1WLZA

Crystal structure of djbp fragment which was obtained by limited proteolysis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
85
structure length
85
Chain Sequence
HMATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of DJBP Fragment which was obtained by Limited Proteolysis
rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords CAP-binding protein complex interacting protein 1 isoform a
total genus 30
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08976 EF-hand_11 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wlzA01
1B47A 1NX3A 3WHUB 5KTYA 1S3PA 3O4YA 3DD4A 1V1FA 2SCPA 4MLWA 3K21A 1M31A 5I2QA 1XFWO 2I2RE 4QJ4B 1G4YR 1J7RA 3EKJA 1SY9A 5DKNA 1CTRA 1J7PA 3SG3A 1SRAA 2LP2A 1MWNA 3D0YB 2PRUA 3BUNB 4MBEA 5DKQA 3HCMA 3TDUA 4BY4A 4YI8A 1F8HA 1FF1A 1IGVA 2GGMA 4ZCVA 1RFJA 3KO0A 2KDHA 2K7DA 1KK8B 1YX8A 1N2DA 1OMDA 2HF5A 3ICBA 5HKYA 5I2LA 1RTP1 4E68A 5TNCA 1KFUL 2ZNDA 1JF0A 1A2XA 1J1EA 1FPWA 1QS7A 1QV1A 3FS7A 1UHNA 1QTXA 1BMOA 2JU0A 2LHLA 3OB2B 4OR9B 5CSJA 4I5NB 4CLNA 2K61A 1DT7B 1QXPA 1B7TZ 2JPTA 3NSIA 2PVBA 3OB1B 4PCWA 1BR4B 1CM1A 1MR8A 1B8LA 1PULA 1QV0A 1OQPA 2ZN8A 4ORBB 3NSOA 3TDIA 2F33A 2M9GA 3I5GB 3FIAA 5HLOA 4NDDA 1J55A 3CR4X 1NUBA 1TCOB 2KSPA 2QPTA 2F2OA 2M49B 2BE4A 4GPLB 4JPZB 3LL8B 1BODA 1XYDA 2EC6C 1N0YA 1XO5A 1NCYA 1NCXA 1YRTB 5AFPA 1L2OC 1MF8B 1QIWA 4OV2A 2ZN9A 3KHEA 1OOJA 2B1UA 3VRQA 1F70A 2I94A 3EVVA 3H4SE 1B7TY 3TUYC 1AJ4A 2Y1NA 2R2IA 1TIZA 1QX7A 1H8BA 2K7CA 3HX4A 1EG3A 1TN4A 4MZKA 4M2QA 3O2PA 1RECA 3SG5A 2EGDA 4AQJA 1IQ5A 1XFZO 1XK4A 1DF0A 2LAPA 1SL7A 1XK4C 4BY5A 4GGNA 4R1EA 1G8IA 1KSMA 1M46A 2Q91A 2KBIA 1SKTA 3TS5C 3VROA 2K7BA 2K2FA 2AAOA 4CPVA 2IS9A 2ISDA 3MSEB 2K0JA 2WCFA 3LK0A 1VRKA 1WLZA 3PSRA 2ZRTA 4JQ0D 5CPVA 1KQVA 2KAVA 3EK8A 2KOTA 3I5GC 2Y4QA 1BLQA 2JT0A 4WRIA 4WQ2A 2JXLA 4I5KA 1K90D 1S6JA 3SG6A 1U5IB 3CTNA 1NX2A 3E3RA 1NSHA 3PN7B 4F0ZB 3BUWB 1AHRA 2BECA 4YGCB 2NXQA 1KWOB 2F2PA 2KI4C 2M1KB 4M2PA 1M39A 1Y1AA 1QX5B 1S5GZ 1XFVO 1TOPA 1UHHA 5DKRA 3CS1A 1TRFA 2L2EA 1KWOC 1J7QA 1RK9A 3BUMB 1UHIA 3DF0A 4MRXA 2M97A 1OMRA 3BOWB 3PN7C 1KQMC 1JC2A 1TNXA 4YGDB 1PSRA 1WLMA 1XFXO 1PVAA 4A4CA 2EHBA 1SPYA 4GAOA 4C0KA 3O78A 1EJ3A 2RGIA 3OP0A 3A8RA 2I7AA 4ORCB 1R2UA 2BCXA 1QIVA 1ZUZA 3JVTB 5KSZA 2L0PA 1JWDA 2JXCA 4XYNA 3I5FC 1QLKA 2ZKMX 2M29A 1JFJA 2V53A 2PSRA 2L50A 5IBWA 4YGBB 5AANA 4PE4A 3SJSA 2LMVA 1LVCD 4PALA 2CXJA 2M8UA 1SW8A 1LKJA 1IKUA 4ORAB 1QVIZ 2O60A 4N1GA 1B1GA 1C7VA 1EG4A 1V1GA 3F45A 4PE0A 1S5GY 1M45A 1X02A 3FWBA 1W7JB 1QVIY 3CWGA 1YTZC 1CM4A 3PALA 1A75B 1DJXA 2WCEA 3OX6A 5PALA 2L4HA 3SIAA 4YGAA 1SCVA 3D10A 2WC8A 1M63B 1DJIA 2LUXA 2KBMA 2Y1MA 1K9KA 1L2OB 4DCKA 1JUOA 1N65A 3AKBA 1AK8A 2WORA 2MHHA 1KSOA 5CSNA 5HLVA 2MLFC 1GJYA 2LMUA 4GGFA 4MZJA 2PMYA 4OKHA 5BPJA 1KFXS 4MSPA 4YI9A 1WRZA 1ALWA 4YRUA 5I8NA 3DF0B 1SR6B 1EXRA 2LUCA 1AVSA 1F71A 1SCMB 1ALVA 4MN0A 1EL4A 1C7WA 2BKIB 2KAXA 2LLUA 2LP3A 1W7IB 4PE1A 1TNWA 3LCPC 1L7ZA 2GGZA 1CFPA 1NP8A 1PALA 1UURA 3CZTX 1KFXL 1CKKA 1CFDA 2KYFA 4OVNF 5ER5A 4HRHA 1K8UA 2CCMA 3PATA 1FBVA 1OMVA 1BJFA 1Y6WA 1YRUB 3SG2A 4PHKA 1IJ6A 1KFUS 2OTGB 4JWQA 2G9BA 3BUXB 3RLZA 2K8MB 3I5FB 5FYXA 2KNEA 1KK8C 3WXAA 1SYMA 1TNPA 2K2AA 4MZLA 1WDCB 1WDCC 2G2BA 2LE9B 1F55A 1J1DA 2JNFA 2ZRSA 1BOCA 4YBHB 1K94A 1BG1A 3LLEA 1XA5A 3BOWA 1A29A 2HETA 1S6IA 3QRXA 4GBAA 4GNKB 1KQMB 5ER4X 4N1FA 1K2HA 2L51A 2F3YA 1K96A 3IF7A 1UHJA 3CGAA 3NXAA 4YGEB 5G08A 2L5XB 4QJ5B 3EK4A 3SIBA 1R6PA 3KF9A 1WY9A 1UWOA 2KYCA 2OTGC 5I2OA 2KQ6A 2BE6A 2MA2A 3IQQA 2TN4A 2FCDA 1XFUO 1BT6A 1GGWA 1K9UA 2E6WA 1DVIA 1PVBA 2WNDA 1DJYA 2AMIA 4GGFC 2KI6D 1C07A 1YUUA 2JOJA 3KPXA 3FWCA 4GFTA 2LVJA 1SCMC 4ICBA 3BXKA 3ZWHA 1MXLC 4D1EA 1NX1A 2O5GA 2M7LA 1SR6C 1Q80A 2M0RA 5D7FA 3CLNA 1PRWA 2JT3A 3GOFA 1JF2A 3NSLA 4WQ3A 2FOTA 1ZOTB 3AAKA 2ZNEA 1NWDA 1S1EA 2SASA 3GK2A 1DJZA 2MLEC 4GUKA 3TS5B 2PALA 4I5LB 4XJKB 2CBLA 4U8DA 1WRKA 2JTZA 2JRFA 4PHNA 4HSZA 1K9PA 2P6BB 3I5HC 1K93D 1YURA 2NCPA 4IL1A 3BUOB 3I5IB 4TNCA 4HRGA 2LNKA 2M7NA 1S6CA 3BQ3A 4FTGA 4Q04A 2F8PA 4NDCA 3EVRA 4PHJA 3PFVA 2GV5A 1TNQA 1U5IA 2BKHB 1A4PA 3TUYB 3SG4A 2JT8A 2FCEA 1B8RA 1S36A 4CFRA 2CNPA 1Y1UA 4PHMA 2KQYA 3TDZA 2COLB 1DGVA 1G33A 4P2YB 1IH0A 1UUSA 2LLSA 2KFFA 3OHMB 2JQ6A 2BBMA 2EC6B 2MBXA 3BYAA 1KCYA 2NCOA 2BL0C 2NZ0A 2LLTA 1OZOA 4NQGA 3JVTC 3AKAA 4MEWA 1B9AA 1YVLA 2BL0B 2HQ8A 3RM1A 4AOMA 1Y1XA 2LVKA 3VRNA 1GQMA 2KGRA 3OX5A 1LA0A 1K95A 1D1OA 1NX0A 2LVVA 3WNXB 2WOSA 1IJ5A 1S26D 1ZFSA 3DVJA 1ODBA 3AAJA 1PSBA 2Y5IA 4L9MA 4A4BA 5AERA 2L4IA 1E8AA 1TCFA 1CDLA 5JOLA 1DMOA 4PDZA 3C1VA 3CR2A 4OCIA 2HQWA 1QATA 1RJVA 1GGZA 3DVEA 3M0WA 1F54A 2KI4B 1UHKA 1ZMZA 1TTXA 3I5HB 1BR1B 1MHOA 1MQ1A 1NIWA 2MRDA 3KEVA 1FW4A 1IQ3A 2DOQA 1DGUA 1FI6A 4ETOA 3DVMA 1SNLA 2H61A 1WRLA 4USLA 1B4CA 2JZIA 2FJUB 1CLBA 1B8CA 5CSFA 2JNXA 2LCPA 2AUCA 1HT9A 1CB1A 1J7OA 3O6BA 1IRJA 1MUXA 2NLNA 2KI6C 4I5JA 5KU1A 1UP5A 3EKHA 3GK4X 1LXFC 1CNPA 1YVHA 4FQOA 3CR5X 1RROA 1HQVA 1CDNA 3DVKA 3GK1A 3PM8A 2LVIA 1SMGA 2BCAA 3JTDC 1SK6D 2WCBA 2ZFDA 1SL9A 2PASA 2LMTA 1JFKA 3EK7A 1IWQA 1QJTA 4QJ3B 2LV7A 1DJHA 4CIDA 5HYDA 2CT9A 2F3ZA 3IQOA 1FI5A 1DJGA 1CLMA 4P5OE 1YUTA 3VRPA 1CMFA 2JULA 1A75A 5J3XA 4DUQA 3ZNIA 1CFCA 2E30A 2LANA 1KK7Y 2LC5A 2D8NA 1KK7Z 1MXEA 2HPSA 1LA3A 2KFGA 1DJWA 1SBJA 2BCBA 1ZACA 5GQQC 2H2KA 2KHNA 1CDPA 2BBNA 1SL8A 1OE9B 1LINA 1PK0D 1CDMA 2JWWA 2OPOA 4MVFA 2VRGA 4MRYA 1OSAA 2L98A 3D0YA 4PE7A 5AEQA 2Q4UA 2A4JA 4XJKA 1AP4A 1YR5A 1OZSA 1IG5A 2KAYA 4N5XA 1Y0VH 2CTNA 1CMGA 5K89A 3VRRA 1NYAA 2H61C 4CFQA 4DS7A 3SG7A 3EVUA 5B8IB 1BF5A 3I5IC 5F6TA 5CSIA 2LM5A 1EH2A 2M3WA 1NPQA 1CLLA 3PLFB 1F4QA 1XFYO 2MAZA 5D69A 1JBAA 2LHIA 3VGOA 1AUIB 5AXIA 2QACA 4DRWA 2KGBC 4ZCUA 1JSAA 2I18A 1H4BA 4UPGA 1A03A 4C0LA 1CFFA 5HKWA 1NCZA 4NDBA 1QLSA 2K7OA 4M2OA 1DF0B 3NSKA 3TZ1A 4DIRA 1YX7A 3LK1A 4C0JA 5JJGA 1QASA 2JC2A 4HREE 1F4OA 3WHTB 2KFHA 4AQIA 3A4UB 1XVJA 1AJ5A 1DTLA 2JTTA 3JTDB 1BU3A 1RWYA 2OS8B 1YUSA 2M1UA 5HKZA 1QX2A 2MJWB 2OS8C
chains in the Genus database with same CATH superfamily
1B47A 1NX3A 2ERBA 3WHUB 5KTYA 1S3PA 3O4YA 3DD4A 1V1FA 2SCPA 4MLWA 3K21A 1M31A 5I2QA 1XFWO 2I2RE 4QJ4B 1G4YR 1J7RA 3EKJA 1SY9A 5DKNA 1CTRA 1J7PA 3SG3A 1SRAA 2LP2A 1MWNA 3D0YB 2PRUA 3BUNB 3L47A 4MBEA 5DKQA 3HCMA 3TDUA 4BY4A 4YI8A 1F8HA 1FF1A 1IGVA 2GGMA 3D78A 4ZCVA 1RFJA 3KO0A 2KDHA 2K7DA 1KK8B 1YX8A 1N2DA 1OMDA 2HF5A 3ICBA 3S0DA 4F7FA 5HKYA 1SSEB 5I2LA 1RTP1 4E68A 5TNCA 1KFUL 3UNWA 2ZNDA 1JF0A 1A2XA 1J1EA 1FPWA 1QS7A 1QV1A 3FS7A 1UHNA 1QTXA 1BMOA 3PJIA 2JU0A 2LHLA 3OB2B 4OR9B 5CSJA 4I5NB 4CLNA 2K61A 1DT7B 1QXPA 1B7TZ 2JPTA 3NSIA 2PVBA 1Z4HA 2QEBA 3OB1B 4FQTA 4PCWA 1BR4B 3VB1A 1CM1A 1MR8A 1B8LA 3PM2A 3S0GA 1PULA 1QV0A 3O4XA 1OQPA 2ZN8A 4ORBB 3NSOA 3IVTA 3TDIA 2F33A 2M9GA 3I5GB 3FIAA 3N7HA 5HLOA 4NDDA 1J55A 3CR4X 5I94A 1NUBA 1TCOB 2KSPA 2QPTA 2F2OA 1GM0A 2M49B 2BE4A 4GPLB 4JPZB 3LL8B 1BODA 1XYDA 2EC6C 2P70A 1N0YA 1XO5A 1NCYA 1NCXA 1YRTB 5AFPA 1L2OC 1MF8B 1QIWA 4OV2A 2ZN9A 3KHEA 3FE6A 1OOJA 2B1UA 3VRQA 1F70A 2I94A 2PQLA 3EVVA 1B7TY 3H4SE 3TUYC 1AJ4A 1C3YA 2Y1NA 2R2IA 1TIZA 1QX7A 1H8BA 2K7CA 3HX4A 1EG3A 1TN4A 4MZKA 4M2QA 3O2PA 1RECA 3SG5A 2EGDA 4AQJA 1IQ5A 1XFZO 1XK4A 1DF0A 2LAPA 1SL7A 1XK4C 4BY5A 4GGNA 4R1EA 1G8IA 1KSMA 1M46A 2Q91A 2KBIA 2WCHA 1SKTA 2L5YA 3TS5C 3VROA 2K7BA 2K2FA 2AAOA 4CPVA 1IIOA 2IS9A 2ISDA 3MSEB 2K0JA 2WCFA 3LK0A 1VRKA 1WLZA 3PSRA 2ZRTA 3OGNA 4JQ0D 2WC6A 5CPVA 1KQVA 2KAVA 3EK8A 2KOTA 3I5GC 2Y4QA 1BLQA 2JT0A 4WRIA 4WQ2A 3SS3A 2JXLA 4I5KA 1K90D 1S6JA 3SG6A 1U5IB 2KLDA 1NX2A 1LS8A 1NSHA 3CTNA 3E3RA 3PN7B 3BUWB 1AHRA 4F0ZB 2BECA 4YGCB 2NXQA 1KWOB 2F2PA 2KI4C 2M1KB 2L2CA 1M39A 1Y1AA 4INXA 4M2PA 1QX5B 1S5GZ 1XFVO 1TOPA 1UHHA 5DKRA 3CS1A 1ORGA 1TRFA 2L2EA 2QEVA 1KWOC 1J7QA 1RK9A 3BUMB 1UHIA 3DF0A 4MRXA 2M97A 1OMRA 3BOWB 3PN7C 1KQMC 3B7AA 1JC2A 1TNXA 4YGDB 1PSRA 1WLMA 3QMEA 1XFXO 1PVAA 4A4CA 2EHBA 1SPYA 4GAOA 4C0KA 3O78A 1EJ3A 2RGIA 4JKTA 3OP0A 3A8RA 2I7AA 4ORCB 1DQEA 1R2UA 2BCXA 1QIVA 1ZUZA 3JVTB 5KSZA 2L0PA 1JWDA 2JXCA 4XYNA 3I5FC 1QLKA 2K60A 2ZKMX 2WC5A 2M29A 1JFJA 2V53A 2PSRA 2L50A 3CDNA 5IBWA 4YGBB 5AANA 4PE4A 3SJSA 2LMVA 1LVCD 5FI6A 4PALA 2CXJA 1OW4A 4OZDA 2M8UA 1SW8A 1LKJA 1IKUA 4ORAB 1QVIZ 2O60A 2YGUA 1DEKA 4N1GA 3S0AA 1B1GA 1C7VA 1EG4A 1V1GA 3F45A 4PE0A 1S5GY 1M45A 1X02A 3FWBA 1W7JB 1QVIY 3CWGA 1YTZC 3DZTA 1CM4A 1P28A 3PALA 1A75B 2BNXA 1DJXA 2WCEA 3OX6A 5PALA 1DC1A 2L4HA 3SIAA 4YGAA 1SCVA 3D10A 1W9ZA 3R1PA 2WC8A 1M63B 1DJIA 2LUXA 2KBMA 2Y1MA 1K9KA 1L2OB 3CZ0A 4DCKA 1C3ZA 1JUOA 1N65A 3AKBA 1AK8A 2WCLA 2WORA 2MHHA 1KSOA 1DELA 5CSNA 2MLFC 5HLVA 1GJYA 2LMUA 4GGFA 4MZJA 2PMYA 4OKHA 5BPJA 1KFXS 4MSPA 4YI9A 1WRZA 1ALWA 4YRUA 5I8NA 3DF0B 1SR6B 1EXRA 2LUCA 3D74A 2QEOA 5ER4X 1AVSA 3L4AA 1F71A 1OOIX 1SCMB 1OOHA 1ALVA 4MN0A 1EL4A 5EL2A 3B6XA 1C7WA 2BKIB 2KAXA 2LLUA 2LP3A 1W7IB 4PE1A 1TNWA 3EG5B 3LCPC 1L7ZA 2GGZA 1CFPA 1NP8A 1PALA 1UURA 3NHIA 3CZTX 1KFXL 2WCJA 1CKKA 1CFDA 2KYFA 4OVNF 5ER5A 4HRHA 1K8UA 2CCMA 3PATA 1FBVA 1OMVA 1BJFA 1Y6WA 1Z2CB 3FE8A 3BFAA 3CZ1A 1YRUB 3SG2A 4PHKA 1IJ6A 1KFUS 2OTGB 4JWQA 2G9BA 3BUXB 3RLZA 2K8MB 3I5FB 5FYXA 2KNEA 1KK8C 3WXAA 1SYMA 1TNPA 2K2AA 4MZLA 1WDCB 1WDCC 2G2BA 2LE9B 1F55A 1J1DA 2JNFA 2ZRSA 1OOGA 3B86A 3V2LA 1BOCA 4YBHB 1K94A 1BG1A 3DY9A 3LLEA 1XA5A 3BOWA 1A29A 2HETA 1S6IA 3QRXA 4GBAA 3R1VA 1KQMB 4GNKB 4N1FA 1K2HA 2QDIA 3UO9A 2L51A 2F3YA 1K96A 1OOFA 3IF7A 1UHJA 3CGAA 3NXAA 4YGEB 5G08A 3D73A 3D75A 2L5XB 4QJ5B 3EK4A 3SIBA 1R6PA 3KF9A 1WY9A 1UWOA 2KYCA 2OTGC 5I2OA 2KQ6A 2BE6A 2MA2A 3IQQA 2TN4A 2FCDA 1XFUO 1BT6A 1GGWA 1K9UA 2E6WA 1DVIA 1PVBA 2WNDA 1DJYA 2AMIA 4GGFC 2KI6D 2JPOA 1C07A 1YUUA 2JOJA 3KPXA 3FWCA 3NHTA 2LVJA 1SCMC 4GFTA 3BXKA 4ICBA 1MXLC 3ZWHA 4D1EA 1NX1A 2O5GA 2M7LA 1SR6C 1Q80A 2M0RA 5D7FA 3CLNA 2PYQA 1PRWA 2JT3A 3GOFA 1JF2A 3NSLA 4WQ3A 2FOTA 1ZOTB 3AAKA 2ZNEA 1NWDA 1S1EA 2SASA 3GK2A 1DJZA 2MLEC 4GUKA 3TS5B 2PALA 4I5LB 4XJKB 2CBLA 4U8DA 1WRKA 2JTZA 2JRFA 4PHNA 4HSZA 1K9PA 2P6BB 3I5HC 1K93D 1YURA 2NCPA 4IL1A 3BUOB 2P71A 3I5IB 4TNCA 4HRGA 2LNKA 2M7NA 2WCKA 5FI7A 1S6CA 3BQ3A 4FTGA 4Q04A 2F8PA 4NDCA 3EVRA 4PHJA 3PFVA 2GV5A 1TNQA 1U5IA 2BKHB 1A4PA 3D76A 3TUYB 5HL1A 3SG4A 2JT8A 2FCEA 1B8RA 1S36A 4CFRA 2CNPA 3RZSA 1Y1UA 2GTEA 4PHMA 2KQYA 3TDZA 2COLB 1DGVA 1G33A 4P2YB 1IH0A 1UUSA 2LLSA 3BFBA 2KFFA 3OHMB 2JQ6A 2BBMA 2EC6B 2MBXA 2H8VA 3BYAA 2NCOA 3DXLA 2BL0C 1KCYA 2NZ0A 2LLTA 2WCMA 1OZOA 4NQGA 4INWA 3JVTC 3AKAA 3CABA 4MEWA 1B9AA 1YVLA 3NGVA 2BL0B 2HQ8A 3RM1A 4AOMA 1Y1XA 2LVKA 3VRNA 1TUJA 1GQMA 2KGRA 3OX5A 1LA0A 1K95A 2BAPA 1D1OA 1NX0A 2LVVA 3WNXB 2WOSA 1IJ5A 1S26D 1ZFSA 3DVJA 1ODBA 3AAJA 1PSBA 2Y5IA 4L9MA 4A4BA 5AERA 2L4IA 1E8AA 1TCFA 1CDLA 5JOLA 1DMOA 4PDZA 5DICA 3C1VA 3CR2A 4OCIA 2HQWA 1QATA 1RJVA 1GGZA 1T14A 3DVEA 3M0WA 2KI4B 1QWVA 1UHKA 1ZMZA 1F54A 1TTXA 3I5HB 1BR1B 1MHOA 1MQ1A 1NIWA 3CYZA 3Q8IA 2MRDA 3KEVA 1FW4A 5D3OA 1IQ3A 2DOQA 2QEHA 1DGUA 1FI6A 3L4LA 4ETOA 3DVMA 1SNLA 2H61A 1WRLA 4USLA 1B4CA 2JZIA 2FJUB 1CLBA 1B8CA 5CSFA 2JNXA 2LCPA 2KPHA 2AUCA 1HT9A 1CB1A 1J7OA 3O6BA 1IRJA 1MUXA 2NLNA 2KI6C 4I5JA 5KU1A 1UP5A 3EKHA 3GK4X 1LXFC 1CNPA 1YVHA 4FQOA 3CR5X 1RROA 1HQVA 1CDNA 3DVKA 3GK1A 3PM8A 2LVIA 1SMGA 2BCAA 3JTDC 1SK6D 2WCBA 2ZFDA 1SL9A 2PASA 4JD9A 2LMTA 1JFKA 3EK7A 1IWQA 1QJTA 4QJ3B 2LV7A 1DJHA 4CIDA 5HYDA 2CT9A 2F3ZA 2FJYA 3IQOA 1FI5A 1DJGA 1CLMA 4P5OE 1YUTA 3VRPA 1CMFA 2JULA 1A75A 5J3XA 4DUQA 3ZNIA 1CFCA 3S0FA 2E30A 2LANA 1KK7Y 2LC5A 2D8NA 1KK7Z 1MXEA 2HPSA 1LA3A 2KFGA 3S0BA 1DJWA 1SBJA 2BCBA 1ZACA 5GQQC 2H2KA 3SS5A 2KHNA 1CDPA 2BBNA 1SL8A 3BFHA 1OE9B 5FI2A 1LINA 1PK0D 1CDMA 2JWWA 1TWOA 2OPOA 4MVFA 4IJ7A 2VRGA 4MRYA 1OSAA 1XFRA 2L98A 3B88A 3D0YA 4PE7A 5AEQA 2Q4UA 2A4JA 4XJKA 1AP4A 1YR5A 1OZSA 1IG5A 3R72A 2KAYA 4N5XA 3OBVA 1Y0VH 2CTNA 1CMGA 5K89A 3VRRA 1NYAA 2H61C 4CFQA 4DS7A 3SG7A 3EVUA 4PT1A 5B8IB 3I5IC 1BF5A 5F6TA 5CSIA 2LM5A 1EH2A 2M3WA 1NPQA 1CLLA 3FE9A 3PLFB 1F4QA 1XFYO 2MAZA 5D69A 1JBAA 2LHIA 3VGOA 1AUIB 5AXIA 2QACA 4DRWA 2KGBC 4ZCUA 1JSAA 2I18A 1H4BA 3SS4A 4UPGA 1A03A 4C0LA 1CFFA 4KYNA 5HKWA 2KLEA 1NCZA 4NDBA 1QLSA 2K7OA 4M2OA 1DF0B 3NSKA 3TZ1A 4DIRA 1YX7A 3LK1A 4C0JA 5JJGA 1QASA 2JC2A 1TUZA 4HREE 1F4OA 3WHTB 3BJHA 2KFHA 3B87A 3K1EA 4AQIA 3A4UB 1XVJA 1AJ5A 1DTLA 2JTTA 3CZ2A 3D77A 3JTDB 1BU3A 1RWYA 2OS8B 3S0EA 1YUSA 2M1UA 3R1OA 5HKZA 1QX2A 2MJWB 3DYEA 2OS8C
chains in the Genus database with same CATH topology
1B47A 1NX3A 3WHUB 5KTYA 1S3PA 3O4YA 3DD4A 1V1FA 2SCPA 4MLWA 3K21A 1M31A 5I2QA 1XFWO 2I2RE 4QJ4B 1G4YR 1J7RA 3EKJA 1SY9A 5DKNA 1CTRA 1J7PA 3SG3A 1SRAA 2LP2A 1MWNA 3D0YB 2PRUA 3BUNB 4MBEA 5DKQA 3HCMA 3TDUA 4BY4A 4YI8A 1F8HA 1FF1A 1IGVA 2GGMA 4ZCVA 1RFJA 3KO0A 2KDHA 2K7DA 1KK8B 1YX8A 1N2DA 1OMDA 2HF5A 3ICBA 5HKYA 5I2LA 1RTP1 4E68A 5TNCA 1KFUL 2ZNDA 1JF0A 1A2XA 1J1EA 1FPWA 1QS7A 1QV1A 3FS7A 1UHNA 1QTXA 1BMOA 2JU0A 2LHLA 3OB2B 4OR9B 5CSJA 4I5NB 4CLNA 2K61A 1DT7B 1QXPA 1B7TZ 2JPTA 3NSIA 2PVBA 3OB1B 4PCWA 1BR4B 1CM1A 1MR8A 1B8LA 1PULA 1QV0A 1OQPA 2ZN8A 4ORBB 3NSOA 3TDIA 2F33A 2M9GA 3I5GB 3FIAA 5HLOA 4NDDA 1J55A 3CR4X 1NUBA 1TCOB 2KSPA 2QPTA 2F2OA 2M49B 2BE4A 4GPLB 4JPZB 3LL8B 1BODA 1XYDA 2EC6C 1N0YA 1XO5A 1NCYA 1NCXA 1YRTB 5AFPA 1L2OC 1MF8B 1QIWA 4OV2A 2ZN9A 3KHEA 1OOJA 2B1UA 3VRQA 1F70A 2I94A 3EVVA 3H4SE 1B7TY 3TUYC 1AJ4A 2Y1NA 2R2IA 1TIZA 1QX7A 1H8BA 2K7CA 3HX4A 1EG3A 1TN4A 4MZKA 4M2QA 3O2PA 1RECA 3SG5A 2EGDA 4AQJA 1IQ5A 1XFZO 1XK4A 1DF0A 2LAPA 1SL7A 1XK4C 4BY5A 4GGNA 4R1EA 1G8IA 1KSMA 1M46A 2Q91A 2KBIA 1SKTA 3TS5C 3VROA 2K7BA 2K2FA 2AAOA 4CPVA 2IS9A 2ISDA 3MSEB 2K0JA 2WCFA 3LK0A 1VRKA 1WLZA 3PSRA 2ZRTA 4JQ0D 5CPVA 1KQVA 2KAVA 3EK8A 2KOTA 3I5GC 2Y4QA 1BLQA 2JT0A 4WRIA 4WQ2A 2JXLA 4I5KA 1K90D 1S6JA 3SG6A 1U5IB 3CTNA 1NX2A 3E3RA 1NSHA 3PN7B 4F0ZB 3BUWB 1AHRA 2BECA 4YGCB 2NXQA 1KWOB 2F2PA 2KI4C 2M1KB 4M2PA 1M39A 1Y1AA 1QX5B 1S5GZ 1XFVO 1TOPA 1UHHA 5DKRA 3CS1A 1TRFA 2L2EA 1KWOC 1J7QA 1RK9A 3BUMB 1UHIA 3DF0A 4MRXA 2M97A 1OMRA 3BOWB 3PN7C 1KQMC 1JC2A 1TNXA 4YGDB 1PSRA 1WLMA 1XFXO 1PVAA 4A4CA 2EHBA 1SPYA 4GAOA 4C0KA 3O78A 1EJ3A 2RGIA 3OP0A 3A8RA 2I7AA 4ORCB 1R2UA 2BCXA 1QIVA 1ZUZA 3JVTB 5KSZA 2L0PA 1JWDA 2JXCA 4XYNA 3I5FC 1QLKA 2ZKMX 2M29A 1JFJA 2V53A 2PSRA 2L50A 5IBWA 4YGBB 5AANA 4PE4A 3SJSA 2LMVA 1LVCD 4PALA 2CXJA 2M8UA 1SW8A 1LKJA 1IKUA 4ORAB 1QVIZ 2O60A 4N1GA 1B1GA 1C7VA 1EG4A 1V1GA 3F45A 4PE0A 1S5GY 1M45A 1X02A 3FWBA 1W7JB 1QVIY 3CWGA 1YTZC 1CM4A 3PALA 1A75B 1DJXA 2WCEA 3OX6A 5PALA 2L4HA 3SIAA 4YGAA 1SCVA 3D10A 2WC8A 1M63B 1DJIA 2LUXA 2KBMA 2Y1MA 1K9KA 1L2OB 4DCKA 1JUOA 1N65A 3AKBA 1AK8A 2WORA 2MHHA 1KSOA 5CSNA 5HLVA 2MLFC 1GJYA 2LMUA 4GGFA 4MZJA 2PMYA 4OKHA 5BPJA 1KFXS 4MSPA 4YI9A 1WRZA 1ALWA 4YRUA 5I8NA 3DF0B 1SR6B 1EXRA 2LUCA 1AVSA 1F71A 1SCMB 1ALVA 4MN0A 1EL4A 1C7WA 2BKIB 2KAXA 2LLUA 2LP3A 1W7IB 4PE1A 1TNWA 3LCPC 1L7ZA 2GGZA 1CFPA 1NP8A 1PALA 1UURA 3CZTX 1KFXL 1CKKA 1CFDA 2KYFA 4OVNF 5ER5A 4HRHA 1K8UA 2CCMA 3PATA 1FBVA 1OMVA 1BJFA 1Y6WA 1YRUB 3SG2A 4PHKA 1IJ6A 1KFUS 2OTGB 4JWQA 2G9BA 3BUXB 3RLZA 2K8MB 3I5FB 5FYXA 2KNEA 1KK8C 3WXAA 1SYMA 1TNPA 2K2AA 4MZLA 1WDCB 1WDCC 2G2BA 2LE9B 1F55A 1J1DA 2JNFA 2ZRSA 1BOCA 4YBHB 1K94A 1BG1A 3LLEA 1XA5A 3BOWA 1A29A 2HETA 1S6IA 3QRXA 4GBAA 4GNKB 1KQMB 5ER4X 4N1FA 1K2HA 2L51A 2F3YA 1K96A 3IF7A 1UHJA 3CGAA 3NXAA 4YGEB 5G08A 2L5XB 4QJ5B 3EK4A 3SIBA 1R6PA 3KF9A 1WY9A 1UWOA 2KYCA 2OTGC 5I2OA 2KQ6A 2BE6A 2MA2A 3IQQA 2TN4A 2FCDA 1XFUO 1BT6A 1GGWA 1K9UA 2E6WA 1DVIA 1PVBA 2WNDA 1DJYA 2AMIA 4GGFC 2KI6D 1C07A 1YUUA 2JOJA 3KPXA 3FWCA 4GFTA 2LVJA 1SCMC 4ICBA 3BXKA 3ZWHA 1MXLC 4D1EA 1NX1A 2O5GA 2M7LA 1SR6C 1Q80A 2M0RA 5D7FA 3CLNA 1PRWA 2JT3A 3GOFA 1JF2A 3NSLA 4WQ3A 2FOTA 1ZOTB 3AAKA 2ZNEA 1NWDA 1S1EA 2SASA 3GK2A 1DJZA 2MLEC 4GUKA 3TS5B 2PALA 4I5LB 4XJKB 2CBLA 4U8DA 1WRKA 2JTZA 2JRFA 4PHNA 4HSZA 1K9PA 2P6BB 3I5HC 1K93D 1YURA 2NCPA 4IL1A 3BUOB 3I5IB 4TNCA 4HRGA 2LNKA 2M7NA 1S6CA 3BQ3A 4FTGA 4Q04A 2F8PA 4NDCA 3EVRA 4PHJA 3PFVA 2GV5A 1TNQA 1U5IA 2BKHB 1A4PA 3TUYB 3SG4A 2JT8A 2FCEA 1B8RA 1S36A 4CFRA 2CNPA 1Y1UA 4PHMA 2KQYA 3TDZA 2COLB 1DGVA 1G33A 4P2YB 1IH0A 1UUSA 2LLSA 2KFFA 3OHMB 2JQ6A 2BBMA 2EC6B 2MBXA 3BYAA 1KCYA 2NCOA 2BL0C 2NZ0A 2LLTA 1OZOA 4NQGA 3JVTC 3AKAA 4MEWA 1B9AA 1YVLA 2BL0B 2HQ8A 3RM1A 4AOMA 1Y1XA 2LVKA 3VRNA 1GQMA 2KGRA 3OX5A 1LA0A 1K95A 1D1OA 1NX0A 2LVVA 3WNXB 2WOSA 1IJ5A 1S26D 1ZFSA 3DVJA 1ODBA 3AAJA 1PSBA 2Y5IA 4L9MA 4A4BA 5AERA 2L4IA 1E8AA 1TCFA 1CDLA 5JOLA 1DMOA 4PDZA 3C1VA 3CR2A 4OCIA 2HQWA 1QATA 1RJVA 1GGZA 3DVEA 3M0WA 1F54A 2KI4B 1UHKA 1ZMZA 1TTXA 3I5HB 1BR1B 1MHOA 1MQ1A 1NIWA 2MRDA 3KEVA 1FW4A 1IQ3A 2DOQA 1DGUA 1FI6A 4ETOA 3DVMA 1SNLA 2H61A 1WRLA 4USLA 1B4CA 2JZIA 2FJUB 1CLBA 1B8CA 5CSFA 2JNXA 2LCPA 2AUCA 1HT9A 1CB1A 1J7OA 3O6BA 1IRJA 1MUXA 2NLNA 2KI6C 4I5JA 5KU1A 1UP5A 3EKHA 3GK4X 1LXFC 1CNPA 1YVHA 4FQOA 3CR5X 1RROA 1HQVA 1CDNA 3DVKA 3GK1A 3PM8A 2LVIA 1SMGA 2BCAA 3JTDC 1SK6D 2WCBA 2ZFDA 1SL9A 2PASA 2LMTA 1JFKA 3EK7A 1IWQA 1QJTA 4QJ3B 2LV7A 1DJHA 4CIDA 5HYDA 2CT9A 2F3ZA 3IQOA 1FI5A 1DJGA 1CLMA 4P5OE 1YUTA 3VRPA 1CMFA 2JULA 1A75A 5J3XA 4DUQA 3ZNIA 1CFCA 2E30A 2LANA 1KK7Y 2LC5A 2D8NA 1KK7Z 1MXEA 2HPSA 1LA3A 2KFGA 1DJWA 1SBJA 2BCBA 1ZACA 5GQQC 2H2KA 2KHNA 1CDPA 2BBNA 1SL8A 1OE9B 1LINA 1PK0D 1CDMA 2JWWA 2OPOA 4MVFA 2VRGA 4MRYA 1OSAA 2L98A 3D0YA 4PE7A 5AEQA 2Q4UA 2A4JA 4XJKA 1AP4A 1YR5A 1OZSA 1IG5A 2KAYA 4N5XA 1Y0VH 2CTNA 1CMGA 5K89A 3VRRA 1NYAA 2H61C 4CFQA 4DS7A 3SG7A 3EVUA 5B8IB 1BF5A 3I5IC 5F6TA 5CSIA 2LM5A 1EH2A 2M3WA 1NPQA 1CLLA 3PLFB 1F4QA 1XFYO 2MAZA 5D69A 1JBAA 2LHIA 3VGOA 1AUIB 5AXIA 2QACA 4DRWA 2KGBC 4ZCUA 1JSAA 2I18A 1H4BA 4UPGA 1A03A 4C0LA 1CFFA 5HKWA 1NCZA 4NDBA 1QLSA 2K7OA 4M2OA 1DF0B 3NSKA 3TZ1A 4DIRA 1YX7A 3LK1A 4C0JA 5JJGA 1QASA 2JC2A 4HREE 1F4OA 3WHTB 2KFHA 4AQIA 3A4UB 1XVJA 1AJ5A 1DTLA 2JTTA 3JTDB 1BU3A 1RWYA 2OS8B 1YUSA 2M1UA 5HKZA 1QX2A 2MJWB 2OS8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B47 A;  1NX3 A;  3WHU B;  5KTY A;  1S3P A;  3O4Y A;  3DD4 A;  1V1F A;  2SCP A;  4MLW A;  3K21 A;  1M31 A;  5I2Q A;  1XFW O;  2I2R E;  4QJ4 B;  1G4Y R;  1J7R A;  3EKJ A;  1SY9 A;  5DKN A;  1CTR A;  1J7P A;  3SG3 A;  1SRA A;  2LP2 A;  1MWN A;  3D0Y B;  2PRU A;  3BUN B;  4MBE A;  5DKQ A;  3HCM A;  3TDU A;  4BY4 A;  4YI8 A;  1F8H A;  1FF1 A;  1IGV A;  2GGM A;  4ZCV A;  1RFJ A;  3KO0 A;  2KDH A;  2K7D A;  1KK8 B;  1YX8 A;  1N2D A;  1OMD A;  2HF5 A;  3ICB A;  5HKY A;  5I2L A;  1RTP 1;  4E68 A;  5TNC A;  1KFU L;  2ZND A;  1JF0 A;  1A2X A;  1J1E A;  1FPW A;  1QS7 A;  1QV1 A;  3FS7 A;  1UHN A;  1QTX A;  1BMO A;  2JU0 A;  2LHL A;  3OB2 B;  4OR9 B;  5CSJ A;  4I5N B;  4CLN A;  2K61 A;  1DT7 B;  1QXP A;  1B7T Z;  2JPT A;  3NSI A;  2PVB A;  3OB1 B;  4PCW A;  1BR4 B;  1CM1 A;  1MR8 A;  1B8L A;  1PUL A;  1QV0 A;  1OQP A;  2ZN8 A;  4ORB B;  3NSO A;  3TDI A;  2F33 A;  2M9G A;  3I5G B;  3FIA A;  5HLO A;  4NDD A;  1J55 A;  3CR4 X;  1NUB A;  1TCO B;  2KSP A;  2QPT A;  2F2O A;  2M49 B;  2BE4 A;  4GPL B;  4JPZ B;  3LL8 B;  1BOD A;  1XYD A;  2EC6 C;  1N0Y A;  1XO5 A;  1NCY A;  1NCX A;  1YRT B;  5AFP A;  1L2O C;  1MF8 B;  1QIW A;  4OV2 A;  2ZN9 A;  3KHE A;  1OOJ A;  2B1U A;  3VRQ A;  1F70 A;  2I94 A;  3EVV A;  3H4S E;  1B7T Y;  3TUY C;  1AJ4 A;  2Y1N A;  2R2I A;  1TIZ A;  1QX7 A;  1H8B A;  2K7C A;  3HX4 A;  1EG3 A;  1TN4 A;  4MZK A;  4M2Q A;  3O2P A;  1REC A;  3SG5 A;  2EGD A;  4AQJ A;  1IQ5 A;  1XFZ O;  1XK4 A;  1DF0 A;  2LAP A;  1SL7 A;  1XK4 C;  4BY5 A;  4GGN A;  4R1E A;  1G8I A;  1KSM A;  1M46 A;  2Q91 A;  2KBI A;  1SKT A;  3TS5 C;  3VRO A;  2K7B A;  2K2F A;  2AAO A;  4CPV A;  2IS9 A;  2ISD A;  3MSE B;  2K0J A;  2WCF A;  3LK0 A;  1VRK A;  1WLZ A;  3PSR A;  2ZRT A;  4JQ0 D;  5CPV A;  1KQV A;  2KAV A;  3EK8 A;  2KOT A;  3I5G C;  2Y4Q A;  1BLQ A;  2JT0 A;  4WRI A;  4WQ2 A;  2JXL A;  4I5K A;  1K90 D;  1S6J A;  3SG6 A;  1U5I B;  3CTN A;  1NX2 A;  3E3R A;  1NSH A;  3PN7 B;  4F0Z B;  3BUW B;  1AHR A;  2BEC A;  4YGC B;  2NXQ A;  1KWO B;  2F2P A;  2KI4 C;  2M1K B;  4M2P A;  1M39 A;  1Y1A A;  1QX5 B;  1S5G Z;  1XFV O;  1TOP A;  1UHH A;  5DKR A;  3CS1 A;  1TRF A;  2L2E A;  1KWO C;  1J7Q A;  1RK9 A;  3BUM B;  1UHI A;  3DF0 A;  4MRX A;  2M97 A;  1OMR A;  3BOW B;  3PN7 C;  1KQM C;  1JC2 A;  1TNX A;  4YGD B;  1PSR A;  1WLM A;  1XFX O;  1PVA A;  4A4C A;  2EHB A;  1SPY A;  4GAO A;  4C0K A;  3O78 A;  1EJ3 A;  2RGI A;  3OP0 A;  3A8R A;  2I7A A;  4ORC B;  1R2U A;  2BCX A;  1QIV A;  1ZUZ A;  3JVT B;  5KSZ A;  2L0P A;  1JWD A;  2JXC A;  4XYN A;  3I5F C;  1QLK A;  2ZKM X;  2M29 A;  1JFJ A;  2V53 A;  2PSR A;  2L50 A;  5IBW A;  4YGB B;  5AAN A;  4PE4 A;  3SJS A;  2LMV A;  1LVC D;  4PAL A;  2CXJ A;  2M8U A;  1SW8 A;  1LKJ A;  1IKU A;  4ORA B;  1QVI Z;  2O60 A;  4N1G A;  1B1G A;  1C7V A;  1EG4 A;  1V1G A;  3F45 A;  4PE0 A;  1S5G Y;  1M45 A;  1X02 A;  3FWB A;  1W7J B;  1QVI Y;  3CWG A;  1YTZ C;  1CM4 A;  3PAL A;  1A75 B;  1DJX A;  2WCE A;  3OX6 A;  5PAL A;  2L4H A;  3SIA A;  4YGA A;  1SCV A;  3D10 A;  2WC8 A;  1M63 B;  1DJI A;  2LUX A;  2KBM A;  2Y1M A;  1K9K A;  1L2O B;  4DCK A;  1JUO A;  1N65 A;  3AKB A;  1AK8 A;  2WOR A;  2MHH A;  1KSO A;  5CSN A;  5HLV A;  2MLF C;  1GJY A;  2LMU A;  4GGF A;  4MZJ A;  2PMY A;  4OKH A;  5BPJ A;  1KFX S;  4MSP A;  4YI9 A;  1WRZ A;  1ALW A;  4YRU A;  5I8N A;  3DF0 B;  1SR6 B;  1EXR A;  2LUC A;  1AVS A;  1F71 A;  1SCM B;  1ALV A;  4MN0 A;  1EL4 A;  1C7W A;  2BKI B;  2KAX A;  2LLU A;  2LP3 A;  1W7I B;  4PE1 A;  1TNW A;  3LCP C;  1L7Z A;  2GGZ A;  1CFP A;  1NP8 A;  1PAL A;  1UUR A;  3CZT X;  1KFX L;  1CKK A;  1CFD A;  2KYF A;  4OVN F;  5ER5 A;  4HRH A;  1K8U A;  2CCM A;  3PAT A;  1FBV A;  1OMV A;  1BJF A;  1Y6W A;  1YRU B;  3SG2 A;  4PHK A;  1IJ6 A;  1KFU S;  2OTG B;  4JWQ A;  2G9B A;  3BUX B;  3RLZ A;  2K8M B;  3I5F B;  5FYX A;  2KNE A;  1KK8 C;  3WXA A;  1SYM A;  1TNP A;  2K2A A;  4MZL A;  1WDC B;  1WDC C;  2G2B A;  2LE9 B;  1F55 A;  1J1D A;  2JNF A;  2ZRS A;  1BOC A;  4YBH B;  1K94 A;  1BG1 A;  3LLE A;  1XA5 A;  3BOW A;  1A29 A;  2HET A;  1S6I A;  3QRX A;  4GBA A;  4GNK B;  1KQM B;  5ER4 X;  4N1F A;  1K2H A;  2L51 A;  2F3Y A;  1K96 A;  3IF7 A;  1UHJ A;  3CGA A;  3NXA A;  4YGE B;  5G08 A;  2L5X B;  4QJ5 B;  3EK4 A;  3SIB A;  1R6P A;  3KF9 A;  1WY9 A;  1UWO A;  2KYC A;  2OTG C;  5I2O A;  2KQ6 A;  2BE6 A;  2MA2 A;  3IQQ A;  2TN4 A;  2FCD A;  1XFU O;  1BT6 A;  1GGW A;  1K9U A;  2E6W A;  1DVI A;  1PVB A;  2WND A;  1DJY A;  2AMI A;  4GGF C;  2KI6 D;  1C07 A;  1YUU A;  2JOJ A;  3KPX A;  3FWC A;  4GFT A;  2LVJ A;  1SCM C;  4ICB A;  3BXK A;  3ZWH A;  1MXL C;  4D1E A;  1NX1 A;  2O5G A;  2M7L A;  1SR6 C;  1Q80 A;  2M0R A;  5D7F A;  3CLN A;  1PRW A;  2JT3 A;  3GOF A;  1JF2 A;  3NSL A;  4WQ3 A;  2FOT A;  1ZOT B;  3AAK A;  2ZNE A;  1NWD A;  1S1E A;  2SAS A;  3GK2 A;  1DJZ A;  2MLE C;  4GUK A;  3TS5 B;  2PAL A;  4I5L B;  4XJK B;  2CBL A;  4U8D A;  1WRK A;  2JTZ A;  2JRF A;  4PHN A;  4HSZ A;  1K9P A;  2P6B B;  3I5H C;  1K93 D;  1YUR A;  2NCP A;  4IL1 A;  3BUO B;  3I5I B;  4TNC A;  4HRG A;  2LNK A;  2M7N A;  1S6C A;  3BQ3 A;  4FTG A;  4Q04 A;  2F8P A;  4NDC A;  3EVR A;  4PHJ A;  3PFV A;  2GV5 A;  1TNQ A;  1U5I A;  2BKH B;  1A4P A;  3TUY B;  3SG4 A;  2JT8 A;  2FCE A;  1B8R A;  1S36 A;  4CFR A;  2CNP A;  1Y1U A;  4PHM A;  2KQY A;  3TDZ A;  2COL B;  1DGV A;  1G33 A;  4P2Y B;  1IH0 A;  1UUS A;  2LLS A;  2KFF A;  3OHM B;  2JQ6 A;  2BBM A;  2EC6 B;  2MBX A;  3BYA A;  1KCY A;  2NCO A;  2BL0 C;  2NZ0 A;  2LLT A;  1OZO A;  4NQG A;  3JVT C;  3AKA A;  4MEW A;  1B9A A;  1YVL A;  2BL0 B;  2HQ8 A;  3RM1 A;  4AOM A;  1Y1X A;  2LVK A;  3VRN A;  1GQM A;  2KGR A;  3OX5 A;  1LA0 A;  1K95 A;  1D1O A;  1NX0 A;  2LVV A;  3WNX B;  2WOS A;  1IJ5 A;  1S26 D;  1ZFS A;  3DVJ A;  1ODB A;  3AAJ A;  1PSB A;  2Y5I A;  4L9M A;  4A4B A;  5AER A;  2L4I A;  1E8A A;  1TCF A;  1CDL A;  5JOL A;  1DMO A;  4PDZ A;  3C1V A;  3CR2 A;  4OCI A;  2HQW A;  1QAT A;  1RJV A;  1GGZ A;  3DVE A;  3M0W A;  1F54 A;  2KI4 B;  1UHK A;  1ZMZ A;  1TTX A;  3I5H B;  1BR1 B;  1MHO A;  1MQ1 A;  1NIW A;  2MRD A;  3KEV A;  1FW4 A;  1IQ3 A;  2DOQ A;  1DGU A;  1FI6 A;  4ETO A;  3DVM A;  1SNL A;  2H61 A;  1WRL A;  4USL A;  1B4C A;  2JZI A;  2FJU B;  1CLB A;  1B8C A;  5CSF A;  2JNX A;  2LCP A;  2AUC A;  1HT9 A;  1CB1 A;  1J7O A;  3O6B A;  1IRJ A;  1MUX A;  2NLN A;  2KI6 C;  4I5J A;  5KU1 A;  1UP5 A;  3EKH A;  3GK4 X;  1LXF C;  1CNP A;  1YVH A;  4FQO A;  3CR5 X;  1RRO A;  1HQV A;  1CDN A;  3DVK A;  3GK1 A;  3PM8 A;  2LVI A;  1SMG A;  2BCA A;  3JTD C;  1SK6 D;  2WCB A;  2ZFD A;  1SL9 A;  2PAS A;  2LMT A;  1JFK A;  3EK7 A;  1IWQ A;  1QJT A;  4QJ3 B;  2LV7 A;  1DJH A;  4CID A;  5HYD A;  2CT9 A;  2F3Z A;  3IQO A;  1FI5 A;  1DJG A;  1CLM A;  4P5O E;  1YUT A;  3VRP A;  1CMF A;  2JUL A;  1A75 A;  5J3X A;  4DUQ A;  3ZNI A;  1CFC A;  2E30 A;  2LAN A;  1KK7 Y;  2LC5 A;  2D8N A;  1KK7 Z;  1MXE A;  2HPS A;  1LA3 A;  2KFG A;  1DJW A;  1SBJ A;  2BCB A;  1ZAC A;  5GQQ C;  2H2K A;  2KHN A;  1CDP A;  2BBN A;  1SL8 A;  1OE9 B;  1LIN A;  1PK0 D;  1CDM A;  2JWW A;  2OPO A;  4MVF A;  2VRG A;  4MRY A;  1OSA A;  2L98 A;  3D0Y A;  4PE7 A;  5AEQ A;  2Q4U A;  2A4J A;  4XJK A;  1AP4 A;  1YR5 A;  1OZS A;  1IG5 A;  2KAY A;  4N5X A;  1Y0V H;  2CTN A;  1CMG A;  5K89 A;  3VRR A;  1NYA A;  2H61 C;  4CFQ A;  4DS7 A;  3SG7 A;  3EVU A;  5B8I B;  1BF5 A;  3I5I C;  5F6T A;  5CSI A;  2LM5 A;  1EH2 A;  2M3W A;  1NPQ A;  1CLL A;  3PLF B;  1F4Q A;  1XFY O;  2MAZ A;  5D69 A;  1JBA A;  2LHI A;  3VGO A;  1AUI B;  5AXI A;  2QAC A;  4DRW A;  2KGB C;  4ZCU A;  1JSA A;  2I18 A;  1H4B A;  4UPG A;  1A03 A;  4C0L A;  1CFF A;  5HKW A;  1NCZ A;  4NDB A;  1QLS A;  2K7O A;  4M2O A;  1DF0 B;  3NSK A;  3TZ1 A;  4DIR A;  1YX7 A;  3LK1 A;  4C0J A;  5JJG A;  1QAS A;  2JC2 A;  4HRE E;  1F4O A;  3WHT B;  2KFH A;  4AQI A;  3A4U B;  1XVJ A;  1AJ5 A;  1DTL A;  2JTT A;  3JTD B;  1BU3 A;  1RWY A;  2OS8 B;  1YUS A;  2M1U A;  5HKZ A;  1QX2 A;  2MJW B;  2OS8 C; 
#chains in the Genus database with same CATH topology
 1B47 A;  1NX3 A;  2ERB A;  3WHU B;  5KTY A;  1S3P A;  3O4Y A;  3DD4 A;  1V1F A;  2SCP A;  4MLW A;  3K21 A;  1M31 A;  5I2Q A;  1XFW O;  2I2R E;  4QJ4 B;  1G4Y R;  1J7R A;  3EKJ A;  1SY9 A;  5DKN A;  1CTR A;  1J7P A;  3SG3 A;  1SRA A;  2LP2 A;  1MWN A;  3D0Y B;  2PRU A;  3BUN B;  3L47 A;  4MBE A;  5DKQ A;  3HCM A;  3TDU A;  4BY4 A;  4YI8 A;  1F8H A;  1FF1 A;  1IGV A;  2GGM A;  3D78 A;  4ZCV A;  1RFJ A;  3KO0 A;  2KDH A;  2K7D A;  1KK8 B;  1YX8 A;  1N2D A;  1OMD A;  2HF5 A;  3ICB A;  3S0D A;  4F7F A;  5HKY A;  1SSE B;  5I2L A;  1RTP 1;  4E68 A;  5TNC A;  1KFU L;  3UNW A;  2ZND A;  1JF0 A;  1A2X A;  1J1E A;  1FPW A;  1QS7 A;  1QV1 A;  3FS7 A;  1UHN A;  1QTX A;  1BMO A;  3PJI A;  2JU0 A;  2LHL A;  3OB2 B;  4OR9 B;  5CSJ A;  4I5N B;  4CLN A;  2K61 A;  1DT7 B;  1QXP A;  1B7T Z;  2JPT A;  3NSI A;  2PVB A;  1Z4H A;  2QEB A;  3OB1 B;  4FQT A;  4PCW A;  1BR4 B;  3VB1 A;  1CM1 A;  1MR8 A;  1B8L A;  3PM2 A;  3S0G A;  1PUL A;  1QV0 A;  3O4X A;  1OQP A;  2ZN8 A;  4ORB B;  3NSO A;  3IVT A;  3TDI A;  2F33 A;  2M9G A;  3I5G B;  3FIA A;  3N7H A;  5HLO A;  4NDD A;  1J55 A;  3CR4 X;  5I94 A;  1NUB A;  1TCO B;  2KSP A;  2QPT A;  2F2O A;  1GM0 A;  2M49 B;  2BE4 A;  4GPL B;  4JPZ B;  3LL8 B;  1BOD A;  1XYD A;  2EC6 C;  2P70 A;  1N0Y A;  1XO5 A;  1NCY A;  1NCX A;  1YRT B;  5AFP A;  1L2O C;  1MF8 B;  1QIW A;  4OV2 A;  2ZN9 A;  3KHE A;  3FE6 A;  1OOJ A;  2B1U A;  3VRQ A;  1F70 A;  2I94 A;  2PQL A;  3EVV A;  1B7T Y;  3H4S E;  3TUY C;  1AJ4 A;  1C3Y A;  2Y1N A;  2R2I A;  1TIZ A;  1QX7 A;  1H8B A;  2K7C A;  3HX4 A;  1EG3 A;  1TN4 A;  4MZK A;  4M2Q A;  3O2P A;  1REC A;  3SG5 A;  2EGD A;  4AQJ A;  1IQ5 A;  1XFZ O;  1XK4 A;  1DF0 A;  2LAP A;  1SL7 A;  1XK4 C;  4BY5 A;  4GGN A;  4R1E A;  1G8I A;  1KSM A;  1M46 A;  2Q91 A;  2KBI A;  2WCH A;  1SKT A;  2L5Y A;  3TS5 C;  3VRO A;  2K7B A;  2K2F A;  2AAO A;  4CPV A;  1IIO A;  2IS9 A;  2ISD A;  3MSE B;  2K0J A;  2WCF A;  3LK0 A;  1VRK A;  1WLZ A;  3PSR A;  2ZRT A;  3OGN A;  4JQ0 D;  2WC6 A;  5CPV A;  1KQV A;  2KAV A;  3EK8 A;  2KOT A;  3I5G C;  2Y4Q A;  1BLQ A;  2JT0 A;  4WRI A;  4WQ2 A;  3SS3 A;  2JXL A;  4I5K A;  1K90 D;  1S6J A;  3SG6 A;  1U5I B;  2KLD A;  1NX2 A;  1LS8 A;  1NSH A;  3CTN A;  3E3R A;  3PN7 B;  3BUW B;  1AHR A;  4F0Z B;  2BEC A;  4YGC B;  2NXQ A;  1KWO B;  2F2P A;  2KI4 C;  2M1K B;  2L2C A;  1M39 A;  1Y1A A;  4INX A;  4M2P A;  1QX5 B;  1S5G Z;  1XFV O;  1TOP A;  1UHH A;  5DKR A;  3CS1 A;  1ORG A;  1TRF A;  2L2E A;  2QEV A;  1KWO C;  1J7Q A;  1RK9 A;  3BUM B;  1UHI A;  3DF0 A;  4MRX A;  2M97 A;  1OMR A;  3BOW B;  3PN7 C;  1KQM C;  3B7A A;  1JC2 A;  1TNX A;  4YGD B;  1PSR A;  1WLM A;  3QME A;  1XFX O;  1PVA A;  4A4C A;  2EHB A;  1SPY A;  4GAO A;  4C0K A;  3O78 A;  1EJ3 A;  2RGI A;  4JKT A;  3OP0 A;  3A8R A;  2I7A A;  4ORC B;  1DQE A;  1R2U A;  2BCX A;  1QIV A;  1ZUZ A;  3JVT B;  5KSZ A;  2L0P A;  1JWD A;  2JXC A;  4XYN A;  3I5F C;  1QLK A;  2K60 A;  2ZKM X;  2WC5 A;  2M29 A;  1JFJ A;  2V53 A;  2PSR A;  2L50 A;  3CDN A;  5IBW A;  4YGB B;  5AAN A;  4PE4 A;  3SJS A;  2LMV A;  1LVC D;  5FI6 A;  4PAL A;  2CXJ A;  1OW4 A;  4OZD A;  2M8U A;  1SW8 A;  1LKJ A;  1IKU A;  4ORA B;  1QVI Z;  2O60 A;  2YGU A;  1DEK A;  4N1G A;  3S0A A;  1B1G A;  1C7V A;  1EG4 A;  1V1G A;  3F45 A;  4PE0 A;  1S5G Y;  1M45 A;  1X02 A;  3FWB A;  1W7J B;  1QVI Y;  3CWG A;  1YTZ C;  3DZT A;  1CM4 A;  1P28 A;  3PAL A;  1A75 B;  2BNX A;  1DJX A;  2WCE A;  3OX6 A;  5PAL A;  1DC1 A;  2L4H A;  3SIA A;  4YGA A;  1SCV A;  3D10 A;  1W9Z A;  3R1P A;  2WC8 A;  1M63 B;  1DJI A;  2LUX A;  2KBM A;  2Y1M A;  1K9K A;  1L2O B;  3CZ0 A;  4DCK A;  1C3Z A;  1JUO A;  1N65 A;  3AKB A;  1AK8 A;  2WCL A;  2WOR A;  2MHH A;  1KSO A;  1DEL A;  5CSN A;  2MLF C;  5HLV A;  1GJY A;  2LMU A;  4GGF A;  4MZJ A;  2PMY A;  4OKH A;  5BPJ A;  1KFX S;  4MSP A;  4YI9 A;  1WRZ A;  1ALW A;  4YRU A;  5I8N A;  3DF0 B;  1SR6 B;  1EXR A;  2LUC A;  3D74 A;  2QEO A;  5ER4 X;  1AVS A;  3L4A A;  1F71 A;  1OOI X;  1SCM B;  1OOH A;  1ALV A;  4MN0 A;  1EL4 A;  5EL2 A;  3B6X A;  1C7W A;  2BKI B;  2KAX A;  2LLU A;  2LP3 A;  1W7I B;  4PE1 A;  1TNW A;  3EG5 B;  3LCP C;  1L7Z A;  2GGZ A;  1CFP A;  1NP8 A;  1PAL A;  1UUR A;  3NHI A;  3CZT X;  1KFX L;  2WCJ A;  1CKK A;  1CFD A;  2KYF A;  4OVN F;  5ER5 A;  4HRH A;  1K8U A;  2CCM A;  3PAT A;  1FBV A;  1OMV A;  1BJF A;  1Y6W A;  1Z2C B;  3FE8 A;  3BFA A;  3CZ1 A;  1YRU B;  3SG2 A;  4PHK A;  1IJ6 A;  1KFU S;  2OTG B;  4JWQ A;  2G9B A;  3BUX B;  3RLZ A;  2K8M B;  3I5F B;  5FYX A;  2KNE A;  1KK8 C;  3WXA A;  1SYM A;  1TNP A;  2K2A A;  4MZL A;  1WDC B;  1WDC C;  2G2B A;  2LE9 B;  1F55 A;  1J1D A;  2JNF A;  2ZRS A;  1OOG A;  3B86 A;  3V2L A;  1BOC A;  4YBH B;  1K94 A;  1BG1 A;  3DY9 A;  3LLE A;  1XA5 A;  3BOW A;  1A29 A;  2HET A;  1S6I A;  3QRX A;  4GBA A;  3R1V A;  1KQM B;  4GNK B;  4N1F A;  1K2H A;  2QDI A;  3UO9 A;  2L51 A;  2F3Y A;  1K96 A;  1OOF A;  3IF7 A;  1UHJ A;  3CGA A;  3NXA A;  4YGE B;  5G08 A;  3D73 A;  3D75 A;  2L5X B;  4QJ5 B;  3EK4 A;  3SIB A;  1R6P A;  3KF9 A;  1WY9 A;  1UWO A;  2KYC A;  2OTG C;  5I2O A;  2KQ6 A;  2BE6 A;  2MA2 A;  3IQQ A;  2TN4 A;  2FCD A;  1XFU O;  1BT6 A;  1GGW A;  1K9U A;  2E6W A;  1DVI A;  1PVB A;  2WND A;  1DJY A;  2AMI A;  4GGF C;  2KI6 D;  2JPO A;  1C07 A;  1YUU A;  2JOJ A;  3KPX A;  3FWC A;  3NHT A;  2LVJ A;  1SCM C;  4GFT A;  3BXK A;  4ICB A;  1MXL C;  3ZWH A;  4D1E A;  1NX1 A;  2O5G A;  2M7L A;  1SR6 C;  1Q80 A;  2M0R A;  5D7F A;  3CLN A;  2PYQ A;  1PRW A;  2JT3 A;  3GOF A;  1JF2 A;  3NSL A;  4WQ3 A;  2FOT A;  1ZOT B;  3AAK A;  2ZNE A;  1NWD A;  1S1E A;  2SAS A;  3GK2 A;  1DJZ A;  2MLE C;  4GUK A;  3TS5 B;  2PAL A;  4I5L B;  4XJK B;  2CBL A;  4U8D A;  1WRK A;  2JTZ A;  2JRF A;  4PHN A;  4HSZ A;  1K9P A;  2P6B B;  3I5H C;  1K93 D;  1YUR A;  2NCP A;  4IL1 A;  3BUO B;  2P71 A;  3I5I B;  4TNC A;  4HRG A;  2LNK A;  2M7N A;  2WCK A;  5FI7 A;  1S6C A;  3BQ3 A;  4FTG A;  4Q04 A;  2F8P A;  4NDC A;  3EVR A;  4PHJ A;  3PFV A;  2GV5 A;  1TNQ A;  1U5I A;  2BKH B;  1A4P A;  3D76 A;  3TUY B;  5HL1 A;  3SG4 A;  2JT8 A;  2FCE A;  1B8R A;  1S36 A;  4CFR A;  2CNP A;  3RZS A;  1Y1U A;  2GTE A;  4PHM A;  2KQY A;  3TDZ A;  2COL B;  1DGV A;  1G33 A;  4P2Y B;  1IH0 A;  1UUS A;  2LLS A;  3BFB A;  2KFF A;  3OHM B;  2JQ6 A;  2BBM A;  2EC6 B;  2MBX A;  2H8V A;  3BYA A;  2NCO A;  3DXL A;  2BL0 C;  1KCY A;  2NZ0 A;  2LLT A;  2WCM A;  1OZO A;  4NQG A;  4INW A;  3JVT C;  3AKA A;  3CAB A;  4MEW A;  1B9A A;  1YVL A;  3NGV A;  2BL0 B;  2HQ8 A;  3RM1 A;  4AOM A;  1Y1X A;  2LVK A;  3VRN A;  1TUJ A;  1GQM A;  2KGR A;  3OX5 A;  1LA0 A;  1K95 A;  2BAP A;  1D1O A;  1NX0 A;  2LVV A;  3WNX B;  2WOS A;  1IJ5 A;  1S26 D;  1ZFS A;  3DVJ A;  1ODB A;  3AAJ A;  1PSB A;  2Y5I A;  4L9M A;  4A4B A;  5AER A;  2L4I A;  1E8A A;  1TCF A;  1CDL A;  5JOL A;  1DMO A;  4PDZ A;  5DIC A;  3C1V A;  3CR2 A;  4OCI A;  2HQW A;  1QAT A;  1RJV A;  1GGZ A;  1T14 A;  3DVE A;  3M0W A;  2KI4 B;  1QWV A;  1UHK A;  1ZMZ A;  1F54 A;  1TTX A;  3I5H B;  1BR1 B;  1MHO A;  1MQ1 A;  1NIW A;  3CYZ A;  3Q8I A;  2MRD A;  3KEV A;  1FW4 A;  5D3O A;  1IQ3 A;  2DOQ A;  2QEH A;  1DGU A;  1FI6 A;  3L4L A;  4ETO A;  3DVM A;  1SNL A;  2H61 A;  1WRL A;  4USL A;  1B4C A;  2JZI A;  2FJU B;  1CLB A;  1B8C A;  5CSF A;  2JNX A;  2LCP A;  2KPH A;  2AUC A;  1HT9 A;  1CB1 A;  1J7O A;  3O6B A;  1IRJ A;  1MUX A;  2NLN A;  2KI6 C;  4I5J A;  5KU1 A;  1UP5 A;  3EKH A;  3GK4 X;  1LXF C;  1CNP A;  1YVH A;  4FQO A;  3CR5 X;  1RRO A;  1HQV A;  1CDN A;  3DVK A;  3GK1 A;  3PM8 A;  2LVI A;  1SMG A;  2BCA A;  3JTD C;  1SK6 D;  2WCB A;  2ZFD A;  1SL9 A;  2PAS A;  4JD9 A;  2LMT A;  1JFK A;  3EK7 A;  1IWQ A;  1QJT A;  4QJ3 B;  2LV7 A;  1DJH A;  4CID A;  5HYD A;  2CT9 A;  2F3Z A;  2FJY A;  3IQO A;  1FI5 A;  1DJG A;  1CLM A;  4P5O E;  1YUT A;  3VRP A;  1CMF A;  2JUL A;  1A75 A;  5J3X A;  4DUQ A;  3ZNI A;  1CFC A;  3S0F A;  2E30 A;  2LAN A;  1KK7 Y;  2LC5 A;  2D8N A;  1KK7 Z;  1MXE A;  2HPS A;  1LA3 A;  2KFG A;  3S0B A;  1DJW A;  1SBJ A;  2BCB A;  1ZAC A;  5GQQ C;  2H2K A;  3SS5 A;  2KHN A;  1CDP A;  2BBN A;  1SL8 A;  3BFH A;  1OE9 B;  5FI2 A;  1LIN A;  1PK0 D;  1CDM A;  2JWW A;  1TWO A;  2OPO A;  4MVF A;  4IJ7 A;  2VRG A;  4MRY A;  1OSA A;  1XFR A;  2L98 A;  3B88 A;  3D0Y A;  4PE7 A;  5AEQ A;  2Q4U A;  2A4J A;  4XJK A;  1AP4 A;  1YR5 A;  1OZS A;  1IG5 A;  3R72 A;  2KAY A;  4N5X A;  3OBV A;  1Y0V H;  2CTN A;  1CMG A;  5K89 A;  3VRR A;  1NYA A;  2H61 C;  4CFQ A;  4DS7 A;  3SG7 A;  3EVU A;  4PT1 A;  5B8I B;  3I5I C;  1BF5 A;  5F6T A;  5CSI A;  2LM5 A;  1EH2 A;  2M3W A;  1NPQ A;  1CLL A;  3FE9 A;  3PLF B;  1F4Q A;  1XFY O;  2MAZ A;  5D69 A;  1JBA A;  2LHI A;  3VGO A;  1AUI B;  5AXI A;  2QAC A;  4DRW A;  2KGB C;  4ZCU A;  1JSA A;  2I18 A;  1H4B A;  3SS4 A;  4UPG A;  1A03 A;  4C0L A;  1CFF A;  4KYN A;  5HKW A;  2KLE A;  1NCZ A;  4NDB A;  1QLS A;  2K7O A;  4M2O A;  1DF0 B;  3NSK A;  3TZ1 A;  4DIR A;  1YX7 A;  3LK1 A;  4C0J A;  5JJG A;  1QAS A;  2JC2 A;  1TUZ A;  4HRE E;  1F4O A;  3WHT B;  3BJH A;  2KFH A;  3B87 A;  3K1E A;  4AQI A;  3A4U B;  1XVJ A;  1AJ5 A;  1DTL A;  2JTT A;  3CZ2 A;  3D77 A;  3JTD B;  1BU3 A;  1RWY A;  2OS8 B;  3S0E A;  1YUS A;  2M1U A;  3R1O A;  5HKZ A;  1QX2 A;  2MJW B;  3DYE A;  2OS8 C; 
#chains in the Genus database with same CATH homology
 1B47 A;  1NX3 A;  3WHU B;  5KTY A;  1S3P A;  3O4Y A;  3DD4 A;  1V1F A;  2SCP A;  4MLW A;  3K21 A;  1M31 A;  5I2Q A;  1XFW O;  2I2R E;  4QJ4 B;  1G4Y R;  1J7R A;  3EKJ A;  1SY9 A;  5DKN A;  1CTR A;  1J7P A;  3SG3 A;  1SRA A;  2LP2 A;  1MWN A;  3D0Y B;  2PRU A;  3BUN B;  4MBE A;  5DKQ A;  3HCM A;  3TDU A;  4BY4 A;  4YI8 A;  1F8H A;  1FF1 A;  1IGV A;  2GGM A;  4ZCV A;  1RFJ A;  3KO0 A;  2KDH A;  2K7D A;  1KK8 B;  1YX8 A;  1N2D A;  1OMD A;  2HF5 A;  3ICB A;  5HKY A;  5I2L A;  1RTP 1;  4E68 A;  5TNC A;  1KFU L;  2ZND A;  1JF0 A;  1A2X A;  1J1E A;  1FPW A;  1QS7 A;  1QV1 A;  3FS7 A;  1UHN A;  1QTX A;  1BMO A;  2JU0 A;  2LHL A;  3OB2 B;  4OR9 B;  5CSJ A;  4I5N B;  4CLN A;  2K61 A;  1DT7 B;  1QXP A;  1B7T Z;  2JPT A;  3NSI A;  2PVB A;  3OB1 B;  4PCW A;  1BR4 B;  1CM1 A;  1MR8 A;  1B8L A;  1PUL A;  1QV0 A;  1OQP A;  2ZN8 A;  4ORB B;  3NSO A;  3TDI A;  2F33 A;  2M9G A;  3I5G B;  3FIA A;  5HLO A;  4NDD A;  1J55 A;  3CR4 X;  1NUB A;  1TCO B;  2KSP A;  2QPT A;  2F2O A;  2M49 B;  2BE4 A;  4GPL B;  4JPZ B;  3LL8 B;  1BOD A;  1XYD A;  2EC6 C;  1N0Y A;  1XO5 A;  1NCY A;  1NCX A;  1YRT B;  5AFP A;  1L2O C;  1MF8 B;  1QIW A;  4OV2 A;  2ZN9 A;  3KHE A;  1OOJ A;  2B1U A;  3VRQ A;  1F70 A;  2I94 A;  3EVV A;  3H4S E;  1B7T Y;  3TUY C;  1AJ4 A;  2Y1N A;  2R2I A;  1TIZ A;  1QX7 A;  1H8B A;  2K7C A;  3HX4 A;  1EG3 A;  1TN4 A;  4MZK A;  4M2Q A;  3O2P A;  1REC A;  3SG5 A;  2EGD A;  4AQJ A;  1IQ5 A;  1XFZ O;  1XK4 A;  1DF0 A;  2LAP A;  1SL7 A;  1XK4 C;  4BY5 A;  4GGN A;  4R1E A;  1G8I A;  1KSM A;  1M46 A;  2Q91 A;  2KBI A;  1SKT A;  3TS5 C;  3VRO A;  2K7B A;  2K2F A;  2AAO A;  4CPV A;  2IS9 A;  2ISD A;  3MSE B;  2K0J A;  2WCF A;  3LK0 A;  1VRK A;  1WLZ A;  3PSR A;  2ZRT A;  4JQ0 D;  5CPV A;  1KQV A;  2KAV A;  3EK8 A;  2KOT A;  3I5G C;  2Y4Q A;  1BLQ A;  2JT0 A;  4WRI A;  4WQ2 A;  2JXL A;  4I5K A;  1K90 D;  1S6J A;  3SG6 A;  1U5I B;  3CTN A;  1NX2 A;  3E3R A;  1NSH A;  3PN7 B;  4F0Z B;  3BUW B;  1AHR A;  2BEC A;  4YGC B;  2NXQ A;  1KWO B;  2F2P A;  2KI4 C;  2M1K B;  4M2P A;  1M39 A;  1Y1A A;  1QX5 B;  1S5G Z;  1XFV O;  1TOP A;  1UHH A;  5DKR A;  3CS1 A;  1TRF A;  2L2E A;  1KWO C;  1J7Q A;  1RK9 A;  3BUM B;  1UHI A;  3DF0 A;  4MRX A;  2M97 A;  1OMR A;  3BOW B;  3PN7 C;  1KQM C;  1JC2 A;  1TNX A;  4YGD B;  1PSR A;  1WLM A;  1XFX O;  1PVA A;  4A4C A;  2EHB A;  1SPY A;  4GAO A;  4C0K A;  3O78 A;  1EJ3 A;  2RGI A;  3OP0 A;  3A8R A;  2I7A A;  4ORC B;  1R2U A;  2BCX A;  1QIV A;  1ZUZ A;  3JVT B;  5KSZ A;  2L0P A;  1JWD A;  2JXC A;  4XYN A;  3I5F C;  1QLK A;  2ZKM X;  2M29 A;  1JFJ A;  2V53 A;  2PSR A;  2L50 A;  5IBW A;  4YGB B;  5AAN A;  4PE4 A;  3SJS A;  2LMV A;  1LVC D;  4PAL A;  2CXJ A;  2M8U A;  1SW8 A;  1LKJ A;  1IKU A;  4ORA B;  1QVI Z;  2O60 A;  4N1G A;  1B1G A;  1C7V A;  1EG4 A;  1V1G A;  3F45 A;  4PE0 A;  1S5G Y;  1M45 A;  1X02 A;  3FWB A;  1W7J B;  1QVI Y;  3CWG A;  1YTZ C;  1CM4 A;  3PAL A;  1A75 B;  1DJX A;  2WCE A;  3OX6 A;  5PAL A;  2L4H A;  3SIA A;  4YGA A;  1SCV A;  3D10 A;  2WC8 A;  1M63 B;  1DJI A;  2LUX A;  2KBM A;  2Y1M A;  1K9K A;  1L2O B;  4DCK A;  1JUO A;  1N65 A;  3AKB A;  1AK8 A;  2WOR A;  2MHH A;  1KSO A;  5CSN A;  5HLV A;  2MLF C;  1GJY A;  2LMU A;  4GGF A;  4MZJ A;  2PMY A;  4OKH A;  5BPJ A;  1KFX S;  4MSP A;  4YI9 A;  1WRZ A;  1ALW A;  4YRU A;  5I8N A;  3DF0 B;  1SR6 B;  1EXR A;  2LUC A;  1AVS A;  1F71 A;  1SCM B;  1ALV A;  4MN0 A;  1EL4 A;  1C7W A;  2BKI B;  2KAX A;  2LLU A;  2LP3 A;  1W7I B;  4PE1 A;  1TNW A;  3LCP C;  1L7Z A;  2GGZ A;  1CFP A;  1NP8 A;  1PAL A;  1UUR A;  3CZT X;  1KFX L;  1CKK A;  1CFD A;  2KYF A;  4OVN F;  5ER5 A;  4HRH A;  1K8U A;  2CCM A;  3PAT A;  1FBV A;  1OMV A;  1BJF A;  1Y6W A;  1YRU B;  3SG2 A;  4PHK A;  1IJ6 A;  1KFU S;  2OTG B;  4JWQ A;  2G9B A;  3BUX B;  3RLZ A;  2K8M B;  3I5F B;  5FYX A;  2KNE A;  1KK8 C;  3WXA A;  1SYM A;  1TNP A;  2K2A A;  4MZL A;  1WDC B;  1WDC C;  2G2B A;  2LE9 B;  1F55 A;  1J1D A;  2JNF A;  2ZRS A;  1BOC A;  4YBH B;  1K94 A;  1BG1 A;  3LLE A;  1XA5 A;  3BOW A;  1A29 A;  2HET A;  1S6I A;  3QRX A;  4GBA A;  4GNK B;  1KQM B;  5ER4 X;  4N1F A;  1K2H A;  2L51 A;  2F3Y A;  1K96 A;  3IF7 A;  1UHJ A;  3CGA A;  3NXA A;  4YGE B;  5G08 A;  2L5X B;  4QJ5 B;  3EK4 A;  3SIB A;  1R6P A;  3KF9 A;  1WY9 A;  1UWO A;  2KYC A;  2OTG C;  5I2O A;  2KQ6 A;  2BE6 A;  2MA2 A;  3IQQ A;  2TN4 A;  2FCD A;  1XFU O;  1BT6 A;  1GGW A;  1K9U A;  2E6W A;  1DVI A;  1PVB A;  2WND A;  1DJY A;  2AMI A;  4GGF C;  2KI6 D;  1C07 A;  1YUU A;  2JOJ A;  3KPX A;  3FWC A;  4GFT A;  2LVJ A;  1SCM C;  4ICB A;  3BXK A;  3ZWH A;  1MXL C;  4D1E A;  1NX1 A;  2O5G A;  2M7L A;  1SR6 C;  1Q80 A;  2M0R A;  5D7F A;  3CLN A;  1PRW A;  2JT3 A;  3GOF A;  1JF2 A;  3NSL A;  4WQ3 A;  2FOT A;  1ZOT B;  3AAK A;  2ZNE A;  1NWD A;  1S1E A;  2SAS A;  3GK2 A;  1DJZ A;  2MLE C;  4GUK A;  3TS5 B;  2PAL A;  4I5L B;  4XJK B;  2CBL A;  4U8D A;  1WRK A;  2JTZ A;  2JRF A;  4PHN A;  4HSZ A;  1K9P A;  2P6B B;  3I5H C;  1K93 D;  1YUR A;  2NCP A;  4IL1 A;  3BUO B;  3I5I B;  4TNC A;  4HRG A;  2LNK A;  2M7N A;  1S6C A;  3BQ3 A;  4FTG A;  4Q04 A;  2F8P A;  4NDC A;  3EVR A;  4PHJ A;  3PFV A;  2GV5 A;  1TNQ A;  1U5I A;  2BKH B;  1A4P A;  3TUY B;  3SG4 A;  2JT8 A;  2FCE A;  1B8R A;  1S36 A;  4CFR A;  2CNP A;  1Y1U A;  4PHM A;  2KQY A;  3TDZ A;  2COL B;  1DGV A;  1G33 A;  4P2Y B;  1IH0 A;  1UUS A;  2LLS A;  2KFF A;  3OHM B;  2JQ6 A;  2BBM A;  2EC6 B;  2MBX A;  3BYA A;  1KCY A;  2NCO A;  2BL0 C;  2NZ0 A;  2LLT A;  1OZO A;  4NQG A;  3JVT C;  3AKA A;  4MEW A;  1B9A A;  1YVL A;  2BL0 B;  2HQ8 A;  3RM1 A;  4AOM A;  1Y1X A;  2LVK A;  3VRN A;  1GQM A;  2KGR A;  3OX5 A;  1LA0 A;  1K95 A;  1D1O A;  1NX0 A;  2LVV A;  3WNX B;  2WOS A;  1IJ5 A;  1S26 D;  1ZFS A;  3DVJ A;  1ODB A;  3AAJ A;  1PSB A;  2Y5I A;  4L9M A;  4A4B A;  5AER A;  2L4I A;  1E8A A;  1TCF A;  1CDL A;  5JOL A;  1DMO A;  4PDZ A;  3C1V A;  3CR2 A;  4OCI A;  2HQW A;  1QAT A;  1RJV A;  1GGZ A;  3DVE A;  3M0W A;  1F54 A;  2KI4 B;  1UHK A;  1ZMZ A;  1TTX A;  3I5H B;  1BR1 B;  1MHO A;  1MQ1 A;  1NIW A;  2MRD A;  3KEV A;  1FW4 A;  1IQ3 A;  2DOQ A;  1DGU A;  1FI6 A;  4ETO A;  3DVM A;  1SNL A;  2H61 A;  1WRL A;  4USL A;  1B4C A;  2JZI A;  2FJU B;  1CLB A;  1B8C A;  5CSF A;  2JNX A;  2LCP A;  2AUC A;  1HT9 A;  1CB1 A;  1J7O A;  3O6B A;  1IRJ A;  1MUX A;  2NLN A;  2KI6 C;  4I5J A;  5KU1 A;  1UP5 A;  3EKH A;  3GK4 X;  1LXF C;  1CNP A;  1YVH A;  4FQO A;  3CR5 X;  1RRO A;  1HQV A;  1CDN A;  3DVK A;  3GK1 A;  3PM8 A;  2LVI A;  1SMG A;  2BCA A;  3JTD C;  1SK6 D;  2WCB A;  2ZFD A;  1SL9 A;  2PAS A;  2LMT A;  1JFK A;  3EK7 A;  1IWQ A;  1QJT A;  4QJ3 B;  2LV7 A;  1DJH A;  4CID A;  5HYD A;  2CT9 A;  2F3Z A;  3IQO A;  1FI5 A;  1DJG A;  1CLM A;  4P5O E;  1YUT A;  3VRP A;  1CMF A;  2JUL A;  1A75 A;  5J3X A;  4DUQ A;  3ZNI A;  1CFC A;  2E30 A;  2LAN A;  1KK7 Y;  2LC5 A;  2D8N A;  1KK7 Z;  1MXE A;  2HPS A;  1LA3 A;  2KFG A;  1DJW A;  1SBJ A;  2BCB A;  1ZAC A;  5GQQ C;  2H2K A;  2KHN A;  1CDP A;  2BBN A;  1SL8 A;  1OE9 B;  1LIN A;  1PK0 D;  1CDM A;  2JWW A;  2OPO A;  4MVF A;  2VRG A;  4MRY A;  1OSA A;  2L98 A;  3D0Y A;  4PE7 A;  5AEQ A;  2Q4U A;  2A4J A;  4XJK A;  1AP4 A;  1YR5 A;  1OZS A;  1IG5 A;  2KAY A;  4N5X A;  1Y0V H;  2CTN A;  1CMG A;  5K89 A;  3VRR A;  1NYA A;  2H61 C;  4CFQ A;  4DS7 A;  3SG7 A;  3EVU A;  5B8I B;  1BF5 A;  3I5I C;  5F6T A;  5CSI A;  2LM5 A;  1EH2 A;  2M3W A;  1NPQ A;  1CLL A;  3PLF B;  1F4Q A;  1XFY O;  2MAZ A;  5D69 A;  1JBA A;  2LHI A;  3VGO A;  1AUI B;  5AXI A;  2QAC A;  4DRW A;  2KGB C;  4ZCU A;  1JSA A;  2I18 A;  1H4B A;  4UPG A;  1A03 A;  4C0L A;  1CFF A;  5HKW A;  1NCZ A;  4NDB A;  1QLS A;  2K7O A;  4M2O A;  1DF0 B;  3NSK A;  3TZ1 A;  4DIR A;  1YX7 A;  3LK1 A;  4C0J A;  5JJG A;  1QAS A;  2JC2 A;  4HRE E;  1F4O A;  3WHT B;  2KFH A;  4AQI A;  3A4U B;  1XVJ A;  1AJ5 A;  1DTL A;  2JTT A;  3JTD B;  1BU3 A;  1RWY A;  2OS8 B;  1YUS A;  2M1U A;  5HKZ A;  1QX2 A;  2MJW B;  2OS8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...