXA 4F0ZB 1JWDA 1AP4A 2K0JA 1UUSA 4R1EA 2WCEA 2JNXA 1NP8A 4MZKA 1H8BA 1CDPA 2F2PA 1OMVA 2EGDA 2KOTA 4OR9B 4CFQA 3EVVA 1IH0A 2LMUA 1ODBA 2SASA 1XFUO 3AKAA 2ZNEA 1S6CA 3EK4A 1QX7A 2FCDA 2QPTA 4L9MA 1GGWA 1MXLC 1FW4A 1YRTB 5KTYA 1IJ5A 1B8LA 2M3WA 1M63B 1K93D 3WHTB 5I2LA 1FF1A 3O78A 4GPLB 1DJZA 1IKUA 2PRUA 5CSIA 2B1UA 2KDHA 3VRNA 2ZN9A 1AJ4A 1UWOA 1QATA 5BPJA 1J1DA 1MHOA 1EG3A 1GQMA 2LVVA 4GAOA 1UHJA 1D1OA 2OS8B 1TIZA 1CDMA 4I5JA 2MAZA 3BUNB 1DGUA 1J7RA 1K94A 2EC6C 2GGMA 2JWWA 5CPVA 1JC2A 3I5IB 1JF0A 1PVBA 2Y5IA 4I5KA 2JXLA 1NPQA 1LVCD 1QLKA 2MLFC 3KPXA 3NSKA 1PRWA 3VRRA 1KQMC 2WCBA 1NX0A 2E6WA 1B47A 1WRZA 1L2OB 3EK8A 4GGNA 1SR6B 1S5GY 3GK1A 4MBEA 5J3XA 1EH2A 3KEVA 5AANA 2M9GA 1DJIA 2QACA 2NCPA 2JZIA 1OMRA 3ICBA 5I2OA 2KI4B 1BU3A 1A29A 3JTDB 1G4YR 1NCZA 1B7TZ 1DJGA 4YGCB 4DUQA 3AKBA 3RM1A 2BBMA 2H2KA 2CNPA 2K8MB 3WXAA 3CWGA 1EJ3A 1SBJA 1V1FA 2BE4A 2BL0B 4ETOA 5I8NA 1GJYA 2BE6A 1PVAA 1K8UA 1N2DA 4CIDA 1AHRA 2OPOA 4GBAA 4PDZA 5D7FA 1CNPA 2LVKA 1AJ5A 1PSBA 2PASA 4AQJA 3I5HB 2FJUB 5JOLA 3HCMA 3KF9A 1CMFA 1NX1A 2NLNA 1CFDA 2KYCA 3NSIA 1XFYO 1S5GZ 1ZFSA 2KFGA 1YRUB 1M46A 3BOWB 4M2OA 5KSZA 1LKJA 1AUIB 4ZCUA 2TN4A 4PHMA 2ZNDA 1B1GA 3QRXA 3BOWA 4YI8A 4GFTA 1RK9A 3TDUA 2F33A 1OOJA 1WLZA 4GUKA 4XYNA 5IBWA 3D0YB 1QTXA 4M2QA 4NQGA 3BYAA 3SG3A 1TCFA 3D0YA 3TZ1A 1NIWA 5JJGA 3IF7A 3DVMA 2KQ6A 3BUWB 5TNCA 5CSFA 2CT9A 4JQ0D 4YGEB 1W7IB 1SW8A 3PSRA 2M1KB 1S6IA 2LUXA 3I5FC 3JVTC 3NSOA 4YGAA 3SG4A 2NXQA 1QASA 2M8UA 2AMIA 3ZWHA 1UHNA 4FQOA 2BL0C 1Y1XA 3PN7B 1MF8B 3EKJA 4AQIA 4QJ3B 1GGZA 4OKHA 3O6BA 4OV2A 1SCMB 3LK0A 1CFPA 1RFJA 1CLMA 2KNEA 1MR8A 5CSJA 3A4UB 3LK1A 4U8DA 3IQOA 1MWNA 5K89A 5D69A 5DKNA 3F45A 2LV7A 1OZSA 2L51A 3CS1A 1DT7B 5HLOA 4OVNF 3EVUA 2KBMA 4C0JA 1K96A 4QJ5B 4A4CA 1OQPA 4D1EA 2CTNA 3PALA 1SRAA 1IG5A 4PE0A 1YR5A 1QV0A 2NCOA 3DVKA 3PM8A 2LLSA 1CMGA 5F6TA 1WDCB 2F3YA 1FI5A 3M0WA 1QLSA 5GQQC 4QJ4B 3FIAA 1TNXA 3DF0A 2JT8A 3PFVA 2BCAA 1WRKA 2WNDA 1BOCA 1A75A 4I5NB 1M39A 2M97A 1XO5A 2KSPA 1Y1UA 4WQ3A 1QXPA 1ALWA 1YVHA 1KFUS 2M1UA 1G33A 1KQVA 1NX3A 2O5GA 2KI6C 1SCVA 5AEQA 3PN7C 1WRLA 3O4YA 3TDIA 4C0KA 4CLNA 4IL1A 2JTZA 2LVJA 4YI9A 4E68A 1SCMC 1FI6A 1QIWA 4A4BA 5AXIA 1KK7Y 3CZTX 1DJHA 1UP5A 1ZOTB 2WCFA 1UHHA 5HYDA 1XFVO 2G9BA 1JFKA 4DRWA 3SG5A 1HQVA 2BECA 4P2YB 1CFFA 1MXEA 1NYAA 2VRGA 1DJYA 3KHEA 3K21A 3BUMB 1TRFA 4PHKA 2LM5A 2G2BA 1UHIA 1XVJA 1WDCC 4C0LA 2ZN8A 2JU0A 1TNWA 3BUOB 2JOJA 3FWBA 4HREE 4PHNA 2JRFA 2E30A 2D8NA 3BQ3A 1BG1A 3I5FB 3JVTB 1RJVA 3LCPC 1BJFA 4ORAB 5G08A 1K9KA 3RLZA 3SJSA 1QJTA 1F71A 2LNKA 1CB1A 3BUXB 1IRJA 1TNPA 2K7OA 2BKIB 2JT0A 2KFFA 3CTNA 1N65A 4ORCB 1R2UA 1CLBA 1K95A 2COLB 3OHMB 4OCIA 3EK7A 1QX2A 1C7WA 1KK7Z 2JPTA 2P6BB 1Y0VH 1M45A 4MN0A 3PLFB 5HKZA 2HETA 1BMOA 3ZNIA 1KFUL 1YVLA 2HQWA 1IJ6A 2H61A 1LA0A 2L0PA 2NZ0A 1DVIA 1CTRA 1J7OA 1Q80A 1F55A 3SG7A 1M31A 2Q91A 2M29A 3CR4X 4JPZB 3C1VA 1OMDA 4YRUA 1NSHA 1PALA 1TOPA 2PALA 2IS9A 3SG2A 2JT3A 1RWYA 1TTXA 2OTGB 1AVSA 1ALVA 2R2IA 1CM1A 2LC5A 1KSOA 2ISDA 2K7CA 2I7AA 3AAJA 2K61A 1YURA 2K7BA 5DKQA 3VRQA 3AAKA 1K90D 5AFPA 3BXKA 3TDZA 2K2FA 1BLQA 1CDLA 4DCKA 2BCBA 1QIVA 3SIAA 1YUSA 2PVBA 3I5GB 2WORA 2JQ6A 1BODA 1DTLA 2MA2A 4PCWA 4BY5A 2Y1MA 1XYDA 4WRIA 5B8IB 1S1EA 1TCOB 1VRKA 2LE9B 4PE4A 1UURA 4M2PA 1XA5A 3WHUB 1F4QA 1U5IB 3VGOA 2LLTA 1SL8A 4CPVA 1MQ1A 1FPWA 1JUOA 1NWDA 1U5IA 2KHNA 1YX7A 2Y1NA 2CBLA 4MZJA 1BR1B 1W7JB 2KI6D 1J55A 2MHHA 3O2PA 1BT6A 1AK8A 2L4IA 2H61C 1PULA 2DOQA 2ZFDA 2HF5A 2LHLA 1XFZO 4DS7A 3E3RA 1KWOC 3KO0A 3PATA 1OZOA 2FOTA 1XFWO 4YBHB 1SKTA 1SYMA 2JXCA 1SPYA 3LLEA 2M7LA 2LP3A 2KAYA 1KK8C 2M7NA 2JTTA 1JFJA 3DF0B 4XJKA 1RTP1 1E8AA 1S26D 2OTGC 2JULA 3EKHA 1TNQA 2LLUA 4FTGA 2I2RE 4NDBA 1QS7A 1N0YA 1B8CA 3CR2A 1A75B 1A03A 1CKKA 3CLNA 2K2AA 1FBVA 2L4HA 3A8RA 4ZCVA 1L7ZA 5ER5A 3LL8B 2KAXA 3VROA 4GGFA 3I5GC 1BF5A 2BBNA 1CFCA 1K9UA 4HSZA 1DJXA 3FS7A 4BY4A 1V1GA 3NXAA 2Y4QA 3NSLA 4MVFA 4MRXA 2F2OA 1B8RA 4HRGA 3TS5B 1HT9A 2CXJA 3TUYB 1J7QA 3OB1B 3DD4A 1LINA 4MRYA 1S6JA 1B7TY 1DJWA 1SL7A 4AOMA 1Y6WA 1S3PA 2O60A 5DKRA 1NX2A 1A4PA 1H4BA 1F54A 2K7DA 2LHIA 1JSAA 1WLMA 1DF0B 2M49B 1ZACA 1DF0A 1JF2A 1S36A 4NDDA 1F70A 4N1GA 3CR5X 1UHKA 1EG4A 1LA3A 1SY9A 1G8IA 1TN4A 2LUCA 1NCXA 1RROA 1KCYA 1QVIY 3H4SE 2CCMA 2LMTA 2PMYA 2BCXA 2V53A 1IQ5A 1BR4B 3IQQA 4N5XA 2F8PA 2L5XB 4GGFC 3SIBA 2KYFA 5HLVA 4ORBB 1DGVA 1NCYA 1YTZC 2Q4UA 4MLWA 2LANA 1PSRA 3FWCA 2L98A 4PE7A 1LXFC 1SK6D 3CGAA 1NUBA 3DVEA 1X02A 2MLEC 4USLA 2WC8A 2I18A 2PSRA 2ZKMX 3MSEB 1KWOB 2KAVA 3TS5C 3TUYC 5AERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YUU A;  2LCP A;  3OX5 A;  2HQ8 A;  1F4O A;  4N1F A;  4P5O E;  2HPS A;  1C7V A;  1CLL A;  1KK8 B;  1KFX S;  1QV1 A;  1XK4 A;  1ZMZ A;  4PAL A;  2MRD A;  1CDN A;  1R6P A;  1REC A;  2GV5 A;  2WOS A;  2KGR A;  2OS8 C;  1QVI Z;  3SG6 A;  1WY9 A;  2LAP A;  4TNC A;  1EL4 A;  2L2E A;  3I5I C;  2LMV A;  2EHB A;  1IWQ A;  2AAO A;  1J1E A;  4YGD B;  5HKY A;  4UPG A;  4PHJ A;  1YX8 A;  4PE1 A;  1JBA A;  5I2Q A;  1SNL A;  4HRH A;  5CSN A;  1L2O C;  3DVJ A;  1C07 A;  2FCE A;  1SR6 C;  2AUC A;  4GNK B;  4WQ2 A;  3EVR A;  1A2X A;  2I94 A;  2SCP A;  1Y1A A;  2ZRS A;  1K9P A;  1IQ3 A;  2KBI A;  1IGV A;  2JNF A;  4CFR A;  4JWQ A;  1B9A A;  2KFH A;  4Q04 A;  1F8H A;  2KI4 C;  2RGI A;  4YGB B;  2KQY A;  3OX6 A;  3JTD C;  2LVI A;  5PAL A;  1SL9 A;  2ZRT A;  3OP0 A;  1ZUZ A;  1J7P A;  3D10 A;  2BKH B;  5ER4 X;  2L50 A;  1K2H A;  4I5L B;  1CM4 A;  2GGZ A;  2LP2 A;  1KSM A;  2KGB C;  1OSA A;  4MSP A;  4DIR A;  2F3Z A;  1XK4 C;  5KU1 A;  4XJK B;  5HKW A;  1QX5 B;  1XFX O;  2EC6 B;  3VRP A;  3WNX B;  3GOF A;  4MZL A;  3OB2 B;  1SMG A;  1OE9 B;  2M0R A;  2A4J A;  1EXR A;  1MUX A;  1YUT A;  2JC2 A;  3I5H C;  3GK4 X;  2MJW B;  3GK2 A;  4ICB A;  4MEW A;  1KQM B;  1KFX L;  2MBX A;  1B4C A;  1PK0 D;  1DMO A;  4NDC A;  3HX4 A;  5FYX A;  4F0Z B;  1JWD A;  1AP4 A;  2K0J A;  1UUS A;  4R1E A;  2WCE A;  2JNX A;  1NP8 A;  4MZK A;  1H8B A;  1CDP A;  2F2P A;  1OMV A;  2EGD A;  2KOT A;  4OR9 B;  4CFQ A;  3EVV A;  1IH0 A;  2LMU A;  1ODB A;  2SAS A;  1XFU O;  3AKA A;  2ZNE A;  1S6C A;  3EK4 A;  1QX7 A;  2FCD A;  2QPT A;  4L9M A;  1GGW A;  1MXL C;  1FW4 A;  1YRT B;  5KTY A;  1IJ5 A;  1B8L A;  2M3W A;  1M63 B;  1K93 D;  3WHT B;  5I2L A;  1FF1 A;  3O78 A;  4GPL B;  1DJZ A;  1IKU A;  2PRU A;  5CSI A;  2B1U A;  2KDH A;  3VRN A;  2ZN9 A;  1AJ4 A;  1UWO A;  1QAT A;  5BPJ A;  1J1D A;  1MHO A;  1EG3 A;  1GQM A;  2LVV A;  4GAO A;  1UHJ A;  1D1O A;  2OS8 B;  1TIZ A;  1CDM A;  4I5J A;  2MAZ A;  3BUN B;  1DGU A;  1J7R A;  1K94 A;  2EC6 C;  2GGM A;  2JWW A;  5CPV A;  1JC2 A;  3I5I B;  1JF0 A;  1PVB A;  2Y5I A;  4I5K A;  2JXL A;  1NPQ A;  1LVC D;  1QLK A;  2MLF C;  3KPX A;  3NSK A;  1PRW A;  3VRR A;  1KQM C;  2WCB A;  1NX0 A;  2E6W A;  1B47 A;  1WRZ A;  1L2O B;  3EK8 A;  4GGN A;  1SR6 B;  1S5G Y;  3GK1 A;  4MBE A;  5J3X A;  1EH2 A;  3KEV A;  5AAN A;  2M9G A;  1DJI A;  2QAC A;  2NCP A;  2JZI A;  1OMR A;  3ICB A;  5I2O A;  2KI4 B;  1BU3 A;  1A29 A;  3JTD B;  1G4Y R;  1NCZ A;  1B7T Z;  1DJG A;  4YGC B;  4DUQ A;  3AKB A;  3RM1 A;  2BBM A;  2H2K A;  2CNP A;  2K8M B;  3WXA A;  3CWG A;  1EJ3 A;  1SBJ A;  1V1F A;  2BE4 A;  2BL0 B;  4ETO A;  5I8N A;  1GJY A;  2BE6 A;  1PVA A;  1K8U A;  1N2D A;  4CID A;  1AHR A;  2OPO A;  4GBA A;  4PDZ A;  5D7F A;  1CNP A;  2LVK A;  1AJ5 A;  1PSB A;  2PAS A;  4AQJ A;  3I5H B;  2FJU B;  5JOL A;  3HCM A;  3KF9 A;  1CMF A;  1NX1 A;  2NLN A;  1CFD A;  2KYC A;  3NSI A;  1XFY O;  1S5G Z;  1ZFS A;  2KFG A;  1YRU B;  1M46 A;  3BOW B;  4M2O A;  5KSZ A;  1LKJ A;  1AUI B;  4ZCU A;  2TN4 A;  4PHM A;  2ZND A;  1B1G A;  3QRX A;  3BOW A;  4YI8 A;  4GFT A;  1RK9 A;  3TDU A;  2F33 A;  1OOJ A;  1WLZ A;  4GUK A;  4XYN A;  5IBW A;  3D0Y B;  1QTX A;  4M2Q A;  4NQG A;  3BYA A;  3SG3 A;  1TCF A;  3D0Y A;  3TZ1 A;  1NIW A;  5JJG A;  3IF7 A;  3DVM A;  2KQ6 A;  3BUW B;  5TNC A;  5CSF A;  2CT9 A;  4JQ0 D;  4YGE B;  1W7I B;  1SW8 A;  3PSR A;  2M1K B;  1S6I A;  2LUX A;  3I5F C;  3JVT C;  3NSO A;  4YGA A;  3SG4 A;  2NXQ A;  1QAS A;  2M8U A;  2AMI A;  3ZWH A;  1UHN A;  4FQO A;  2BL0 C;  1Y1X A;  3PN7 B;  1MF8 B;  3EKJ A;  4AQI A;  4QJ3 B;  1GGZ A;  4OKH A;  3O6B A;  4OV2 A;  1SCM B;  3LK0 A;  1CFP A;  1RFJ A;  1CLM A;  2KNE A;  1MR8 A;  5CSJ A;  3A4U B;  3LK1 A;  4U8D A;  3IQO A;  1MWN A;  5K89 A;  5D69 A;  5DKN A;  3F45 A;  2LV7 A;  1OZS A;  2L51 A;  3CS1 A;  1DT7 B;  5HLO A;  4OVN F;  3EVU A;  2KBM A;  4C0J A;  1K96 A;  4QJ5 B;  4A4C A;  1OQP A;  4D1E A;  2CTN A;  3PAL A;  1SRA A;  1IG5 A;  4PE0 A;  1YR5 A;  1QV0 A;  2NCO A;  3DVK A;  3PM8 A;  2LLS A;  1CMG A;  5F6T A;  1WDC B;  2F3Y A;  1FI5 A;  3M0W A;  1QLS A;  5GQQ C;  4QJ4 B;  3FIA A;  1TNX A;  3DF0 A;  2JT8 A;  3PFV A;  2BCA A;  1WRK A;  2WND A;  1BOC A;  1A75 A;  4I5N B;  1M39 A;  2M97 A;  1XO5 A;  2KSP A;  1Y1U A;  4WQ3 A;  1QXP A;  1ALW A;  1YVH A;  1KFU S;  2M1U A;  1G33 A;  1KQV A;  1NX3 A;  2O5G A;  2KI6 C;  1SCV A;  5AEQ A;  3PN7 C;  1WRL A;  3O4Y A;  3TDI A;  4C0K A;  4CLN A;  4IL1 A;  2JTZ A;  2LVJ A;  4YI9 A;  4E68 A;  1SCM C;  1FI6 A;  1QIW A;  4A4B A;  5AXI A;  1KK7 Y;  3CZT X;  1DJH A;  1UP5 A;  1ZOT B;  2WCF A;  1UHH A;  5HYD A;  1XFV O;  2G9B A;  1JFK A;  4DRW A;  3SG5 A;  1HQV A;  2BEC A;  4P2Y B;  1CFF A;  1MXE A;  1NYA A;  2VRG A;  1DJY A;  3KHE A;  3K21 A;  3BUM B;  1TRF A;  4PHK A;  2LM5 A;  2G2B A;  1UHI A;  1XVJ A;  1WDC C;  4C0L A;  2ZN8 A;  2JU0 A;  1TNW A;  3BUO B;  2JOJ A;  3FWB A;  4HRE E;  4PHN A;  2JRF A;  2E30 A;  2D8N A;  3BQ3 A;  1BG1 A;  3I5F B;  3JVT B;  1RJV A;  3LCP C;  1BJF A;  4ORA B;  5G08 A;  1K9K A;  3RLZ A;  3SJS A;  1QJT A;  1F71 A;  2LNK A;  1CB1 A;  3BUX B;  1IRJ A;  1TNP A;  2K7O A;  2BKI B;  2JT0 A;  2KFF A;  3CTN A;  1N65 A;  4ORC B;  1R2U A;  1CLB A;  1K95 A;  2COL B;  3OHM B;  4OCI A;  3EK7 A;  1QX2 A;  1C7W A;  1KK7 Z;  2JPT A;  2P6B B;  1Y0V H;  1M45 A;  4MN0 A;  3PLF B;  5HKZ A;  2HET A;  1BMO A;  3ZNI A;  1KFU L;  1YVL A;  2HQW A;  1IJ6 A;  2H61 A;  1LA0 A;  2L0P A;  2NZ0 A;  1DVI A;  1CTR A;  1J7O A;  1Q80 A;  1F55 A;  3SG7 A;  1M31 A;  2Q91 A;  2M29 A;  3CR4 X;  4JPZ B;  3C1V A;  1OMD A;  4YRU A;  1NSH A;  1PAL A;  1TOP A;  2PAL A;  2IS9 A;  3SG2 A;  2JT3 A;  1RWY A;  1TTX A;  2OTG B;  1AVS A;  1ALV A;  2R2I A;  1CM1 A;  2LC5 A;  1KSO A;  2ISD A;  2K7C A;  2I7A A;  3AAJ A;  2K61 A;  1YUR A;  2K7B A;  5DKQ A;  3VRQ A;  3AAK A;  1K90 D;  5AFP A;  3BXK A;  3TDZ A;  2K2F A;  1BLQ A;  1CDL A;  4DCK A;  2BCB A;  1QIV A;  3SIA A;  1YUS A;  2PVB A;  3I5G B;  2WOR A;  2JQ6 A;  1BOD A;  1DTL A;  2MA2 A;  4PCW A;  4BY5 A;  2Y1M A;  1XYD A;  4WRI A;  5B8I B;  1S1E A;  1TCO B;  1VRK A;  2LE9 B;  4PE4 A;  1UUR A;  4M2P A;  1XA5 A;  3WHU B;  1F4Q A;  1U5I B;  3VGO A;  2LLT A;  1SL8 A;  4CPV A;  1MQ1 A;  1FPW A;  1JUO A;  1NWD A;  1U5I A;  2KHN A;  1YX7 A;  2Y1N A;  2CBL A;  4MZJ A;  1BR1 B;  1W7J B;  2KI6 D;  1J55 A;  2MHH A;  3O2P A;  1BT6 A;  1AK8 A;  2L4I A;  2H61 C;  1PUL A;  2DOQ A;  2ZFD A;  2HF5 A;  2LHL A;  1XFZ O;  4DS7 A;  3E3R A;  1KWO C;  3KO0 A;  3PAT A;  1OZO A;  2FOT A;  1XFW O;  4YBH B;  1SKT A;  1SYM A;  2JXC A;  1SPY A;  3LLE A;  2M7L A;  2LP3 A;  2KAY A;  1KK8 C;  2M7N A;  2JTT A;  1JFJ A;  3DF0 B;  4XJK A;  1RTP 1;  1E8A A;  1S26 D;  2OTG C;  2JUL A;  3EKH A;  1TNQ A;  2LLU A;  4FTG A;  2I2R E;  4NDB A;  1QS7 A;  1N0Y A;  1B8C A;  3CR2 A;  1A75 B;  1A03 A;  1CKK A;  3CLN A;  2K2A A;  1FBV A;  2L4H A;  3A8R A;  4ZCV A;  1L7Z A;  5ER5 A;  3LL8 B;  2KAX A;  3VRO A;  4GGF A;  3I5G C;  1BF5 A;  2BBN A;  1CFC A;  1K9U A;  4HSZ A;  1DJX A;  3FS7 A;  4BY4 A;  1V1G A;  3NXA A;  2Y4Q A;  3NSL A;  4MVF A;  4MRX A;  2F2O A;  1B8R A;  4HRG A;  3TS5 B;  1HT9 A;  2CXJ A;  3TUY B;  1J7Q A;  3OB1 B;  3DD4 A;  1LIN A;  4MRY A;  1S6J A;  1B7T Y;  1DJW A;  1SL7 A;  4AOM A;  1Y6W A;  1S3P A;  2O60 A;  5DKR A;  1NX2 A;  1A4P A;  1H4B A;  1F54 A;  2K7D A;  2LHI A;  1JSA A;  1WLM A;  1DF0 B;  2M49 B;  1ZAC A;  1DF0 A;  1JF2 A;  1S36 A;  4NDD A;  1F70 A;  4N1G A;  3CR5 X;  1UHK A;  1EG4 A;  1LA3 A;  1SY9 A;  1G8I A;  1TN4 A;  2LUC A;  1NCX A;  1RRO A;  1KCY A;  1QVI Y;  3H4S E;  2CCM A;  2LMT A;  2PMY A;  2BCX A;  2V53 A;  1IQ5 A;  1BR4 B;  3IQQ A;  4N5X A;  2F8P A;  2L5X B;  4GGF C;  3SIB A;  2KYF A;  5HLV A;  4ORB B;  1DGV A;  1NCY A;  1YTZ C;  2Q4U A;  4MLW A;  2LAN A;  1PSR A;  3FWC A;  2L98 A;  4PE7 A;  1LXF C;  1SK6 D;  3CGA A;  1NUB A;  3DVE A;  1X02 A;  2MLE C;  4USL A;  2WC8 A;  2I18 A;  2PSR A;  2ZKM X;  3MSE B;  1KWO B;  2KAV A;  3TS5 C;  3TUY C;  5AER A; 
#chains in the Genus database with same CATH topology
 1YUU A;  2LCP A;  3OX5 A;  2HQ8 A;  1F4O A;  3CZ0 A;  4N1F A;  4P5O E;  2HPS A;  4OZD A;  1C7V A;  1CLL A;  1KK8 B;  1KFX S;  1QV1 A;  1XK4 A;  1ZMZ A;  2BAP A;  4PAL A;  2MRD A;  1CDN A;  1R6P A;  1REC A;  2GV5 A;  2WOS A;  2KGR A;  2OS8 C;  1QVI Z;  3SG6 A;  1WY9 A;  2LAP A;  4TNC A;  1EL4 A;  2L2E A;  3I5I C;  2LMV A;  2EHB A;  1IWQ A;  2AAO A;  1J1E A;  4YGD B;  5HKY A;  3R1O A;  4UPG A;  4PHJ A;  1YX8 A;  4PE1 A;  3DZT A;  1JBA A;  5I2Q A;  1SNL A;  4HRH A;  5CSN A;  1L2O C;  3DVJ A;  1C07 A;  2FCE A;  1SR6 C;  1OOH A;  2AUC A;  4GNK B;  4WQ2 A;  3EVR A;  1A2X A;  2I94 A;  2SCP A;  1Y1A A;  2ZRS A;  1K9P A;  1IQ3 A;  2KBI A;  1IGV A;  2JNF A;  2WC6 A;  4JWQ A;  1B9A A;  2KFH A;  4Q04 A;  4CFR A;  2KI4 C;  2RGI A;  4YGB B;  1F8H A;  2KQY A;  3OX6 A;  3JTD C;  2LVI A;  5PAL A;  1SL9 A;  2ZRT A;  3OP0 A;  1ZUZ A;  1J7P A;  1OOI X;  3D10 A;  2BKH B;  5ER4 X;  2L50 A;  1K2H A;  4I5L B;  1CM4 A;  2GGZ A;  2LP2 A;  1KSM A;  2KGB C;  1OSA A;  4MSP A;  4DIR A;  2F3Z A;  1XK4 C;  5KU1 A;  4XJK B;  5HKW A;  1QX5 B;  1XFX O;  2EC6 B;  3VRP A;  3WNX B;  2L2C A;  3GOF A;  4MZL A;  1C3Y A;  3OB2 B;  1SMG A;  1OE9 B;  2M0R A;  3L47 A;  2A4J A;  1EXR A;  1MUX A;  1YUT A;  2JC2 A;  3I5H C;  3CDN A;  3GK4 X;  2MJW B;  3GK2 A;  4ICB A;  4MEW A;  1KQM B;  1KFX L;  2MBX A;  1B4C A;  1PK0 D;  1DMO A;  4NDC A;  3HX4 A;  5FYX A;  4F0Z B;  1JWD A;  1AP4 A;  2K0J A;  1GM0 A;  1UUS A;  2WCL A;  4R1E A;  2WCE A;  2JNX A;  4JD9 A;  1DC1 A;  1NP8 A;  4MZK A;  1H8B A;  1CDP A;  2F2P A;  1OMV A;  2EGD A;  2KOT A;  4OR9 B;  5DIC A;  3S0B A;  2L5Y A;  4CFQ A;  3CZ1 A;  3EVV A;  1IH0 A;  2LMU A;  1ODB A;  2SAS A;  3BFH A;  1XFU O;  2QEO A;  3AKA A;  2ZNE A;  1S6C A;  1TUZ A;  1QX7 A;  2FCD A;  2QPT A;  3EK4 A;  4L9M A;  1MXL C;  1FW4 A;  1YRT B;  5KTY A;  1GGW A;  1C3Z A;  1IJ5 A;  1B8L A;  2M3W A;  1M63 B;  3N7H A;  1K93 D;  3WHT B;  5I2L A;  1FF1 A;  3O78 A;  2ERB A;  3D74 A;  1DJZ A;  4GPL B;  1IKU A;  1QWV A;  2PRU A;  3DYE A;  5CSI A;  2B1U A;  2KDH A;  3VRN A;  2ZN9 A;  2WCH A;  4INX A;  1AJ4 A;  1UWO A;  1QAT A;  5BPJ A;  1J1D A;  1MHO A;  1EG3 A;  1GQM A;  2LVV A;  4GAO A;  1UHJ A;  1D1O A;  2OS8 B;  1TIZ A;  1CDM A;  4I5J A;  2MAZ A;  3BUN B;  1DGU A;  1OW4 A;  1J7R A;  1K94 A;  2EC6 C;  2GGM A;  2JWW A;  5CPV A;  1JC2 A;  3I5I B;  1JF0 A;  1PVB A;  2Y5I A;  4F7F A;  4I5K A;  2JXL A;  1NPQ A;  1LVC D;  1QLK A;  2MLF C;  3KPX A;  3NSK A;  3QME A;  1PRW A;  3VRR A;  1KQM C;  1DEL A;  1NX0 A;  2WCB A;  2E6W A;  1B47 A;  1WRZ A;  1L2O B;  3EK8 A;  4INW A;  4GGN A;  1SR6 B;  1S5G Y;  3GK1 A;  4MBE A;  3B6X A;  5J3X A;  1EH2 A;  3KEV A;  5AAN A;  2M9G A;  1DJI A;  2QAC A;  2NCP A;  2JZI A;  1OMR A;  3ICB A;  5I2O A;  2KI4 B;  1BU3 A;  1A29 A;  3JTD B;  1G4Y R;  3S0D A;  3B87 A;  1NCZ A;  1B7T Z;  1DJG A;  4YGC B;  4DUQ A;  3AKB A;  3RM1 A;  2BBM A;  2H2K A;  2K60 A;  3FE6 A;  2CNP A;  2K8M B;  3WXA A;  3CWG A;  1LS8 A;  1EJ3 A;  1SBJ A;  1V1F A;  2BE4 A;  2BL0 B;  4ETO A;  2PQL A;  1GJY A;  5I8N A;  2BE6 A;  1PVA A;  1K8U A;  1N2D A;  4CID A;  1AHR A;  2OPO A;  4GBA A;  4PDZ A;  5D7F A;  1CNP A;  2LVK A;  4IJ7 A;  1AJ5 A;  1PSB A;  2PAS A;  2QEH A;  3I5H B;  2FJU B;  4AQJ A;  3S0F A;  5JOL A;  3S0A A;  3HCM A;  3KF9 A;  1CMF A;  1NX1 A;  2NLN A;  1CFD A;  2KYC A;  3NSI A;  1XFY O;  1S5G Z;  1ZFS A;  4FQT A;  2KFG A;  1YRU B;  1M46 A;  3BOW B;  4M2O A;  5KSZ A;  1LKJ A;  1W9Z A;  1T14 A;  1AUI B;  4ZCU A;  2TN4 A;  4PHM A;  2ZND A;  1B1G A;  2YGU A;  3BOW A;  1TWO A;  3QRX A;  4GFT A;  4YI8 A;  1RK9 A;  3TDU A;  2F33 A;  1OOJ A;  1WLZ A;  4GUK A;  2P70 A;  4XYN A;  5IBW A;  3R1V A;  3D0Y B;  1QTX A;  4M2Q A;  4NQG A;  3BYA A;  2QEB A;  3SG3 A;  1TCF A;  3BJH A;  3D0Y A;  3TZ1 A;  1DQE A;  1NIW A;  5JJG A;  3IF7 A;  3DVM A;  2KQ6 A;  3BUW B;  5TNC A;  5CSF A;  2CT9 A;  4JQ0 D;  4YGE B;  5EL2 A;  1W7I B;  1SW8 A;  3PSR A;  2M1K B;  1S6I A;  2LUX A;  3I5F C;  3JVT C;  3NSO A;  4YGA A;  3SG4 A;  2NXQ A;  1QAS A;  2M8U A;  2AMI A;  3ZWH A;  1UHN A;  3DXL A;  4FQO A;  2BL0 C;  1Y1X A;  3PN7 B;  1MF8 B;  3EKJ A;  4AQI A;  4QJ3 B;  1GGZ A;  4OKH A;  3O6B A;  4OV2 A;  1SCM B;  3LK0 A;  1CFP A;  1RFJ A;  2GTE A;  2JPO A;  1CLM A;  2KNE A;  1MR8 A;  1TUJ A;  5CSJ A;  3A4U B;  3LK1 A;  4U8D A;  3IQO A;  3L4A A;  3DY9 A;  1MWN A;  5K89 A;  3Q8I A;  5D69 A;  5DKN A;  3F45 A;  2LV7 A;  1OZS A;  2L51 A;  3CS1 A;  1DT7 B;  5HLO A;  4OVN F;  3EVU A;  2KBM A;  4C0J A;  1K96 A;  4QJ5 B;  4A4C A;  1OQP A;  4D1E A;  2CTN A;  3PAL A;  1SRA A;  5FI2 A;  1IG5 A;  4PE0 A;  1YR5 A;  1QV0 A;  2NCO A;  3DVK A;  3PM8 A;  2LLS A;  3SS4 A;  5F6T A;  1WDC B;  2F3Y A;  1CMG A;  1FI5 A;  3M0W A;  1QLS A;  5GQQ C;  3O4X A;  4QJ4 B;  3EG5 B;  1Z4H A;  3D78 A;  1ORG A;  3FIA A;  1TNX A;  3DF0 A;  2JT8 A;  3PFV A;  2BCA A;  1WRK A;  2WND A;  3D75 A;  1BOC A;  1A75 A;  4I5N B;  1M39 A;  2M97 A;  3B88 A;  1XO5 A;  2KSP A;  1Y1U A;  4WQ3 A;  3BFB A;  1QXP A;  1ALW A;  1YVH A;  1KFU S;  2M1U A;  1G33 A;  1KQV A;  1NX3 A;  2O5G A;  2KI6 C;  1SCV A;  5AEQ A;  3PN7 C;  1WRL A;  3O4Y A;  3TDI A;  4C0K A;  4CLN A;  4IL1 A;  2JTZ A;  2LVJ A;  4YI9 A;  4E68 A;  1SCM C;  1FI6 A;  2QEV A;  3D76 A;  1QIW A;  4A4B A;  5AXI A;  1KK7 Y;  3CZT X;  1DJH A;  1UP5 A;  1ZOT B;  2WCF A;  1UHH A;  5HYD A;  1XFV O;  2G9B A;  1JFK A;  4DRW A;  3SG5 A;  1HQV A;  2BEC A;  4P2Y B;  1CFF A;  1XFR A;  1MXE A;  1NYA A;  2QDI A;  2VRG A;  5D3O A;  1DJY A;  3KHE A;  2WCK A;  3K21 A;  3BUM B;  1TRF A;  4PHK A;  2LM5 A;  2G2B A;  1UHI A;  1XVJ A;  1WDC C;  4C0L A;  2ZN8 A;  2JU0 A;  1TNW A;  3BUO B;  2JOJ A;  3FWB A;  4HRE E;  4PHN A;  2JRF A;  2E30 A;  2D8N A;  3BQ3 A;  1BG1 A;  3I5F B;  3JVT B;  1RJV A;  3R72 A;  3LCP C;  1BJF A;  3V2L A;  4ORA B;  5G08 A;  1K9K A;  3RLZ A;  3SJS A;  1QJT A;  3UNW A;  3OBV A;  3VB1 A;  1F71 A;  2LNK A;  1CB1 A;  3BUX B;  1IRJ A;  1TNP A;  2K7O A;  2BKI B;  2KLE A;  2JT0 A;  2KFF A;  1OOF A;  3CTN A;  1N65 A;  4ORC B;  1R2U A;  1CLB A;  5FI6 A;  1K95 A;  2COL B;  3OHM B;  4OCI A;  3EK7 A;  1QX2 A;  1C7W A;  1KK7 Z;  2JPT A;  2P6B B;  1Y0V H;  1M45 A;  4MN0 A;  3PLF B;  5HKZ A;  2HET A;  1BMO A;  3ZNI A;  1KFU L;  1YVL A;  3R1P A;  2HQW A;  1IJ6 A;  3FE8 A;  2H61 A;  1LA0 A;  2L0P A;  2NZ0 A;  1DVI A;  3L4L A;  1CTR A;  1J7O A;  1Q80 A;  1F55 A;  3SG7 A;  1M31 A;  1OOG A;  2Q91 A;  2M29 A;  3CR4 X;  4JPZ B;  3C1V A;  2PYQ A;  1OMD A;  4YRU A;  1NSH A;  1PAL A;  1TOP A;  2PAL A;  3B7A A;  2IS9 A;  3SG2 A;  2JT3 A;  1RWY A;  1TTX A;  2OTG B;  1AVS A;  1ALV A;  2R2I A;  5HL1 A;  1CM1 A;  2LC5 A;  1KSO A;  3CYZ A;  2ISD A;  2K7C A;  2I7A A;  3AAJ A;  2K61 A;  1YUR A;  2K7B A;  5DKQ A;  3VRQ A;  3AAK A;  1K90 D;  5AFP A;  3BXK A;  1DEK A;  3TDZ A;  2K2F A;  1BLQ A;  3D77 A;  1CDL A;  4DCK A;  2BCB A;  1QIV A;  3SIA A;  1YUS A;  2PVB A;  3I5G B;  2WOR A;  2JQ6 A;  1BOD A;  1DTL A;  2MA2 A;  3UO9 A;  4PCW A;  4BY5 A;  3RZS A;  2Y1M A;  1XYD A;  4WRI A;  5B8I B;  1S1E A;  1TCO B;  1VRK A;  2LE9 B;  4PE4 A;  1UUR A;  4M2P A;  1XA5 A;  3WHU B;  1F4Q A;  1U5I B;  3VGO A;  2LLT A;  1SL8 A;  3PM2 A;  4CPV A;  1MQ1 A;  1FPW A;  1JUO A;  1NWD A;  1U5I A;  2KHN A;  1YX7 A;  2Y1N A;  2CBL A;  4MZJ A;  1BR1 B;  1W7J B;  2KI6 D;  1J55 A;  2MHH A;  3O2P A;  1BT6 A;  4KYN A;  1AK8 A;  2L4I A;  2H61 C;  1PUL A;  2DOQ A;  2ZFD A;  2HF5 A;  2LHL A;  1XFZ O;  4DS7 A;  3CZ2 A;  3E3R A;  1KWO C;  3KO0 A;  3PAT A;  1OZO A;  2FOT A;  1IIO A;  1XFW O;  4YBH B;  1SKT A;  1SYM A;  2JXC A;  1SPY A;  2WC5 A;  3LLE A;  2M7L A;  3NGV A;  2LP3 A;  2KAY A;  2FJY A;  1KK8 C;  2M7N A;  2JTT A;  1JFJ A;  3DF0 B;  3IVT A;  4XJK A;  1RTP 1;  1E8A A;  1S26 D;  2OTG C;  2JUL A;  3EKH A;  1TNQ A;  2LLU A;  4FTG A;  2I2R E;  4NDB A;  1QS7 A;  1N0Y A;  1B8C A;  3CR2 A;  1A75 B;  1A03 A;  1CKK A;  2KPH A;  3CLN A;  3FE9 A;  2K2A A;  1FBV A;  2L4H A;  3A8R A;  3OGN A;  4ZCV A;  3S0G A;  1L7Z A;  2WCJ A;  5ER5 A;  3LL8 B;  2KAX A;  3K1E A;  4GGF A;  3VRO A;  3I5G C;  1BF5 A;  2BBN A;  1CFC A;  1K9U A;  4HSZ A;  2H8V A;  1DJX A;  3FS7 A;  3SS5 A;  1V1G A;  3BFA A;  4BY4 A;  3NXA A;  2Y4Q A;  3NSL A;  1SSE B;  4MVF A;  2WCM A;  4MRX A;  2F2O A;  1B8R A;  4HRG A;  2P71 A;  3TS5 B;  1HT9 A;  2CXJ A;  4JKT A;  3TUY B;  3D73 A;  1J7Q A;  3OB1 B;  3NHT A;  3DD4 A;  1LIN A;  4PT1 A;  3SS3 A;  4MRY A;  1S6J A;  1B7T Y;  1DJW A;  1Z2C B;  1SL7 A;  4AOM A;  1Y6W A;  1S3P A;  2O60 A;  5DKR A;  1NX2 A;  1A4P A;  3PJI A;  5I94 A;  1H4B A;  1F54 A;  2K7D A;  2LHI A;  1JSA A;  1WLM A;  3NHI A;  1DF0 B;  2M49 B;  1ZAC A;  1DF0 A;  1JF2 A;  1S36 A;  4NDD A;  1F70 A;  4N1G A;  3CR5 X;  1UHK A;  1EG4 A;  1LA3 A;  1SY9 A;  1G8I A;  1TN4 A;  2LUC A;  1NCX A;  1RRO A;  1KCY A;  1QVI Y;  3H4S E;  2CCM A;  2LMT A;  2PMY A;  2BCX A;  2V53 A;  1IQ5 A;  1BR4 B;  3IQQ A;  4N5X A;  2F8P A;  2L5X B;  2BNX A;  4GGF C;  3SIB A;  5FI7 A;  2KYF A;  5HLV A;  2KLD A;  4ORB B;  3CAB A;  1DGV A;  1NCY A;  1YTZ C;  2Q4U A;  4MLW A;  3B86 A;  2LAN A;  1PSR A;  3FWC A;  1P28 A;  2L98 A;  4PE7 A;  1LXF C;  1SK6 D;  3CGA A;  3S0E A;  1NUB A;  3DVE A;  1X02 A;  2MLE C;  4USL A;  2WC8 A;  2I18 A;  2PSR A;  2ZKM X;  3MSE B;  1KWO B;  2KAV A;  3TS5 C;  3TUY C;  5AER A; 
#chains in the Genus database with same CATH homology
 1YUU A;  2LCP A;  3OX5 A;  2HQ8 A;  1F4O A;  4N1F A;  4P5O E;  2HPS A;  1C7V A;  1CLL A;  1KK8 B;  1KFX S;  1QV1 A;  1XK4 A;  1ZMZ A;  4PAL A;  2MRD A;  1CDN A;  1R6P A;  1REC A;  2GV5 A;  2WOS A;  2KGR A;  2OS8 C;  1QVI Z;  3SG6 A;  1WY9 A;  2LAP A;  4TNC A;  1EL4 A;  2L2E A;  3I5I C;  2LMV A;  2EHB A;  1IWQ A;  2AAO A;  1J1E A;  4YGD B;  5HKY A;  4UPG A;  4PHJ A;  1YX8 A;  4PE1 A;  1JBA A;  5I2Q A;  1SNL A;  4HRH A;  5CSN A;  1L2O C;  3DVJ A;  1C07 A;  2FCE A;  1SR6 C;  2AUC A;  4GNK B;  4WQ2 A;  3EVR A;  1A2X A;  2I94 A;  2SCP A;  1Y1A A;  2ZRS A;  1K9P A;  1IQ3 A;  2KBI A;  1IGV A;  2JNF A;  4CFR A;  4JWQ A;  1B9A A;  2KFH A;  4Q04 A;  1F8H A;  2KI4 C;  2RGI A;  4YGB B;  2KQY A;  3OX6 A;  3JTD C;  2LVI A;  5PAL A;  1SL9 A;  2ZRT A;  3OP0 A;  1ZUZ A;  1J7P A;  3D10 A;  2BKH B;  5ER4 X;  2L50 A;  1K2H A;  4I5L B;  1CM4 A;  2GGZ A;  2LP2 A;  1KSM A;  2KGB C;  1OSA A;  4MSP A;  4DIR A;  2F3Z A;  1XK4 C;  5KU1 A;  4XJK B;  5HKW A;  1QX5 B;  1XFX O;  2EC6 B;  3VRP A;  3WNX B;  3GOF A;  4MZL A;  3OB2 B;  1SMG A;  1OE9 B;  2M0R A;  2A4J A;  1EXR A;  1MUX A;  1YUT A;  2JC2 A;  3I5H C;  3GK4 X;  2MJW B;  3GK2 A;  4ICB A;  4MEW A;  1KQM B;  1KFX L;  2MBX A;  1B4C A;  1PK0 D;  1DMO A;  4NDC A;  3HX4 A;  5FYX A;  4F0Z B;  1JWD A;  1AP4 A;  2K0J A;  1UUS A;  4R1E A;  2WCE A;  2JNX A;  1NP8 A;  4MZK A;  1H8B A;  1CDP A;  2F2P A;  1OMV A;  2EGD A;  2KOT A;  4OR9 B;  4CFQ A;  3EVV A;  1IH0 A;  2LMU A;  1ODB A;  2SAS A;  1XFU O;  3AKA A;  2ZNE A;  1S6C A;  3EK4 A;  1QX7 A;  2FCD A;  2QPT A;  4L9M A;  1GGW A;  1MXL C;  1FW4 A;  1YRT B;  5KTY A;  1IJ5 A;  1B8L A;  2M3W A;  1M63 B;  1K93 D;  3WHT B;  5I2L A;  1FF1 A;  3O78 A;  4GPL B;  1DJZ A;  1IKU A;  2PRU A;  5CSI A;  2B1U A;  2KDH A;  3VRN A;  2ZN9 A;  1AJ4 A;  1UWO A;  1QAT A;  5BPJ A;  1J1D A;  1MHO A;  1EG3 A;  1GQM A;  2LVV A;  4GAO A;  1UHJ A;  1D1O A;  2OS8 B;  1TIZ A;  1CDM A;  4I5J A;  2MAZ A;  3BUN B;  1DGU A;  1J7R A;  1K94 A;  2EC6 C;  2GGM A;  2JWW A;  5CPV A;  1JC2 A;  3I5I B;  1JF0 A;  1PVB A;  2Y5I A;  4I5K A;  2JXL A;  1NPQ A;  1LVC D;  1QLK A;  2MLF C;  3KPX A;  3NSK A;  1PRW A;  3VRR A;  1KQM C;  2WCB A;  1NX0 A;  2E6W A;  1B47 A;  1WRZ A;  1L2O B;  3EK8 A;  4GGN A;  1SR6 B;  1S5G Y;  3GK1 A;  4MBE A;  5J3X A;  1EH2 A;  3KEV A;  5AAN A;  2M9G A;  1DJI A;  2QAC A;  2NCP A;  2JZI A;  1OMR A;  3ICB A;  5I2O A;  2KI4 B;  1BU3 A;  1A29 A;  3JTD B;  1G4Y R;  1NCZ A;  1B7T Z;  1DJG A;  4YGC B;  4DUQ A;  3AKB A;  3RM1 A;  2BBM A;  2H2K A;  2CNP A;  2K8M B;  3WXA A;  3CWG A;  1EJ3 A;  1SBJ A;  1V1F A;  2BE4 A;  2BL0 B;  4ETO A;  5I8N A;  1GJY A;  2BE6 A;  1PVA A;  1K8U A;  1N2D A;  4CID A;  1AHR A;  2OPO A;  4GBA A;  4PDZ A;  5D7F A;  1CNP A;  2LVK A;  1AJ5 A;  1PSB A;  2PAS A;  4AQJ A;  3I5H B;  2FJU B;  5JOL A;  3HCM A;  3KF9 A;  1CMF A;  1NX1 A;  2NLN A;  1CFD A;  2KYC A;  3NSI A;  1XFY O;  1S5G Z;  1ZFS A;  2KFG A;  1YRU B;  1M46 A;  3BOW B;  4M2O A;  5KSZ A;  1LKJ A;  1AUI B;  4ZCU A;  2TN4 A;  4PHM A;  2ZND A;  1B1G A;  3QRX A;  3BOW A;  4YI8 A;  4GFT A;  1RK9 A;  3TDU A;  2F33 A;  1OOJ A;  1WLZ A;  4GUK A;  4XYN A;  5IBW A;  3D0Y B;  1QTX A;  4M2Q A;  4NQG A;  3BYA A;  3SG3 A;  1TCF A;  3D0Y A;  3TZ1 A;  1NIW A;  5JJG A;  3IF7 A;  3DVM A;  2KQ6 A;  3BUW B;  5TNC A;  5CSF A;  2CT9 A;  4JQ0 D;  4YGE B;  1W7I B;  1SW8 A;  3PSR A;  2M1K B;  1S6I A;  2LUX A;  3I5F C;  3JVT C;  3NSO A;  4YGA A;  3SG4 A;  2NXQ A;  1QAS A;  2M8U A;  2AMI A;  3ZWH A;  1UHN A;  4FQO A;  2BL0 C;  1Y1X A;  3PN7 B;  1MF8 B;  3EKJ A;  4AQI A;  4QJ3 B;  1GGZ A;  4OKH A;  3O6B A;  4OV2 A;  1SCM B;  3LK0 A;  1CFP A;  1RFJ A;  1CLM A;  2KNE A;  1MR8 A;  5CSJ A;  3A4U B;  3LK1 A;  4U8D A;  3IQO A;  1MWN A;  5K89 A;  5D69 A;  5DKN A;  3F45 A;  2LV7 A;  1OZS A;  2L51 A;  3CS1 A;  1DT7 B;  5HLO A;  4OVN F;  3EVU A;  2KBM A;  4C0J A;  1K96 A;  4QJ5 B;  4A4C A;  1OQP A;  4D1E A;  2CTN A;  3PAL A;  1SRA A;  1IG5 A;  4PE0 A;  1YR5 A;  1QV0 A;  2NCO A;  3DVK A;  3PM8 A;  2LLS A;  1CMG A;  5F6T A;  1WDC B;  2F3Y A;  1FI5 A;  3M0W A;  1QLS A;  5GQQ C;  4QJ4 B;  3FIA A;  1TNX A;  3DF0 A;  2JT8 A;  3PFV A;  2BCA A;  1WRK A;  2WND A;  1BOC A;  1A75 A;  4I5N B;  1M39 A;  2M97 A;  1XO5 A;  2KSP A;  1Y1U A;  4WQ3 A;  1QXP A;  1ALW A;  1YVH A;  1KFU S;  2M1U A;  1G33 A;  1KQV A;  1NX3 A;  2O5G A;  2KI6 C;  1SCV A;  5AEQ A;  3PN7 C;  1WRL A;  3O4Y A;  3TDI A;  4C0K A;  4CLN A;  4IL1 A;  2JTZ A;  2LVJ A;  4YI9 A;  4E68 A;  1SCM C;  1FI6 A;  1QIW A;  4A4B A;  5AXI A;  1KK7 Y;  3CZT X;  1DJH A;  1UP5 A;  1ZOT B;  2WCF A;  1UHH A;  5HYD A;  1XFV O;  2G9B A;  1JFK A;  4DRW A;  3SG5 A;  1HQV A;  2BEC A;  4P2Y B;  1CFF A;  1MXE A;  1NYA A;  2VRG A;  1DJY A;  3KHE A;  3K21 A;  3BUM B;  1TRF A;  4PHK A;  2LM5 A;  2G2B A;  1UHI A;  1XVJ A;  1WDC C;  4C0L A;  2ZN8 A;  2JU0 A;  1TNW A;  3BUO B;  2JOJ A;  3FWB A;  4HRE E;  4PHN A;  2JRF A;  2E30 A;  2D8N A;  3BQ3 A;  1BG1 A;  3I5F B;  3JVT B;  1RJV A;  3LCP C;  1BJF A;  4ORA B;  5G08 A;  1K9K A;  3RLZ A;  3SJS A;  1QJT A;  1F71 A;  2LNK A;  1CB1 A;  3BUX B;  1IRJ A;  1TNP A;  2K7O A;  2BKI B;  2JT0 A;  2KFF A;  3CTN A;  1N65 A;  4ORC B;  1R2U A;  1CLB A;  1K95 A;  2COL B;  3OHM B;  4OCI A;  3EK7 A;  1QX2 A;  1C7W A;  1KK7 Z;  2JPT A;  2P6B B;  1Y0V H;  1M45 A;  4MN0 A;  3PLF B;  5HKZ A;  2HET A;  1BMO A;  3ZNI A;  1KFU L;  1YVL A;  2HQW A;  1IJ6 A;  2H61 A;  1LA0 A;  2L0P A;  2NZ0 A;  1DVI A;  1CTR A;  1J7O A;  1Q80 A;  1F55 A;  3SG7 A;  1M31 A;  2Q91 A;  2M29 A;  3CR4 X;  4JPZ B;  3C1V A;  1OMD A;  4YRU A;  1NSH A;  1PAL A;  1TOP A;  2PAL A;  2IS9 A;  3SG2 A;  2JT3 A;  1RWY A;  1TTX A;  2OTG B;  1AVS A;  1ALV A;  2R2I A;  1CM1 A;  2LC5 A;  1KSO A;  2ISD A;  2K7C A;  2I7A A;  3AAJ A;  2K61 A;  1YUR A;  2K7B A;  5DKQ A;  3VRQ A;  3AAK A;  1K90 D;  5AFP A;  3BXK A;  3TDZ A;  2K2F A;  1BLQ A;  1CDL A;  4DCK A;  2BCB A;  1QIV A;  3SIA A;  1YUS A;  2PVB A;  3I5G B;  2WOR A;  2JQ6 A;  1BOD A;  1DTL A;  2MA2 A;  4PCW A;  4BY5 A;  2Y1M A;  1XYD A;  4WRI A;  5B8I B;  1S1E A;  1TCO B;  1VRK A;  2LE9 B;  4PE4 A;  1UUR A;  4M2P A;  1XA5 A;  3WHU B;  1F4Q A;  1U5I B;  3VGO A;  2LLT A;  1SL8 A;  4CPV A;  1MQ1 A;  1FPW A;  1JUO A;  1NWD A;  1U5I A;  2KHN A;  1YX7 A;  2Y1N A;  2CBL A;  4MZJ A;  1BR1 B;  1W7J B;  2KI6 D;  1J55 A;  2MHH A;  3O2P A;  1BT6 A;  1AK8 A;  2L4I A;  2H61 C;  1PUL A;  2DOQ A;  2ZFD A;  2HF5 A;  2LHL A;  1XFZ O;  4DS7 A;  3E3R A;  1KWO C;  3KO0 A;  3PAT A;  1OZO A;  2FOT A;  1XFW O;  4YBH B;  1SKT A;  1SYM A;  2JXC A;  1SPY A;  3LLE A;  2M7L A;  2LP3 A;  2KAY A;  1KK8 C;  2M7N A;  2JTT A;  1JFJ A;  3DF0 B;  4XJK A;  1RTP 1;  1E8A A;  1S26 D;  2OTG C;  2JUL A;  3EKH A;  1TNQ A;  2LLU A;  4FTG A;  2I2R E;  4NDB A;  1QS7 A;  1N0Y A;  1B8C A;  3CR2 A;  1A75 B;  1A03 A;  1CKK A;  3CLN A;  2K2A A;  1FBV A;  2L4H A;  3A8R A;  4ZCV A;  1L7Z A;  5ER5 A;  3LL8 B;  2KAX A;  3VRO A;  4GGF A;  3I5G C;  1BF5 A;  2BBN A;  1CFC A;  1K9U A;  4HSZ A;  1DJX A;  3FS7 A;  4BY4 A;  1V1G A;  3NXA A;  2Y4Q A;  3NSL A;  4MVF A;  4MRX A;  2F2O A;  1B8R A;  4HRG A;  3TS5 B;  1HT9 A;  2CXJ A;  3TUY B;  1J7Q A;  3OB1 B;  3DD4 A;  1LIN A;  4MRY A;  1S6J A;  1B7T Y;  1DJW A;  1SL7 A;  4AOM A;  1Y6W A;  1S3P A;  2O60 A;  5DKR A;  1NX2 A;  1A4P A;  1H4B A;  1F54 A;  2K7D A;  2LHI A;  1JSA A;  1WLM A;  1DF0 B;  2M49 B;  1ZAC A;  1DF0 A;  1JF2 A;  1S36 A;  4NDD A;  1F70 A;  4N1G A;  3CR5 X;  1UHK A;  1EG4 A;  1LA3 A;  1SY9 A;  1G8I A;  1TN4 A;  2LUC A;  1NCX A;  1RRO A;  1KCY A;  1QVI Y;  3H4S E;  2CCM A;  2LMT A;  2PMY A;  2BCX A;  2V53 A;  1IQ5 A;  1BR4 B;  3IQQ A;  4N5X A;  2F8P A;  2L5X B;  4GGF C;  3SIB A;  2KYF A;  5HLV A;  4ORB B;  1DGV A;  1NCY A;  1YTZ C;  2Q4U A;  4MLW A;  2LAN A;  1PSR A;  3FWC A;  2L98 A;  4PE7 A;  1LXF C;  1SK6 D;  3CGA A;  1NUB A;  3DVE A;  1X02 A;  2MLE C;  4USL A;  2WC8 A;  2I18 A;  2PSR A;  2ZKM X;  3MSE B;  1KWO B;  2KAV A;  3TS5 C;  3TUY C;  5AER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...