3B87A

Complex of t57a substituted droposphila lush protein with butanol
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
124
structure length
124
Chain Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGAVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General odorant-binding protein lush
publication title The role of multiple hydrogen-bonding groups in specific alcohol binding sites in proteins: insights from structural studies of LUSH.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 46
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3b87A00
1DQEA 2WCHA 3L4LA 3L4AA 2QEVA 2L2CA 4INXA 3N7HA 3B87A 3BJHA 3K1EA 2QEOA 3S0FA 1XFRA 2PQLA 3D78A 3FE6A 1GM0A 3B7AA 2QEBA 5DICA 3NGVA 1OOHA 2WCMA 3R72A 2FJYA 3D75A 3CDNA 2P71A 1LS8A 2WC5A 3S0GA 3B6XA 3VB1A 3L47A 3B86A 4JD9A 5EL2A 4OZDA 3S0EA 1OOIX 2WCJA 2WCKA 3BFHA 2GTEA 2WC6A 3R1VA 4F7FA 3D73A 1C3ZA 1QWVA 3B88A 1C3YA 2QEHA 3Q8IA 1OOGA 2JPOA 3CZ1A 1TUJA 3QMEA 1T14A 4FQTA 3PJIA 3BFBA 2QDIA 3BFAA 3CZ0A 2KPHA 3NHIA 3NHTA 3S0BA 1ORGA 2P70A 1P28A 3RZSA 3CZ2A 3V2LA 3OGNA 2WCLA 2ERBA 3DXLA 1OW4A 3S0DA 3D76A 2H8VA 3D74A 3R1OA 1TWOA 3CABA 3DZTA 3CYZA 3S0AA 3DYEA 3FE8A 3D77A 3DY9A 3R1PA 4PT1A 4INWA 1OOFA 3FE9A
chains in the Genus database with same CATH superfamily
1PVBA 1UHNA 2KI4C 1YVHA 1IKUA 5D7FA 3PLFB 1JFKA 5HLVA 1QX5B 1NIWA 1W7IB 2L2CA 2OS8C 4INXA 3JVTC 3B87A 3BJHA 2QEOA 1XO5A 4GGFC 1YR5A 2B1UA 2WCEA 1L7ZA 3I5HB 3EK7A 1EL4A 4PE0A 2F3ZA 3BYAA 1SCMB 2L2EA 1DGUA 1XFZO 1CTRA 2QACA 2F2OA 2H2KA 3I5FB 1NPQA 2PQLA 1IH0A 1GJYA 4I5KA 2LLTA 1QX2A 1KQMC 3E3RA 3SIAA 2M29A 3OX6A 4NDCA 2QEBA 3BOWA 3NGVA 5HL1A 5I2QA 1L2OC 1BU3A 4GBAA 2ZNEA 3VRPA 4GPLB 1S6CA 2GGZA 3R72A 4Q04A 2FJYA 3FWCA 3M0WA 5TNCA 1IJ5A 1J1DA 3DVJA 2K7BA 2Y1MA 4MZKA 4QJ5B 1RFJA 1YUUA 1K2HA 3B6XA 2E6WA 1UUSA 2KBMA 2LE9B 2F8PA 1W9ZA 3L47A 2M0RA 4CFQA 3SG5A 4PE7A 3HX4A 1BF5A 4JD9A 1XFYO 2JOJA 2NCOA 1CMGA 4CFRA 3SIBA 5I8NA 1K94A 2LMVA 3CLNA 5I2LA 1LA3A 1TCFA 2LNKA 1QATA 2EHBA 3F45A 1CB1A 1TCOB 1KFXL 1K9KA 3PN7C 1CMFA 1DJHA 2K7CA 3BFHA 5GQQC 1NCZA 1KFUL 1U5IA 3NSLA 2K2AA 3IQQA 4MZJA 3VRNA 3BOWB 2I2RE 4OR9B 2CXJA 2Y1NA 1G4YR 1SNLA 1YUTA 2JULA 2RGIA 2JC2A 4YI8A 1SCVA 1UURA 1ZMZA 4JQ0D 2K0JA 3WHUB 3DD4A 4PHJA 4MRYA 1GQMA 2KFGA 1YRTB 1TNXA 2K2FA 2GGMA 1JBAA 1GGZA 2SCPA 2LVKA 2KNEA 3PALA 1B8LA 2M9GA 2LAPA 4MBEA 1J7OA 1NX0A 2PSRA 1FW4A 1CFDA 3OP0A 1OE9B 4N1FA 3SG2A 1SK6D 2NCPA 3BFBA 4ORBB 4CIDA 1S6IA 1CM4A 1UWOA 2KPHA 4YGBB 1WY9A 1IWQA 2CBLA 1C7WA 1BLQA 1TIZA 1S36A 2PASA 2P70A 2CNPA 2K8MB 1QS7A 1B9AA 3RLZA 3CZ2A 1S26D 2WCLA 2JZIA 1DT7B 3AKBA 1ZFSA 4AOMA 5CSIA 2L4HA 2P6BB 1B8RA 2H8VA 2JTTA 4IL1A 2KSPA 4TNCA 2V53A 2BCBA 1MF8B 2LMUA 1B47A 1AJ4A 3NSOA 2M1KB 1A4PA 2MLEC 1ZACA 3DZTA 1RWYA 4FTGA 1SR6C 1IRJA 3I5IB 4P5OE 1DVIA 4GGNA 2KQ6A 1A2XA 3FE8A 2KFHA 1TNPA 4HRGA 4PE1A 2LMTA 3IF7A 1AP4A 1CDMA 2O5GA 2CT9A 4MRXA 5HLOA 3TZ1A 1QXPA 2BL0B 2FOTA 3PSRA 1NUBA 1QV0A 1YUSA 2KYFA 2PMYA 2KHNA 3FE9A 4OVNF 1LVCD 4YGAA 5G08A 4PHMA 2MLFC 1IQ3A 2BECA 4C0KA 3JTDB 1K9UA 3VGOA 1YTZC 2F3YA 2LM5A 4QJ3B 1CLBA 3L4LA 2BNXA 2MBXA 3L4AA 4MZLA 4P2YB 1S6JA 3GK2A 2R2IA 2QEVA 3KEVA 1QIVA 2Y5IA 3VRRA 1KWOB 4DCKA 2M7NA 4ORCB 1CFCA 1DEKA 1J7QA 1TUZA 1LKJA 1RK9A 1EXRA 1DJXA 5FI6A 2LLUA 4WRIA 3IQOA 1TNWA 1KK7Z 3WHTB 2E30A 1K95A 2LANA 1QLKA 1QLSA 4QJ4B 4XJKA 1LXFC 2LUCA 3FE6A 3GK1A 2BBMA 2G2BA 2KI6D 2H61C 3DF0A 1YX8A 4PT1A 1GM0A 2OTGB 3B7AA 2KDHA 2EGDA 1CKKA 1MQ1A 3I5GB 1R6PA 5CSFA 2WORA 2MJWB 3EKJA 2K60A 4GFTA 1WLZA 2WCMA 3TS5C 2BE6A 1A29A 3FWBA 2D8NA 2KAYA 1MXLC 2BE4A 3NSKA 4HSZA 3VB1A 4MN0A 1PALA 3OB1B 1CLLA 5CPVA 1Y1XA 5KTYA 1SY9A 1B7TZ 3PM2A 1CLMA 4YI9A 1J7PA 1AHRA 1XK4A 2I18A 1F4QA 4MLWA 4U8DA 5J3XA 2I7AA 2LP3A 3S0EA 1KQVA 1G8IA 1OOIX 1PRWA 3DVMA 5DKNA 1FI6A 2WCJA 2Y4QA 2WCKA 4PHKA 3DF0B 1BR4B 1K90D 1DJGA 2GTEA 3LLEA 3O4XA 4N5XA 4CLNA 3H4SE 1W7JB 4F7FA 3A4UB 2O60A 2HETA 3SG4A 1PSBA 2CCMA 2L98A 1F70A 1NX2A 3QRXA 1TN4A 1C3ZA 2KFFA 2M49B 2VRGA 3TDIA 1QWVA 1EH2A 4PALA 4PE4A 5KSZA 1K9PA 2LLSA 3D0YA 2FCDA 2PYQA 1EJ3A 2PRUA 2PVBA 2EC6B 2MHHA 4DS7A 5BPJA 1BG1A 5CSJA 2FJUB 3SG7A 4ETOA 2BCXA 3ZWHA 2G9BA 1YVLA 1TTXA 3I5HC 3VROA 1CFFA 1H8BA 1QVIY 1UHHA 1SCMC 1WRKA 1DF0A 1SBJA 1UHIA 1N65A 1NX3A 2QDIA 3EK4A 3KF9A 3PJIA 1CDPA 3BFAA 4PHNA 2AUCA 1J7RA 3I5FC 3BUWB 2M1UA 2ISDA 3S0BA 1F55A 1BJFA 3SG3A 5HYDA 1PVAA 3CWGA 1RECA 4F0ZB 1DELA 1WDCB 2F33A 3D0YB 1Q80A 3AKAA 1J55A 1OMRA 3LK0A 2JTZA 2WCBA 1PULA 2AAOA 2JNXA 3ICBA 4OV2A 3DYEA 2JT8A 3TUYB 1F71A 2JQ6A 3AAJA 3EK8A 2WNDA 3DVEA 1JFJA 4JWQA 5AEQA 4CPVA 1U5IB 5ER5A 1OOFA 1DJWA 2WC8A 1DQEA 2LCPA 1OMDA 2WCHA 2M3WA 1B8CA 1AVSA 5KU1A 2L50A 3SG6A 5JOLA 3CZTX 1F54A 2KLDA 1QASA 2NLNA 1KK8B 2L5XB 1S5GZ 1ZUZA 4MSPA 4OCIA 1BMOA 3MSEB 1RTP1 1KSMA 2WCFA 4YGDB 1R2UA 4NQGA 1JSAA 3BUOB 1ZOTB 4GAOA 4DRWA 5D3OA 2HQ8A 1XFRA 3WXAA 2JWWA 1UHKA 2KBIA 3D78A 5IBWA 2Q91A 3CR4X 1HQVA 4I5JA 3HCMA 3PFVA 1BR1B 1MXEA 1OMVA 5DICA 4JKTA 2BKIB 3RM1A 5FI2A 2KQYA 5F6TA 2JPTA 1JUOA 1SL7A 2ZRTA 5HKWA 1FF1A 2JT3A 3EVUA 4KYNA 4AQIA 4PDZA 3D75A 1IQ5A 2P71A 3CDNA 1LS8A 2WC5A 3S0GA 1NWDA 1S1EA 3CR5X 2JXCA 4GGFA 1DTLA 4DUQA 3EG5B 5K89A 2LV7A 5EL2A 1JF0A 4IJ7A 2CTNA 3I5IC 2KOTA 4MVFA 2FCEA 3LCPC 4OZDA 3KHEA 4NDBA 1Y0VH 1FBVA 2WC6A 3SS3A 3R1VA 3LK1A 1H4BA 2KI4B 3VRQA 2BL0C 2LHLA 1A75A 4L9MA 3SS5A 4BY5A 1FPWA 1MWNA 2LVVA 3JTDC 2OS8B 3D73A 1ODBA 4M2OA 3EVVA 3JVTB 4AQJA 2I94A 1C3YA 3OBVA 1YX7A 2NZ0A 4ORAB 1JC2A 2LC5A 5HKYA 5JJGA 1BOCA 1MHOA 1SYMA 3Q8IA 1DMOA 2DOQA 1KWOC 1OOGA 1JF2A 1LA0A 1OOJA 2M97A 3CGAA 3O4YA 4I5NB 4USLA 5DKRA 1M63B 1HT9A 1TUJA 2K7OA 3QMEA 3CS1A 3BUXB 4WQ2A 4FQTA 1GGWA 4XJKB 1C7VA 1F4OA 1KQMB 2LVJA 4PCWA 4C0LA 1XYDA 4UPGA 3CZ0A 3NSIA 1AK8A 3NHIA 1DJYA 1L2OB 4DIRA 1P28A 2OTGC 3V2LA 3RZSA 3OGNA 4WQ3A 2ERBA 3DXLA 1IIOA 1VRKA 1WLMA 3I5GC 4MEWA 1CNPA 3D74A 1XFWO 4N1GA 3R1OA 1TWOA 2LUXA 1KCYA 4D1EA 2ZNDA 3DVKA 3EKHA 1OSAA 3CYZA 1SSEB 4OKHA 2JRFA 2JXLA 3PN7B 3O6BA 3S0AA 1WRZA 1M46A 4R1EA 2LP2A 3DY9A 1RJVA 2K61A 2ZN8A 1MUXA 1QJTA 2BCAA 3R1PA 4INWA 1BT6A 1ALVA 4JPZB 2JT0A 5HKZA 3O2PA 2M8UA 1IGVA 1DC1A 3PATA 5AFPA 2LVIA 2KI6C 5AANA 1IG5A 2Q4UA 1KK7Y 2AMIA 1MR8A 1QV1A 1XFVO 1XFXO 2F2PA 4C0JA 1OQPA 3N7HA 4GUKA 2WOSA 1PK0D 4GNKB 3K1EA 1B4CA 3ZNIA 1DJZA 3K21A 5AXIA 3S0FA 1XK4C 2EC6C 2HF5A 2ZN9A 4HRHA 2KAVA 3AAKA 1CDLA 4ZCUA 1DF0B 1D1OA 1F8HA 2JU0A 4M2PA 1YRUB 1LINA 3BQ3A 4M2QA 5CSNA 1TRFA 1QTXA 4YGEB 3BXKA 3O78A 1NP8A 3IVTA 4A4BA 3OX5A 1M39A 3BUNB 3GOFA 3LL8B 2MA2A 1B7TY 3KO0A 3SS4A 3TDUA 1OZSA 1C07A 4I5LB 1PSRA 1SL8A 1UP5A 4FQOA 2M7LA 1A03A 1OOHA 1KSOA 1S3PA 2TN4A 3EVRA 1E8AA 1OZOA 1J1EA 1Y6WA 2COLB 4XYNA 4YRUA 1JWDA 1SR6B 1WDCC 2BKHB 2NXQA 3TDZA 3B86A 2GV5A 1SKTA 1QX7A 4BY4A 4E68A 4YGCB 1X02A 5I94A 1CDNA 2MAZA 2L5YA 3TUYC 5PALA 1DGVA 5I2OA 3KPXA 1NSHA 3FS7A 3WNXB 2H61A 1SPYA 1AJ5A 1AUIB 2KLEA 1CFPA 3FIAA 1IJ6A 2HPSA 2OPOA 4ICBA 3UNWA 2BAPA 3C1VA 2ZRSA 1Z2CB 5B8IB 2SASA 2BBNA 2YGUA 3SJSA 3B88A 1K93D 2KAXA 1V1GA 2QEHA 1M31A 4HREE 1Y1AA 1SL9A 1SMGA 4A4CA 1FI5A 1XVJA 3BUMB 2A4JA 1KK8C 2JPOA 3CZ1A 1WRLA 4ZCVA 2L51A 1T14A 1B1GA 1EG4A 3OB2B 2KGRA 1XA5A 1EG3A 1G33A 1NCYA 1TOPA 3D10A 5FI7A 3NHTA 1ORGA 2K7DA 2KYCA 3OHMB 1UHJA 1YURA 1V1FA 2L4IA 3TS5B 2ZFDA 4YBHB 1BODA 1ALWA 1K96A 1SRAA 1NYAA 1QIWA 1QVIZ 1OW4A 2HQWA 3CTNA 1RROA 1SW8A 1Y1UA 2QPTA 3A8RA 3D76A 3S0DA 1TNQA 5FYXA 5DKQA 2IS9A 3CABA 4NDDA 1Z4HA 1CM1A 1XFUO 2KGBC 1K8UA 2LHIA 2PALA 2ZKMX 2JNFA 3GK4X 2MRDA 3NXAA 1N0YA 1NX1A 5ER4X 3CR2A 3D77A 5AERA 3UO9A 1KFXS 1M45A 5D69A 1S5GY 1N2DA 3PM8A 1DJIA 2L0PA 1NCXA 1A75B 1KFUS
chains in the Genus database with same CATH topology
1DQEA 2WCHA 3L4LA 3L4AA 2QEVA 2L2CA 4INXA 3N7HA 3B87A 3BJHA 3K1EA 2QEOA 3S0FA 1XFRA 2PQLA 3D78A 3FE6A 1GM0A 3B7AA 2QEBA 5DICA 3NGVA 1OOHA 2WCMA 3R72A 2FJYA 3D75A 3CDNA 2P71A 1LS8A 2WC5A 3S0GA 3B6XA 3VB1A 3L47A 3B86A 4JD9A 5EL2A 4OZDA 3S0EA 1OOIX 2WCJA 2WCKA 3BFHA 2GTEA 2WC6A 3R1VA 4F7FA 3D73A 1C3ZA 1QWVA 3B88A 1C3YA 2QEHA 3Q8IA 1OOGA 2JPOA 3CZ1A 1TUJA 3QMEA 1T14A 4FQTA 3PJIA 3BFBA 2QDIA 3BFAA 3CZ0A 2KPHA 3NHIA 3NHTA 3S0BA 1ORGA 2P70A 1P28A 3RZSA 3CZ2A 3V2LA 3OGNA 2WCLA 2ERBA 3DXLA 1OW4A 3S0DA 3D76A 2H8VA 3D74A 3R1OA 1TWOA 3CABA 3DZTA 3CYZA 3S0AA 3DYEA 3FE8A 3D77A 3DY9A 3R1PA 4PT1A 4INWA 1OOFA 3FE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DQE A;  2WCH A;  3L4L A;  3L4A A;  2QEV A;  2L2C A;  4INX A;  3N7H A;  3B87 A;  3BJH A;  3K1E A;  2QEO A;  3S0F A;  1XFR A;  2PQL A;  3D78 A;  3FE6 A;  1GM0 A;  3B7A A;  2QEB A;  5DIC A;  3NGV A;  1OOH A;  2WCM A;  3R72 A;  2FJY A;  3D75 A;  3CDN A;  2P71 A;  1LS8 A;  2WC5 A;  3S0G A;  3B6X A;  3VB1 A;  3L47 A;  3B86 A;  4JD9 A;  5EL2 A;  4OZD A;  3S0E A;  1OOI X;  2WCJ A;  2WCK A;  3BFH A;  2GTE A;  2WC6 A;  3R1V A;  4F7F A;  3D73 A;  1C3Z A;  1QWV A;  3B88 A;  1C3Y A;  2QEH A;  3Q8I A;  1OOG A;  2JPO A;  3CZ1 A;  1TUJ A;  3QME A;  1T14 A;  4FQT A;  3PJI A;  3BFB A;  2QDI A;  3BFA A;  3CZ0 A;  2KPH A;  3NHI A;  3NHT A;  3S0B A;  1ORG A;  2P70 A;  1P28 A;  3RZS A;  3CZ2 A;  3V2L A;  3OGN A;  2WCL A;  2ERB A;  3DXL A;  1OW4 A;  3S0D A;  3D76 A;  2H8V A;  3D74 A;  3R1O A;  1TWO A;  3CAB A;  3DZT A;  3CYZ A;  3S0A A;  3DYE A;  3FE8 A;  3D77 A;  3DY9 A;  3R1P A;  4PT1 A;  4INW A;  1OOF A;  3FE9 A; 
#chains in the Genus database with same CATH topology
 1PVB A;  1UHN A;  2KI4 C;  1YVH A;  1IKU A;  5D7F A;  3PLF B;  1JFK A;  5HLV A;  1QX5 B;  1NIW A;  1W7I B;  2L2C A;  2OS8 C;  4INX A;  3JVT C;  3B87 A;  3BJH A;  2QEO A;  1XO5 A;  4GGF C;  1YR5 A;  2B1U A;  2WCE A;  1L7Z A;  3I5H B;  3EK7 A;  1EL4 A;  4PE0 A;  2F3Z A;  3BYA A;  1SCM B;  2L2E A;  1DGU A;  1XFZ O;  1CTR A;  2QAC A;  2F2O A;  2H2K A;  3I5F B;  1NPQ A;  2PQL A;  1IH0 A;  1GJY A;  4I5K A;  2LLT A;  1QX2 A;  1KQM C;  3E3R A;  3SIA A;  2M29 A;  3OX6 A;  4NDC A;  2QEB A;  3BOW A;  3NGV A;  5HL1 A;  5I2Q A;  1L2O C;  1BU3 A;  4GBA A;  2ZNE A;  3VRP A;  4GPL B;  1S6C A;  2GGZ A;  3R72 A;  4Q04 A;  2FJY A;  3FWC A;  3M0W A;  5TNC A;  1IJ5 A;  1J1D A;  3DVJ A;  2K7B A;  2Y1M A;  4MZK A;  4QJ5 B;  1RFJ A;  1YUU A;  1K2H A;  3B6X A;  2E6W A;  1UUS A;  2KBM A;  2LE9 B;  2F8P A;  1W9Z A;  3L47 A;  2M0R A;  4CFQ A;  3SG5 A;  4PE7 A;  3HX4 A;  1BF5 A;  4JD9 A;  1XFY O;  2JOJ A;  2NCO A;  1CMG A;  4CFR A;  3SIB A;  5I8N A;  1K94 A;  2LMV A;  3CLN A;  5I2L A;  1LA3 A;  1TCF A;  2LNK A;  1QAT A;  2EHB A;  3F45 A;  1CB1 A;  1TCO B;  1KFX L;  1K9K A;  3PN7 C;  1CMF A;  1DJH A;  2K7C A;  3BFH A;  5GQQ C;  1NCZ A;  1KFU L;  1U5I A;  3NSL A;  2K2A A;  3IQQ A;  4MZJ A;  3VRN A;  3BOW B;  2I2R E;  4OR9 B;  2CXJ A;  2Y1N A;  1G4Y R;  1SNL A;  1YUT A;  2JUL A;  2RGI A;  2JC2 A;  4YI8 A;  1SCV A;  1UUR A;  1ZMZ A;  4JQ0 D;  2K0J A;  3WHU B;  3DD4 A;  4PHJ A;  4MRY A;  1GQM A;  2KFG A;  1YRT B;  1TNX A;  2K2F A;  2GGM A;  1JBA A;  1GGZ A;  2SCP A;  2LVK A;  2KNE A;  3PAL A;  1B8L A;  2M9G A;  2LAP A;  4MBE A;  1J7O A;  1NX0 A;  2PSR A;  1FW4 A;  1CFD A;  3OP0 A;  1OE9 B;  4N1F A;  3SG2 A;  1SK6 D;  2NCP A;  3BFB A;  4ORB B;  4CID A;  1S6I A;  1CM4 A;  1UWO A;  2KPH A;  4YGB B;  1WY9 A;  1IWQ A;  2CBL A;  1C7W A;  1BLQ A;  1TIZ A;  1S36 A;  2PAS A;  2P70 A;  2CNP A;  2K8M B;  1QS7 A;  1B9A A;  3RLZ A;  3CZ2 A;  1S26 D;  2WCL A;  2JZI A;  1DT7 B;  3AKB A;  1ZFS A;  4AOM A;  5CSI A;  2L4H A;  2P6B B;  1B8R A;  2H8V A;  2JTT A;  4IL1 A;  2KSP A;  4TNC A;  2V53 A;  2BCB A;  1MF8 B;  2LMU A;  1B47 A;  1AJ4 A;  3NSO A;  2M1K B;  1A4P A;  2MLE C;  1ZAC A;  3DZT A;  1RWY A;  4FTG A;  1SR6 C;  1IRJ A;  3I5I B;  4P5O E;  1DVI A;  4GGN A;  2KQ6 A;  1A2X A;  3FE8 A;  2KFH A;  1TNP A;  4HRG A;  4PE1 A;  2LMT A;  3IF7 A;  1AP4 A;  1CDM A;  2O5G A;  2CT9 A;  4MRX A;  5HLO A;  3TZ1 A;  1QXP A;  2BL0 B;  2FOT A;  3PSR A;  1NUB A;  1QV0 A;  1YUS A;  2KYF A;  2PMY A;  2KHN A;  3FE9 A;  4OVN F;  1LVC D;  4YGA A;  5G08 A;  4PHM A;  2MLF C;  1IQ3 A;  2BEC A;  4C0K A;  3JTD B;  1K9U A;  3VGO A;  1YTZ C;  2F3Y A;  2LM5 A;  4QJ3 B;  1CLB A;  3L4L A;  2BNX A;  2MBX A;  3L4A A;  4MZL A;  4P2Y B;  1S6J A;  3GK2 A;  2R2I A;  2QEV A;  3KEV A;  1QIV A;  2Y5I A;  3VRR A;  1KWO B;  4DCK A;  2M7N A;  4ORC B;  1CFC A;  1DEK A;  1J7Q A;  1TUZ A;  1LKJ A;  1RK9 A;  1EXR A;  1DJX A;  5FI6 A;  2LLU A;  4WRI A;  3IQO A;  1TNW A;  1KK7 Z;  3WHT B;  2E30 A;  1K95 A;  2LAN A;  1QLK A;  1QLS A;  4QJ4 B;  4XJK A;  1LXF C;  2LUC A;  3FE6 A;  3GK1 A;  2BBM A;  2G2B A;  2KI6 D;  2H61 C;  3DF0 A;  1YX8 A;  4PT1 A;  1GM0 A;  2OTG B;  3B7A A;  2KDH A;  2EGD A;  1CKK A;  1MQ1 A;  3I5G B;  1R6P A;  5CSF A;  2WOR A;  2MJW B;  3EKJ A;  2K60 A;  4GFT A;  1WLZ A;  2WCM A;  3TS5 C;  2BE6 A;  1A29 A;  3FWB A;  2D8N A;  2KAY A;  1MXL C;  2BE4 A;  3NSK A;  4HSZ A;  3VB1 A;  4MN0 A;  1PAL A;  3OB1 B;  1CLL A;  5CPV A;  1Y1X A;  5KTY A;  1SY9 A;  1B7T Z;  3PM2 A;  1CLM A;  4YI9 A;  1J7P A;  1AHR A;  1XK4 A;  2I18 A;  1F4Q A;  4MLW A;  4U8D A;  5J3X A;  2I7A A;  2LP3 A;  3S0E A;  1KQV A;  1G8I A;  1OOI X;  1PRW A;  3DVM A;  5DKN A;  1FI6 A;  2WCJ A;  2Y4Q A;  2WCK A;  4PHK A;  3DF0 B;  1BR4 B;  1K90 D;  1DJG A;  2GTE A;  3LLE A;  3O4X A;  4N5X A;  4CLN A;  3H4S E;  1W7J B;  4F7F A;  3A4U B;  2O60 A;  2HET A;  3SG4 A;  1PSB A;  2CCM A;  2L98 A;  1F70 A;  1NX2 A;  3QRX A;  1TN4 A;  1C3Z A;  2KFF A;  2M49 B;  2VRG A;  3TDI A;  1QWV A;  1EH2 A;  4PAL A;  4PE4 A;  5KSZ A;  1K9P A;  2LLS A;  3D0Y A;  2FCD A;  2PYQ A;  1EJ3 A;  2PRU A;  2PVB A;  2EC6 B;  2MHH A;  4DS7 A;  5BPJ A;  1BG1 A;  5CSJ A;  2FJU B;  3SG7 A;  4ETO A;  2BCX A;  3ZWH A;  2G9B A;  1YVL A;  1TTX A;  3I5H C;  3VRO A;  1CFF A;  1H8B A;  1QVI Y;  1UHH A;  1SCM C;  1WRK A;  1DF0 A;  1SBJ A;  1UHI A;  1N65 A;  1NX3 A;  2QDI A;  3EK4 A;  3KF9 A;  3PJI A;  1CDP A;  3BFA A;  4PHN A;  2AUC A;  1J7R A;  3I5F C;  3BUW B;  2M1U A;  2ISD A;  3S0B A;  1F55 A;  1BJF A;  3SG3 A;  5HYD A;  1PVA A;  3CWG A;  1REC A;  4F0Z B;  1DEL A;  1WDC B;  2F33 A;  3D0Y B;  1Q80 A;  3AKA A;  1J55 A;  1OMR A;  3LK0 A;  2JTZ A;  2WCB A;  1PUL A;  2AAO A;  2JNX A;  3ICB A;  4OV2 A;  3DYE A;  2JT8 A;  3TUY B;  1F71 A;  2JQ6 A;  3AAJ A;  3EK8 A;  2WND A;  3DVE A;  1JFJ A;  4JWQ A;  5AEQ A;  4CPV A;  1U5I B;  5ER5 A;  1OOF A;  1DJW A;  2WC8 A;  1DQE A;  2LCP A;  1OMD A;  2WCH A;  2M3W A;  1B8C A;  1AVS A;  5KU1 A;  2L50 A;  3SG6 A;  5JOL A;  3CZT X;  1F54 A;  2KLD A;  1QAS A;  2NLN A;  1KK8 B;  2L5X B;  1S5G Z;  1ZUZ A;  4MSP A;  4OCI A;  1BMO A;  3MSE B;  1RTP 1;  1KSM A;  2WCF A;  4YGD B;  1R2U A;  4NQG A;  1JSA A;  3BUO B;  1ZOT B;  4GAO A;  4DRW A;  5D3O A;  2HQ8 A;  1XFR A;  3WXA A;  2JWW A;  1UHK A;  2KBI A;  3D78 A;  5IBW A;  2Q91 A;  3CR4 X;  1HQV A;  4I5J A;  3HCM A;  3PFV A;  1BR1 B;  1MXE A;  1OMV A;  5DIC A;  4JKT A;  2BKI B;  3RM1 A;  5FI2 A;  2KQY A;  5F6T A;  2JPT A;  1JUO A;  1SL7 A;  2ZRT A;  5HKW A;  1FF1 A;  2JT3 A;  3EVU A;  4KYN A;  4AQI A;  4PDZ A;  3D75 A;  1IQ5 A;  2P71 A;  3CDN A;  1LS8 A;  2WC5 A;  3S0G A;  1NWD A;  1S1E A;  3CR5 X;  2JXC A;  4GGF A;  1DTL A;  4DUQ A;  3EG5 B;  5K89 A;  2LV7 A;  5EL2 A;  1JF0 A;  4IJ7 A;  2CTN A;  3I5I C;  2KOT A;  4MVF A;  2FCE A;  3LCP C;  4OZD A;  3KHE A;  4NDB A;  1Y0V H;  1FBV A;  2WC6 A;  3SS3 A;  3R1V A;  3LK1 A;  1H4B A;  2KI4 B;  3VRQ A;  2BL0 C;  2LHL A;  1A75 A;  4L9M A;  3SS5 A;  4BY5 A;  1FPW A;  1MWN A;  2LVV A;  3JTD C;  2OS8 B;  3D73 A;  1ODB A;  4M2O A;  3EVV A;  3JVT B;  4AQJ A;  2I94 A;  1C3Y A;  3OBV A;  1YX7 A;  2NZ0 A;  4ORA B;  1JC2 A;  2LC5 A;  5HKY A;  5JJG A;  1BOC A;  1MHO A;  1SYM A;  3Q8I A;  1DMO A;  2DOQ A;  1KWO C;  1OOG A;  1JF2 A;  1LA0 A;  1OOJ A;  2M97 A;  3CGA A;  3O4Y A;  4I5N B;  4USL A;  5DKR A;  1M63 B;  1HT9 A;  1TUJ A;  2K7O A;  3QME A;  3CS1 A;  3BUX B;  4WQ2 A;  4FQT A;  1GGW A;  4XJK B;  1C7V A;  1F4O A;  1KQM B;  2LVJ A;  4PCW A;  4C0L A;  1XYD A;  4UPG A;  3CZ0 A;  3NSI A;  1AK8 A;  3NHI A;  1DJY A;  1L2O B;  4DIR A;  1P28 A;  2OTG C;  3V2L A;  3RZS A;  3OGN A;  4WQ3 A;  2ERB A;  3DXL A;  1IIO A;  1VRK A;  1WLM A;  3I5G C;  4MEW A;  1CNP A;  3D74 A;  1XFW O;  4N1G A;  3R1O A;  1TWO A;  2LUX A;  1KCY A;  4D1E A;  2ZND A;  3DVK A;  3EKH A;  1OSA A;  3CYZ A;  1SSE B;  4OKH A;  2JRF A;  2JXL A;  3PN7 B;  3O6B A;  3S0A A;  1WRZ A;  1M46 A;  4R1E A;  2LP2 A;  3DY9 A;  1RJV A;  2K61 A;  2ZN8 A;  1MUX A;  1QJT A;  2BCA A;  3R1P A;  4INW A;  1BT6 A;  1ALV A;  4JPZ B;  2JT0 A;  5HKZ A;  3O2P A;  2M8U A;  1IGV A;  1DC1 A;  3PAT A;  5AFP A;  2LVI A;  2KI6 C;  5AAN A;  1IG5 A;  2Q4U A;  1KK7 Y;  2AMI A;  1MR8 A;  1QV1 A;  1XFV O;  1XFX O;  2F2P A;  4C0J A;  1OQP A;  3N7H A;  4GUK A;  2WOS A;  1PK0 D;  4GNK B;  3K1E A;  1B4C A;  3ZNI A;  1DJZ A;  3K21 A;  5AXI A;  3S0F A;  1XK4 C;  2EC6 C;  2HF5 A;  2ZN9 A;  4HRH A;  2KAV A;  3AAK A;  1CDL A;  4ZCU A;  1DF0 B;  1D1O A;  1F8H A;  2JU0 A;  4M2P A;  1YRU B;  1LIN A;  3BQ3 A;  4M2Q A;  5CSN A;  1TRF A;  1QTX A;  4YGE B;  3BXK A;  3O78 A;  1NP8 A;  3IVT A;  4A4B A;  3OX5 A;  1M39 A;  3BUN B;  3GOF A;  3LL8 B;  2MA2 A;  1B7T Y;  3KO0 A;  3SS4 A;  3TDU A;  1OZS A;  1C07 A;  4I5L B;  1PSR A;  1SL8 A;  1UP5 A;  4FQO A;  2M7L A;  1A03 A;  1OOH A;  1KSO A;  1S3P A;  2TN4 A;  3EVR A;  1E8A A;  1OZO A;  1J1E A;  1Y6W A;  2COL B;  4XYN A;  4YRU A;  1JWD A;  1SR6 B;  1WDC C;  2BKH B;  2NXQ A;  3TDZ A;  3B86 A;  2GV5 A;  1SKT A;  1QX7 A;  4BY4 A;  4E68 A;  4YGC B;  1X02 A;  5I94 A;  1CDN A;  2MAZ A;  2L5Y A;  3TUY C;  5PAL A;  1DGV A;  5I2O A;  3KPX A;  1NSH A;  3FS7 A;  3WNX B;  2H61 A;  1SPY A;  1AJ5 A;  1AUI B;  2KLE A;  1CFP A;  3FIA A;  1IJ6 A;  2HPS A;  2OPO A;  4ICB A;  3UNW A;  2BAP A;  3C1V A;  2ZRS A;  1Z2C B;  5B8I B;  2SAS A;  2BBN A;  2YGU A;  3SJS A;  3B88 A;  1K93 D;  2KAX A;  1V1G A;  2QEH A;  1M31 A;  4HRE E;  1Y1A A;  1SL9 A;  1SMG A;  4A4C A;  1FI5 A;  1XVJ A;  3BUM B;  2A4J A;  1KK8 C;  2JPO A;  3CZ1 A;  1WRL A;  4ZCV A;  2L51 A;  1T14 A;  1B1G A;  1EG4 A;  3OB2 B;  2KGR A;  1XA5 A;  1EG3 A;  1G33 A;  1NCY A;  1TOP A;  3D10 A;  5FI7 A;  3NHT A;  1ORG A;  2K7D A;  2KYC A;  3OHM B;  1UHJ A;  1YUR A;  1V1F A;  2L4I A;  3TS5 B;  2ZFD A;  4YBH B;  1BOD A;  1ALW A;  1K96 A;  1SRA A;  1NYA A;  1QIW A;  1QVI Z;  1OW4 A;  2HQW A;  3CTN A;  1RRO A;  1SW8 A;  1Y1U A;  2QPT A;  3A8R A;  3D76 A;  3S0D A;  1TNQ A;  5FYX A;  5DKQ A;  2IS9 A;  3CAB A;  4NDD A;  1Z4H A;  1CM1 A;  1XFU O;  2KGB C;  1K8U A;  2LHI A;  2PAL A;  2ZKM X;  2JNF A;  3GK4 X;  2MRD A;  3NXA A;  1N0Y A;  1NX1 A;  5ER4 X;  3CR2 A;  3D77 A;  5AER A;  3UO9 A;  1KFX S;  1M45 A;  5D69 A;  1S5G Y;  1N2D A;  3PM8 A;  1DJI A;  2L0P A;  1NCX A;  1A75 B;  1KFU S; 
#chains in the Genus database with same CATH homology
 1DQE A;  2WCH A;  3L4L A;  3L4A A;  2QEV A;  2L2C A;  4INX A;  3N7H A;  3B87 A;  3BJH A;  3K1E A;  2QEO A;  3S0F A;  1XFR A;  2PQL A;  3D78 A;  3FE6 A;  1GM0 A;  3B7A A;  2QEB A;  5DIC A;  3NGV A;  1OOH A;  2WCM A;  3R72 A;  2FJY A;  3D75 A;  3CDN A;  2P71 A;  1LS8 A;  2WC5 A;  3S0G A;  3B6X A;  3VB1 A;  3L47 A;  3B86 A;  4JD9 A;  5EL2 A;  4OZD A;  3S0E A;  1OOI X;  2WCJ A;  2WCK A;  3BFH A;  2GTE A;  2WC6 A;  3R1V A;  4F7F A;  3D73 A;  1C3Z A;  1QWV A;  3B88 A;  1C3Y A;  2QEH A;  3Q8I A;  1OOG A;  2JPO A;  3CZ1 A;  1TUJ A;  3QME A;  1T14 A;  4FQT A;  3PJI A;  3BFB A;  2QDI A;  3BFA A;  3CZ0 A;  2KPH A;  3NHI A;  3NHT A;  3S0B A;  1ORG A;  2P70 A;  1P28 A;  3RZS A;  3CZ2 A;  3V2L A;  3OGN A;  2WCL A;  2ERB A;  3DXL A;  1OW4 A;  3S0D A;  3D76 A;  2H8V A;  3D74 A;  3R1O A;  1TWO A;  3CAB A;  3DZT A;  3CYZ A;  3S0A A;  3DYE A;  3FE8 A;  3D77 A;  3DY9 A;  3R1P A;  4PT1 A;  4INW A;  1OOF A;  3FE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...