1FF1A

Structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfl
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR SUBSTRATE 15
publication title Molecular mechanism of NPF recognition by EH domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ff1A00
3BUOB 3LCPC 1DJHA 1B47A 5CPVA 2WCFA 1NX3A 1NYAA 1JF2A 2JT0A 1XFWO 4DS7A 1SL9A 4NDBA 2CBLA 3IQQA 1FPWA 1EXRA 1QIVA 3LK0A 1A2XA 1DJYA 1H8BA 2BCAA 2JOJA 2Q4UA 4XJKB 1DJZA 5CSFA 1CM4A 2KI4B 1SR6C 2EC6B 3FS7A 4GGFC 1K2HA 2R2IA 2ZRTA 1IJ5A 1RTP1 2CCMA 2L0PA 4A4BA 4HSZA 3VROA 3TDIA 2E6WA 5DKNA 1JF0A 3PATA 5DKQA 4CIDA 1YVLA 1NPQA 3NXAA 2CNPA 1WY9A 2WCEA 1SCMC 1QX5B 2FJUB 2F33A 1PVBA 3I5GC 2KI6C 1CLMA 1F4QA 1MR8A 4DRWA 1AJ5A 1NCYA 3D0YA 5HLOA 1QS7A 4P5OE 1TIZA 3PALA 2M49B 3PN7B 1CFFA 2H2KA 1UHKA 4N1GA 3O78A 1K9PA 2LM5A 1NUBA 1XYDA 2Y4QA 2NXQA 2BBMA 3LK1A 2ZFDA 1K95A 2F2PA 2M8UA 2KYFA 2WOSA 2M1UA 1K93D 4MLWA 2JTTA 1OQPA 2K61A 3EVUA 1JUOA 4CFQA 1L2OC 2JQ6A 2KSPA 4GBAA 2LE9B 1QJTA 1CB1A 2K2FA 3DVKA 4HRHA 1SPYA 4YGBB 1BR4B 2LLSA 3VRQA 1NIWA 2BECA 4MRYA 1IH0A 2KOTA 2I2RE 4PHJA 2GV5A 2K7CA 3I5HB 3LLEA 1QASA 5AEQA 3WHTB 2SASA 1B8RA 1H4BA 2NLNA 3NSKA 5CSNA 2CXJA 1EJ3A 1S3PA 3CR5X 1J7QA 4M2OA 5KTYA 2M0RA 2LMTA 1ALWA 3I5FC 2MA2A 4YBHB 1IQ5A 1A29A 1TNXA 2ISDA 1TNWA 3F45A 3NSOA 1BLQA 1RJVA 1M39A 2M97A 2QPTA 1SK6D 2BKHB 3D0YB 2PASA 1M31A 1TCOB 3KO0A 1DF0A 1UP5A 2LMUA 5PALA 2JXLA 2DOQA 1BU3A 3SG5A 3E3RA 1C07A 2M3WA 5TNCA 1SL8A 5AANA 3PFVA 1E8AA 1XFZO 3TZ1A 1J1EA 2HQWA 4ORBB 2JT3A 5I2LA 4WQ3A 2LHIA 2HETA 1OMVA 2KNEA 3NSIA 2MBXA 4YGCB 4C0KA 5D69A 3DVJA 1TNPA 3TDUA 3GK4X 2WNDA 1S5GY 3ZWHA 1KK7Z 2OS8B 5GQQC 2KDHA 2WORA 4GAOA 1YR5A 4QJ3B 3TUYB 1XFVO 1S6JA 2H61C 3KEVA 1NSHA 1NX2A 2B1UA 2MLFC 4CLNA 3WNXB 1YX7A 1F71A 4U8DA 4MRXA 1KQMC 1Y1AA 1SKTA 2WC8A 1KWOB 1PSRA 1LA0A 1WRLA 1YUSA 2L98A 3TS5B 3EK4A 1RFJA 3DVMA 1L7ZA 1S6IA 1SBJA 5HYDA 1N2DA 1CDPA 4DIRA 2BCXA 1QTXA 1SRAA 3WXAA 1BODA 5I2QA 1DF0B 1G33A 5BPJA 3VRPA 3D10A 1XK4A 2L50A 1AUIB 1JC2A 2CTNA 3OB2B 4Q04A 1K9UA 2M29A 1PRWA 3PSRA 5KU1A 1BOCA 4AQJA 3BUWB 1DJXA 4I5JA 1MXLC 2BL0C 2LV7A 4FTGA 1ZOTB 1NCXA 4GUKA 1UWOA 1PK0D 2LNKA 1QVIZ 1RECA 1N65A 2CT9A 1KFXL 3RLZA 1GGZA 2KFHA 2NCOA 2Y1MA 3KF9A 2KFFA 2KI6D 2PALA 2M7NA 1IG5A 2KQ6A 3SIBA 1TTXA 4OCIA 4CPVA 1HT9A 1BR1B 2JXCA 1UHNA 2MRDA 3K21A 3O6BA 3SIAA 4P2YB 3VGOA 1F8HA 1B4CA 2ZNEA 2EC6C 1TNQA 3I5IB 3O4YA 1FW4A 1TRFA 4D1EA 2OTGB 1CLBA 1X02A 1C7WA 4F0ZB 4YI8A 1J7RA 1JFJA 1KSOA 5J3XA 1S36A 4N5XA 2KBMA 1A03A 2COLB 3I5GB 1KK7Y 3SJSA 1YRTB 4OR9B 1F54A 5HLVA 3SG7A 1OMDA 2PMYA 4PE7A 4M2PA 2KGBC 3PN7C 4I5LB 4QJ4B 1UHJA 2MHHA 1RK9A 2D8NA 3SG2A 4PHMA 3AAJA 2HF5A 1SYMA 2K7BA 3GK1A 1KK8B 4A4CA 1XFXO 2M9GA 1IWQA 1MWNA 1M45A 1EG4A 1OE9B 1PVAA 4JQ0D 1FF1A 2WCBA 3CWGA 1IJ6A 2BCBA 2LUXA 1S26D 4OKHA 1QX2A 1R6PA 4MEWA 4AOMA 4DUQA 1XK4C 4MZKA 2LVKA 2LMVA 1GJYA 3ZNIA 3NSLA 4FQOA 1IRJA 1SCVA 4NDCA 1QLKA 4YI9A 1YRUB 4BY4A 1R2UA 4PE4A 2Q91A 1ZMZA 3CGAA 1AVSA 1NP8A 1B7TZ 1YVHA 2O5GA 2FCDA 1A75B 3EK7A 3I5HC 4ICBA 4NQGA 1ALVA 1SY9A 3MSEB 1MQ1A 1YURA 3BQ3A 1MXEA 2KQYA 3BUMB 4HRGA 2I7AA 1DT7B 1MUXA 1JSAA 1CMFA 1LKJA 1OMRA 3OB1B 5K89A 5I8NA 3KPXA 4XYNA 4E68A 4M2QA 1RWYA 3JTDC 4JPZB 3VRNA 1J7PA 2PSRA 4L9MA 3TDZA 1QV1A 1Q80A 3CR4X 1CMGA 3C1VA 1WDCB 5CSJA 1TCFA 2I18A 1GGWA 1ZFSA 2EHBA 3JVTB 3M0WA 5ER5A 1WRKA 2ZRSA 3HX4A 3DF0B 1KFUS 1LXFC 1AK8A 4TNCA 3KHEA 1DJIA 4YGAA 1CLLA 2KGRA 1BT6A 1CTRA 2K7OA 4ETOA 1B8LA 2KHNA 1J7OA 1YX8A 1CFPA 4PHKA 1OZOA 1WLMA 3GOFA 2JNFA 4GGFA 2K7DA 4MZJA 3RM1A 4MSPA 5JOLA 3EKJA 1PSBA 4USLA 3QRXA 2JWWA 3BOWB 4PHNA 4QJ5B 4AQIA 2GGZA 2O60A 1DGUA 1JWDA 1K8UA 3SG3A 3FWBA 2KAYA 1Y6WA 1DJGA 1QATA 1UURA 2Y5IA 4MVFA 1OZSA 2A4JA 3A4UB 1VRKA 5CSIA 2FOTA 2JRFA 2NZ0A 2LP2A 3TS5C 2LVIA 1CDMA 2M1KB 1B1GA 1QX7A 1RROA 1YUTA 3EVRA 1B9AA 3OHMB 2L4IA 2JPTA 1PALA 1JFKA 1BG1A 3CZTX 5AFPA 3AKAA 4PDZA 3H4SE 1LINA 1CDNA 1HQVA 2G9BA 3WHUB 3FWCA 1IQ3A 2BBNA 3EVVA 3CTNA 4GPLB 4MBEA 5AXIA 4NDDA 2JC2A 1PULA 4GNKB 2JNXA 2Y1NA 5I2OA 1A75A 1SR6B 1KSMA 2MLEC 2KI4C 4MN0A 1CDLA 2PVBA 1AJ4A 1DTLA 1BMOA 3AAKA 2KBIA 2LVVA 2L4HA 3VRRA 4C0LA 2LANA 1XO5A 1QV0A 1S6CA 4ZCUA 1SCMB 1XFUO 2PRUA 5D7FA 2K0JA 3CS1A 2GGMA 1SNLA 4ORAB 4WRIA 2VRGA 3DD4A 3I5IC 3BXKA 1WLZA 4I5KA 2F2OA 2OTGC 2AMIA 1EG3A 5B8IB 1C7VA 5G08A 1IKUA 3DF0A 3FIAA 1SW8A 2HQ8A 1G8IA 3PM8A 1BJFA 2ZN9A 1V1FA 1Y1UA 4GFTA 5HKZA 1NCZA 1K90D 1L2OB 2ZKMX 3OX5A 5HKYA 2F8PA 1S5GZ 1MHOA 5AERA 1WRZA 2HPSA 1KK8C 1LA3A 3CLNA 4JWQA 2OPOA 2KAVA 5HKWA 1ODBA 3BOWA 1JBAA 2TN4A 2H61A 1AHRA 1K9KA 4HREE 2LUCA 2JZIA 2ZNDA 3LL8B 3CR2A 1FI6A 1IGVA 1TOPA 1ZUZA 2G2BA 1XVJA 5IBWA 1ZACA 1QVIY 1U5IA 1W7JB 4N1FA 1NX1A 2LLUA 4YRUA 1B8CA 2EGDA 3I5FB 3ICBA 2KAXA 1SMGA 1SL7A 2LP3A 4DCKA 1F70A 1FBVA 1D1OA 4OV2A 2K8MB 3O2PA 1DGVA 1CNPA 1QIWA 2KFGA 1CM1A 2JU0A 1G4YR 1YUUA 3EKHA 2K2AA 1TN4A 3BUXB 5KSZA 3A8RA 2LHLA 1F4OA 1UHHA 3IQOA 4MZLA 1KCYA 5F6TA 1K94A 2KYCA 1QXPA 1S1EA 2LVJA 2M7LA 1LVCD 1Y0VH 3JTDB 4C0JA 2FCEA 1OSAA 2LLTA 4OVNF 2LC5A 3BUNB 5FYXA 2JULA 3DVEA 1OOJA 4CFRA 2SCPA 1KQVA 1EL4A 4ORCB 1WDCC 1CFDA 4YGEB 2L51A 4BY5A 1QLSA 1YTZC 3JVTC 4PE0A 1EH2A 1NWDA 4WQ2A 1DMOA 2AUCA 1W7IB 1XA5A 3SG6A 1N0YA 2NCPA 1J55A 1UHIA 1DJWA 2OS8C 4IL1A 4ZCVA 4UPGA 2BKIB 4XJKA 1KFUL 3TUYC 1CKKA 3HCMA 1GQMA 5JJGA 2IS9A 3OP0A 1MF8B 2MAZA 3AKBA 1NX0A 2LCPA 2JTZA 3EK8A 1J1DA 1KQMB 1U5IB 1XFYO 2BE6A 1K96A 1KWOC 1M63B 2I94A 2LAPA 5DKRA 2F3YA 1UUSA 2JT8A 1V1GA 2MJWB 3PLFB 1FI5A 1F55A 1M46A 2BE4A 5ER4X 4YGDB 4GGNA 2E30A 3OX6A 4PE1A 3GK2A 1AP4A 4R1EA 2F3ZA 1Y1XA 1B7TY 3BYAA 2V53A 2P6BB 2ZN8A 1A4PA 3IF7A 1BF5A 4PCWA 3SG4A 2AAOA 2L2EA 1DVIA 2RGIA 1KFXS 4I5NB 4PALA 2QACA 2L5XB 1CFCA 2BL0B
chains in the Genus database with same CATH superfamily
3BUOB 3LCPC 1DJHA 1B47A 4INWA 5CPVA 2WCFA 1NX3A 1NYAA 1JF2A 2JT0A 1XFWO 4DS7A 1SL9A 4NDBA 2CBLA 1P28A 3IQQA 1FPWA 1EXRA 1QIVA 5D3OA 3LK0A 1A2XA 1DJYA 1H8BA 2BCAA 2JOJA 2Q4UA 4XJKB 1DJZA 5CSFA 1CM4A 1Z2CB 2KI4B 1SR6C 2EC6B 3FS7A 4GGFC 1K2HA 2R2IA 2ZRTA 1IJ5A 1RTP1 2CCMA 2L0PA 4A4BA 4HSZA 3VROA 3TDIA 2E6WA 5DKNA 1JF0A 3PATA 5DKQA 4CIDA 1YVLA 5FI2A 1NPQA 3NXAA 2CNPA 1WY9A 2WCEA 1SCMC 1QX5B 2FJUB 2F33A 1PVBA 3I5GC 2KI6C 1CLMA 1F4QA 1MR8A 4DRWA 1AJ5A 1NCYA 3D0YA 5HLOA 1QS7A 4P5OE 1TIZA 2QEVA 2M49B 3PALA 3PN7B 1CFFA 2H2KA 1UHKA 4N1GA 3B7AA 3NGVA 3O78A 1K9PA 2LM5A 1NUBA 1XYDA 2Y4QA 2NXQA 2BBMA 3LK1A 2ZFDA 1K95A 2F2PA 2M8UA 3D73A 3DZTA 2KYFA 2WOSA 2M1UA 1K93D 4MLWA 2JTTA 1OQPA 2K61A 3EVUA 1JUOA 4CFQA 1L2OC 2JQ6A 3CABA 2KSPA 4GBAA 2LE9B 1QJTA 1CB1A 2K2FA 3DVKA 2KLEA 4HRHA 1SPYA 4YGBB 1BR4B 2LLSA 3CZ1A 1NIWA 3VRQA 2BECA 4MRYA 1IH0A 2KOTA 2I2RE 4PHJA 2GV5A 2K7CA 3I5HB 3LLEA 1QASA 5AEQA 3WHTB 2SASA 1B8RA 3BFAA 1H4BA 2NLNA 3NSKA 5CSNA 2CXJA 1EJ3A 1S3PA 3CR5X 1J7QA 4M2OA 5KTYA 2M0RA 2LMTA 1ALWA 3I5FC 2MA2A 4YBHB 1IQ5A 1A29A 1TNXA 2ISDA 1TNWA 3F45A 3NSOA 1BLQA 1RJVA 1M39A 2M97A 2QPTA 1SK6D 2BKHB 3D0YB 2PASA 1M31A 1TCOB 3KO0A 1DF0A 1UP5A 2LMUA 5PALA 2JXLA 3VB1A 2DOQA 1BU3A 2WCKA 3OGNA 3SG5A 1OOHA 3E3RA 1C07A 2M3WA 2H8VA 5TNCA 1SL8A 5AANA 3PFVA 1E8AA 1XFZO 3TZ1A 1J1EA 4OZDA 2HQWA 4ORBB 2JT3A 5I2LA 3SS4A 4WQ3A 2LHIA 2HETA 1OMVA 2YGUA 1ORGA 2KNEA 3NSIA 2L2CA 2MBXA 4YGCB 4C0KA 5D69A 2GTEA 3DVJA 1TNPA 2WC5A 3PM2A 3TDUA 2QEHA 3GK4X 2WNDA 1S5GY 3ZWHA 1KK7Z 2OS8B 4PT1A 2KDHA 5GQQC 2WORA 4GAOA 1YR5A 4QJ3B 3TUYB 1XFVO 1S6JA 2H61C 3KEVA 1NSHA 5DICA 2FJYA 1NX2A 2B1UA 2MLFC 4CLNA 3WNXB 1YX7A 1F71A 4U8DA 1IIOA 4MRXA 1KQMC 1Y1AA 1SKTA 2WC8A 5HL1A 1KWOB 1PSRA 1LA0A 1WRLA 1YUSA 2L98A 3TS5B 3EK4A 1RFJA 3DVMA 1L7ZA 3L47A 3UO9A 1C3ZA 1S6IA 1SBJA 1TUZA 1GM0A 5HYDA 3S0GA 3NHTA 1CDPA 4DIRA 2BCXA 1QTXA 1SRAA 3WXAA 1BODA 5I2QA 1DF0B 1G33A 5BPJA 2QEBA 3VRPA 3D10A 1XK4A 2L50A 1AUIB 1JC2A 2CTNA 3OB2B 4Q04A 1K9UA 2M29A 1PRWA 3PSRA 5KU1A 1BOCA 4AQJA 3BUWB 1DJXA 4I5JA 1MXLC 2BL0C 2LV7A 4FTGA 1ZOTB 1NCXA 4GUKA 1UWOA 1PK0D 2LNKA 1QVIZ 1RECA 1N65A 2CT9A 1KFXL 3SS5A 3RLZA 1GGZA 2KFHA 2NCOA 2Y1MA 3KF9A 2KFFA 4JD9A 2KI6D 2PALA 2M7NA 1IG5A 2KQ6A 3SIBA 1TTXA 4OCIA 4CPVA 1HT9A 1BR1B 2JXCA 1UHNA 2MRDA 3K21A 3O6BA 3SIAA 4P2YB 3VGOA 3D76A 1F8HA 1B4CA 2ZNEA 2EC6C 1TNQA 3I5IB 3O4YA 1FW4A 1TRFA 4D1EA 2OTGB 1CLBA 1X02A 1C7WA 4F0ZB 4YI8A 1J7RA 1JFJA 1KSOA 5J3XA 1S36A 4N5XA 2KBMA 1A03A 2COLB 3I5GB 1KK7Y 3SJSA 2JPOA 1YRTB 4OR9B 3L4LA 5HLVA 1F54A 3SG7A 1OMDA 2PMYA 4PE7A 4M2PA 2KGBC 3OBVA 2WCHA 3PN7C 4I5LB 4QJ4B 1UHJA 2MHHA 1RK9A 2D8NA 2PYQA 3SG2A 1OOGA 3CZ0A 4PHMA 3AAJA 2HF5A 1SYMA 2K7BA 3GK1A 1KK8B 4A4CA 1XFXO 2M9GA 1IWQA 3DYEA 1MWNA 1SSEB 1M45A 1EG4A 1OE9B 1PVAA 4JQ0D 1FF1A 2WCBA 3CWGA 1IJ6A 2BCBA 2ERBA 1S26D 2LUXA 4OKHA 1QX2A 2BNXA 1R6PA 4MEWA 4AOMA 4DUQA 1QWVA 1XK4C 4MZKA 3BFHA 2LVKA 2LMVA 3RZSA 1GJYA 3EG5B 3ZNIA 3D74A 3NSLA 4FQOA 1IRJA 1SCVA 4NDCA 1QLKA 4YI9A 1YRUB 1TWOA 4BY4A 1R2UA 4PE4A 2Q91A 1ZMZA 3CGAA 1AVSA 1NP8A 1B7TZ 1YVHA 2O5GA 2FCDA 1A75B 3EK7A 3I5HC 4ICBA 3K1EA 1ALVA 1SY9A 3MSEB 4NQGA 3B88A 1MQ1A 2KPHA 1YURA 3BQ3A 4IJ7A 1MXEA 2KQYA 3BUMB 4HRGA 2I7AA 3D78A 1DT7B 1MUXA 1JSAA 1CMFA 1LKJA 1OMRA 3OB1B 5K89A 5I8NA 3KPXA 4XYNA 4E68A 4M2QA 1RWYA 3FE9A 3JTDC 4JPZB 3VRNA 1J7PA 2PSRA 2L5YA 4L9MA 3TDZA 1QV1A 1Q80A 3CR4X 1CMGA 3C1VA 1WDCB 5CSJA 1TCFA 2I18A 1GGWA 1ZFSA 2EHBA 1DELA 3JVTB 3M0WA 5ER5A 1WRKA 2ZRSA 3HX4A 3DF0B 3QMEA 1KFUS 1LXFC 1AK8A 4TNCA 3BFBA 3KHEA 1DJIA 4YGAA 1CLLA 1DQEA 2KGRA 1BT6A 1CTRA 2K7OA 4ETOA 3UNWA 1B8LA 2KHNA 4FQTA 1YX8A 1CFPA 1J7OA 3R1VA 4PHKA 1OZOA 1WLMA 3GOFA 2JNFA 4GGFA 2K7DA 4MZJA 5FI6A 3RM1A 3DXLA 4MSPA 5JOLA 3EKJA 1PSBA 4USLA 3QRXA 2JWWA 3BOWB 4PHNA 4QJ5B 4AQIA 2GGZA 2O60A 1DGUA 1JWDA 1K8UA 3R72A 3FWBA 3SG3A 2KAYA 1Y6WA 1DJGA 1QATA 1T14A 3V2LA 1UURA 2Y5IA 4MVFA 1OZSA 3CDNA 2A4JA 3D75A 3A4UB 1VRKA 5CSIA 2FOTA 2JRFA 2NZ0A 2LP2A 3TS5C 2LVIA 1CDMA 2M1KB 4INXA 1B1GA 1QX7A 1RROA 1YUTA 3EVRA 2QDIA 1B9AA 3OHMB 2L4IA 2JPTA 2WC6A 4F7FA 3B86A 1PALA 3S0BA 1JFKA 1BG1A 3CZTX 5AFPA 3AKAA 4PDZA 1DEKA 3H4SE 1LINA 1DC1A 1CDNA 1HQVA 2G9BA 3WHUB 3FWCA 1IQ3A 2BBNA 3EVVA 3CTNA 4GPLB 4MBEA 5AXIA 4NDDA 2JC2A 1PULA 4GNKB 2JNXA 2Y1NA 5I2OA 1A75A 1SR6B 1KSMA 2MLEC 2KI4C 4MN0A 3S0FA 1CDLA 2PVBA 1AJ4A 1DTLA 1BMOA 3AAKA 2KBIA 2LVVA 2L4HA 3VRRA 4C0LA 2LANA 1XO5A 3R1OA 3R1PA 1QV0A 1S6CA 4ZCUA 2PQLA 1SCMB 1XFUO 2PRUA 5D7FA 1OOIX 2K0JA 3CS1A 2GGMA 1SNLA 3O4XA 4ORAB 2VRGA 3DD4A 4WRIA 3I5IC 3BXKA 1WLZA 4I5KA 3S0DA 2F2OA 2OTGC 1LS8A 3SS3A 2AMIA 1EG3A 5B8IB 1C7VA 1XFRA 5G08A 1IKUA 3DF0A 3FIAA 1SW8A 2HQ8A 1G8IA 3PM8A 1BJFA 2ZN9A 1V1FA 1Y1UA 4GFTA 5HKZA 1NCZA 1K90D 1L2OB 2ZKMX 3OX5A 5HKYA 2F8PA 3D77A 1S5GZ 1MHOA 5AERA 1WRZA 2HPSA 2K60A 1KK8C 1LA3A 3CLNA 4JWQA 2OPOA 2KAVA 5HKWA 1ODBA 3S0EA 3BOWA 1JBAA 2TN4A 2H61A 1AHRA 1K9KA 4HREE 2LUCA 2JZIA 3B6XA 2ZNDA 3PJIA 3LL8B 3Q8IA 3CR2A 1FI6A 1IGVA 1TOPA 1ZUZA 2G2BA 3CZ2A 1XVJA 5IBWA 1ZACA 1QVIY 1U5IA 1W7JB 4N1FA 1NX1A 2LLUA 4YRUA 1B8CA 2EGDA 3I5FB 3ICBA 2KAXA 1SMGA 1SL7A 2LP3A 4DCKA 1F70A 1FBVA 1D1OA 4OV2A 2K8MB 3O2PA 1DGVA 1CNPA 1QIWA 2KFGA 1CM1A 2JU0A 1G4YR 1YUUA 3EKHA 1W9ZA 2BAPA 2K2AA 1TN4A 2WCMA 3BUXB 3A8RA 5KSZA 1OW4A 2LHLA 1F4OA 1UHHA 3IQOA 4MZLA 5I94A 5F6TA 1K94A 1KCYA 2KYCA 1QXPA 1S1EA 2LVJA 2M7LA 1LVCD 1Y0VH 3JTDB 4C0JA 1TUJA 2FCEA 1OSAA 2LLTA 4OVNF 2LC5A 3BUNB 3N7HA 2JULA 3DVEA 1OOJA 3L4AA 5FYXA 4CFRA 2SCPA 1KQVA 1EL4A 4ORCB 2KLDA 1WDCC 1CFDA 4YGEB 2L51A 4BY5A 1QLSA 1YTZC 3JVTC 4PE0A 1EH2A 2WCLA 3FE6A 1NWDA 2BL0B 4WQ2A 1DMOA 2AUCA 1W7IB 3BJHA 1XA5A 3SG6A 1N0YA 1Z4HA 2NCPA 1J55A 1UHIA 1DJWA 2OS8C 4IL1A 4ZCVA 4UPGA 2BKIB 4XJKA 1KFUL 3TUYC 1CKKA 3HCMA 1GQMA 5EL2A 5JJGA 2IS9A 3OP0A 3IVTA 4JKTA 1MF8B 2MAZA 3AKBA 1NX0A 2LCPA 1OOFA 2JTZA 2P70A 2P71A 3EK8A 1J1DA 1KQMB 1U5IB 1XFYO 2BE6A 1K96A 3FE8A 3S0AA 1KWOC 1M63B 2I94A 2LAPA 5DKRA 2F3YA 1UUSA 2JT8A 1V1GA 2MJWB 3PLFB 1FI5A 1F55A 1M46A 2BE4A 5ER4X 5FI7A 4YGDB 4GGNA 2E30A 3OX6A 4PE1A 3GK2A 3DY9A 1AP4A 2QEOA 4R1EA 2F3ZA 1Y1XA 1B7TY 3BYAA 2V53A 2P6BB 2ZN8A 3NHIA 1A4PA 3IF7A 3CYZA 1BF5A 4PCWA 1C3YA 3SG4A 2AAOA 2L2EA 1DVIA 2RGIA 1KFXS 4I5NB 4PALA 4KYNA 2QACA 3B87A 2L5XB 1CFCA 2WCJA 1N2DA
chains in the Genus database with same CATH topology
3BUOB 3LCPC 1DJHA 1B47A 5CPVA 2WCFA 1NX3A 1NYAA 1JF2A 2JT0A 1XFWO 4DS7A 1SL9A 4NDBA 2CBLA 3IQQA 1FPWA 1EXRA 1QIVA 3LK0A 1A2XA 1DJYA 1H8BA 2BCAA 2JOJA 2Q4UA 4XJKB 1DJZA 5CSFA 1CM4A 2KI4B 1SR6C 2EC6B 3FS7A 4GGFC 1K2HA 2R2IA 2ZRTA 1IJ5A 1RTP1 2CCMA 2L0PA 4A4BA 4HSZA 3VROA 3TDIA 2E6WA 5DKNA 1JF0A 3PATA 5DKQA 4CIDA 1YVLA 1NPQA 3NXAA 2CNPA 1WY9A 2WCEA 1SCMC 1QX5B 2FJUB 2F33A 1PVBA 3I5GC 2KI6C 1CLMA 1F4QA 1MR8A 4DRWA 1AJ5A 1NCYA 3D0YA 5HLOA 1QS7A 4P5OE 1TIZA 3PALA 2M49B 3PN7B 1CFFA 2H2KA 1UHKA 4N1GA 3O78A 1K9PA 2LM5A 1NUBA 1XYDA 2Y4QA 2NXQA 2BBMA 3LK1A 2ZFDA 1K95A 2F2PA 2M8UA 2KYFA 2WOSA 2M1UA 1K93D 4MLWA 2JTTA 1OQPA 2K61A 3EVUA 1JUOA 4CFQA 1L2OC 2JQ6A 2KSPA 4GBAA 2LE9B 1QJTA 1CB1A 2K2FA 3DVKA 4HRHA 1SPYA 4YGBB 1BR4B 2LLSA 3VRQA 1NIWA 2BECA 4MRYA 1IH0A 2KOTA 2I2RE 4PHJA 2GV5A 2K7CA 3I5HB 3LLEA 1QASA 5AEQA 3WHTB 2SASA 1B8RA 1H4BA 2NLNA 3NSKA 5CSNA 2CXJA 1EJ3A 1S3PA 3CR5X 1J7QA 4M2OA 5KTYA 2M0RA 2LMTA 1ALWA 3I5FC 2MA2A 4YBHB 1IQ5A 1A29A 1TNXA 2ISDA 1TNWA 3F45A 3NSOA 1BLQA 1RJVA 1M39A 2M97A 2QPTA 1SK6D 2BKHB 3D0YB 2PASA 1M31A 1TCOB 3KO0A 1DF0A 1UP5A 2LMUA 5PALA 2JXLA 2DOQA 1BU3A 3SG5A 3E3RA 1C07A 2M3WA 5TNCA 1SL8A 5AANA 3PFVA 1E8AA 1XFZO 3TZ1A 1J1EA 2HQWA 4ORBB 2JT3A 5I2LA 4WQ3A 2LHIA 2HETA 1OMVA 2KNEA 3NSIA 2MBXA 4YGCB 4C0KA 5D69A 3DVJA 1TNPA 3TDUA 3GK4X 2WNDA 1S5GY 3ZWHA 1KK7Z 2OS8B 5GQQC 2KDHA 2WORA 4GAOA 1YR5A 4QJ3B 3TUYB 1XFVO 1S6JA 2H61C 3KEVA 1NSHA 1NX2A 2B1UA 2MLFC 4CLNA 3WNXB 1YX7A 1F71A 4U8DA 4MRXA 1KQMC 1Y1AA 1SKTA 2WC8A 1KWOB 1PSRA 1LA0A 1WRLA 1YUSA 2L98A 3TS5B 3EK4A 1RFJA 3DVMA 1L7ZA 1S6IA 1SBJA 5HYDA 1N2DA 1CDPA 4DIRA 2BCXA 1QTXA 1SRAA 3WXAA 1BODA 5I2QA 1DF0B 1G33A 5BPJA 3VRPA 3D10A 1XK4A 2L50A 1AUIB 1JC2A 2CTNA 3OB2B 4Q04A 1K9UA 2M29A 1PRWA 3PSRA 5KU1A 1BOCA 4AQJA 3BUWB 1DJXA 4I5JA 1MXLC 2BL0C 2LV7A 4FTGA 1ZOTB 1NCXA 4GUKA 1UWOA 1PK0D 2LNKA 1QVIZ 1RECA 1N65A 2CT9A 1KFXL 3RLZA 1GGZA 2KFHA 2NCOA 2Y1MA 3KF9A 2KFFA 2KI6D 2PALA 2M7NA 1IG5A 2KQ6A 3SIBA 1TTXA 4OCIA 4CPVA 1HT9A 1BR1B 2JXCA 1UHNA 2MRDA 3K21A 3O6BA 3SIAA 4P2YB 3VGOA 1F8HA 1B4CA 2ZNEA 2EC6C 1TNQA 3I5IB 3O4YA 1FW4A 1TRFA 4D1EA 2OTGB 1CLBA 1X02A 1C7WA 4F0ZB 4YI8A 1J7RA 1JFJA 1KSOA 5J3XA 1S36A 4N5XA 2KBMA 1A03A 2COLB 3I5GB 1KK7Y 3SJSA 1YRTB 4OR9B 1F54A 5HLVA 3SG7A 1OMDA 2PMYA 4PE7A 4M2PA 2KGBC 3PN7C 4I5LB 4QJ4B 1UHJA 2MHHA 1RK9A 2D8NA 3SG2A 4PHMA 3AAJA 2HF5A 1SYMA 2K7BA 3GK1A 1KK8B 4A4CA 1XFXO 2M9GA 1IWQA 1MWNA 1M45A 1EG4A 1OE9B 1PVAA 4JQ0D 1FF1A 2WCBA 3CWGA 1IJ6A 2BCBA 2LUXA 1S26D 4OKHA 1QX2A 1R6PA 4MEWA 4AOMA 4DUQA 1XK4C 4MZKA 2LVKA 2LMVA 1GJYA 3ZNIA 3NSLA 4FQOA 1IRJA 1SCVA 4NDCA 1QLKA 4YI9A 1YRUB 4BY4A 1R2UA 4PE4A 2Q91A 1ZMZA 3CGAA 1AVSA 1NP8A 1B7TZ 1YVHA 2O5GA 2FCDA 1A75B 3EK7A 3I5HC 4ICBA 4NQGA 1ALVA 1SY9A 3MSEB 1MQ1A 1YURA 3BQ3A 1MXEA 2KQYA 3BUMB 4HRGA 2I7AA 1DT7B 1MUXA 1JSAA 1CMFA 1LKJA 1OMRA 3OB1B 5K89A 5I8NA 3KPXA 4XYNA 4E68A 4M2QA 1RWYA 3JTDC 4JPZB 3VRNA 1J7PA 2PSRA 4L9MA 3TDZA 1QV1A 1Q80A 3CR4X 1CMGA 3C1VA 1WDCB 5CSJA 1TCFA 2I18A 1GGWA 1ZFSA 2EHBA 3JVTB 3M0WA 5ER5A 1WRKA 2ZRSA 3HX4A 3DF0B 1KFUS 1LXFC 1AK8A 4TNCA 3KHEA 1DJIA 4YGAA 1CLLA 2KGRA 1BT6A 1CTRA 2K7OA 4ETOA 1B8LA 2KHNA 1J7OA 1YX8A 1CFPA 4PHKA 1OZOA 1WLMA 3GOFA 2JNFA 4GGFA 2K7DA 4MZJA 3RM1A 4MSPA 5JOLA 3EKJA 1PSBA 4USLA 3QRXA 2JWWA 3BOWB 4PHNA 4QJ5B 4AQIA 2GGZA 2O60A 1DGUA 1JWDA 1K8UA 3SG3A 3FWBA 2KAYA 1Y6WA 1DJGA 1QATA 1UURA 2Y5IA 4MVFA 1OZSA 2A4JA 3A4UB 1VRKA 5CSIA 2FOTA 2JRFA 2NZ0A 2LP2A 3TS5C 2LVIA 1CDMA 2M1KB 1B1GA 1QX7A 1RROA 1YUTA 3EVRA 1B9AA 3OHMB 2L4IA 2JPTA 1PALA 1JFKA 1BG1A 3CZTX 5AFPA 3AKAA 4PDZA 3H4SE 1LINA 1CDNA 1HQVA 2G9BA 3WHUB 3FWCA 1IQ3A 2BBNA 3EVVA 3CTNA 4GPLB 4MBEA 5AXIA 4NDDA 2JC2A 1PULA 4GNKB 2JNXA 2Y1NA 5I2OA 1A75A 1SR6B 1KSMA 2MLEC 2KI4C 4MN0A 1CDLA 2PVBA 1AJ4A 1DTLA 1BMOA 3AAKA 2KBIA 2LVVA 2L4HA 3VRRA 4C0LA 2LANA 1XO5A 1QV0A 1S6CA 4ZCUA 1SCMB 1XFUO 2PRUA 5D7FA 2K0JA 3CS1A 2GGMA 1SNLA 4ORAB 4WRIA 2VRGA 3DD4A 3I5IC 3BXKA 1WLZA 4I5KA 2F2OA 2OTGC 2AMIA 1EG3A 5B8IB 1C7VA 5G08A 1IKUA 3DF0A 3FIAA 1SW8A 2HQ8A 1G8IA 3PM8A 1BJFA 2ZN9A 1V1FA 1Y1UA 4GFTA 5HKZA 1NCZA 1K90D 1L2OB 2ZKMX 3OX5A 5HKYA 2F8PA 1S5GZ 1MHOA 5AERA 1WRZA 2HPSA 1KK8C 1LA3A 3CLNA 4JWQA 2OPOA 2KAVA 5HKWA 1ODBA 3BOWA 1JBAA 2TN4A 2H61A 1AHRA 1K9KA 4HREE 2LUCA 2JZIA 2ZNDA 3LL8B 3CR2A 1FI6A 1IGVA 1TOPA 1ZUZA 2G2BA 1XVJA 5IBWA 1ZACA 1QVIY 1U5IA 1W7JB 4N1FA 1NX1A 2LLUA 4YRUA 1B8CA 2EGDA 3I5FB 3ICBA 2KAXA 1SMGA 1SL7A 2LP3A 4DCKA 1F70A 1FBVA 1D1OA 4OV2A 2K8MB 3O2PA 1DGVA 1CNPA 1QIWA 2KFGA 1CM1A 2JU0A 1G4YR 1YUUA 3EKHA 2K2AA 1TN4A 3BUXB 5KSZA 3A8RA 2LHLA 1F4OA 1UHHA 3IQOA 4MZLA 1KCYA 5F6TA 1K94A 2KYCA 1QXPA 1S1EA 2LVJA 2M7LA 1LVCD 1Y0VH 3JTDB 4C0JA 2FCEA 1OSAA 2LLTA 4OVNF 2LC5A 3BUNB 5FYXA 2JULA 3DVEA 1OOJA 4CFRA 2SCPA 1KQVA 1EL4A 4ORCB 1WDCC 1CFDA 4YGEB 2L51A 4BY5A 1QLSA 1YTZC 3JVTC 4PE0A 1EH2A 1NWDA 4WQ2A 1DMOA 2AUCA 1W7IB 1XA5A 3SG6A 1N0YA 2NCPA 1J55A 1UHIA 1DJWA 2OS8C 4IL1A 4ZCVA 4UPGA 2BKIB 4XJKA 1KFUL 3TUYC 1CKKA 3HCMA 1GQMA 5JJGA 2IS9A 3OP0A 1MF8B 2MAZA 3AKBA 1NX0A 2LCPA 2JTZA 3EK8A 1J1DA 1KQMB 1U5IB 1XFYO 2BE6A 1K96A 1KWOC 1M63B 2I94A 2LAPA 5DKRA 2F3YA 1UUSA 2JT8A 1V1GA 2MJWB 3PLFB 1FI5A 1F55A 1M46A 2BE4A 5ER4X 4YGDB 4GGNA 2E30A 3OX6A 4PE1A 3GK2A 1AP4A 4R1EA 2F3ZA 1Y1XA 1B7TY 3BYAA 2V53A 2P6BB 2ZN8A 1A4PA 3IF7A 1BF5A 4PCWA 3SG4A 2AAOA 2L2EA 1DVIA 2RGIA 1KFXS 4I5NB 4PALA 2QACA 2L5XB 1CFCA 2BL0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUO B;  3LCP C;  1DJH A;  1B47 A;  5CPV A;  2WCF A;  1NX3 A;  1NYA A;  1JF2 A;  2JT0 A;  1XFW O;  4DS7 A;  1SL9 A;  4NDB A;  2CBL A;  3IQQ A;  1FPW A;  1EXR A;  1QIV A;  3LK0 A;  1A2X A;  1DJY A;  1H8B A;  2BCA A;  2JOJ A;  2Q4U A;  4XJK B;  1DJZ A;  5CSF A;  1CM4 A;  2KI4 B;  1SR6 C;  2EC6 B;  3FS7 A;  4GGF C;  1K2H A;  2R2I A;  2ZRT A;  1IJ5 A;  1RTP 1;  2CCM A;  2L0P A;  4A4B A;  4HSZ A;  3VRO A;  3TDI A;  2E6W A;  5DKN A;  1JF0 A;  3PAT A;  5DKQ A;  4CID A;  1YVL A;  1NPQ A;  3NXA A;  2CNP A;  1WY9 A;  2WCE A;  1SCM C;  1QX5 B;  2FJU B;  2F33 A;  1PVB A;  3I5G C;  2KI6 C;  1CLM A;  1F4Q A;  1MR8 A;  4DRW A;  1AJ5 A;  1NCY A;  3D0Y A;  5HLO A;  1QS7 A;  4P5O E;  1TIZ A;  3PAL A;  2M49 B;  3PN7 B;  1CFF A;  2H2K A;  1UHK A;  4N1G A;  3O78 A;  1K9P A;  2LM5 A;  1NUB A;  1XYD A;  2Y4Q A;  2NXQ A;  2BBM A;  3LK1 A;  2ZFD A;  1K95 A;  2F2P A;  2M8U A;  2KYF A;  2WOS A;  2M1U A;  1K93 D;  4MLW A;  2JTT A;  1OQP A;  2K61 A;  3EVU A;  1JUO A;  4CFQ A;  1L2O C;  2JQ6 A;  2KSP A;  4GBA A;  2LE9 B;  1QJT A;  1CB1 A;  2K2F A;  3DVK A;  4HRH A;  1SPY A;  4YGB B;  1BR4 B;  2LLS A;  3VRQ A;  1NIW A;  2BEC A;  4MRY A;  1IH0 A;  2KOT A;  2I2R E;  4PHJ A;  2GV5 A;  2K7C A;  3I5H B;  3LLE A;  1QAS A;  5AEQ A;  3WHT B;  2SAS A;  1B8R A;  1H4B A;  2NLN A;  3NSK A;  5CSN A;  2CXJ A;  1EJ3 A;  1S3P A;  3CR5 X;  1J7Q A;  4M2O A;  5KTY A;  2M0R A;  2LMT A;  1ALW A;  3I5F C;  2MA2 A;  4YBH B;  1IQ5 A;  1A29 A;  1TNX A;  2ISD A;  1TNW A;  3F45 A;  3NSO A;  1BLQ A;  1RJV A;  1M39 A;  2M97 A;  2QPT A;  1SK6 D;  2BKH B;  3D0Y B;  2PAS A;  1M31 A;  1TCO B;  3KO0 A;  1DF0 A;  1UP5 A;  2LMU A;  5PAL A;  2JXL A;  2DOQ A;  1BU3 A;  3SG5 A;  3E3R A;  1C07 A;  2M3W A;  5TNC A;  1SL8 A;  5AAN A;  3PFV A;  1E8A A;  1XFZ O;  3TZ1 A;  1J1E A;  2HQW A;  4ORB B;  2JT3 A;  5I2L A;  4WQ3 A;  2LHI A;  2HET A;  1OMV A;  2KNE A;  3NSI A;  2MBX A;  4YGC B;  4C0K A;  5D69 A;  3DVJ A;  1TNP A;  3TDU A;  3GK4 X;  2WND A;  1S5G Y;  3ZWH A;  1KK7 Z;  2OS8 B;  5GQQ C;  2KDH A;  2WOR A;  4GAO A;  1YR5 A;  4QJ3 B;  3TUY B;  1XFV O;  1S6J A;  2H61 C;  3KEV A;  1NSH A;  1NX2 A;  2B1U A;  2MLF C;  4CLN A;  3WNX B;  1YX7 A;  1F71 A;  4U8D A;  4MRX A;  1KQM C;  1Y1A A;  1SKT A;  2WC8 A;  1KWO B;  1PSR A;  1LA0 A;  1WRL A;  1YUS A;  2L98 A;  3TS5 B;  3EK4 A;  1RFJ A;  3DVM A;  1L7Z A;  1S6I A;  1SBJ A;  5HYD A;  1N2D A;  1CDP A;  4DIR A;  2BCX A;  1QTX A;  1SRA A;  3WXA A;  1BOD A;  5I2Q A;  1DF0 B;  1G33 A;  5BPJ A;  3VRP A;  3D10 A;  1XK4 A;  2L50 A;  1AUI B;  1JC2 A;  2CTN A;  3OB2 B;  4Q04 A;  1K9U A;  2M29 A;  1PRW A;  3PSR A;  5KU1 A;  1BOC A;  4AQJ A;  3BUW B;  1DJX A;  4I5J A;  1MXL C;  2BL0 C;  2LV7 A;  4FTG A;  1ZOT B;  1NCX A;  4GUK A;  1UWO A;  1PK0 D;  2LNK A;  1QVI Z;  1REC A;  1N65 A;  2CT9 A;  1KFX L;  3RLZ A;  1GGZ A;  2KFH A;  2NCO A;  2Y1M A;  3KF9 A;  2KFF A;  2KI6 D;  2PAL A;  2M7N A;  1IG5 A;  2KQ6 A;  3SIB A;  1TTX A;  4OCI A;  4CPV A;  1HT9 A;  1BR1 B;  2JXC A;  1UHN A;  2MRD A;  3K21 A;  3O6B A;  3SIA A;  4P2Y B;  3VGO A;  1F8H A;  1B4C A;  2ZNE A;  2EC6 C;  1TNQ A;  3I5I B;  3O4Y A;  1FW4 A;  1TRF A;  4D1E A;  2OTG B;  1CLB A;  1X02 A;  1C7W A;  4F0Z B;  4YI8 A;  1J7R A;  1JFJ A;  1KSO A;  5J3X A;  1S36 A;  4N5X A;  2KBM A;  1A03 A;  2COL B;  3I5G B;  1KK7 Y;  3SJS A;  1YRT B;  4OR9 B;  1F54 A;  5HLV A;  3SG7 A;  1OMD A;  2PMY A;  4PE7 A;  4M2P A;  2KGB C;  3PN7 C;  4I5L B;  4QJ4 B;  1UHJ A;  2MHH A;  1RK9 A;  2D8N A;  3SG2 A;  4PHM A;  3AAJ A;  2HF5 A;  1SYM A;  2K7B A;  3GK1 A;  1KK8 B;  4A4C A;  1XFX O;  2M9G A;  1IWQ A;  1MWN A;  1M45 A;  1EG4 A;  1OE9 B;  1PVA A;  4JQ0 D;  1FF1 A;  2WCB A;  3CWG A;  1IJ6 A;  2BCB A;  2LUX A;  1S26 D;  4OKH A;  1QX2 A;  1R6P A;  4MEW A;  4AOM A;  4DUQ A;  1XK4 C;  4MZK A;  2LVK A;  2LMV A;  1GJY A;  3ZNI A;  3NSL A;  4FQO A;  1IRJ A;  1SCV A;  4NDC A;  1QLK A;  4YI9 A;  1YRU B;  4BY4 A;  1R2U A;  4PE4 A;  2Q91 A;  1ZMZ A;  3CGA A;  1AVS A;  1NP8 A;  1B7T Z;  1YVH A;  2O5G A;  2FCD A;  1A75 B;  3EK7 A;  3I5H C;  4ICB A;  4NQG A;  1ALV A;  1SY9 A;  3MSE B;  1MQ1 A;  1YUR A;  3BQ3 A;  1MXE A;  2KQY A;  3BUM B;  4HRG A;  2I7A A;  1DT7 B;  1MUX A;  1JSA A;  1CMF A;  1LKJ A;  1OMR A;  3OB1 B;  5K89 A;  5I8N A;  3KPX A;  4XYN A;  4E68 A;  4M2Q A;  1RWY A;  3JTD C;  4JPZ B;  3VRN A;  1J7P A;  2PSR A;  4L9M A;  3TDZ A;  1QV1 A;  1Q80 A;  3CR4 X;  1CMG A;  3C1V A;  1WDC B;  5CSJ A;  1TCF A;  2I18 A;  1GGW A;  1ZFS A;  2EHB A;  3JVT B;  3M0W A;  5ER5 A;  1WRK A;  2ZRS A;  3HX4 A;  3DF0 B;  1KFU S;  1LXF C;  1AK8 A;  4TNC A;  3KHE A;  1DJI A;  4YGA A;  1CLL A;  2KGR A;  1BT6 A;  1CTR A;  2K7O A;  4ETO A;  1B8L A;  2KHN A;  1J7O A;  1YX8 A;  1CFP A;  4PHK A;  1OZO A;  1WLM A;  3GOF A;  2JNF A;  4GGF A;  2K7D A;  4MZJ A;  3RM1 A;  4MSP A;  5JOL A;  3EKJ A;  1PSB A;  4USL A;  3QRX A;  2JWW A;  3BOW B;  4PHN A;  4QJ5 B;  4AQI A;  2GGZ A;  2O60 A;  1DGU A;  1JWD A;  1K8U A;  3SG3 A;  3FWB A;  2KAY A;  1Y6W A;  1DJG A;  1QAT A;  1UUR A;  2Y5I A;  4MVF A;  1OZS A;  2A4J A;  3A4U B;  1VRK A;  5CSI A;  2FOT A;  2JRF A;  2NZ0 A;  2LP2 A;  3TS5 C;  2LVI A;  1CDM A;  2M1K B;  1B1G A;  1QX7 A;  1RRO A;  1YUT A;  3EVR A;  1B9A A;  3OHM B;  2L4I A;  2JPT A;  1PAL A;  1JFK A;  1BG1 A;  3CZT X;  5AFP A;  3AKA A;  4PDZ A;  3H4S E;  1LIN A;  1CDN A;  1HQV A;  2G9B A;  3WHU B;  3FWC A;  1IQ3 A;  2BBN A;  3EVV A;  3CTN A;  4GPL B;  4MBE A;  5AXI A;  4NDD A;  2JC2 A;  1PUL A;  4GNK B;  2JNX A;  2Y1N A;  5I2O A;  1A75 A;  1SR6 B;  1KSM A;  2MLE C;  2KI4 C;  4MN0 A;  1CDL A;  2PVB A;  1AJ4 A;  1DTL A;  1BMO A;  3AAK A;  2KBI A;  2LVV A;  2L4H A;  3VRR A;  4C0L A;  2LAN A;  1XO5 A;  1QV0 A;  1S6C A;  4ZCU A;  1SCM B;  1XFU O;  2PRU A;  5D7F A;  2K0J A;  3CS1 A;  2GGM A;  1SNL A;  4ORA B;  4WRI A;  2VRG A;  3DD4 A;  3I5I C;  3BXK A;  1WLZ A;  4I5K A;  2F2O A;  2OTG C;  2AMI A;  1EG3 A;  5B8I B;  1C7V A;  5G08 A;  1IKU A;  3DF0 A;  3FIA A;  1SW8 A;  2HQ8 A;  1G8I A;  3PM8 A;  1BJF A;  2ZN9 A;  1V1F A;  1Y1U A;  4GFT A;  5HKZ A;  1NCZ A;  1K90 D;  1L2O B;  2ZKM X;  3OX5 A;  5HKY A;  2F8P A;  1S5G Z;  1MHO A;  5AER A;  1WRZ A;  2HPS A;  1KK8 C;  1LA3 A;  3CLN A;  4JWQ A;  2OPO A;  2KAV A;  5HKW A;  1ODB A;  3BOW A;  1JBA A;  2TN4 A;  2H61 A;  1AHR A;  1K9K A;  4HRE E;  2LUC A;  2JZI A;  2ZND A;  3LL8 B;  3CR2 A;  1FI6 A;  1IGV A;  1TOP A;  1ZUZ A;  2G2B A;  1XVJ A;  5IBW A;  1ZAC A;  1QVI Y;  1U5I A;  1W7J B;  4N1F A;  1NX1 A;  2LLU A;  4YRU A;  1B8C A;  2EGD A;  3I5F B;  3ICB A;  2KAX A;  1SMG A;  1SL7 A;  2LP3 A;  4DCK A;  1F70 A;  1FBV A;  1D1O A;  4OV2 A;  2K8M B;  3O2P A;  1DGV A;  1CNP A;  1QIW A;  2KFG A;  1CM1 A;  2JU0 A;  1G4Y R;  1YUU A;  3EKH A;  2K2A A;  1TN4 A;  3BUX B;  5KSZ A;  3A8R A;  2LHL A;  1F4O A;  1UHH A;  3IQO A;  4MZL A;  1KCY A;  5F6T A;  1K94 A;  2KYC A;  1QXP A;  1S1E A;  2LVJ A;  2M7L A;  1LVC D;  1Y0V H;  3JTD B;  4C0J A;  2FCE A;  1OSA A;  2LLT A;  4OVN F;  2LC5 A;  3BUN B;  5FYX A;  2JUL A;  3DVE A;  1OOJ A;  4CFR A;  2SCP A;  1KQV A;  1EL4 A;  4ORC B;  1WDC C;  1CFD A;  4YGE B;  2L51 A;  4BY5 A;  1QLS A;  1YTZ C;  3JVT C;  4PE0 A;  1EH2 A;  1NWD A;  4WQ2 A;  1DMO A;  2AUC A;  1W7I B;  1XA5 A;  3SG6 A;  1N0Y A;  2NCP A;  1J55 A;  1UHI A;  1DJW A;  2OS8 C;  4IL1 A;  4ZCV A;  4UPG A;  2BKI B;  4XJK A;  1KFU L;  3TUY C;  1CKK A;  3HCM A;  1GQM A;  5JJG A;  2IS9 A;  3OP0 A;  1MF8 B;  2MAZ A;  3AKB A;  1NX0 A;  2LCP A;  2JTZ A;  3EK8 A;  1J1D A;  1KQM B;  1U5I B;  1XFY O;  2BE6 A;  1K96 A;  1KWO C;  1M63 B;  2I94 A;  2LAP A;  5DKR A;  2F3Y A;  1UUS A;  2JT8 A;  1V1G A;  2MJW B;  3PLF B;  1FI5 A;  1F55 A;  1M46 A;  2BE4 A;  5ER4 X;  4YGD B;  4GGN A;  2E30 A;  3OX6 A;  4PE1 A;  3GK2 A;  1AP4 A;  4R1E A;  2F3Z A;  1Y1X A;  1B7T Y;  3BYA A;  2V53 A;  2P6B B;  2ZN8 A;  1A4P A;  3IF7 A;  1BF5 A;  4PCW A;  3SG4 A;  2AAO A;  2L2E A;  1DVI A;  2RGI A;  1KFX S;  4I5N B;  4PAL A;  2QAC A;  2L5X B;  1CFC A;  2BL0 B; 
#chains in the Genus database with same CATH topology
 3BUO B;  3LCP C;  1DJH A;  1B47 A;  4INW A;  5CPV A;  2WCF A;  1NX3 A;  1NYA A;  1JF2 A;  2JT0 A;  1XFW O;  4DS7 A;  1SL9 A;  4NDB A;  2CBL A;  1P28 A;  3IQQ A;  1FPW A;  1EXR A;  1QIV A;  5D3O A;  3LK0 A;  1A2X A;  1DJY A;  1H8B A;  2BCA A;  2JOJ A;  2Q4U A;  4XJK B;  1DJZ A;  5CSF A;  1CM4 A;  1Z2C B;  2KI4 B;  1SR6 C;  2EC6 B;  3FS7 A;  4GGF C;  1K2H A;  2R2I A;  2ZRT A;  1IJ5 A;  1RTP 1;  2CCM A;  2L0P A;  4A4B A;  4HSZ A;  3VRO A;  3TDI A;  2E6W A;  5DKN A;  1JF0 A;  3PAT A;  5DKQ A;  4CID A;  1YVL A;  5FI2 A;  1NPQ A;  3NXA A;  2CNP A;  1WY9 A;  2WCE A;  1SCM C;  1QX5 B;  2FJU B;  2F33 A;  1PVB A;  3I5G C;  2KI6 C;  1CLM A;  1F4Q A;  1MR8 A;  4DRW A;  1AJ5 A;  1NCY A;  3D0Y A;  5HLO A;  1QS7 A;  4P5O E;  1TIZ A;  2QEV A;  2M49 B;  3PAL A;  3PN7 B;  1CFF A;  2H2K A;  1UHK A;  4N1G A;  3B7A A;  3NGV A;  3O78 A;  1K9P A;  2LM5 A;  1NUB A;  1XYD A;  2Y4Q A;  2NXQ A;  2BBM A;  3LK1 A;  2ZFD A;  1K95 A;  2F2P A;  2M8U A;  3D73 A;  3DZT A;  2KYF A;  2WOS A;  2M1U A;  1K93 D;  4MLW A;  2JTT A;  1OQP A;  2K61 A;  3EVU A;  1JUO A;  4CFQ A;  1L2O C;  2JQ6 A;  3CAB A;  2KSP A;  4GBA A;  2LE9 B;  1QJT A;  1CB1 A;  2K2F A;  3DVK A;  2KLE A;  4HRH A;  1SPY A;  4YGB B;  1BR4 B;  2LLS A;  3CZ1 A;  1NIW A;  3VRQ A;  2BEC A;  4MRY A;  1IH0 A;  2KOT A;  2I2R E;  4PHJ A;  2GV5 A;  2K7C A;  3I5H B;  3LLE A;  1QAS A;  5AEQ A;  3WHT B;  2SAS A;  1B8R A;  3BFA A;  1H4B A;  2NLN A;  3NSK A;  5CSN A;  2CXJ A;  1EJ3 A;  1S3P A;  3CR5 X;  1J7Q A;  4M2O A;  5KTY A;  2M0R A;  2LMT A;  1ALW A;  3I5F C;  2MA2 A;  4YBH B;  1IQ5 A;  1A29 A;  1TNX A;  2ISD A;  1TNW A;  3F45 A;  3NSO A;  1BLQ A;  1RJV A;  1M39 A;  2M97 A;  2QPT A;  1SK6 D;  2BKH B;  3D0Y B;  2PAS A;  1M31 A;  1TCO B;  3KO0 A;  1DF0 A;  1UP5 A;  2LMU A;  5PAL A;  2JXL A;  3VB1 A;  2DOQ A;  1BU3 A;  2WCK A;  3OGN A;  3SG5 A;  1OOH A;  3E3R A;  1C07 A;  2M3W A;  2H8V A;  5TNC A;  1SL8 A;  5AAN A;  3PFV A;  1E8A A;  1XFZ O;  3TZ1 A;  1J1E A;  4OZD A;  2HQW A;  4ORB B;  2JT3 A;  5I2L A;  3SS4 A;  4WQ3 A;  2LHI A;  2HET A;  1OMV A;  2YGU A;  1ORG A;  2KNE A;  3NSI A;  2L2C A;  2MBX A;  4YGC B;  4C0K A;  5D69 A;  2GTE A;  3DVJ A;  1TNP A;  2WC5 A;  3PM2 A;  3TDU A;  2QEH A;  3GK4 X;  2WND A;  1S5G Y;  3ZWH A;  1KK7 Z;  2OS8 B;  4PT1 A;  2KDH A;  5GQQ C;  2WOR A;  4GAO A;  1YR5 A;  4QJ3 B;  3TUY B;  1XFV O;  1S6J A;  2H61 C;  3KEV A;  1NSH A;  5DIC A;  2FJY A;  1NX2 A;  2B1U A;  2MLF C;  4CLN A;  3WNX B;  1YX7 A;  1F71 A;  4U8D A;  1IIO A;  4MRX A;  1KQM C;  1Y1A A;  1SKT A;  2WC8 A;  5HL1 A;  1KWO B;  1PSR A;  1LA0 A;  1WRL A;  1YUS A;  2L98 A;  3TS5 B;  3EK4 A;  1RFJ A;  3DVM A;  1L7Z A;  3L47 A;  3UO9 A;  1C3Z A;  1S6I A;  1SBJ A;  1TUZ A;  1GM0 A;  5HYD A;  3S0G A;  3NHT A;  1CDP A;  4DIR A;  2BCX A;  1QTX A;  1SRA A;  3WXA A;  1BOD A;  5I2Q A;  1DF0 B;  1G33 A;  5BPJ A;  2QEB A;  3VRP A;  3D10 A;  1XK4 A;  2L50 A;  1AUI B;  1JC2 A;  2CTN A;  3OB2 B;  4Q04 A;  1K9U A;  2M29 A;  1PRW A;  3PSR A;  5KU1 A;  1BOC A;  4AQJ A;  3BUW B;  1DJX A;  4I5J A;  1MXL C;  2BL0 C;  2LV7 A;  4FTG A;  1ZOT B;  1NCX A;  4GUK A;  1UWO A;  1PK0 D;  2LNK A;  1QVI Z;  1REC A;  1N65 A;  2CT9 A;  1KFX L;  3SS5 A;  3RLZ A;  1GGZ A;  2KFH A;  2NCO A;  2Y1M A;  3KF9 A;  2KFF A;  4JD9 A;  2KI6 D;  2PAL A;  2M7N A;  1IG5 A;  2KQ6 A;  3SIB A;  1TTX A;  4OCI A;  4CPV A;  1HT9 A;  1BR1 B;  2JXC A;  1UHN A;  2MRD A;  3K21 A;  3O6B A;  3SIA A;  4P2Y B;  3VGO A;  3D76 A;  1F8H A;  1B4C A;  2ZNE A;  2EC6 C;  1TNQ A;  3I5I B;  3O4Y A;  1FW4 A;  1TRF A;  4D1E A;  2OTG B;  1CLB A;  1X02 A;  1C7W A;  4F0Z B;  4YI8 A;  1J7R A;  1JFJ A;  1KSO A;  5J3X A;  1S36 A;  4N5X A;  2KBM A;  1A03 A;  2COL B;  3I5G B;  1KK7 Y;  3SJS A;  2JPO A;  1YRT B;  4OR9 B;  3L4L A;  5HLV A;  1F54 A;  3SG7 A;  1OMD A;  2PMY A;  4PE7 A;  4M2P A;  2KGB C;  3OBV A;  2WCH A;  3PN7 C;  4I5L B;  4QJ4 B;  1UHJ A;  2MHH A;  1RK9 A;  2D8N A;  2PYQ A;  3SG2 A;  1OOG A;  3CZ0 A;  4PHM A;  3AAJ A;  2HF5 A;  1SYM A;  2K7B A;  3GK1 A;  1KK8 B;  4A4C A;  1XFX O;  2M9G A;  1IWQ A;  3DYE A;  1MWN A;  1SSE B;  1M45 A;  1EG4 A;  1OE9 B;  1PVA A;  4JQ0 D;  1FF1 A;  2WCB A;  3CWG A;  1IJ6 A;  2BCB A;  2ERB A;  1S26 D;  2LUX A;  4OKH A;  1QX2 A;  2BNX A;  1R6P A;  4MEW A;  4AOM A;  4DUQ A;  1QWV A;  1XK4 C;  4MZK A;  3BFH A;  2LVK A;  2LMV A;  3RZS A;  1GJY A;  3EG5 B;  3ZNI A;  3D74 A;  3NSL A;  4FQO A;  1IRJ A;  1SCV A;  4NDC A;  1QLK A;  4YI9 A;  1YRU B;  1TWO A;  4BY4 A;  1R2U A;  4PE4 A;  2Q91 A;  1ZMZ A;  3CGA A;  1AVS A;  1NP8 A;  1B7T Z;  1YVH A;  2O5G A;  2FCD A;  1A75 B;  3EK7 A;  3I5H C;  4ICB A;  3K1E A;  1ALV A;  1SY9 A;  3MSE B;  4NQG A;  3B88 A;  1MQ1 A;  2KPH A;  1YUR A;  3BQ3 A;  4IJ7 A;  1MXE A;  2KQY A;  3BUM B;  4HRG A;  2I7A A;  3D78 A;  1DT7 B;  1MUX A;  1JSA A;  1CMF A;  1LKJ A;  1OMR A;  3OB1 B;  5K89 A;  5I8N A;  3KPX A;  4XYN A;  4E68 A;  4M2Q A;  1RWY A;  3FE9 A;  3JTD C;  4JPZ B;  3VRN A;  1J7P A;  2PSR A;  2L5Y A;  4L9M A;  3TDZ A;  1QV1 A;  1Q80 A;  3CR4 X;  1CMG A;  3C1V A;  1WDC B;  5CSJ A;  1TCF A;  2I18 A;  1GGW A;  1ZFS A;  2EHB A;  1DEL A;  3JVT B;  3M0W A;  5ER5 A;  1WRK A;  2ZRS A;  3HX4 A;  3DF0 B;  3QME A;  1KFU S;  1LXF C;  1AK8 A;  4TNC A;  3BFB A;  3KHE A;  1DJI A;  4YGA A;  1CLL A;  1DQE A;  2KGR A;  1BT6 A;  1CTR A;  2K7O A;  4ETO A;  3UNW A;  1B8L A;  2KHN A;  4FQT A;  1YX8 A;  1CFP A;  1J7O A;  3R1V A;  4PHK A;  1OZO A;  1WLM A;  3GOF A;  2JNF A;  4GGF A;  2K7D A;  4MZJ A;  5FI6 A;  3RM1 A;  3DXL A;  4MSP A;  5JOL A;  3EKJ A;  1PSB A;  4USL A;  3QRX A;  2JWW A;  3BOW B;  4PHN A;  4QJ5 B;  4AQI A;  2GGZ A;  2O60 A;  1DGU A;  1JWD A;  1K8U A;  3R72 A;  3FWB A;  3SG3 A;  2KAY A;  1Y6W A;  1DJG A;  1QAT A;  1T14 A;  3V2L A;  1UUR A;  2Y5I A;  4MVF A;  1OZS A;  3CDN A;  2A4J A;  3D75 A;  3A4U B;  1VRK A;  5CSI A;  2FOT A;  2JRF A;  2NZ0 A;  2LP2 A;  3TS5 C;  2LVI A;  1CDM A;  2M1K B;  4INX A;  1B1G A;  1QX7 A;  1RRO A;  1YUT A;  3EVR A;  2QDI A;  1B9A A;  3OHM B;  2L4I A;  2JPT A;  2WC6 A;  4F7F A;  3B86 A;  1PAL A;  3S0B A;  1JFK A;  1BG1 A;  3CZT X;  5AFP A;  3AKA A;  4PDZ A;  1DEK A;  3H4S E;  1LIN A;  1DC1 A;  1CDN A;  1HQV A;  2G9B A;  3WHU B;  3FWC A;  1IQ3 A;  2BBN A;  3EVV A;  3CTN A;  4GPL B;  4MBE A;  5AXI A;  4NDD A;  2JC2 A;  1PUL A;  4GNK B;  2JNX A;  2Y1N A;  5I2O A;  1A75 A;  1SR6 B;  1KSM A;  2MLE C;  2KI4 C;  4MN0 A;  3S0F A;  1CDL A;  2PVB A;  1AJ4 A;  1DTL A;  1BMO A;  3AAK A;  2KBI A;  2LVV A;  2L4H A;  3VRR A;  4C0L A;  2LAN A;  1XO5 A;  3R1O A;  3R1P A;  1QV0 A;  1S6C A;  4ZCU A;  2PQL A;  1SCM B;  1XFU O;  2PRU A;  5D7F A;  1OOI X;  2K0J A;  3CS1 A;  2GGM A;  1SNL A;  3O4X A;  4ORA B;  2VRG A;  3DD4 A;  4WRI A;  3I5I C;  3BXK A;  1WLZ A;  4I5K A;  3S0D A;  2F2O A;  2OTG C;  1LS8 A;  3SS3 A;  2AMI A;  1EG3 A;  5B8I B;  1C7V A;  1XFR A;  5G08 A;  1IKU A;  3DF0 A;  3FIA A;  1SW8 A;  2HQ8 A;  1G8I A;  3PM8 A;  1BJF A;  2ZN9 A;  1V1F A;  1Y1U A;  4GFT A;  5HKZ A;  1NCZ A;  1K90 D;  1L2O B;  2ZKM X;  3OX5 A;  5HKY A;  2F8P A;  3D77 A;  1S5G Z;  1MHO A;  5AER A;  1WRZ A;  2HPS A;  2K60 A;  1KK8 C;  1LA3 A;  3CLN A;  4JWQ A;  2OPO A;  2KAV A;  5HKW A;  1ODB A;  3S0E A;  3BOW A;  1JBA A;  2TN4 A;  2H61 A;  1AHR A;  1K9K A;  4HRE E;  2LUC A;  2JZI A;  3B6X A;  2ZND A;  3PJI A;  3LL8 B;  3Q8I A;  3CR2 A;  1FI6 A;  1IGV A;  1TOP A;  1ZUZ A;  2G2B A;  3CZ2 A;  1XVJ A;  5IBW A;  1ZAC A;  1QVI Y;  1U5I A;  1W7J B;  4N1F A;  1NX1 A;  2LLU A;  4YRU A;  1B8C A;  2EGD A;  3I5F B;  3ICB A;  2KAX A;  1SMG A;  1SL7 A;  2LP3 A;  4DCK A;  1F70 A;  1FBV A;  1D1O A;  4OV2 A;  2K8M B;  3O2P A;  1DGV A;  1CNP A;  1QIW A;  2KFG A;  1CM1 A;  2JU0 A;  1G4Y R;  1YUU A;  3EKH A;  1W9Z A;  2BAP A;  2K2A A;  1TN4 A;  2WCM A;  3BUX B;  3A8R A;  5KSZ A;  1OW4 A;  2LHL A;  1F4O A;  1UHH A;  3IQO A;  4MZL A;  5I94 A;  5F6T A;  1K94 A;  1KCY A;  2KYC A;  1QXP A;  1S1E A;  2LVJ A;  2M7L A;  1LVC D;  1Y0V H;  3JTD B;  4C0J A;  1TUJ A;  2FCE A;  1OSA A;  2LLT A;  4OVN F;  2LC5 A;  3BUN B;  3N7H A;  2JUL A;  3DVE A;  1OOJ A;  3L4A A;  5FYX A;  4CFR A;  2SCP A;  1KQV A;  1EL4 A;  4ORC B;  2KLD A;  1WDC C;  1CFD A;  4YGE B;  2L51 A;  4BY5 A;  1QLS A;  1YTZ C;  3JVT C;  4PE0 A;  1EH2 A;  2WCL A;  3FE6 A;  1NWD A;  2BL0 B;  4WQ2 A;  1DMO A;  2AUC A;  1W7I B;  3BJH A;  1XA5 A;  3SG6 A;  1N0Y A;  1Z4H A;  2NCP A;  1J55 A;  1UHI A;  1DJW A;  2OS8 C;  4IL1 A;  4ZCV A;  4UPG A;  2BKI B;  4XJK A;  1KFU L;  3TUY C;  1CKK A;  3HCM A;  1GQM A;  5EL2 A;  5JJG A;  2IS9 A;  3OP0 A;  3IVT A;  4JKT A;  1MF8 B;  2MAZ A;  3AKB A;  1NX0 A;  2LCP A;  1OOF A;  2JTZ A;  2P70 A;  2P71 A;  3EK8 A;  1J1D A;  1KQM B;  1U5I B;  1XFY O;  2BE6 A;  1K96 A;  3FE8 A;  3S0A A;  1KWO C;  1M63 B;  2I94 A;  2LAP A;  5DKR A;  2F3Y A;  1UUS A;  2JT8 A;  1V1G A;  2MJW B;  3PLF B;  1FI5 A;  1F55 A;  1M46 A;  2BE4 A;  5ER4 X;  5FI7 A;  4YGD B;  4GGN A;  2E30 A;  3OX6 A;  4PE1 A;  3GK2 A;  3DY9 A;  1AP4 A;  2QEO A;  4R1E A;  2F3Z A;  1Y1X A;  1B7T Y;  3BYA A;  2V53 A;  2P6B B;  2ZN8 A;  3NHI A;  1A4P A;  3IF7 A;  3CYZ A;  1BF5 A;  4PCW A;  1C3Y A;  3SG4 A;  2AAO A;  2L2E A;  1DVI A;  2RGI A;  1KFX S;  4I5N B;  4PAL A;  4KYN A;  2QAC A;  3B87 A;  2L5X B;  1CFC A;  2WCJ A;  1N2D A; 
#chains in the Genus database with same CATH homology
 3BUO B;  3LCP C;  1DJH A;  1B47 A;  5CPV A;  2WCF A;  1NX3 A;  1NYA A;  1JF2 A;  2JT0 A;  1XFW O;  4DS7 A;  1SL9 A;  4NDB A;  2CBL A;  3IQQ A;  1FPW A;  1EXR A;  1QIV A;  3LK0 A;  1A2X A;  1DJY A;  1H8B A;  2BCA A;  2JOJ A;  2Q4U A;  4XJK B;  1DJZ A;  5CSF A;  1CM4 A;  2KI4 B;  1SR6 C;  2EC6 B;  3FS7 A;  4GGF C;  1K2H A;  2R2I A;  2ZRT A;  1IJ5 A;  1RTP 1;  2CCM A;  2L0P A;  4A4B A;  4HSZ A;  3VRO A;  3TDI A;  2E6W A;  5DKN A;  1JF0 A;  3PAT A;  5DKQ A;  4CID A;  1YVL A;  1NPQ A;  3NXA A;  2CNP A;  1WY9 A;  2WCE A;  1SCM C;  1QX5 B;  2FJU B;  2F33 A;  1PVB A;  3I5G C;  2KI6 C;  1CLM A;  1F4Q A;  1MR8 A;  4DRW A;  1AJ5 A;  1NCY A;  3D0Y A;  5HLO A;  1QS7 A;  4P5O E;  1TIZ A;  3PAL A;  2M49 B;  3PN7 B;  1CFF A;  2H2K A;  1UHK A;  4N1G A;  3O78 A;  1K9P A;  2LM5 A;  1NUB A;  1XYD A;  2Y4Q A;  2NXQ A;  2BBM A;  3LK1 A;  2ZFD A;  1K95 A;  2F2P A;  2M8U A;  2KYF A;  2WOS A;  2M1U A;  1K93 D;  4MLW A;  2JTT A;  1OQP A;  2K61 A;  3EVU A;  1JUO A;  4CFQ A;  1L2O C;  2JQ6 A;  2KSP A;  4GBA A;  2LE9 B;  1QJT A;  1CB1 A;  2K2F A;  3DVK A;  4HRH A;  1SPY A;  4YGB B;  1BR4 B;  2LLS A;  3VRQ A;  1NIW A;  2BEC A;  4MRY A;  1IH0 A;  2KOT A;  2I2R E;  4PHJ A;  2GV5 A;  2K7C A;  3I5H B;  3LLE A;  1QAS A;  5AEQ A;  3WHT B;  2SAS A;  1B8R A;  1H4B A;  2NLN A;  3NSK A;  5CSN A;  2CXJ A;  1EJ3 A;  1S3P A;  3CR5 X;  1J7Q A;  4M2O A;  5KTY A;  2M0R A;  2LMT A;  1ALW A;  3I5F C;  2MA2 A;  4YBH B;  1IQ5 A;  1A29 A;  1TNX A;  2ISD A;  1TNW A;  3F45 A;  3NSO A;  1BLQ A;  1RJV A;  1M39 A;  2M97 A;  2QPT A;  1SK6 D;  2BKH B;  3D0Y B;  2PAS A;  1M31 A;  1TCO B;  3KO0 A;  1DF0 A;  1UP5 A;  2LMU A;  5PAL A;  2JXL A;  2DOQ A;  1BU3 A;  3SG5 A;  3E3R A;  1C07 A;  2M3W A;  5TNC A;  1SL8 A;  5AAN A;  3PFV A;  1E8A A;  1XFZ O;  3TZ1 A;  1J1E A;  2HQW A;  4ORB B;  2JT3 A;  5I2L A;  4WQ3 A;  2LHI A;  2HET A;  1OMV A;  2KNE A;  3NSI A;  2MBX A;  4YGC B;  4C0K A;  5D69 A;  3DVJ A;  1TNP A;  3TDU A;  3GK4 X;  2WND A;  1S5G Y;  3ZWH A;  1KK7 Z;  2OS8 B;  5GQQ C;  2KDH A;  2WOR A;  4GAO A;  1YR5 A;  4QJ3 B;  3TUY B;  1XFV O;  1S6J A;  2H61 C;  3KEV A;  1NSH A;  1NX2 A;  2B1U A;  2MLF C;  4CLN A;  3WNX B;  1YX7 A;  1F71 A;  4U8D A;  4MRX A;  1KQM C;  1Y1A A;  1SKT A;  2WC8 A;  1KWO B;  1PSR A;  1LA0 A;  1WRL A;  1YUS A;  2L98 A;  3TS5 B;  3EK4 A;  1RFJ A;  3DVM A;  1L7Z A;  1S6I A;  1SBJ A;  5HYD A;  1N2D A;  1CDP A;  4DIR A;  2BCX A;  1QTX A;  1SRA A;  3WXA A;  1BOD A;  5I2Q A;  1DF0 B;  1G33 A;  5BPJ A;  3VRP A;  3D10 A;  1XK4 A;  2L50 A;  1AUI B;  1JC2 A;  2CTN A;  3OB2 B;  4Q04 A;  1K9U A;  2M29 A;  1PRW A;  3PSR A;  5KU1 A;  1BOC A;  4AQJ A;  3BUW B;  1DJX A;  4I5J A;  1MXL C;  2BL0 C;  2LV7 A;  4FTG A;  1ZOT B;  1NCX A;  4GUK A;  1UWO A;  1PK0 D;  2LNK A;  1QVI Z;  1REC A;  1N65 A;  2CT9 A;  1KFX L;  3RLZ A;  1GGZ A;  2KFH A;  2NCO A;  2Y1M A;  3KF9 A;  2KFF A;  2KI6 D;  2PAL A;  2M7N A;  1IG5 A;  2KQ6 A;  3SIB A;  1TTX A;  4OCI A;  4CPV A;  1HT9 A;  1BR1 B;  2JXC A;  1UHN A;  2MRD A;  3K21 A;  3O6B A;  3SIA A;  4P2Y B;  3VGO A;  1F8H A;  1B4C A;  2ZNE A;  2EC6 C;  1TNQ A;  3I5I B;  3O4Y A;  1FW4 A;  1TRF A;  4D1E A;  2OTG B;  1CLB A;  1X02 A;  1C7W A;  4F0Z B;  4YI8 A;  1J7R A;  1JFJ A;  1KSO A;  5J3X A;  1S36 A;  4N5X A;  2KBM A;  1A03 A;  2COL B;  3I5G B;  1KK7 Y;  3SJS A;  1YRT B;  4OR9 B;  1F54 A;  5HLV A;  3SG7 A;  1OMD A;  2PMY A;  4PE7 A;  4M2P A;  2KGB C;  3PN7 C;  4I5L B;  4QJ4 B;  1UHJ A;  2MHH A;  1RK9 A;  2D8N A;  3SG2 A;  4PHM A;  3AAJ A;  2HF5 A;  1SYM A;  2K7B A;  3GK1 A;  1KK8 B;  4A4C A;  1XFX O;  2M9G A;  1IWQ A;  1MWN A;  1M45 A;  1EG4 A;  1OE9 B;  1PVA A;  4JQ0 D;  1FF1 A;  2WCB A;  3CWG A;  1IJ6 A;  2BCB A;  2LUX A;  1S26 D;  4OKH A;  1QX2 A;  1R6P A;  4MEW A;  4AOM A;  4DUQ A;  1XK4 C;  4MZK A;  2LVK A;  2LMV A;  1GJY A;  3ZNI A;  3NSL A;  4FQO A;  1IRJ A;  1SCV A;  4NDC A;  1QLK A;  4YI9 A;  1YRU B;  4BY4 A;  1R2U A;  4PE4 A;  2Q91 A;  1ZMZ A;  3CGA A;  1AVS A;  1NP8 A;  1B7T Z;  1YVH A;  2O5G A;  2FCD A;  1A75 B;  3EK7 A;  3I5H C;  4ICB A;  4NQG A;  1ALV A;  1SY9 A;  3MSE B;  1MQ1 A;  1YUR A;  3BQ3 A;  1MXE A;  2KQY A;  3BUM B;  4HRG A;  2I7A A;  1DT7 B;  1MUX A;  1JSA A;  1CMF A;  1LKJ A;  1OMR A;  3OB1 B;  5K89 A;  5I8N A;  3KPX A;  4XYN A;  4E68 A;  4M2Q A;  1RWY A;  3JTD C;  4JPZ B;  3VRN A;  1J7P A;  2PSR A;  4L9M A;  3TDZ A;  1QV1 A;  1Q80 A;  3CR4 X;  1CMG A;  3C1V A;  1WDC B;  5CSJ A;  1TCF A;  2I18 A;  1GGW A;  1ZFS A;  2EHB A;  3JVT B;  3M0W A;  5ER5 A;  1WRK A;  2ZRS A;  3HX4 A;  3DF0 B;  1KFU S;  1LXF C;  1AK8 A;  4TNC A;  3KHE A;  1DJI A;  4YGA A;  1CLL A;  2KGR A;  1BT6 A;  1CTR A;  2K7O A;  4ETO A;  1B8L A;  2KHN A;  1J7O A;  1YX8 A;  1CFP A;  4PHK A;  1OZO A;  1WLM A;  3GOF A;  2JNF A;  4GGF A;  2K7D A;  4MZJ A;  3RM1 A;  4MSP A;  5JOL A;  3EKJ A;  1PSB A;  4USL A;  3QRX A;  2JWW A;  3BOW B;  4PHN A;  4QJ5 B;  4AQI A;  2GGZ A;  2O60 A;  1DGU A;  1JWD A;  1K8U A;  3SG3 A;  3FWB A;  2KAY A;  1Y6W A;  1DJG A;  1QAT A;  1UUR A;  2Y5I A;  4MVF A;  1OZS A;  2A4J A;  3A4U B;  1VRK A;  5CSI A;  2FOT A;  2JRF A;  2NZ0 A;  2LP2 A;  3TS5 C;  2LVI A;  1CDM A;  2M1K B;  1B1G A;  1QX7 A;  1RRO A;  1YUT A;  3EVR A;  1B9A A;  3OHM B;  2L4I A;  2JPT A;  1PAL A;  1JFK A;  1BG1 A;  3CZT X;  5AFP A;  3AKA A;  4PDZ A;  3H4S E;  1LIN A;  1CDN A;  1HQV A;  2G9B A;  3WHU B;  3FWC A;  1IQ3 A;  2BBN A;  3EVV A;  3CTN A;  4GPL B;  4MBE A;  5AXI A;  4NDD A;  2JC2 A;  1PUL A;  4GNK B;  2JNX A;  2Y1N A;  5I2O A;  1A75 A;  1SR6 B;  1KSM A;  2MLE C;  2KI4 C;  4MN0 A;  1CDL A;  2PVB A;  1AJ4 A;  1DTL A;  1BMO A;  3AAK A;  2KBI A;  2LVV A;  2L4H A;  3VRR A;  4C0L A;  2LAN A;  1XO5 A;  1QV0 A;  1S6C A;  4ZCU A;  1SCM B;  1XFU O;  2PRU A;  5D7F A;  2K0J A;  3CS1 A;  2GGM A;  1SNL A;  4ORA B;  4WRI A;  2VRG A;  3DD4 A;  3I5I C;  3BXK A;  1WLZ A;  4I5K A;  2F2O A;  2OTG C;  2AMI A;  1EG3 A;  5B8I B;  1C7V A;  5G08 A;  1IKU A;  3DF0 A;  3FIA A;  1SW8 A;  2HQ8 A;  1G8I A;  3PM8 A;  1BJF A;  2ZN9 A;  1V1F A;  1Y1U A;  4GFT A;  5HKZ A;  1NCZ A;  1K90 D;  1L2O B;  2ZKM X;  3OX5 A;  5HKY A;  2F8P A;  1S5G Z;  1MHO A;  5AER A;  1WRZ A;  2HPS A;  1KK8 C;  1LA3 A;  3CLN A;  4JWQ A;  2OPO A;  2KAV A;  5HKW A;  1ODB A;  3BOW A;  1JBA A;  2TN4 A;  2H61 A;  1AHR A;  1K9K A;  4HRE E;  2LUC A;  2JZI A;  2ZND A;  3LL8 B;  3CR2 A;  1FI6 A;  1IGV A;  1TOP A;  1ZUZ A;  2G2B A;  1XVJ A;  5IBW A;  1ZAC A;  1QVI Y;  1U5I A;  1W7J B;  4N1F A;  1NX1 A;  2LLU A;  4YRU A;  1B8C A;  2EGD A;  3I5F B;  3ICB A;  2KAX A;  1SMG A;  1SL7 A;  2LP3 A;  4DCK A;  1F70 A;  1FBV A;  1D1O A;  4OV2 A;  2K8M B;  3O2P A;  1DGV A;  1CNP A;  1QIW A;  2KFG A;  1CM1 A;  2JU0 A;  1G4Y R;  1YUU A;  3EKH A;  2K2A A;  1TN4 A;  3BUX B;  5KSZ A;  3A8R A;  2LHL A;  1F4O A;  1UHH A;  3IQO A;  4MZL A;  1KCY A;  5F6T A;  1K94 A;  2KYC A;  1QXP A;  1S1E A;  2LVJ A;  2M7L A;  1LVC D;  1Y0V H;  3JTD B;  4C0J A;  2FCE A;  1OSA A;  2LLT A;  4OVN F;  2LC5 A;  3BUN B;  5FYX A;  2JUL A;  3DVE A;  1OOJ A;  4CFR A;  2SCP A;  1KQV A;  1EL4 A;  4ORC B;  1WDC C;  1CFD A;  4YGE B;  2L51 A;  4BY5 A;  1QLS A;  1YTZ C;  3JVT C;  4PE0 A;  1EH2 A;  1NWD A;  4WQ2 A;  1DMO A;  2AUC A;  1W7I B;  1XA5 A;  3SG6 A;  1N0Y A;  2NCP A;  1J55 A;  1UHI A;  1DJW A;  2OS8 C;  4IL1 A;  4ZCV A;  4UPG A;  2BKI B;  4XJK A;  1KFU L;  3TUY C;  1CKK A;  3HCM A;  1GQM A;  5JJG A;  2IS9 A;  3OP0 A;  1MF8 B;  2MAZ A;  3AKB A;  1NX0 A;  2LCP A;  2JTZ A;  3EK8 A;  1J1D A;  1KQM B;  1U5I B;  1XFY O;  2BE6 A;  1K96 A;  1KWO C;  1M63 B;  2I94 A;  2LAP A;  5DKR A;  2F3Y A;  1UUS A;  2JT8 A;  1V1G A;  2MJW B;  3PLF B;  1FI5 A;  1F55 A;  1M46 A;  2BE4 A;  5ER4 X;  4YGD B;  4GGN A;  2E30 A;  3OX6 A;  4PE1 A;  3GK2 A;  1AP4 A;  4R1E A;  2F3Z A;  1Y1X A;  1B7T Y;  3BYA A;  2V53 A;  2P6B B;  2ZN8 A;  1A4P A;  3IF7 A;  1BF5 A;  4PCW A;  3SG4 A;  2AAO A;  2L2E A;  1DVI A;  2RGI A;  1KFX S;  4I5N B;  4PAL A;  2QAC A;  2L5X B;  1CFC A;  2BL0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...