1WLZA

Crystal structure of djbp fragment which was obtained by limited proteolysis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
85
structure length
85
Chain Sequence
HMATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of DJBP Fragment which was obtained by Limited Proteolysis
rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords CAP-binding protein complex interacting protein 1 isoform a
total genus 30
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08976 EF-hand_11 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wlzA01
2AAOA 1F71A 1S6IA 2JZIA 1RTP1 2R2IA 3VRPA 1MR8A 3PM8A 4JPZB 4PE0A 4F0ZB 1OOJA 4MRXA 1Y0VH 4NDBA 1NUBA 2CBLA 1BOCA 3VGOA 1FI6A 2BKIB 3TDZA 3VROA 1DJIA 1EG4A 1QV0A 1R2UA 2LLSA 1N65A 2I18A 3NSKA 1A29A 5I2OA 1B1GA 4PHMA 1S6JA 1S36A 1XFUO 4MRYA 2K2AA 3CLNA 1FF1A 4ZCVA 4WQ3A 1UP5A 2ISDA 4C0KA 4QJ5B 3TS5B 1WDCC 5HKYA 2M1UA 2M1KB 2AMIA 2JNFA 1QVIZ 3BXKA 1WLZA 2D8NA 1B8CA 1SL8A 3E3RA 2OTGC 1AUIB 2KFGA 5DKQA 2JXCA 2EGDA 1PRWA 4N1FA 3PFVA 1TN4A 1DJGA 5CSJA 5JOLA 1DJHA 3WHUB 1CB1A 4MEWA 4MBEA 1R6PA 4OCIA 2L4HA 4MVFA 1M39A 2BKHB 4YGCB 4GUKA 1NCXA 1XFXO 3PSRA 3EKJA 1SBJA 3O78A 3JTDB 1DJWA 1G4YR 3CS1A 2K7BA 1WY9A 4IL1A 2KBIA 4R1EA 3TUYB 1B8LA 1IQ3A 1S3PA 2E30A 1XFYO 3NSOA 4PHNA 1K93D 3SG2A 1CFCA 1UHHA 2K7OA 1B47A 3D0YA 3FS7A 1AHRA 2JTZA 3NSLA 3M0WA 1CNPA 4JQ0D 1LXFC 1SCMB 2JT8A 1IWQA 1CDLA 2EC6B 4CPVA 1LINA 2LAPA 1N2DA 3NXAA 2ZRSA 4BY4A 1F4OA 1J7PA 1JUOA 2F2OA 2JRFA 1PULA 1DT7B 1UHIA 2ZNDA 1LKJA 1RROA 2MJWB 4WQ2A 3I5IB 1KFXL 1M45A 3TUYC 2HF5A 1DJZA 1GJYA 4YGBB 5G08A 5TNCA 1DJYA 1XA5A 3A8RA 4DRWA 1TCOB 2O60A 1X02A 3O2PA 1SNLA 2KAVA 4ORCB 1QVIY 1YRUB 1SR6B 2AUCA 4N5XA 3LK1A 3CR2A 3EK4A 2KI4C 1QXPA 1YUUA 5CSIA 1JF2A 4I5NB 4C0LA 1NX3A 2MA2A 4PCWA 1CDNA 1OQPA 1DF0B 2KFHA 1XFZO 1NP8A 1JF0A 1S1EA 1J7OA 4GAOA 1XFVO 3IQQA 1DGVA 1SCMC 2CNPA 2IS9A 1YURA 1CMGA 3DVJA 5ER4X 1AK8A 1F54A 1YUSA 2KHNA 1K90D 2B1UA 1S5GZ 2K7CA 2VRGA 4XJKB 1A75B 5HLOA 3SG6A 1UWOA 1D1OA 2I2RE 3BUNB 1KK7Z 3EVRA 5CPVA 1N0YA 1KK8C 2JXLA 4MZLA 2ZKMX 2JULA 5PALA 1CFPA 1K2HA 1GQMA 4NDCA 2NZ0A 4CFRA 2KQYA 4QJ4B 1QATA 1YX7A 1JSAA 2L50A 3WXAA 3NSIA 2GV5A 4YGEB 3IQOA 4YBHB 2LMVA 5KTYA 1ZFSA 2G2BA 2KAYA 4XYNA 2COLB 1EL4A 1HT9A 3SIBA 1SL9A 1IQ5A 4I5JA 2WNDA 3VRQA 5AFPA 5HKWA 2CTNA 1BR4B 2Y1MA 1SRAA 3HX4A 1KK7Y 2FCDA 2KYCA 2DOQA 4GFTA 4PALA 2ZNEA 1WDCB 1QX2A 1UHNA 5HKZA 1SR6C 1NCZA 3PN7B 4ZCUA 1G8IA 1TRFA 2NXQA 1TIZA 2BL0B 5KU1A 1RFJA 2KDHA 4OKHA 3LCPC 1KWOC 5B8IB 2K8MB 4PE7A 1U5IB 2HETA 4PHKA 2BCBA 2KNEA 1YUTA 3GOFA 3TS5C 4L9MA 1A03A 1A2XA 3BOWA 2FCEA 2L0PA 1NIWA 1RWYA 3FWBA 2K2FA 1ALWA 3I5IC 2SCPA 3DVEA 1XFWO 2LLTA 2KGBC 4AQJA 2PASA 1TNXA 3HCMA 1TNQA 2JU0A 1MQ1A 1H8BA 2PVBA 1KQMC 2JT0A 1OE9B 2EC6C 1XK4C 1BT6A 1J1EA 2LUCA 1XO5A 2KAXA 1K95A 3H4SE 4HSZA 3ICBA 3BUXB 3QRXA 4GGFC 4MSPA 1QLSA 4MN0A 1K9PA 1KFUS 4P5OE 1ZMZA 3F45A 4PHJA 2BECA 5AXIA 1MXLC 3MSEB 4I5LB 3ZNIA 1QTXA 3I5FB 1MHOA 2GGMA 1V1GA 2JC2A 2JWWA 4M2QA 4C0JA 1ZUZA 1TOPA 5DKRA 5BPJA 1J7RA 1E8AA 2I7AA 2K0JA 1XK4A 2Y1NA 4D1EA 1CFFA 5CSFA 2CXJA 1IJ6A 3TDIA 2CCMA 4NQGA 5KSZA 3SG3A 2ZFDA 1AP4A 1WLMA 4GGFA 5AANA 2BBNA 1NYAA 1QIWA 4YGDB 1ZOTB 2LMUA 4MLWA 1SKTA 3I5HB 2EHBA 4U8DA 4YI9A 3EKHA 4YI8A 1ZACA 1WRKA 5HLVA 4AOMA 1JBAA 3VRNA 3CWGA 3EVVA 1LA3A 1AJ5A 1SY9A 3BQ3A 2MBXA 1SL7A 2HPSA 4UPGA 2H2KA 2HQ8A 1FPWA 1L7ZA 1NWDA 2TN4A 4CFQA 1NX1A 4JWQA 3SG4A 1K9KA 5HYDA 3PALA 4HREE 1KSMA 2LP2A 2BL0C 2BE6A 2OS8C 3SIAA 3CTNA 1Y1AA 1JWDA 1EH2A 3SJSA 1L2OC 1MWNA 1QV1A 3I5FC 2WCEA 2HQWA 1K94A 2CT9A 3D10A 2LVJA 2OS8B 2LMTA 3AAJA 2KGRA 2M3WA 3AKBA 2LVKA 1JC2A 1H4BA 5F6TA 1UURA 1B7TZ 2K61A 1OZOA 3EVUA 2M7LA 1LVCD 2E6WA 2PMYA 1Q80A 1EXRA 3DF0A 1KFUL 4PE4A 1TCFA 1AVSA 3GK1A 1QASA 1BMOA 3I5GC 3KF9A 3KO0A 1PSRA 4M2PA 3VRRA 1CLLA 2F2PA 5I2LA 4FTGA 2LHLA 1SPYA 4FQOA 2JOJA 2F8PA 1CM4A 2KQ6A 1SCVA 2QACA 2F3ZA 4DIRA 2F3YA 1M46A 4GNKB 1B7TY 4GBAA 3OX5A 1GGZA 2MHHA 1K96A 1YRTB 4HRGA 3AKAA 1KSOA 3JVTB 1TTXA 3WNXB 1RJVA 4P2YB 4TNCA 1QX7A 2MAZA 5J3XA 1CTRA 1SK6D 2JNXA 3CR5X 4DUQA 3KPXA 1MF8B 1C7WA 5I8NA 4HRHA 1YTZC 1YVLA 5D69A 5FYXA 1KK8B 3DVMA 2JT3A 1DGUA 1BG1A 3CZTX 3DF0B 2NCOA 5D7FA 1Y6WA 4GGNA 1BR1B 3O4YA 2WOSA 1C7VA 1YX8A 1A75A 3RLZA 3FWCA 1A4PA 2Q4UA 1OMRA 4PE1A 1TNWA 2LLUA 1NX0A 4YRUA 2KYFA 1J7QA 1BODA 2RGIA 3C1VA 2M29A 3JVTC 3OB2B 2LV7A 2KSPA 2Y5IA 3DVKA 5AEQA 2NCPA 1FW4A 2LCPA 3GK4X 3BUMB 1RK9A 2KI6D 3O6BA 1QX5B 3LLEA 2WORA 1WRLA 3K21A 1CLBA 1IRJA 2LNKA 1JFKA 2PRUA 3OB1B 1IG5A 2SASA 2BE4A 2LHIA 1DF0A 2LM5A 2KBMA 2Q91A 3OHMB 3D0YB 4GPLB 1KWOB 1ODBA 2BBMA 2L98A 3AAKA 5DKNA 4OV2A 1BU3A 2BCXA 1LA0A 2LE9B 4MZKA 2JQ6A 4YGAA 2MRDA 2ZN8A 1F55A 1KCYA 4BY5A 3KHEA 1F8HA 5AERA 4OR9B 2FOTA 2V53A 4ORBB 5ER5A 3BYAA 1OMDA 3BUWB 4OVNF 5K89A 1FI5A 3SG7A 1KFXS 2O5GA 1DMOA 1JFJA 1MXEA 1UHKA 2QPTA 1G33A 2F33A 1CDMA 2FJUB 2KFFA 2L4IA 1CM1A 2M97A 1YR5A 3DD4A 1L2OB 1QJTA 2LVVA 3TZ1A 1RECA 4A4BA 1KQVA 2M7NA 1K9UA 1S6CA 1XYDA 2I94A 2PALA 1K8UA 1OSAA 2LVIA 1PK0D 1PVAA 2M0RA 2JPTA 1ALVA 2LUXA 1C07A 1UHJA 3LL8B 1CKKA 2OTGB 2KI6C 1UUSA 3GK2A 4ICBA 2LP3A 3BUOB 4NDDA 1QIVA 4M2OA 1IKUA 3PATA 1WRZA 5IBWA 1PALA 1XVJA 5CSNA 2L5XB 3I5GB 4USLA 1IGVA 2JTTA 4ETOA 2A4JA 1B9AA 2M8UA 4CLNA 3EK7A 1NSHA 1VRKA 2WCBA 3PLFB 1DTLA 1SYMA 3I5HC 2G9BA 1KQMB 2NLNA 1CLMA 2MLEC 3OP0A 2WC8A 3ZWHA 1QS7A 1Y1UA 2PSRA 1DVIA 4DCKA 4XJKA 2ZN9A 1W7JB 1FBVA 1IJ5A 4WRIA 1HQVA 2KOTA 1Y1XA 4N1GA 1OZSA 1BLQA 1B4CA 4AQIA 2WCFA 1QLKA 1M31A 1V1FA 3CGAA 5JJGA 1CMFA 1SMGA 3RM1A 4DS7A 5I2QA 3WHTB 1NCYA 2LANA 2Y4QA 2L2EA 2ZRTA 2OPOA 1B8RA 3EK8A 1MUXA 1AJ4A 1DJXA 1CDPA 2K7DA 3JTDC 2LC5A 1S26D 4CIDA 1BF5A 4MZJA 2H61C 2L51A 1NPQA 4A4CA 1PVBA 1W7IB 1OMVA 1S5GY 1PSBA 4QJ3B 2KI4B 1TNPA 3A4UB 3CR4X 3IF7A 1M63B 2BCAA 2P6BB 3LK0A 2M9GA 1YVHA 1EG3A 4ORAB 5GQQC 2MLFC 4Q04A 1U5IA 1F4QA 1EJ3A 1NX2A 3SG5A 2H61A 3TDUA 1J1DA 1J55A 3BOWB 1SW8A 3KEVA 4E68A 1F70A 2M49B 3FIAA 3PN7C 1GGWA 3OX6A 2GGZA 1BJFA 4PDZA 4I5KA 1CFDA 1IH0A
chains in the Genus database with same CATH superfamily
2AAOA 1F71A 1S6IA 2JZIA 1RTP1 2R2IA 3VRPA 1MR8A 3PM8A 3OGNA 4JPZB 4PE0A 4F0ZB 1OOJA 4MRXA 1Y0VH 4NDBA 1NUBA 3R1VA 2CBLA 3QMEA 1P28A 3VGOA 1BOCA 1FI6A 2BKIB 3DXLA 3TDZA 3VROA 1DJIA 1EG4A 1QV0A 1R2UA 2LLSA 3D75A 3R72A 1N65A 2I18A 3NSKA 2PYQA 1A29A 5I2OA 1B1GA 4PHMA 1S6JA 1S36A 1XFUO 4MRYA 2K2AA 3CLNA 1FF1A 4ZCVA 4WQ3A 1UP5A 2ISDA 4C0KA 4QJ5B 3TS5B 1WDCC 5HKYA 2M1UA 2M1KB 5EL2A 2WCLA 2AMIA 2JNFA 1QVIZ 3BXKA 1WLZA 2D8NA 1B8CA 1SL8A 3E3RA 2OTGC 1AUIB 2KFGA 5DKQA 2KLEA 2JXCA 3S0EA 2EGDA 1PRWA 1FI5A 4N1FA 3R1OA 2WCJA 3PFVA 1TN4A 1DJGA 5CSJA 5JOLA 1DJHA 3WHUB 1CB1A 4MEWA 3B7AA 4MBEA 1R6PA 3NGVA 4OCIA 2L4HA 4MVFA 1M39A 2BKHB 2YGUA 4YGCB 4GUKA 1NCXA 1XFXO 2WCKA 3PSRA 3R1PA 3EKJA 1SBJA 3O78A 3JTDB 1DJWA 1G4YR 3CS1A 2K7BA 3L4LA 1WY9A 4IL1A 2KBIA 1GM0A 4R1EA 3TUYB 1B8LA 1IQ3A 1S3PA 2E30A 1XFYO 3NSOA 4PHNA 1K93D 3SG2A 2QDIA 1CFCA 1UHHA 2K7OA 1B47A 3D0YA 3FS7A 1AHRA 2JTZA 3NSLA 3M0WA 1CNPA 1QWVA 4JQ0D 1LXFC 1SCMB 2JT8A 1IWQA 1CDLA 2EC6B 4CPVA 1LINA 2LAPA 1N2DA 3NXAA 2ZRSA 4BY4A 1F4OA 1J7PA 1JUOA 2F2OA 2JRFA 1PULA 3BFAA 3CZ1A 1DT7B 2ERBA 1UHIA 2ZNDA 1LKJA 1RROA 2MJWB 4WQ2A 3I5IB 1KFXL 1M45A 3IVTA 3TUYC 3N7HA 2HF5A 1DJZA 1GJYA 4YGBB 5G08A 5TNCA 1DJYA 1XA5A 3A8RA 4DRWA 1TCOB 2O60A 1X02A 3O2PA 1SNLA 2KAVA 4ORCB 1QVIY 1YRUB 1SR6B 2AUCA 4N5XA 1LS8A 3LK1A 2QEHA 3CR2A 3EK4A 2KI4C 1QXPA 3SS3A 1YUUA 5CSIA 1JF2A 1XFRA 4I5NB 4C0LA 1NX3A 2MA2A 4PCWA 1CDNA 1OQPA 1DF0B 2KFHA 1XFZO 1NP8A 1JF0A 1S1EA 1J7OA 4GAOA 1XFVO 3Q8IA 3D76A 3IQQA 1DGVA 1SCMC 2CNPA 2IS9A 1YURA 1CMGA 3DVJA 5ER4X 1AK8A 1F54A 1YUSA 2KHNA 1K90D 2B1UA 1S5GZ 2K7CA 2VRGA 4XJKB 1A75B 5D3OA 5FI7A 1UWOA 5HLOA 3SG6A 2I2RE 1D1OA 3BUNB 3CZ0A 1KK7Z 3EVRA 5CPVA 1N0YA 1KK8C 2JXLA 4MZLA 2ZKMX 2JULA 5PALA 1CFPA 1K2HA 1GQMA 2L2CA 2NZ0A 3B87A 4NDCA 2KQYA 4CFRA 4QJ4B 1QATA 1YX7A 1JSAA 2L50A 3WXAA 3NSIA 2GV5A 4YGEB 3IQOA 4YBHB 2LMVA 5KTYA 1ZFSA 2G2BA 2WCMA 2KAYA 5I94A 4XYNA 2COLB 1EL4A 1HT9A 3SIBA 1SL9A 4IJ7A 1IQ5A 3CABA 4I5JA 2WNDA 3NHIA 3VRQA 5AFPA 5HKWA 2CTNA 2WC6A 1BR4B 2Y1MA 1SRAA 3HX4A 1KK7Y 2FCDA 2KYCA 2DOQA 4GFTA 4PALA 2ZNEA 1DQEA 1WDCB 1QX2A 1OOHA 1UHNA 3EG5B 3FE6A 5HKZA 1SR6C 1NCZA 3PN7B 4ZCUA 1G8IA 1TRFA 2NXQA 1TIZA 2BL0B 3BFBA 1RFJA 2KDHA 4OKHA 5KU1A 3LCPC 1KWOC 5B8IB 2K8MB 3K1EA 4PE7A 1U5IB 2HETA 4PHKA 2BCBA 2KNEA 1YUTA 3GOFA 3TS5C 4L9MA 1A03A 1A2XA 3BOWA 2FCEA 2L0PA 1NIWA 1RWYA 3FWBA 2K2FA 1ALWA 3I5IC 2K60A 2SCPA 3DY9A 2L5YA 3DVEA 1XFWO 2LLTA 2KGBC 4AQJA 2PASA 1TNXA 3HCMA 1TNQA 2QEOA 2JU0A 1MQ1A 2BAPA 5FI6A 1H8BA 2PVBA 1KQMC 2JT0A 1OE9B 2EC6C 1XK4C 1BT6A 1J1EA 2LUCA 4JD9A 1XO5A 2KAXA 1K95A 3H4SE 3OBVA 4HSZA 3ICBA 2JPOA 3BUXB 1OOGA 3QRXA 1QLSA 2H8VA 4GGFC 4MSPA 4MN0A 1K9PA 1KFUS 4P5OE 1ZMZA 3BJHA 3F45A 4PHJA 2BECA 5AXIA 1MXLC 3MSEB 4I5LB 3ZNIA 1QTXA 3I5FB 1MHOA 2GGMA 1V1GA 2JC2A 2JWWA 4M2QA 4C0JA 1ZUZA 1TOPA 1TWOA 4INXA 5DKRA 5BPJA 1J7RA 1E8AA 2I7AA 2K0JA 1XK4A 2Y1NA 4D1EA 1CFFA 5CSFA 2CXJA 1IJ6A 2QEBA 3TDIA 2CCMA 4NQGA 5KSZA 3SS4A 5FI2A 3SG3A 2ZFDA 1AP4A 1WLMA 4GGFA 5AANA 2BBNA 1NYAA 1QIWA 3B88A 1OW4A 4YGDB 3UO9A 1ZOTB 2LMUA 4MLWA 1SKTA 3I5HB 2EHBA 4U8DA 4YI9A 3EKHA 4YI8A 1ZACA 1WRKA 5HLVA 4AOMA 1JBAA 3VRNA 3CWGA 3EVVA 1LA3A 1AJ5A 1SY9A 3BQ3A 2MBXA 1SL7A 2HPSA 4UPGA 2H2KA 2HQ8A 1FPWA 1L7ZA 2KPHA 1NWDA 2TN4A 3CYZA 4CFQA 1NX1A 4JWQA 3SG4A 3S0GA 1K9KA 5HYDA 3PALA 4HREE 3S0AA 1KSMA 3V2LA 2LP2A 2BL0C 2BE6A 2OS8C 3SIAA 3CTNA 1Y1AA 1JWDA 1EH2A 3SJSA 1L2OC 1MWNA 3L4AA 1QV1A 3I5FC 2WCEA 2HQWA 3D74A 1K94A 2CT9A 2P70A 3D10A 3O4XA 2LVJA 2OS8B 2LMTA 3AAJA 2KGRA 2M3WA 3AKBA 2LVKA 1JC2A 1H4BA 5F6TA 1UURA 1B7TZ 2K61A 3DYEA 1OZOA 3EVUA 2M7LA 1LVCD 2E6WA 1DELA 2PMYA 1Q80A 4OZDA 1EXRA 3DF0A 1KFUL 4PE4A 3NHTA 1TCFA 1AVSA 3GK1A 3B6XA 1QASA 1BMOA 3I5GC 3KF9A 2P71A 3KO0A 3FE8A 1PSRA 4M2PA 3VRRA 1CLLA 2F2PA 5I2LA 4FTGA 2LHLA 1C3YA 1SPYA 4FQOA 2JOJA 2F8PA 1CM4A 2KQ6A 1SCVA 2QACA 2F3ZA 3D78A 2F3YA 4DIRA 1M46A 4GNKB 1B7TY 4GBAA 3OX5A 1GGZA 2MHHA 1K96A 1YRTB 4HRGA 2PQLA 1KSOA 1TUJA 3AKAA 3JVTB 1TTXA 3WNXB 1RJVA 4P2YB 4TNCA 1QX7A 1TUZA 2MAZA 1CTRA 3PM2A 1SK6D 5J3XA 2JNXA 3CR5X 4DUQA 3KPXA 1MF8B 1C7WA 5I8NA 4HRHA 1YTZC 1YVLA 5D69A 5FYXA 1KK8B 4FQTA 3DVMA 2JT3A 1DGUA 1BG1A 3CZTX 3DF0B 2NCOA 5D7FA 3S0FA 1Y6WA 4GGNA 1BR1B 3O4YA 2WOSA 3SS5A 1C7VA 1YX8A 3D73A 1A75A 3UNWA 1DEKA 3RLZA 3FWCA 1A4PA 2Q4UA 1OMRA 3S0BA 4PE1A 1TNWA 2LLUA 1NX0A 4YRUA 3D77A 2KYFA 1J7QA 1BODA 2RGIA 3C1VA 2M29A 3JVTC 3OB2B 2LV7A 2KSPA 2Y5IA 3DVKA 5AEQA 2NCPA 1FW4A 2LCPA 3GK4X 4PT1A 3BUMB 1RK9A 2KI6D 3O6BA 1QX5B 3LLEA 2WORA 1WRLA 3K21A 1CLBA 1IRJA 2LNKA 1JFKA 2PRUA 3OB1B 1IG5A 2SASA 2BE4A 2LHIA 1DF0A 2LM5A 2KBMA 2Q91A 2WCHA 3L47A 3OHMB 3D0YB 4GPLB 1KWOB 1ODBA 2BBMA 2L98A 2FJYA 3AAKA 5DKNA 4OV2A 1BU3A 2BCXA 1LA0A 2LE9B 4MZKA 2JQ6A 2QEVA 4YGAA 2GTEA 2MRDA 2ZN8A 1F55A 1KCYA 4BY5A 3KHEA 1F8HA 5AERA 4OR9B 2FOTA 2V53A 4ORBB 5ER5A 1OOIX 1OMDA 3BUWB 3BYAA 4OVNF 5K89A 3SG7A 1KFXS 2O5GA 1DMOA 1JFJA 1MXEA 1UHKA 2QPTA 1G33A 2F33A 1CDMA 2FJUB 2KFFA 2L4IA 3DZTA 3PJIA 1CM1A 2M97A 1YR5A 3DD4A 1L2OB 1QJTA 2LVVA 3TZ1A 1RECA 4A4BA 1KQVA 2M7NA 1K9UA 1S6CA 1XYDA 2I94A 2PALA 1K8UA 1ORGA 1OSAA 2LVIA 1PK0D 1PVAA 2M0RA 2JPTA 1ALVA 2LUXA 1C07A 1UHJA 1Z2CB 3LL8B 1CKKA 2OTGB 4KYNA 4INWA 2KI6C 1UUSA 1W9ZA 3GK2A 4ICBA 2LP3A 3BUOB 4NDDA 1QIVA 3RZSA 4M2OA 1IKUA 3PATA 1WRZA 5IBWA 1PALA 1XVJA 3B86A 2L5XB 5CSNA 3I5GB 4USLA 1IGVA 2JTTA 4ETOA 3CDNA 2A4JA 1B9AA 2M8UA 4CLNA 3EK7A 3BFHA 1NSHA 1VRKA 2WCBA 3PLFB 1DTLA 1SYMA 3I5HC 2G9BA 1KQMB 2NLNA 1CLMA 2MLEC 3OP0A 2WC8A 3ZWHA 1QS7A 2WC5A 1Y1UA 2PSRA 1DVIA 4DCKA 4XJKA 2ZN9A 1W7JB 1FBVA 1IJ5A 4WRIA 1HQVA 2KOTA 1Y1XA 4N1GA 5DICA 1OZSA 1C3ZA 2BNXA 4JKTA 1BLQA 1B4CA 4AQIA 2WCFA 1QLKA 1M31A 1V1FA 3CGAA 5JJGA 1CMFA 1SMGA 3RM1A 4DS7A 5I2QA 3WHTB 5HL1A 1NCYA 2LANA 2Y4QA 1SSEB 2L2EA 2ZRTA 2OPOA 1B8RA 3EK8A 1MUXA 1AJ4A 1DJXA 1CDPA 2K7DA 3JTDC 3VB1A 2LC5A 1S26D 4CIDA 1BF5A 4MZJA 1OOFA 2H61C 2L51A 1NPQA 1Z4HA 4A4CA 1T14A 1PVBA 1W7IB 1OMVA 1S5GY 1PSBA 1IIOA 3CZ2A 4QJ3B 2KLDA 2KI4B 1TNPA 3A4UB 3CR4X 3IF7A 1M63B 2BCAA 2P6BB 3LK0A 3FE9A 2M9GA 1YVHA 1EG3A 4ORAB 3S0DA 5GQQC 2MLFC 4Q04A 1U5IA 1F4QA 1EJ3A 1NX2A 3SG5A 2H61A 1DC1A 3TDUA 1J1DA 1J55A 3BOWB 1SW8A 3KEVA 4E68A 1F70A 2M49B 3FIAA 3PN7C 1GGWA 3OX6A 2GGZA 1BJFA 4PDZA 4I5KA 4F7FA 1CFDA 1IH0A
chains in the Genus database with same CATH topology
2AAOA 1F71A 1S6IA 2JZIA 1RTP1 2R2IA 3VRPA 1MR8A 3PM8A 4JPZB 4PE0A 4F0ZB 1OOJA 4MRXA 1Y0VH 4NDBA 1NUBA 2CBLA 1BOCA 3VGOA 1FI6A 2BKIB 3TDZA 3VROA 1DJIA 1EG4A 1QV0A 1R2UA 2LLSA 1N65A 2I18A 3NSKA 1A29A 5I2OA 1B1GA 4PHMA 1S6JA 1S36A 1XFUO 4MRYA 2K2AA 3CLNA 1FF1A 4ZCVA 4WQ3A 1UP5A 2ISDA 4C0KA 4QJ5B 3TS5B 1WDCC 5HKYA 2M1UA 2M1KB 2AMIA 2JNFA 1QVIZ 3BXKA 1WLZA 2D8NA 1B8CA 1SL8A 3E3RA 2OTGC 1AUIB 2KFGA 5DKQA 2JXCA 2EGDA 1PRWA 4N1FA 3PFVA 1TN4A 1DJGA 5CSJA 5JOLA 1DJHA 3WHUB 1CB1A 4MEWA 4MBEA 1R6PA 4OCIA 2L4HA 4MVFA 1M39A 2BKHB 4YGCB 4GUKA 1NCXA 1XFXO 3PSRA 3EKJA 1SBJA 3O78A 3JTDB 1DJWA 1G4YR 3CS1A 2K7BA 1WY9A 4IL1A 2KBIA 4R1EA 3TUYB 1B8LA 1IQ3A 1S3PA 2E30A 1XFYO 3NSOA 4PHNA 1K93D 3SG2A 1CFCA 1UHHA 2K7OA 1B47A 3D0YA 3FS7A 1AHRA 2JTZA 3NSLA 3M0WA 1CNPA 4JQ0D 1LXFC 1SCMB 2JT8A 1IWQA 1CDLA 2EC6B 4CPVA 1LINA 2LAPA 1N2DA 3NXAA 2ZRSA 4BY4A 1F4OA 1J7PA 1JUOA 2F2OA 2JRFA 1PULA 1DT7B 1UHIA 2ZNDA 1LKJA 1RROA 2MJWB 4WQ2A 3I5IB 1KFXL 1M45A 3TUYC 2HF5A 1DJZA 1GJYA 4YGBB 5G08A 5TNCA 1DJYA 1XA5A 3A8RA 4DRWA 1TCOB 2O60A 1X02A 3O2PA 1SNLA 2KAVA 4ORCB 1QVIY 1YRUB 1SR6B 2AUCA 4N5XA 3LK1A 3CR2A 3EK4A 2KI4C 1QXPA 1YUUA 5CSIA 1JF2A 4I5NB 4C0LA 1NX3A 2MA2A 4PCWA 1CDNA 1OQPA 1DF0B 2KFHA 1XFZO 1NP8A 1JF0A 1S1EA 1J7OA 4GAOA 1XFVO 3IQQA 1DGVA 1SCMC 2CNPA 2IS9A 1YURA 1CMGA 3DVJA 5ER4X 1AK8A 1F54A 1YUSA 2KHNA 1K90D 2B1UA 1S5GZ 2K7CA 2VRGA 4XJKB 1A75B 5HLOA 3SG6A 1UWOA 1D1OA 2I2RE 3BUNB 1KK7Z 3EVRA 5CPVA 1N0YA 1KK8C 2JXLA 4MZLA 2ZKMX 2JULA 5PALA 1CFPA 1K2HA 1GQMA 4NDCA 2NZ0A 4CFRA 2KQYA 4QJ4B 1QATA 1YX7A 1JSAA 2L50A 3WXAA 3NSIA 2GV5A 4YGEB 3IQOA 4YBHB 2LMVA 5KTYA 1ZFSA 2G2BA 2KAYA 4XYNA 2COLB 1EL4A 1HT9A 3SIBA 1SL9A 1IQ5A 4I5JA 2WNDA 3VRQA 5AFPA 5HKWA 2CTNA 1BR4B 2Y1MA 1SRAA 3HX4A 1KK7Y 2FCDA 2KYCA 2DOQA 4GFTA 4PALA 2ZNEA 1WDCB 1QX2A 1UHNA 5HKZA 1SR6C 1NCZA 3PN7B 4ZCUA 1G8IA 1TRFA 2NXQA 1TIZA 2BL0B 5KU1A 1RFJA 2KDHA 4OKHA 3LCPC 1KWOC 5B8IB 2K8MB 4PE7A 1U5IB 2HETA 4PHKA 2BCBA 2KNEA 1YUTA 3GOFA 3TS5C 4L9MA 1A03A 1A2XA 3BOWA 2FCEA 2L0PA 1NIWA 1RWYA 3FWBA 2K2FA 1ALWA 3I5IC 2SCPA 3DVEA 1XFWO 2LLTA 2KGBC 4AQJA 2PASA 1TNXA 3HCMA 1TNQA 2JU0A 1MQ1A 1H8BA 2PVBA 1KQMC 2JT0A 1OE9B 2EC6C 1XK4C 1BT6A 1J1EA 2LUCA 1XO5A 2KAXA 1K95A 3H4SE 4HSZA 3ICBA 3BUXB 3QRXA 4GGFC 4MSPA 1QLSA 4MN0A 1K9PA 1KFUS 4P5OE 1ZMZA 3F45A 4PHJA 2BECA 5AXIA 1MXLC 3MSEB 4I5LB 3ZNIA 1QTXA 3I5FB 1MHOA 2GGMA 1V1GA 2JC2A 2JWWA 4M2QA 4C0JA 1ZUZA 1TOPA 5DKRA 5BPJA 1J7RA 1E8AA 2I7AA 2K0JA 1XK4A 2Y1NA 4D1EA 1CFFA 5CSFA 2CXJA 1IJ6A 3TDIA 2CCMA 4NQGA 5KSZA 3SG3A 2ZFDA 1AP4A 1WLMA 4GGFA 5AANA 2BBNA 1NYAA 1QIWA 4YGDB 1ZOTB 2LMUA 4MLWA 1SKTA 3I5HB 2EHBA 4U8DA 4YI9A 3EKHA 4YI8A 1ZACA 1WRKA 5HLVA 4AOMA 1JBAA 3VRNA 3CWGA 3EVVA 1LA3A 1AJ5A 1SY9A 3BQ3A 2MBXA 1SL7A 2HPSA 4UPGA 2H2KA 2HQ8A 1FPWA 1L7ZA 1NWDA 2TN4A 4CFQA 1NX1A 4JWQA 3SG4A 1K9KA 5HYDA 3PALA 4HREE 1KSMA 2LP2A 2BL0C 2BE6A 2OS8C 3SIAA 3CTNA 1Y1AA 1JWDA 1EH2A 3SJSA 1L2OC 1MWNA 1QV1A 3I5FC 2WCEA 2HQWA 1K94A 2CT9A 3D10A 2LVJA 2OS8B 2LMTA 3AAJA 2KGRA 2M3WA 3AKBA 2LVKA 1JC2A 1H4BA 5F6TA 1UURA 1B7TZ 2K61A 1OZOA 3EVUA 2M7LA 1LVCD 2E6WA 2PMYA 1Q80A 1EXRA 3DF0A 1KFUL 4PE4A 1TCFA 1AVSA 3GK1A 1QASA 1BMOA 3I5GC 3KF9A 3KO0A 1PSRA 4M2PA 3VRRA 1CLLA 2F2PA 5I2LA 4FTGA 2LHLA 1SPYA 4FQOA 2JOJA 2F8PA 1CM4A 2KQ6A 1SCVA 2QACA 2F3ZA 4DIRA 2F3YA 1M46A 4GNKB 1B7TY 4GBAA 3OX5A 1GGZA 2MHHA 1K96A 1YRTB 4HRGA 3AKAA 1KSOA 3JVTB 1TTXA 3WNXB 1RJVA 4P2YB 4TNCA 1QX7A 2MAZA 5J3XA 1CTRA 1SK6D 2JNXA 3CR5X 4DUQA 3KPXA 1MF8B 1C7WA 5I8NA 4HRHA 1YTZC 1YVLA 5D69A 5FYXA 1KK8B 3DVMA 2JT3A 1DGUA 1BG1A 3CZTX 3DF0B 2NCOA 5D7FA 1Y6WA 4GGNA 1BR1B 3O4YA 2WOSA 1C7VA 1YX8A 1A75A 3RLZA 3FWCA 1A4PA 2Q4UA 1OMRA 4PE1A 1TNWA 2LLUA 1NX0A 4YRUA 2KYFA 1J7QA 1BODA 2RGIA 3C1VA 2M29A 3JVTC 3OB2B 2LV7A 2KSPA 2Y5IA 3DVKA 5AEQA 2NCPA 1FW4A 2LCPA 3GK4X 3BUMB 1RK9A 2KI6D 3O6BA 1QX5B 3LLEA 2WORA 1WRLA 3K21A 1CLBA 1IRJA 2LNKA 1JFKA 2PRUA 3OB1B 1IG5A 2SASA 2BE4A 2LHIA 1DF0A 2LM5A 2KBMA 2Q91A 3OHMB 3D0YB 4GPLB 1KWOB 1ODBA 2BBMA 2L98A 3AAKA 5DKNA 4OV2A 1BU3A 2BCXA 1LA0A 2LE9B 4MZKA 2JQ6A 4YGAA 2MRDA 2ZN8A 1F55A 1KCYA 4BY5A 3KHEA 1F8HA 5AERA 4OR9B 2FOTA 2V53A 4ORBB 5ER5A 3BYAA 1OMDA 3BUWB 4OVNF 5K89A 1FI5A 3SG7A 1KFXS 2O5GA 1DMOA 1JFJA 1MXEA 1UHKA 2QPTA 1G33A 2F33A 1CDMA 2FJUB 2KFFA 2L4IA 1CM1A 2M97A 1YR5A 3DD4A 1L2OB 1QJTA 2LVVA 3TZ1A 1RECA 4A4BA 1KQVA 2M7NA 1K9UA 1S6CA 1XYDA 2I94A 2PALA 1K8UA 1OSAA 2LVIA 1PK0D 1PVAA 2M0RA 2JPTA 1ALVA 2LUXA 1C07A 1UHJA 3LL8B 1CKKA 2OTGB 2KI6C 1UUSA 3GK2A 4ICBA 2LP3A 3BUOB 4NDDA 1QIVA 4M2OA 1IKUA 3PATA 1WRZA 5IBWA 1PALA 1XVJA 5CSNA 2L5XB 3I5GB 4USLA 1IGVA 2JTTA 4ETOA 2A4JA 1B9AA 2M8UA 4CLNA 3EK7A 1NSHA 1VRKA 2WCBA 3PLFB 1DTLA 1SYMA 3I5HC 2G9BA 1KQMB 2NLNA 1CLMA 2MLEC 3OP0A 2WC8A 3ZWHA 1QS7A 1Y1UA 2PSRA 1DVIA 4DCKA 4XJKA 2ZN9A 1W7JB 1FBVA 1IJ5A 4WRIA 1HQVA 2KOTA 1Y1XA 4N1GA 1OZSA 1BLQA 1B4CA 4AQIA 2WCFA 1QLKA 1M31A 1V1FA 3CGAA 5JJGA 1CMFA 1SMGA 3RM1A 4DS7A 5I2QA 3WHTB 1NCYA 2LANA 2Y4QA 2L2EA 2ZRTA 2OPOA 1B8RA 3EK8A 1MUXA 1AJ4A 1DJXA 1CDPA 2K7DA 3JTDC 2LC5A 1S26D 4CIDA 1BF5A 4MZJA 2H61C 2L51A 1NPQA 4A4CA 1PVBA 1W7IB 1OMVA 1S5GY 1PSBA 4QJ3B 2KI4B 1TNPA 3A4UB 3CR4X 3IF7A 1M63B 2BCAA 2P6BB 3LK0A 2M9GA 1YVHA 1EG3A 4ORAB 5GQQC 2MLFC 4Q04A 1U5IA 1F4QA 1EJ3A 1NX2A 3SG5A 2H61A 3TDUA 1J1DA 1J55A 3BOWB 1SW8A 3KEVA 4E68A 1F70A 2M49B 3FIAA 3PN7C 1GGWA 3OX6A 2GGZA 1BJFA 4PDZA 4I5KA 1CFDA 1IH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAO A;  1F71 A;  1S6I A;  2JZI A;  1RTP 1;  2R2I A;  3VRP A;  1MR8 A;  3PM8 A;  4JPZ B;  4PE0 A;  4F0Z B;  1OOJ A;  4MRX A;  1Y0V H;  4NDB A;  1NUB A;  2CBL A;  1BOC A;  3VGO A;  1FI6 A;  2BKI B;  3TDZ A;  3VRO A;  1DJI A;  1EG4 A;  1QV0 A;  1R2U A;  2LLS A;  1N65 A;  2I18 A;  3NSK A;  1A29 A;  5I2O A;  1B1G A;  4PHM A;  1S6J A;  1S36 A;  1XFU O;  4MRY A;  2K2A A;  3CLN A;  1FF1 A;  4ZCV A;  4WQ3 A;  1UP5 A;  2ISD A;  4C0K A;  4QJ5 B;  3TS5 B;  1WDC C;  5HKY A;  2M1U A;  2M1K B;  2AMI A;  2JNF A;  1QVI Z;  3BXK A;  1WLZ A;  2D8N A;  1B8C A;  1SL8 A;  3E3R A;  2OTG C;  1AUI B;  2KFG A;  5DKQ A;  2JXC A;  2EGD A;  1PRW A;  4N1F A;  3PFV A;  1TN4 A;  1DJG A;  5CSJ A;  5JOL A;  1DJH A;  3WHU B;  1CB1 A;  4MEW A;  4MBE A;  1R6P A;  4OCI A;  2L4H A;  4MVF A;  1M39 A;  2BKH B;  4YGC B;  4GUK A;  1NCX A;  1XFX O;  3PSR A;  3EKJ A;  1SBJ A;  3O78 A;  3JTD B;  1DJW A;  1G4Y R;  3CS1 A;  2K7B A;  1WY9 A;  4IL1 A;  2KBI A;  4R1E A;  3TUY B;  1B8L A;  1IQ3 A;  1S3P A;  2E30 A;  1XFY O;  3NSO A;  4PHN A;  1K93 D;  3SG2 A;  1CFC A;  1UHH A;  2K7O A;  1B47 A;  3D0Y A;  3FS7 A;  1AHR A;  2JTZ A;  3NSL A;  3M0W A;  1CNP A;  4JQ0 D;  1LXF C;  1SCM B;  2JT8 A;  1IWQ A;  1CDL A;  2EC6 B;  4CPV A;  1LIN A;  2LAP A;  1N2D A;  3NXA A;  2ZRS A;  4BY4 A;  1F4O A;  1J7P A;  1JUO A;  2F2O A;  2JRF A;  1PUL A;  1DT7 B;  1UHI A;  2ZND A;  1LKJ A;  1RRO A;  2MJW B;  4WQ2 A;  3I5I B;  1KFX L;  1M45 A;  3TUY C;  2HF5 A;  1DJZ A;  1GJY A;  4YGB B;  5G08 A;  5TNC A;  1DJY A;  1XA5 A;  3A8R A;  4DRW A;  1TCO B;  2O60 A;  1X02 A;  3O2P A;  1SNL A;  2KAV A;  4ORC B;  1QVI Y;  1YRU B;  1SR6 B;  2AUC A;  4N5X A;  3LK1 A;  3CR2 A;  3EK4 A;  2KI4 C;  1QXP A;  1YUU A;  5CSI A;  1JF2 A;  4I5N B;  4C0L A;  1NX3 A;  2MA2 A;  4PCW A;  1CDN A;  1OQP A;  1DF0 B;  2KFH A;  1XFZ O;  1NP8 A;  1JF0 A;  1S1E A;  1J7O A;  4GAO A;  1XFV O;  3IQQ A;  1DGV A;  1SCM C;  2CNP A;  2IS9 A;  1YUR A;  1CMG A;  3DVJ A;  5ER4 X;  1AK8 A;  1F54 A;  1YUS A;  2KHN A;  1K90 D;  2B1U A;  1S5G Z;  2K7C A;  2VRG A;  4XJK B;  1A75 B;  5HLO A;  3SG6 A;  1UWO A;  1D1O A;  2I2R E;  3BUN B;  1KK7 Z;  3EVR A;  5CPV A;  1N0Y A;  1KK8 C;  2JXL A;  4MZL A;  2ZKM X;  2JUL A;  5PAL A;  1CFP A;  1K2H A;  1GQM A;  4NDC A;  2NZ0 A;  4CFR A;  2KQY A;  4QJ4 B;  1QAT A;  1YX7 A;  1JSA A;  2L50 A;  3WXA A;  3NSI A;  2GV5 A;  4YGE B;  3IQO A;  4YBH B;  2LMV A;  5KTY A;  1ZFS A;  2G2B A;  2KAY A;  4XYN A;  2COL B;  1EL4 A;  1HT9 A;  3SIB A;  1SL9 A;  1IQ5 A;  4I5J A;  2WND A;  3VRQ A;  5AFP A;  5HKW A;  2CTN A;  1BR4 B;  2Y1M A;  1SRA A;  3HX4 A;  1KK7 Y;  2FCD A;  2KYC A;  2DOQ A;  4GFT A;  4PAL A;  2ZNE A;  1WDC B;  1QX2 A;  1UHN A;  5HKZ A;  1SR6 C;  1NCZ A;  3PN7 B;  4ZCU A;  1G8I A;  1TRF A;  2NXQ A;  1TIZ A;  2BL0 B;  5KU1 A;  1RFJ A;  2KDH A;  4OKH A;  3LCP C;  1KWO C;  5B8I B;  2K8M B;  4PE7 A;  1U5I B;  2HET A;  4PHK A;  2BCB A;  2KNE A;  1YUT A;  3GOF A;  3TS5 C;  4L9M A;  1A03 A;  1A2X A;  3BOW A;  2FCE A;  2L0P A;  1NIW A;  1RWY A;  3FWB A;  2K2F A;  1ALW A;  3I5I C;  2SCP A;  3DVE A;  1XFW O;  2LLT A;  2KGB C;  4AQJ A;  2PAS A;  1TNX A;  3HCM A;  1TNQ A;  2JU0 A;  1MQ1 A;  1H8B A;  2PVB A;  1KQM C;  2JT0 A;  1OE9 B;  2EC6 C;  1XK4 C;  1BT6 A;  1J1E A;  2LUC A;  1XO5 A;  2KAX A;  1K95 A;  3H4S E;  4HSZ A;  3ICB A;  3BUX B;  3QRX A;  4GGF C;  4MSP A;  1QLS A;  4MN0 A;  1K9P A;  1KFU S;  4P5O E;  1ZMZ A;  3F45 A;  4PHJ A;  2BEC A;  5AXI A;  1MXL C;  3MSE B;  4I5L B;  3ZNI A;  1QTX A;  3I5F B;  1MHO A;  2GGM A;  1V1G A;  2JC2 A;  2JWW A;  4M2Q A;  4C0J A;  1ZUZ A;  1TOP A;  5DKR A;  5BPJ A;  1J7R A;  1E8A A;  2I7A A;  2K0J A;  1XK4 A;  2Y1N A;  4D1E A;  1CFF A;  5CSF A;  2CXJ A;  1IJ6 A;  3TDI A;  2CCM A;  4NQG A;  5KSZ A;  3SG3 A;  2ZFD A;  1AP4 A;  1WLM A;  4GGF A;  5AAN A;  2BBN A;  1NYA A;  1QIW A;  4YGD B;  1ZOT B;  2LMU A;  4MLW A;  1SKT A;  3I5H B;  2EHB A;  4U8D A;  4YI9 A;  3EKH A;  4YI8 A;  1ZAC A;  1WRK A;  5HLV A;  4AOM A;  1JBA A;  3VRN A;  3CWG A;  3EVV A;  1LA3 A;  1AJ5 A;  1SY9 A;  3BQ3 A;  2MBX A;  1SL7 A;  2HPS A;  4UPG A;  2H2K A;  2HQ8 A;  1FPW A;  1L7Z A;  1NWD A;  2TN4 A;  4CFQ A;  1NX1 A;  4JWQ A;  3SG4 A;  1K9K A;  5HYD A;  3PAL A;  4HRE E;  1KSM A;  2LP2 A;  2BL0 C;  2BE6 A;  2OS8 C;  3SIA A;  3CTN A;  1Y1A A;  1JWD A;  1EH2 A;  3SJS A;  1L2O C;  1MWN A;  1QV1 A;  3I5F C;  2WCE A;  2HQW A;  1K94 A;  2CT9 A;  3D10 A;  2LVJ A;  2OS8 B;  2LMT A;  3AAJ A;  2KGR A;  2M3W A;  3AKB A;  2LVK A;  1JC2 A;  1H4B A;  5F6T A;  1UUR A;  1B7T Z;  2K61 A;  1OZO A;  3EVU A;  2M7L A;  1LVC D;  2E6W A;  2PMY A;  1Q80 A;  1EXR A;  3DF0 A;  1KFU L;  4PE4 A;  1TCF A;  1AVS A;  3GK1 A;  1QAS A;  1BMO A;  3I5G C;  3KF9 A;  3KO0 A;  1PSR A;  4M2P A;  3VRR A;  1CLL A;  2F2P A;  5I2L A;  4FTG A;  2LHL A;  1SPY A;  4FQO A;  2JOJ A;  2F8P A;  1CM4 A;  2KQ6 A;  1SCV A;  2QAC A;  2F3Z A;  4DIR A;  2F3Y A;  1M46 A;  4GNK B;  1B7T Y;  4GBA A;  3OX5 A;  1GGZ A;  2MHH A;  1K96 A;  1YRT B;  4HRG A;  3AKA A;  1KSO A;  3JVT B;  1TTX A;  3WNX B;  1RJV A;  4P2Y B;  4TNC A;  1QX7 A;  2MAZ A;  5J3X A;  1CTR A;  1SK6 D;  2JNX A;  3CR5 X;  4DUQ A;  3KPX A;  1MF8 B;  1C7W A;  5I8N A;  4HRH A;  1YTZ C;  1YVL A;  5D69 A;  5FYX A;  1KK8 B;  3DVM A;  2JT3 A;  1DGU A;  1BG1 A;  3CZT X;  3DF0 B;  2NCO A;  5D7F A;  1Y6W A;  4GGN A;  1BR1 B;  3O4Y A;  2WOS A;  1C7V A;  1YX8 A;  1A75 A;  3RLZ A;  3FWC A;  1A4P A;  2Q4U A;  1OMR A;  4PE1 A;  1TNW A;  2LLU A;  1NX0 A;  4YRU A;  2KYF A;  1J7Q A;  1BOD A;  2RGI A;  3C1V A;  2M29 A;  3JVT C;  3OB2 B;  2LV7 A;  2KSP A;  2Y5I A;  3DVK A;  5AEQ A;  2NCP A;  1FW4 A;  2LCP A;  3GK4 X;  3BUM B;  1RK9 A;  2KI6 D;  3O6B A;  1QX5 B;  3LLE A;  2WOR A;  1WRL A;  3K21 A;  1CLB A;  1IRJ A;  2LNK A;  1JFK A;  2PRU A;  3OB1 B;  1IG5 A;  2SAS A;  2BE4 A;  2LHI A;  1DF0 A;  2LM5 A;  2KBM A;  2Q91 A;  3OHM B;  3D0Y B;  4GPL B;  1KWO B;  1ODB A;  2BBM A;  2L98 A;  3AAK A;  5DKN A;  4OV2 A;  1BU3 A;  2BCX A;  1LA0 A;  2LE9 B;  4MZK A;  2JQ6 A;  4YGA A;  2MRD A;  2ZN8 A;  1F55 A;  1KCY A;  4BY5 A;  3KHE A;  1F8H A;  5AER A;  4OR9 B;  2FOT A;  2V53 A;  4ORB B;  5ER5 A;  3BYA A;  1OMD A;  3BUW B;  4OVN F;  5K89 A;  1FI5 A;  3SG7 A;  1KFX S;  2O5G A;  1DMO A;  1JFJ A;  1MXE A;  1UHK A;  2QPT A;  1G33 A;  2F33 A;  1CDM A;  2FJU B;  2KFF A;  2L4I A;  1CM1 A;  2M97 A;  1YR5 A;  3DD4 A;  1L2O B;  1QJT A;  2LVV A;  3TZ1 A;  1REC A;  4A4B A;  1KQV A;  2M7N A;  1K9U A;  1S6C A;  1XYD A;  2I94 A;  2PAL A;  1K8U A;  1OSA A;  2LVI A;  1PK0 D;  1PVA A;  2M0R A;  2JPT A;  1ALV A;  2LUX A;  1C07 A;  1UHJ A;  3LL8 B;  1CKK A;  2OTG B;  2KI6 C;  1UUS A;  3GK2 A;  4ICB A;  2LP3 A;  3BUO B;  4NDD A;  1QIV A;  4M2O A;  1IKU A;  3PAT A;  1WRZ A;  5IBW A;  1PAL A;  1XVJ A;  5CSN A;  2L5X B;  3I5G B;  4USL A;  1IGV A;  2JTT A;  4ETO A;  2A4J A;  1B9A A;  2M8U A;  4CLN A;  3EK7 A;  1NSH A;  1VRK A;  2WCB A;  3PLF B;  1DTL A;  1SYM A;  3I5H C;  2G9B A;  1KQM B;  2NLN A;  1CLM A;  2MLE C;  3OP0 A;  2WC8 A;  3ZWH A;  1QS7 A;  1Y1U A;  2PSR A;  1DVI A;  4DCK A;  4XJK A;  2ZN9 A;  1W7J B;  1FBV A;  1IJ5 A;  4WRI A;  1HQV A;  2KOT A;  1Y1X A;  4N1G A;  1OZS A;  1BLQ A;  1B4C A;  4AQI A;  2WCF A;  1QLK A;  1M31 A;  1V1F A;  3CGA A;  5JJG A;  1CMF A;  1SMG A;  3RM1 A;  4DS7 A;  5I2Q A;  3WHT B;  1NCY A;  2LAN A;  2Y4Q A;  2L2E A;  2ZRT A;  2OPO A;  1B8R A;  3EK8 A;  1MUX A;  1AJ4 A;  1DJX A;  1CDP A;  2K7D A;  3JTD C;  2LC5 A;  1S26 D;  4CID A;  1BF5 A;  4MZJ A;  2H61 C;  2L51 A;  1NPQ A;  4A4C A;  1PVB A;  1W7I B;  1OMV A;  1S5G Y;  1PSB A;  4QJ3 B;  2KI4 B;  1TNP A;  3A4U B;  3CR4 X;  3IF7 A;  1M63 B;  2BCA A;  2P6B B;  3LK0 A;  2M9G A;  1YVH A;  1EG3 A;  4ORA B;  5GQQ C;  2MLF C;  4Q04 A;  1U5I A;  1F4Q A;  1EJ3 A;  1NX2 A;  3SG5 A;  2H61 A;  3TDU A;  1J1D A;  1J55 A;  3BOW B;  1SW8 A;  3KEV A;  4E68 A;  1F70 A;  2M49 B;  3FIA A;  3PN7 C;  1GGW A;  3OX6 A;  2GGZ A;  1BJF A;  4PDZ A;  4I5K A;  1CFD A;  1IH0 A; 
#chains in the Genus database with same CATH topology
 2AAO A;  1F71 A;  1S6I A;  2JZI A;  1RTP 1;  2R2I A;  3VRP A;  1MR8 A;  3PM8 A;  3OGN A;  4JPZ B;  4PE0 A;  4F0Z B;  1OOJ A;  4MRX A;  1Y0V H;  4NDB A;  1NUB A;  3R1V A;  2CBL A;  3QME A;  1P28 A;  3VGO A;  1BOC A;  1FI6 A;  2BKI B;  3DXL A;  3TDZ A;  3VRO A;  1DJI A;  1EG4 A;  1QV0 A;  1R2U A;  2LLS A;  3D75 A;  3R72 A;  1N65 A;  2I18 A;  3NSK A;  2PYQ A;  1A29 A;  5I2O A;  1B1G A;  4PHM A;  1S6J A;  1S36 A;  1XFU O;  4MRY A;  2K2A A;  3CLN A;  1FF1 A;  4ZCV A;  4WQ3 A;  1UP5 A;  2ISD A;  4C0K A;  4QJ5 B;  3TS5 B;  1WDC C;  5HKY A;  2M1U A;  2M1K B;  5EL2 A;  2WCL A;  2AMI A;  2JNF A;  1QVI Z;  3BXK A;  1WLZ A;  2D8N A;  1B8C A;  1SL8 A;  3E3R A;  2OTG C;  1AUI B;  2KFG A;  5DKQ A;  2KLE A;  2JXC A;  3S0E A;  2EGD A;  1PRW A;  1FI5 A;  4N1F A;  3R1O A;  2WCJ A;  3PFV A;  1TN4 A;  1DJG A;  5CSJ A;  5JOL A;  1DJH A;  3WHU B;  1CB1 A;  4MEW A;  3B7A A;  4MBE A;  1R6P A;  3NGV A;  4OCI A;  2L4H A;  4MVF A;  1M39 A;  2BKH B;  2YGU A;  4YGC B;  4GUK A;  1NCX A;  1XFX O;  2WCK A;  3PSR A;  3R1P A;  3EKJ A;  1SBJ A;  3O78 A;  3JTD B;  1DJW A;  1G4Y R;  3CS1 A;  2K7B A;  3L4L A;  1WY9 A;  4IL1 A;  2KBI A;  1GM0 A;  4R1E A;  3TUY B;  1B8L A;  1IQ3 A;  1S3P A;  2E30 A;  1XFY O;  3NSO A;  4PHN A;  1K93 D;  3SG2 A;  2QDI A;  1CFC A;  1UHH A;  2K7O A;  1B47 A;  3D0Y A;  3FS7 A;  1AHR A;  2JTZ A;  3NSL A;  3M0W A;  1CNP A;  1QWV A;  4JQ0 D;  1LXF C;  1SCM B;  2JT8 A;  1IWQ A;  1CDL A;  2EC6 B;  4CPV A;  1LIN A;  2LAP A;  1N2D A;  3NXA A;  2ZRS A;  4BY4 A;  1F4O A;  1J7P A;  1JUO A;  2F2O A;  2JRF A;  1PUL A;  3BFA A;  3CZ1 A;  1DT7 B;  2ERB A;  1UHI A;  2ZND A;  1LKJ A;  1RRO A;  2MJW B;  4WQ2 A;  3I5I B;  1KFX L;  1M45 A;  3IVT A;  3TUY C;  3N7H A;  2HF5 A;  1DJZ A;  1GJY A;  4YGB B;  5G08 A;  5TNC A;  1DJY A;  1XA5 A;  3A8R A;  4DRW A;  1TCO B;  2O60 A;  1X02 A;  3O2P A;  1SNL A;  2KAV A;  4ORC B;  1QVI Y;  1YRU B;  1SR6 B;  2AUC A;  4N5X A;  1LS8 A;  3LK1 A;  2QEH A;  3CR2 A;  3EK4 A;  2KI4 C;  1QXP A;  3SS3 A;  1YUU A;  5CSI A;  1JF2 A;  1XFR A;  4I5N B;  4C0L A;  1NX3 A;  2MA2 A;  4PCW A;  1CDN A;  1OQP A;  1DF0 B;  2KFH A;  1XFZ O;  1NP8 A;  1JF0 A;  1S1E A;  1J7O A;  4GAO A;  1XFV O;  3Q8I A;  3D76 A;  3IQQ A;  1DGV A;  1SCM C;  2CNP A;  2IS9 A;  1YUR A;  1CMG A;  3DVJ A;  5ER4 X;  1AK8 A;  1F54 A;  1YUS A;  2KHN A;  1K90 D;  2B1U A;  1S5G Z;  2K7C A;  2VRG A;  4XJK B;  1A75 B;  5D3O A;  5FI7 A;  1UWO A;  5HLO A;  3SG6 A;  2I2R E;  1D1O A;  3BUN B;  3CZ0 A;  1KK7 Z;  3EVR A;  5CPV A;  1N0Y A;  1KK8 C;  2JXL A;  4MZL A;  2ZKM X;  2JUL A;  5PAL A;  1CFP A;  1K2H A;  1GQM A;  2L2C A;  2NZ0 A;  3B87 A;  4NDC A;  2KQY A;  4CFR A;  4QJ4 B;  1QAT A;  1YX7 A;  1JSA A;  2L50 A;  3WXA A;  3NSI A;  2GV5 A;  4YGE B;  3IQO A;  4YBH B;  2LMV A;  5KTY A;  1ZFS A;  2G2B A;  2WCM A;  2KAY A;  5I94 A;  4XYN A;  2COL B;  1EL4 A;  1HT9 A;  3SIB A;  1SL9 A;  4IJ7 A;  1IQ5 A;  3CAB A;  4I5J A;  2WND A;  3NHI A;  3VRQ A;  5AFP A;  5HKW A;  2CTN A;  2WC6 A;  1BR4 B;  2Y1M A;  1SRA A;  3HX4 A;  1KK7 Y;  2FCD A;  2KYC A;  2DOQ A;  4GFT A;  4PAL A;  2ZNE A;  1DQE A;  1WDC B;  1QX2 A;  1OOH A;  1UHN A;  3EG5 B;  3FE6 A;  5HKZ A;  1SR6 C;  1NCZ A;  3PN7 B;  4ZCU A;  1G8I A;  1TRF A;  2NXQ A;  1TIZ A;  2BL0 B;  3BFB A;  1RFJ A;  2KDH A;  4OKH A;  5KU1 A;  3LCP C;  1KWO C;  5B8I B;  2K8M B;  3K1E A;  4PE7 A;  1U5I B;  2HET A;  4PHK A;  2BCB A;  2KNE A;  1YUT A;  3GOF A;  3TS5 C;  4L9M A;  1A03 A;  1A2X A;  3BOW A;  2FCE A;  2L0P A;  1NIW A;  1RWY A;  3FWB A;  2K2F A;  1ALW A;  3I5I C;  2K60 A;  2SCP A;  3DY9 A;  2L5Y A;  3DVE A;  1XFW O;  2LLT A;  2KGB C;  4AQJ A;  2PAS A;  1TNX A;  3HCM A;  1TNQ A;  2QEO A;  2JU0 A;  1MQ1 A;  2BAP A;  5FI6 A;  1H8B A;  2PVB A;  1KQM C;  2JT0 A;  1OE9 B;  2EC6 C;  1XK4 C;  1BT6 A;  1J1E A;  2LUC A;  4JD9 A;  1XO5 A;  2KAX A;  1K95 A;  3H4S E;  3OBV A;  4HSZ A;  3ICB A;  2JPO A;  3BUX B;  1OOG A;  3QRX A;  1QLS A;  2H8V A;  4GGF C;  4MSP A;  4MN0 A;  1K9P A;  1KFU S;  4P5O E;  1ZMZ A;  3BJH A;  3F45 A;  4PHJ A;  2BEC A;  5AXI A;  1MXL C;  3MSE B;  4I5L B;  3ZNI A;  1QTX A;  3I5F B;  1MHO A;  2GGM A;  1V1G A;  2JC2 A;  2JWW A;  4M2Q A;  4C0J A;  1ZUZ A;  1TOP A;  1TWO A;  4INX A;  5DKR A;  5BPJ A;  1J7R A;  1E8A A;  2I7A A;  2K0J A;  1XK4 A;  2Y1N A;  4D1E A;  1CFF A;  5CSF A;  2CXJ A;  1IJ6 A;  2QEB A;  3TDI A;  2CCM A;  4NQG A;  5KSZ A;  3SS4 A;  5FI2 A;  3SG3 A;  2ZFD A;  1AP4 A;  1WLM A;  4GGF A;  5AAN A;  2BBN A;  1NYA A;  1QIW A;  3B88 A;  1OW4 A;  4YGD B;  3UO9 A;  1ZOT B;  2LMU A;  4MLW A;  1SKT A;  3I5H B;  2EHB A;  4U8D A;  4YI9 A;  3EKH A;  4YI8 A;  1ZAC A;  1WRK A;  5HLV A;  4AOM A;  1JBA A;  3VRN A;  3CWG A;  3EVV A;  1LA3 A;  1AJ5 A;  1SY9 A;  3BQ3 A;  2MBX A;  1SL7 A;  2HPS A;  4UPG A;  2H2K A;  2HQ8 A;  1FPW A;  1L7Z A;  2KPH A;  1NWD A;  2TN4 A;  3CYZ A;  4CFQ A;  1NX1 A;  4JWQ A;  3SG4 A;  3S0G A;  1K9K A;  5HYD A;  3PAL A;  4HRE E;  3S0A A;  1KSM A;  3V2L A;  2LP2 A;  2BL0 C;  2BE6 A;  2OS8 C;  3SIA A;  3CTN A;  1Y1A A;  1JWD A;  1EH2 A;  3SJS A;  1L2O C;  1MWN A;  3L4A A;  1QV1 A;  3I5F C;  2WCE A;  2HQW A;  3D74 A;  1K94 A;  2CT9 A;  2P70 A;  3D10 A;  3O4X A;  2LVJ A;  2OS8 B;  2LMT A;  3AAJ A;  2KGR A;  2M3W A;  3AKB A;  2LVK A;  1JC2 A;  1H4B A;  5F6T A;  1UUR A;  1B7T Z;  2K61 A;  3DYE A;  1OZO A;  3EVU A;  2M7L A;  1LVC D;  2E6W A;  1DEL A;  2PMY A;  1Q80 A;  4OZD A;  1EXR A;  3DF0 A;  1KFU L;  4PE4 A;  3NHT A;  1TCF A;  1AVS A;  3GK1 A;  3B6X A;  1QAS A;  1BMO A;  3I5G C;  3KF9 A;  2P71 A;  3KO0 A;  3FE8 A;  1PSR A;  4M2P A;  3VRR A;  1CLL A;  2F2P A;  5I2L A;  4FTG A;  2LHL A;  1C3Y A;  1SPY A;  4FQO A;  2JOJ A;  2F8P A;  1CM4 A;  2KQ6 A;  1SCV A;  2QAC A;  2F3Z A;  3D78 A;  2F3Y A;  4DIR A;  1M46 A;  4GNK B;  1B7T Y;  4GBA A;  3OX5 A;  1GGZ A;  2MHH A;  1K96 A;  1YRT B;  4HRG A;  2PQL A;  1KSO A;  1TUJ A;  3AKA A;  3JVT B;  1TTX A;  3WNX B;  1RJV A;  4P2Y B;  4TNC A;  1QX7 A;  1TUZ A;  2MAZ A;  1CTR A;  3PM2 A;  1SK6 D;  5J3X A;  2JNX A;  3CR5 X;  4DUQ A;  3KPX A;  1MF8 B;  1C7W A;  5I8N A;  4HRH A;  1YTZ C;  1YVL A;  5D69 A;  5FYX A;  1KK8 B;  4FQT A;  3DVM A;  2JT3 A;  1DGU A;  1BG1 A;  3CZT X;  3DF0 B;  2NCO A;  5D7F A;  3S0F A;  1Y6W A;  4GGN A;  1BR1 B;  3O4Y A;  2WOS A;  3SS5 A;  1C7V A;  1YX8 A;  3D73 A;  1A75 A;  3UNW A;  1DEK A;  3RLZ A;  3FWC A;  1A4P A;  2Q4U A;  1OMR A;  3S0B A;  4PE1 A;  1TNW A;  2LLU A;  1NX0 A;  4YRU A;  3D77 A;  2KYF A;  1J7Q A;  1BOD A;  2RGI A;  3C1V A;  2M29 A;  3JVT C;  3OB2 B;  2LV7 A;  2KSP A;  2Y5I A;  3DVK A;  5AEQ A;  2NCP A;  1FW4 A;  2LCP A;  3GK4 X;  4PT1 A;  3BUM B;  1RK9 A;  2KI6 D;  3O6B A;  1QX5 B;  3LLE A;  2WOR A;  1WRL A;  3K21 A;  1CLB A;  1IRJ A;  2LNK A;  1JFK A;  2PRU A;  3OB1 B;  1IG5 A;  2SAS A;  2BE4 A;  2LHI A;  1DF0 A;  2LM5 A;  2KBM A;  2Q91 A;  2WCH A;  3L47 A;  3OHM B;  3D0Y B;  4GPL B;  1KWO B;  1ODB A;  2BBM A;  2L98 A;  2FJY A;  3AAK A;  5DKN A;  4OV2 A;  1BU3 A;  2BCX A;  1LA0 A;  2LE9 B;  4MZK A;  2JQ6 A;  2QEV A;  4YGA A;  2GTE A;  2MRD A;  2ZN8 A;  1F55 A;  1KCY A;  4BY5 A;  3KHE A;  1F8H A;  5AER A;  4OR9 B;  2FOT A;  2V53 A;  4ORB B;  5ER5 A;  1OOI X;  1OMD A;  3BUW B;  3BYA A;  4OVN F;  5K89 A;  3SG7 A;  1KFX S;  2O5G A;  1DMO A;  1JFJ A;  1MXE A;  1UHK A;  2QPT A;  1G33 A;  2F33 A;  1CDM A;  2FJU B;  2KFF A;  2L4I A;  3DZT A;  3PJI A;  1CM1 A;  2M97 A;  1YR5 A;  3DD4 A;  1L2O B;  1QJT A;  2LVV A;  3TZ1 A;  1REC A;  4A4B A;  1KQV A;  2M7N A;  1K9U A;  1S6C A;  1XYD A;  2I94 A;  2PAL A;  1K8U A;  1ORG A;  1OSA A;  2LVI A;  1PK0 D;  1PVA A;  2M0R A;  2JPT A;  1ALV A;  2LUX A;  1C07 A;  1UHJ A;  1Z2C B;  3LL8 B;  1CKK A;  2OTG B;  4KYN A;  4INW A;  2KI6 C;  1UUS A;  1W9Z A;  3GK2 A;  4ICB A;  2LP3 A;  3BUO B;  4NDD A;  1QIV A;  3RZS A;  4M2O A;  1IKU A;  3PAT A;  1WRZ A;  5IBW A;  1PAL A;  1XVJ A;  3B86 A;  2L5X B;  5CSN A;  3I5G B;  4USL A;  1IGV A;  2JTT A;  4ETO A;  3CDN A;  2A4J A;  1B9A A;  2M8U A;  4CLN A;  3EK7 A;  3BFH A;  1NSH A;  1VRK A;  2WCB A;  3PLF B;  1DTL A;  1SYM A;  3I5H C;  2G9B A;  1KQM B;  2NLN A;  1CLM A;  2MLE C;  3OP0 A;  2WC8 A;  3ZWH A;  1QS7 A;  2WC5 A;  1Y1U A;  2PSR A;  1DVI A;  4DCK A;  4XJK A;  2ZN9 A;  1W7J B;  1FBV A;  1IJ5 A;  4WRI A;  1HQV A;  2KOT A;  1Y1X A;  4N1G A;  5DIC A;  1OZS A;  1C3Z A;  2BNX A;  4JKT A;  1BLQ A;  1B4C A;  4AQI A;  2WCF A;  1QLK A;  1M31 A;  1V1F A;  3CGA A;  5JJG A;  1CMF A;  1SMG A;  3RM1 A;  4DS7 A;  5I2Q A;  3WHT B;  5HL1 A;  1NCY A;  2LAN A;  2Y4Q A;  1SSE B;  2L2E A;  2ZRT A;  2OPO A;  1B8R A;  3EK8 A;  1MUX A;  1AJ4 A;  1DJX A;  1CDP A;  2K7D A;  3JTD C;  3VB1 A;  2LC5 A;  1S26 D;  4CID A;  1BF5 A;  4MZJ A;  1OOF A;  2H61 C;  2L51 A;  1NPQ A;  1Z4H A;  4A4C A;  1T14 A;  1PVB A;  1W7I B;  1OMV A;  1S5G Y;  1PSB A;  1IIO A;  3CZ2 A;  4QJ3 B;  2KLD A;  2KI4 B;  1TNP A;  3A4U B;  3CR4 X;  3IF7 A;  1M63 B;  2BCA A;  2P6B B;  3LK0 A;  3FE9 A;  2M9G A;  1YVH A;  1EG3 A;  4ORA B;  3S0D A;  5GQQ C;  2MLF C;  4Q04 A;  1U5I A;  1F4Q A;  1EJ3 A;  1NX2 A;  3SG5 A;  2H61 A;  1DC1 A;  3TDU A;  1J1D A;  1J55 A;  3BOW B;  1SW8 A;  3KEV A;  4E68 A;  1F70 A;  2M49 B;  3FIA A;  3PN7 C;  1GGW A;  3OX6 A;  2GGZ A;  1BJF A;  4PDZ A;  4I5K A;  4F7F A;  1CFD A;  1IH0 A; 
#chains in the Genus database with same CATH homology
 2AAO A;  1F71 A;  1S6I A;  2JZI A;  1RTP 1;  2R2I A;  3VRP A;  1MR8 A;  3PM8 A;  4JPZ B;  4PE0 A;  4F0Z B;  1OOJ A;  4MRX A;  1Y0V H;  4NDB A;  1NUB A;  2CBL A;  1BOC A;  3VGO A;  1FI6 A;  2BKI B;  3TDZ A;  3VRO A;  1DJI A;  1EG4 A;  1QV0 A;  1R2U A;  2LLS A;  1N65 A;  2I18 A;  3NSK A;  1A29 A;  5I2O A;  1B1G A;  4PHM A;  1S6J A;  1S36 A;  1XFU O;  4MRY A;  2K2A A;  3CLN A;  1FF1 A;  4ZCV A;  4WQ3 A;  1UP5 A;  2ISD A;  4C0K A;  4QJ5 B;  3TS5 B;  1WDC C;  5HKY A;  2M1U A;  2M1K B;  2AMI A;  2JNF A;  1QVI Z;  3BXK A;  1WLZ A;  2D8N A;  1B8C A;  1SL8 A;  3E3R A;  2OTG C;  1AUI B;  2KFG A;  5DKQ A;  2JXC A;  2EGD A;  1PRW A;  4N1F A;  3PFV A;  1TN4 A;  1DJG A;  5CSJ A;  5JOL A;  1DJH A;  3WHU B;  1CB1 A;  4MEW A;  4MBE A;  1R6P A;  4OCI A;  2L4H A;  4MVF A;  1M39 A;  2BKH B;  4YGC B;  4GUK A;  1NCX A;  1XFX O;  3PSR A;  3EKJ A;  1SBJ A;  3O78 A;  3JTD B;  1DJW A;  1G4Y R;  3CS1 A;  2K7B A;  1WY9 A;  4IL1 A;  2KBI A;  4R1E A;  3TUY B;  1B8L A;  1IQ3 A;  1S3P A;  2E30 A;  1XFY O;  3NSO A;  4PHN A;  1K93 D;  3SG2 A;  1CFC A;  1UHH A;  2K7O A;  1B47 A;  3D0Y A;  3FS7 A;  1AHR A;  2JTZ A;  3NSL A;  3M0W A;  1CNP A;  4JQ0 D;  1LXF C;  1SCM B;  2JT8 A;  1IWQ A;  1CDL A;  2EC6 B;  4CPV A;  1LIN A;  2LAP A;  1N2D A;  3NXA A;  2ZRS A;  4BY4 A;  1F4O A;  1J7P A;  1JUO A;  2F2O A;  2JRF A;  1PUL A;  1DT7 B;  1UHI A;  2ZND A;  1LKJ A;  1RRO A;  2MJW B;  4WQ2 A;  3I5I B;  1KFX L;  1M45 A;  3TUY C;  2HF5 A;  1DJZ A;  1GJY A;  4YGB B;  5G08 A;  5TNC A;  1DJY A;  1XA5 A;  3A8R A;  4DRW A;  1TCO B;  2O60 A;  1X02 A;  3O2P A;  1SNL A;  2KAV A;  4ORC B;  1QVI Y;  1YRU B;  1SR6 B;  2AUC A;  4N5X A;  3LK1 A;  3CR2 A;  3EK4 A;  2KI4 C;  1QXP A;  1YUU A;  5CSI A;  1JF2 A;  4I5N B;  4C0L A;  1NX3 A;  2MA2 A;  4PCW A;  1CDN A;  1OQP A;  1DF0 B;  2KFH A;  1XFZ O;  1NP8 A;  1JF0 A;  1S1E A;  1J7O A;  4GAO A;  1XFV O;  3IQQ A;  1DGV A;  1SCM C;  2CNP A;  2IS9 A;  1YUR A;  1CMG A;  3DVJ A;  5ER4 X;  1AK8 A;  1F54 A;  1YUS A;  2KHN A;  1K90 D;  2B1U A;  1S5G Z;  2K7C A;  2VRG A;  4XJK B;  1A75 B;  5HLO A;  3SG6 A;  1UWO A;  1D1O A;  2I2R E;  3BUN B;  1KK7 Z;  3EVR A;  5CPV A;  1N0Y A;  1KK8 C;  2JXL A;  4MZL A;  2ZKM X;  2JUL A;  5PAL A;  1CFP A;  1K2H A;  1GQM A;  4NDC A;  2NZ0 A;  4CFR A;  2KQY A;  4QJ4 B;  1QAT A;  1YX7 A;  1JSA A;  2L50 A;  3WXA A;  3NSI A;  2GV5 A;  4YGE B;  3IQO A;  4YBH B;  2LMV A;  5KTY A;  1ZFS A;  2G2B A;  2KAY A;  4XYN A;  2COL B;  1EL4 A;  1HT9 A;  3SIB A;  1SL9 A;  1IQ5 A;  4I5J A;  2WND A;  3VRQ A;  5AFP A;  5HKW A;  2CTN A;  1BR4 B;  2Y1M A;  1SRA A;  3HX4 A;  1KK7 Y;  2FCD A;  2KYC A;  2DOQ A;  4GFT A;  4PAL A;  2ZNE A;  1WDC B;  1QX2 A;  1UHN A;  5HKZ A;  1SR6 C;  1NCZ A;  3PN7 B;  4ZCU A;  1G8I A;  1TRF A;  2NXQ A;  1TIZ A;  2BL0 B;  5KU1 A;  1RFJ A;  2KDH A;  4OKH A;  3LCP C;  1KWO C;  5B8I B;  2K8M B;  4PE7 A;  1U5I B;  2HET A;  4PHK A;  2BCB A;  2KNE A;  1YUT A;  3GOF A;  3TS5 C;  4L9M A;  1A03 A;  1A2X A;  3BOW A;  2FCE A;  2L0P A;  1NIW A;  1RWY A;  3FWB A;  2K2F A;  1ALW A;  3I5I C;  2SCP A;  3DVE A;  1XFW O;  2LLT A;  2KGB C;  4AQJ A;  2PAS A;  1TNX A;  3HCM A;  1TNQ A;  2JU0 A;  1MQ1 A;  1H8B A;  2PVB A;  1KQM C;  2JT0 A;  1OE9 B;  2EC6 C;  1XK4 C;  1BT6 A;  1J1E A;  2LUC A;  1XO5 A;  2KAX A;  1K95 A;  3H4S E;  4HSZ A;  3ICB A;  3BUX B;  3QRX A;  4GGF C;  4MSP A;  1QLS A;  4MN0 A;  1K9P A;  1KFU S;  4P5O E;  1ZMZ A;  3F45 A;  4PHJ A;  2BEC A;  5AXI A;  1MXL C;  3MSE B;  4I5L B;  3ZNI A;  1QTX A;  3I5F B;  1MHO A;  2GGM A;  1V1G A;  2JC2 A;  2JWW A;  4M2Q A;  4C0J A;  1ZUZ A;  1TOP A;  5DKR A;  5BPJ A;  1J7R A;  1E8A A;  2I7A A;  2K0J A;  1XK4 A;  2Y1N A;  4D1E A;  1CFF A;  5CSF A;  2CXJ A;  1IJ6 A;  3TDI A;  2CCM A;  4NQG A;  5KSZ A;  3SG3 A;  2ZFD A;  1AP4 A;  1WLM A;  4GGF A;  5AAN A;  2BBN A;  1NYA A;  1QIW A;  4YGD B;  1ZOT B;  2LMU A;  4MLW A;  1SKT A;  3I5H B;  2EHB A;  4U8D A;  4YI9 A;  3EKH A;  4YI8 A;  1ZAC A;  1WRK A;  5HLV A;  4AOM A;  1JBA A;  3VRN A;  3CWG A;  3EVV A;  1LA3 A;  1AJ5 A;  1SY9 A;  3BQ3 A;  2MBX A;  1SL7 A;  2HPS A;  4UPG A;  2H2K A;  2HQ8 A;  1FPW A;  1L7Z A;  1NWD A;  2TN4 A;  4CFQ A;  1NX1 A;  4JWQ A;  3SG4 A;  1K9K A;  5HYD A;  3PAL A;  4HRE E;  1KSM A;  2LP2 A;  2BL0 C;  2BE6 A;  2OS8 C;  3SIA A;  3CTN A;  1Y1A A;  1JWD A;  1EH2 A;  3SJS A;  1L2O C;  1MWN A;  1QV1 A;  3I5F C;  2WCE A;  2HQW A;  1K94 A;  2CT9 A;  3D10 A;  2LVJ A;  2OS8 B;  2LMT A;  3AAJ A;  2KGR A;  2M3W A;  3AKB A;  2LVK A;  1JC2 A;  1H4B A;  5F6T A;  1UUR A;  1B7T Z;  2K61 A;  1OZO A;  3EVU A;  2M7L A;  1LVC D;  2E6W A;  2PMY A;  1Q80 A;  1EXR A;  3DF0 A;  1KFU L;  4PE4 A;  1TCF A;  1AVS A;  3GK1 A;  1QAS A;  1BMO A;  3I5G C;  3KF9 A;  3KO0 A;  1PSR A;  4M2P A;  3VRR A;  1CLL A;  2F2P A;  5I2L A;  4FTG A;  2LHL A;  1SPY A;  4FQO A;  2JOJ A;  2F8P A;  1CM4 A;  2KQ6 A;  1SCV A;  2QAC A;  2F3Z A;  4DIR A;  2F3Y A;  1M46 A;  4GNK B;  1B7T Y;  4GBA A;  3OX5 A;  1GGZ A;  2MHH A;  1K96 A;  1YRT B;  4HRG A;  3AKA A;  1KSO A;  3JVT B;  1TTX A;  3WNX B;  1RJV A;  4P2Y B;  4TNC A;  1QX7 A;  2MAZ A;  5J3X A;  1CTR A;  1SK6 D;  2JNX A;  3CR5 X;  4DUQ A;  3KPX A;  1MF8 B;  1C7W A;  5I8N A;  4HRH A;  1YTZ C;  1YVL A;  5D69 A;  5FYX A;  1KK8 B;  3DVM A;  2JT3 A;  1DGU A;  1BG1 A;  3CZT X;  3DF0 B;  2NCO A;  5D7F A;  1Y6W A;  4GGN A;  1BR1 B;  3O4Y A;  2WOS A;  1C7V A;  1YX8 A;  1A75 A;  3RLZ A;  3FWC A;  1A4P A;  2Q4U A;  1OMR A;  4PE1 A;  1TNW A;  2LLU A;  1NX0 A;  4YRU A;  2KYF A;  1J7Q A;  1BOD A;  2RGI A;  3C1V A;  2M29 A;  3JVT C;  3OB2 B;  2LV7 A;  2KSP A;  2Y5I A;  3DVK A;  5AEQ A;  2NCP A;  1FW4 A;  2LCP A;  3GK4 X;  3BUM B;  1RK9 A;  2KI6 D;  3O6B A;  1QX5 B;  3LLE A;  2WOR A;  1WRL A;  3K21 A;  1CLB A;  1IRJ A;  2LNK A;  1JFK A;  2PRU A;  3OB1 B;  1IG5 A;  2SAS A;  2BE4 A;  2LHI A;  1DF0 A;  2LM5 A;  2KBM A;  2Q91 A;  3OHM B;  3D0Y B;  4GPL B;  1KWO B;  1ODB A;  2BBM A;  2L98 A;  3AAK A;  5DKN A;  4OV2 A;  1BU3 A;  2BCX A;  1LA0 A;  2LE9 B;  4MZK A;  2JQ6 A;  4YGA A;  2MRD A;  2ZN8 A;  1F55 A;  1KCY A;  4BY5 A;  3KHE A;  1F8H A;  5AER A;  4OR9 B;  2FOT A;  2V53 A;  4ORB B;  5ER5 A;  3BYA A;  1OMD A;  3BUW B;  4OVN F;  5K89 A;  1FI5 A;  3SG7 A;  1KFX S;  2O5G A;  1DMO A;  1JFJ A;  1MXE A;  1UHK A;  2QPT A;  1G33 A;  2F33 A;  1CDM A;  2FJU B;  2KFF A;  2L4I A;  1CM1 A;  2M97 A;  1YR5 A;  3DD4 A;  1L2O B;  1QJT A;  2LVV A;  3TZ1 A;  1REC A;  4A4B A;  1KQV A;  2M7N A;  1K9U A;  1S6C A;  1XYD A;  2I94 A;  2PAL A;  1K8U A;  1OSA A;  2LVI A;  1PK0 D;  1PVA A;  2M0R A;  2JPT A;  1ALV A;  2LUX A;  1C07 A;  1UHJ A;  3LL8 B;  1CKK A;  2OTG B;  2KI6 C;  1UUS A;  3GK2 A;  4ICB A;  2LP3 A;  3BUO B;  4NDD A;  1QIV A;  4M2O A;  1IKU A;  3PAT A;  1WRZ A;  5IBW A;  1PAL A;  1XVJ A;  5CSN A;  2L5X B;  3I5G B;  4USL A;  1IGV A;  2JTT A;  4ETO A;  2A4J A;  1B9A A;  2M8U A;  4CLN A;  3EK7 A;  1NSH A;  1VRK A;  2WCB A;  3PLF B;  1DTL A;  1SYM A;  3I5H C;  2G9B A;  1KQM B;  2NLN A;  1CLM A;  2MLE C;  3OP0 A;  2WC8 A;  3ZWH A;  1QS7 A;  1Y1U A;  2PSR A;  1DVI A;  4DCK A;  4XJK A;  2ZN9 A;  1W7J B;  1FBV A;  1IJ5 A;  4WRI A;  1HQV A;  2KOT A;  1Y1X A;  4N1G A;  1OZS A;  1BLQ A;  1B4C A;  4AQI A;  2WCF A;  1QLK A;  1M31 A;  1V1F A;  3CGA A;  5JJG A;  1CMF A;  1SMG A;  3RM1 A;  4DS7 A;  5I2Q A;  3WHT B;  1NCY A;  2LAN A;  2Y4Q A;  2L2E A;  2ZRT A;  2OPO A;  1B8R A;  3EK8 A;  1MUX A;  1AJ4 A;  1DJX A;  1CDP A;  2K7D A;  3JTD C;  2LC5 A;  1S26 D;  4CID A;  1BF5 A;  4MZJ A;  2H61 C;  2L51 A;  1NPQ A;  4A4C A;  1PVB A;  1W7I B;  1OMV A;  1S5G Y;  1PSB A;  4QJ3 B;  2KI4 B;  1TNP A;  3A4U B;  3CR4 X;  3IF7 A;  1M63 B;  2BCA A;  2P6B B;  3LK0 A;  2M9G A;  1YVH A;  1EG3 A;  4ORA B;  5GQQ C;  2MLF C;  4Q04 A;  1U5I A;  1F4Q A;  1EJ3 A;  1NX2 A;  3SG5 A;  2H61 A;  3TDU A;  1J1D A;  1J55 A;  3BOW B;  1SW8 A;  3KEV A;  4E68 A;  1F70 A;  2M49 B;  3FIA A;  3PN7 C;  1GGW A;  3OX6 A;  2GGZ A;  1BJF A;  4PDZ A;  4I5K A;  1CFD A;  1IH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...