1WLZA

Crystal structure of djbp fragment which was obtained by limited proteolysis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
85
structure length
85
Chain Sequence
b'HMATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAP-binding protein complex interacting protein 1 isoform a
publication title Crystal Structure of DJBP Fragment which was obtained by Limited Proteolysis
rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 30
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08976 EF-hand_11 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wlzA01
1TCFA 1UHIA 1K94A 4F0ZB 1SCMC 2JTZA 4YGAA 3EKHA 3JTDC 2FCDA 4CFQA 3KHEA 1PVBA 2PMYA 1ZOTB 3IF7A 1PSRA 2LHIA 4BY4A 4JWQA 1J7QA 1QX7A 2KAXA 3BUMB 2PSRA 2G2BA 4MRXA 2LANA 3SG4A 1MXLC 3CGAA 3D0YB 1F55A 1SBJA 1WRLA 1CFDA 3RM1A 1J7RA 1IWQA 2PVBA 1L2OC 1S3PA 3FWBA 1DT7B 2OTGB 2K7CA 2M3WA 3NSOA 3DF0A 2I7AA 5AXIA 1RFJA 1MR8A 2JNFA 1UUSA 1M39A 1CDPA 2LLUA 4PHJA 1CDMA 2WCEA 1B9AA 3DVJA 1F4QA 1U5IB 2K7OA 2WCBA 3PLFB 4MBEA 1LKJA 3OHMB 1TTXA 3CR5X 2LVVA 1B8RA 2CXJA 1M63B 4XJKB 1UHHA 1RWYA 1MF8B 3WNXB 4OVNF 1RTP1 2BCBA 4MRYA 1K2HA 3IQQA 1J1DA 3JVTC 1UP5A 5CSJA 1M31A 2FCEA 2JPTA 3TDZA 2WOSA 1QXPA 4Q04A 4C0LA 1S5GZ 1KFXS 2K7DA 2M1KB 2E30A 2LMVA 2JQ6A 1SYMA 4XJKA 3WXAA 4MLWA 1KK7Z 3H4SE 3PATA 1TNQA 1WY9A 4PE4A 1PRWA 1BLQA 1BMOA 4GPLB 4N1FA 1SY9A 3LL8B 3TDUA 1TIZA 2A4JA 2MAZA 1M46A 1KFUS 5HKYA 4MN0A 4DIRA 2BE6A 1BR4B 1ZACA 3MSEB 1QV0A 1B8LA 2JTTA 1QASA 4QJ3B 2MBXA 4ORCB 5D7FA 3SIBA 4JQ0D 3CWGA 3O6BA 2VRGA 1KWOB 3VRNA 1TRFA 2O60A 2WCFA 1CFFA 1KQMB 1KK8C 1JSAA 3LK1A 2DOQA 1NX3A 2KI6D 1IQ5A 2KFGA 1YX7A 1WDCC 1G4YR 2L0PA 2K8MB 1DJYA 2WNDA 1ZUZA 5AERA 2JOJA 4YI8A 1IH0A 1MWNA 4AQJA 1BR1B 2I18A 2COLB 1L7ZA 2LHLA 1K9UA 1CLMA 1WLMA 3AKBA 5CSIA 5AFPA 1CMFA 1XK4A 3NXAA 1QX2A 1OZOA 1VRKA 1YURA 2LUXA 2KBMA 2PALA 3D10A 4P5OE 5FYXA 1SCVA 1CFCA 1DGVA 4YGBB 2LVIA 2Q91A 2E6WA 1AJ4A 2HETA 1Q80A 2ZKMX 2H61A 2JC2A 2GGZA 1AHRA 2Y5IA 1QLKA 3I5FB 3TZ1A 5KU1A 1S6CA 5DKNA 2KSPA 1E8AA 2LP3A 1Y6WA 1N65A 2JT3A 5PALA 2OTGC 5GQQC 4JPZB 1XFWO 3IQOA 4TNCA 3BUXB 2JT8A 1J7PA 2K61A 1LXFC 5HKWA 2BBNA 2ZRTA 3OX5A 1JBAA 1YRUB 1NP8A 4WRIA 1DGUA 1RJVA 3EK7A 1CKKA 1QVIZ 1OMRA 2CBLA 4PHMA 1AUIB 4R1EA 1XVJA 1XFUO 1CM4A 1DJWA 4M2PA 2JXLA 1XA5A 1TNXA 1S1EA 4DS7A 2WC8A 1IGVA 4N1GA 1AK8A 1NCYA 3EVRA 4FTGA 1F54A 1IJ5A 1KCYA 5JJGA 1DJHA 4A4BA 1R6PA 1TN4A 2JZIA 2M49B 2EC6C 4GNKB 4MZKA 3DF0B 3OB2B 1QTXA 1MQ1A 3CZTX 5HLVA 1SRAA 1V1FA 3GK2A 1B47A 1SMGA 1GJYA 4A4CA 1HQVA 3E3RA 4PHNA 4YGCB 4YBHB 3SJSA 2EGDA 4N5XA 4GGFC 3ZNIA 2MLEC 5I2OA 1EG4A 1KWOC 3EVUA 1CLLA 4C0JA 1CB1A 2JRFA 1B7TZ 4M2OA 2K0JA 3KF9A 2BE4A 1EXRA 1WLZA 2D8NA 1QS7A 1TOPA 1A2XA 2WORA 1Y1UA 2R2IA 1F8HA 1YR5A 3VRRA 1GGZA 2MHHA 4CPVA 5HYDA 1RK9A 4MSPA 4PDZA 2LAPA 2LVKA 1PSBA 2K2FA 4MZLA 4ZCUA 2BL0C 1XYDA 1B8CA 3I5HC 1F70A 5I2LA 5DKQA 2ZFDA 1N0YA 5TNCA 4HRGA 3FWCA 4MEWA 4E68A 1K95A 1M45A 1UHNA 3SG5A 5CSFA 1C7WA 1DJIA 5AEQA 2MJWB 4DUQA 4C0KA 2KGRA 2M9GA 1NPQA 4I5LB 3BXKA 5KTYA 1QIVA 2KI4B 3RLZA 3HX4A 3AKAA 3NSKA 4FQOA 3VGOA 3CLNA 1B4CA 3I5GC 1XFZO 5ER4X 1SCMB 4L9MA 5B8IB 1BOCA 2JU0A 1IQ3A 3JTDB 3SG7A 3TUYC 2L51A 4YRUA 3BQ3A 2BKHB 2M7NA 4MZJA 3LLEA 1KFXL 2KAVA 2OS8B 4YGEB 3TS5C 2M8UA 5K89A 1NWDA 3SG6A 1SR6C 4XYNA 4OKHA 1C07A 4YI9A 5ER5A 1A29A 2L4HA 2ZN9A 1MUXA 1SKTA 2AMIA 3WHUB 4UPGA 1IRJA 1SK6D 2I94A 3BUWB 4P2YB 1KFUL 1QIWA 3BYAA 4OV2A 4PHKA 2GV5A 1K8UA 2F2PA 4NQGA 2LC5A 3LCPC 1PK0D 1V1GA 2F3YA 2LNKA 4I5JA 1QLSA 1GQMA 1N2DA 2KDHA 2QACA 2LVJA 4GGNA 1SW8A 1S5GY 1K90D 1X02A 3KEVA 4U8DA 1BODA 4WQ3A 1G33A 5F6TA 1CTRA 3HCMA 1J7OA 1JFJA 1YUUA 3KPXA 1KK7Y 2BCAA 1SL8A 1AJ5A 1WRKA 1TNPA 1YTZC 2B1UA 3BUNB 2LMUA 2KYFA 1DJGA 2F8PA 1S6JA 2M0RA 3DVMA 1G8IA 4PALA 2KFHA 1BU3A 3PN7B 1FW4A 2BCXA 4WQ2A 1TCOB 4GBAA 3AAKA 1NSHA 1Y0VH 1W7IB 3EK8A 2BKIB 1DTLA 2L2EA 2ZRSA 2SCPA 1EG3A 2TN4A 2PASA 4HRHA 2L98A 5CPVA 3VROA 1RECA 4D1EA 2NCPA 4ORBB 1Y1XA 3EVVA 3WHTB 4GAOA 2NLNA 2O5GA 2F2OA 1FPWA 1KK8B 2K7BA 2AUCA 4HREE 1LA0A 1EJ3A 2KI6C 1FI6A 3F45A 1WDCB 3GK4X 2NZ0A 1H4BA 2LM5A 2CCMA 4AQIA 2V53A 3BUOB 2SASA 1MHOA 2KOTA 1FI5A 3CTNA 2L5XB 1UWOA 1XO5A 2MLFC 3M0WA 1UHKA 1J55A 3I5IB 1QX5B 3DVKA 1RROA 5HKZA 2FOTA 1S36A 1A4PA 3LK0A 3FIAA 3FS7A 4I5KA 1KQMC 2P6BB 1DJXA 1XK4C 1Y1AA 3EKJA 1BG1A 3NSLA 2HPSA 2OS8C 1YUTA 3NSIA 1YUSA 2BBMA 2CT9A 1C7VA 1UHJA 1A75A 1CFPA 2KQ6A 1DJZA 1MXEA 2ZNEA 1BJFA 1B1GA 3C1VA 2PRUA 2H61C 1JF2A 1YVLA 2KYCA 1KQVA 1K9PA 2QPTA 4OCIA 5AANA 2MRDA 1ZFSA 1PVAA 1QVIY 2JXCA 2ZN8A 5J3XA 4ETOA 2KBIA 1EL4A 3AAJA 2OPOA 3CR2A 1UURA 2LV7A 3BOWB 3DD4A 2L4IA 3KO0A 1FBVA 4CIDA 1CMGA 1K96A 2JNXA 3K21A 3D0YA 2KQYA 4YGDB 1NCXA 5I2QA 3I5FC 4GFTA 4NDDA 4PE0A 3CR4X 4USLA 3O2PA 5DKRA 1IKUA 1YX8A 1EH2A 1SL9A 2EHBA 2HQWA 1CDNA 2LCPA 3BOWA 1NX2A 4QJ5B 2LP2A 1YVHA 5BPJA 1QATA 1DMOA 3GOFA 5I8NA 3OX6A 2KAYA 2KFFA 1U5IA 4ZCVA 1BT6A 1J1EA 1DVIA 2NCOA 5KSZA 1ALWA 4CLNA 3VRPA 1S26D 1XFXO 2MA2A 3PN7C 4GUKA 1NUBA 1K93D 1JF0A 1W7JB 3PALA 3SG2A 5D69A 2EC6B 1LA3A 2L50A 4NDBA 3A4UB 4AOMA 1S6IA 4I5NB 5CSNA 1B7TY 2NXQA 2RGIA 1DF0B 4M2QA 1NX1A 3PM8A 3GK1A 1L2OB 4HSZA 4NDCA 1JC2A 1OMDA 3QRXA 2M7LA 1SNLA 1OMVA 1PULA 4CFRA 2Y4QA 2KNEA 3EK4A 3PFVA 2CTNA 1OE9B 2LLSA 1DF0A 3ICBA 2Y1MA 2KHNA 1OQPA 3A8RA 4GGFA 1AVSA 1OSAA 2Q4UA 1H8BA 2M1UA 5JOLA 1SL7A 3O78A 4BY5A 1LINA 1XFYO 2ZNDA 3I5IC 2Y1NA 4PCWA 4ORAB 4OR9B 3CS1A 3JVTB 1KSOA 3SG3A 2I2RE 2BL0B 3I5HB 2JULA 2H2KA 5G08A 3OP0A 1WRZA 2JWWA 1KSMA 4PE1A 4DRWA 1R2UA 5IBWA 1ODBA 2K2AA 2M97A 2LMTA 1LVCD 1PALA 1FF1A 2AAOA 4ICBA 1F71A 1CNPA 3SIAA 1XFVO 1CLBA 3OB1B 1ZMZA 1F4OA 4MVFA 1BF5A 1CDLA 1QJTA 1IG5A 1OOJA 1GGWA 1HT9A 1JFKA 3DVEA 4PE7A 1A03A 2IS9A 3TDIA 1IJ6A 2JT0A 2CNPA 2FJUB 3I5GB 1TNWA 1OZSA 4QJ4B 1JUOA 4IL1A 3ZWHA 1NIWA 3PSRA 4DCKA 3TUYB 2M29A 1AP4A 2GGMA 2LUCA 1NYAA 3TS5B 1QV1A 1K9KA 1ALVA 2ISDA 2KGBC 1YRTB 2KI4C 1SR6B 2HQ8A 1D1OA 1JWDA 3O4YA 5HLOA 2HF5A 1A75B 1NX0A 2BECA 2LE9B 3VRQA 2G9BA 2LLTA 1SPYA 2F3ZA 2F33A 1NCZA 1CM1A
chains in the Genus database with same CATH superfamily
1TCFA 1UHIA 1K94A 4F0ZB 1SCMC 2JTZA 4YGAA 3EKHA 3JTDC 2FCDA 4CFQA 3KHEA 1PVBA 2PMYA 5EL2A 1ZOTB 3IF7A 1PSRA 2LHIA 3BFAA 4BY4A 4JWQA 1J7QA 3SS3A 1QX7A 2KAXA 3QMEA 3S0GA 3BUMB 2PSRA 2KPHA 2G2BA 4MRXA 3D74A 2LANA 3SG4A 1MXLC 3CGAA 3D0YB 1F55A 1SBJA 1WRLA 1CFDA 3RM1A 1J7RA 1IWQA 1DQEA 1L2OC 1S3PA 2PVBA 3FWBA 1DT7B 2OTGB 2K7CA 2M3WA 3NSOA 3DF0A 2I7AA 4IJ7A 5AXIA 1RFJA 1MR8A 3V2LA 2JNFA 1UUSA 1M39A 1CDPA 2LLUA 4PHJA 1CDMA 2WCEA 1B9AA 3DVJA 5I94A 1F4QA 1U5IB 2K7OA 2WCBA 3PLFB 4MBEA 1LKJA 3OHMB 1TTXA 3CR5X 2LVVA 1B8RA 2CXJA 1M63B 2GTEA 1UHHA 4XJKB 1RWYA 1MF8B 3WNXB 4OVNF 1RTP1 2BCBA 4MRYA 1C3YA 3IQQA 1K2HA 1J1DA 1W9ZA 3OBVA 1SSEB 1UP5A 3JVTC 1M31A 5CSJA 2FCEA 2JPTA 2YGUA 3TDZA 2WOSA 1QXPA 4Q04A 4C0LA 1S5GZ 1KFXS 2K7DA 2M1KB 2E30A 2KLEA 2LMVA 5DICA 2JQ6A 1SYMA 3R1OA 4XJKA 3WXAA 4MLWA 1KK7Z 3H4SE 3PATA 1TNQA 1WY9A 4PE4A 1PRWA 1BLQA 1BMOA 4GPLB 4N1FA 1SY9A 3LL8B 3TDUA 1TIZA 2A4JA 2MAZA 1M46A 1KFUS 5HKYA 4MN0A 4DIRA 2BE6A 1BR4B 1ZACA 3MSEB 2QEOA 1QV0A 1B8LA 2JTTA 1QASA 2WCLA 4QJ3B 4ORCB 4INXA 3CYZA 5D7FA 4JQ0D 3CWGA 3O6BA 1OOFA 2MBXA 3DZTA 2VRGA 1KWOB 3VRNA 1TRFA 2O60A 1DC1A 2WCFA 1CFFA 1KQMB 1KK8C 1TUZA 3L47A 3LK1A 1JSAA 2DOQA 4JD9A 1NX3A 2KI6D 1IQ5A 1TWOA 1YX7A 2KFGA 1WDCC 1G4YR 2L0PA 2K8MB 1DJYA 2WNDA 1ZUZA 3FE8A 2JOJA 5AERA 4YI8A 1IH0A 1MWNA 4AQJA 1BR1B 2I18A 2COLB 3RZSA 1L7ZA 2LHLA 1K9UA 1CLMA 1WLMA 3AKBA 5CSIA 5AFPA 1CMFA 1XK4A 3NXAA 1QX2A 1OZOA 1VRKA 1YURA 2LUXA 2KBMA 2PALA 2QEBA 3D10A 4P5OE 5FYXA 2P71A 1SCVA 5FI6A 1CFCA 1DGVA 4YGBB 2LVIA 2Q91A 2E6WA 4INWA 1AJ4A 2HETA 1Q80A 2ZKMX 2H61A 2JC2A 3Q8IA 2GGZA 3CZ1A 1AHRA 3L4LA 2Y5IA 1QLKA 3I5FB 3TZ1A 5KU1A 1S6CA 5DKNA 2KSPA 1E8AA 2LP3A 2QEHA 1Y6WA 1N65A 2JT3A 5PALA 2OTGC 5GQQC 3S0AA 4JPZB 1XFWO 3IQOA 4TNCA 3BUXB 2JT8A 1J7PA 2K61A 1LXFC 4JKTA 5HKWA 3S0EA 2BBNA 2ZRTA 3OX5A 1JBAA 1YRUB 1NP8A 4WRIA 1DGUA 1RJVA 3EK7A 1CKKA 1QVIZ 3O4XA 1OMRA 3DYEA 2P70A 2CBLA 1OOHA 1AUIB 1OOIX 4PHMA 1XVJA 4R1EA 1XFUO 1CM4A 1DJWA 3R1VA 2JXLA 4M2PA 1XA5A 1TNXA 1S1EA 3FE9A 4DS7A 2WC8A 1IGVA 4N1GA 1Z4HA 1AK8A 1NCYA 3EVRA 4FTGA 1F54A 1IJ5A 1KCYA 5JJGA 1DJHA 4A4BA 1R6PA 1TN4A 2JZIA 2M49B 2EC6C 4GNKB 4MZKA 3DF0B 3OB2B 3B7AA 1QTXA 1MQ1A 3CZTX 5HLVA 1SRAA 1V1FA 3GK2A 1B47A 1SMGA 1GJYA 4A4CA 1HQVA 1LS8A 3E3RA 3PJIA 4PHNA 4YGCB 4YBHB 3SJSA 2EGDA 4N5XA 4GGFC 3ZNIA 2MLEC 3NGVA 5I2OA 3CZ0A 1EG4A 1KWOC 3EVUA 1CLLA 4C0JA 1CB1A 2WCMA 2JRFA 1B7TZ 4M2OA 2K0JA 3KF9A 2BE4A 1EXRA 1WLZA 2D8NA 1QS7A 1TOPA 1A2XA 2WORA 1Y1UA 2R2IA 3VB1A 4KYNA 1F8HA 1YR5A 3VRRA 1GGZA 2MHHA 4CPVA 5HYDA 1RK9A 4MSPA 4PDZA 2LAPA 2LVKA 1PSBA 2K2FA 4MZLA 4ZCUA 2BL0C 1XYDA 5D3OA 1B8CA 2ERBA 2PYQA 3I5HC 1F70A 5HL1A 5I2LA 5DKQA 2ZFDA 1N0YA 5TNCA 4HRGA 3FWCA 4MEWA 4E68A 1K95A 1M45A 1UHNA 3SG5A 5CSFA 1C7WA 1DJIA 5AEQA 2MJWB 4DUQA 4C0KA 2KGRA 2M9GA 1NPQA 2L2CA 4I5LB 3BXKA 5KTYA 1GM0A 1QIVA 2KI4B 3RLZA 3HX4A 3AKAA 3NSKA 4FQOA 3VGOA 3CLNA 1B4CA 1Z2CB 2KLDA 3I5GC 3BFBA 3L4AA 1XFZO 3N7HA 5ER4X 1SCMB 4L9MA 5B8IB 1BOCA 2JU0A 1IQ3A 3JTDB 3SG7A 3TUYC 1OOGA 2L51A 4YRUA 3B88A 3BQ3A 2BKHB 2M7NA 4MZJA 3LLEA 1KFXL 2KAVA 2OS8B 4YGEB 3TS5C 2M8UA 5K89A 1NWDA 3SG6A 1SR6C 4XYNA 4OKHA 1C07A 4YI9A 5ER5A 1A29A 2L4HA 2ZN9A 1MUXA 1SKTA 2AMIA 3WHUB 4UPGA 1IRJA 1SK6D 2I94A 3BUWB 4P2YB 1KFUL 3SS5A 2WCHA 1QIWA 3BYAA 4OV2A 4PHKA 2GV5A 5FI7A 1K8UA 2F2PA 4NQGA 2LC5A 3LCPC 1PK0D 1V1GA 2F3YA 2LNKA 3CABA 4I5JA 1QLSA 1GQMA 1N2DA 1ORGA 2KDHA 2QACA 3R72A 2LVJA 4GGNA 1X02A 1SW8A 1S5GY 1K90D 3KEVA 4U8DA 1BODA 4WQ3A 1G33A 5F6TA 1CTRA 3HCMA 1J7OA 1JFJA 1YUUA 3D76A 3KPXA 1KK7Y 3FE6A 2BCAA 3CZ2A 1SL8A 1AJ5A 1WRKA 1TNPA 1YTZC 2B1UA 2QEVA 3BUNB 2LMUA 2KYFA 1DJGA 2F8PA 1S6JA 2M0RA 3DVMA 3PM2A 1G8IA 4PALA 2KFHA 1BU3A 3PN7B 3UNWA 1FW4A 2BCXA 4WQ2A 1C3ZA 1TCOB 4GBAA 4PT1A 3AAKA 1NSHA 1Y0VH 1W7IB 2WCKA 3EK8A 2BKIB 1DTLA 2L2EA 1QWVA 2ZRSA 2SCPA 1EG3A 2TN4A 2PASA 4HRHA 2L98A 5CPVA 3VROA 1RECA 4D1EA 2NCPA 4ORBB 1Y1XA 2WC6A 3EVVA 1TUJA 4GAOA 3WHTB 2NLNA 2O5GA 2F2OA 1DEKA 1FPWA 1KK8B 2K7BA 2AUCA 4HREE 1LA0A 1EJ3A 2KI6C 1FI6A 1XFRA 3F45A 1WDCB 3GK4X 2NZ0A 1H4BA 2L5YA 2LM5A 2CCMA 4AQIA 2V53A 3BUOB 2SASA 1MHOA 3BFHA 2KOTA 1FI5A 3CTNA 2L5XB 1UWOA 1XO5A 2MLFC 3M0WA 1UHKA 1DELA 2K60A 1J55A 3I5IB 1QX5B 3DVKA 1RROA 5HKZA 2FOTA 1S36A 1A4PA 3LK0A 3FIAA 3FS7A 4I5KA 1KQMC 2P6BB 4F7FA 1DJXA 1XK4C 1Y1AA 3EKJA 1BG1A 3NSLA 2HPSA 2OS8C 1YUTA 3NSIA 1YUSA 2BBMA 2CT9A 1C7VA 1UHJA 1A75A 1CFPA 1OW4A 3B87A 2KQ6A 1DJZA 1MXEA 2ZNEA 1BJFA 1B1GA 3C1VA 2PRUA 2H61C 1JF2A 1YVLA 2KYCA 3S0FA 1KQVA 1K9PA 2QPTA 4OCIA 5AANA 2MRDA 1ZFSA 1PVAA 1QVIY 2JXCA 3SS4A 2ZN8A 5J3XA 2QDIA 4ETOA 2KBIA 1EL4A 3AAJA 2OPOA 3CR2A 1UURA 2LV7A 3BOWB 3DD4A 2L4IA 3KO0A 1FBVA 4CIDA 1CMGA 1K96A 2JNXA 3K21A 3D0YA 2KQYA 4YGDB 1NCXA 5I2QA 3I5FC 4GFTA 4NDDA 4PE0A 3CR4X 4USLA 3O2PA 3DXLA 2BNXA 5DKRA 1YX8A 3D75A 1IKUA 1EH2A 1SL9A 2EHBA 2HQWA 1CDNA 2LCPA 3BOWA 1NX2A 4QJ5B 2LP2A 1YVHA 5BPJA 1IIOA 1QATA 1DMOA 3GOFA 5I8NA 3OX6A 2KAYA 2KFFA 1U5IA 4ZCVA 1BT6A 1J1EA 1DVIA 2NCOA 5KSZA 1ALWA 4CLNA 3VRPA 1S26D 1XFXO 2MA2A 3PN7C 4GUKA 1NUBA 3IVTA 4FQTA 1P28A 1K93D 1JF0A 1W7JB 3PALA 3SIBA 3SG2A 5D69A 2EC6B 1LA3A 2L50A 4NDBA 3A4UB 2JPOA 4AOMA 1S6IA 3DY9A 4I5NB 5CSNA 1B7TY 2NXQA 2RGIA 1DF0B 4M2QA 1NX1A 3PM8A 3NHTA 3CDNA 3GK1A 1L2OB 4HSZA 4NDCA 3UO9A 1JC2A 1OMDA 3QRXA 2M7LA 1SNLA 1OMVA 3S0DA 2WCJA 3S0BA 1PULA 4CFRA 2Y4QA 2KNEA 3EK4A 3PFVA 5FI2A 2CTNA 1OE9B 3B6XA 2LLSA 1DF0A 3ICBA 2Y1MA 2KHNA 1OQPA 3A8RA 4GGFA 1AVSA 1OSAA 2Q4UA 3K1EA 1T14A 1H8BA 2M1UA 5JOLA 1SL7A 3O78A 4BY5A 2BAPA 1LINA 1XFYO 2ZNDA 3I5IC 2Y1NA 3NHIA 4ORAB 4PCWA 4OR9B 3CS1A 3JVTB 1KSOA 3SG3A 2I2RE 2BL0B 3I5HB 2JULA 2H2KA 5G08A 3OP0A 1WRZA 2JWWA 1KSMA 2WC5A 4PE1A 4DRWA 1R2UA 5IBWA 1ODBA 2K2AA 2M97A 2LMTA 1LVCD 1PALA 1FF1A 2AAOA 4ICBA 1F71A 1CNPA 3SIAA 1XFVO 1CLBA 3OB1B 1ZMZA 1F4OA 4MVFA 1BF5A 1CDLA 4OZDA 1QJTA 1IG5A 1OOJA 1GGWA 1HT9A 1JFKA 3DVEA 4PE7A 1A03A 2IS9A 3TDIA 1IJ6A 2JT0A 3EG5B 2CNPA 2FJYA 2FJUB 3I5GB 3R1PA 1TNWA 1OZSA 3D77A 4QJ4B 1JUOA 3D78A 4IL1A 3ZWHA 1NIWA 3PSRA 4DCKA 3TUYB 2M29A 1AP4A 2GGMA 2LUCA 1NYAA 3TS5B 1QV1A 1K9KA 1ALVA 2H8VA 2ISDA 2KGBC 3B86A 1YRTB 3OGNA 2KI4C 1SR6B 2HQ8A 1D1OA 1JWDA 3O4YA 5HLOA 2HF5A 1A75B 1NX0A 2BECA 2LE9B 3BJHA 3VRQA 2G9BA 2LLTA 2PQLA 3D73A 1SPYA 2F3ZA 2F33A 1NCZA 1CM1A
chains in the Genus database with same CATH topology
1TCFA 1UHIA 1K94A 4F0ZB 1SCMC 2JTZA 4YGAA 3EKHA 3JTDC 2FCDA 4CFQA 3KHEA 1PVBA 2PMYA 1ZOTB 3IF7A 1PSRA 2LHIA 4BY4A 4JWQA 1J7QA 1QX7A 2KAXA 3BUMB 2PSRA 2G2BA 4MRXA 2LANA 3SG4A 1MXLC 3CGAA 3D0YB 1F55A 1SBJA 1WRLA 1CFDA 3RM1A 1J7RA 1IWQA 2PVBA 1L2OC 1S3PA 3FWBA 1DT7B 2OTGB 2K7CA 2M3WA 3NSOA 3DF0A 2I7AA 5AXIA 1RFJA 1MR8A 2JNFA 1UUSA 1M39A 1CDPA 2LLUA 4PHJA 1CDMA 2WCEA 1B9AA 3DVJA 1F4QA 1U5IB 2K7OA 2WCBA 3PLFB 4MBEA 1LKJA 3OHMB 1TTXA 3CR5X 2LVVA 1B8RA 2CXJA 1M63B 4XJKB 1UHHA 1RWYA 1MF8B 3WNXB 4OVNF 1RTP1 2BCBA 4MRYA 1K2HA 3IQQA 1J1DA 3JVTC 1UP5A 5CSJA 1M31A 2FCEA 2JPTA 3TDZA 2WOSA 1QXPA 4Q04A 4C0LA 1S5GZ 1KFXS 2K7DA 2M1KB 2E30A 2LMVA 2JQ6A 1SYMA 4XJKA 3WXAA 4MLWA 1KK7Z 3H4SE 3PATA 1TNQA 1WY9A 4PE4A 1PRWA 1BLQA 1BMOA 4GPLB 4N1FA 1SY9A 3LL8B 3TDUA 1TIZA 2A4JA 2MAZA 1M46A 1KFUS 5HKYA 4MN0A 4DIRA 2BE6A 1BR4B 1ZACA 3MSEB 1QV0A 1B8LA 2JTTA 1QASA 4QJ3B 2MBXA 4ORCB 5D7FA 3SIBA 4JQ0D 3CWGA 3O6BA 2VRGA 1KWOB 3VRNA 1TRFA 2O60A 2WCFA 1CFFA 1KQMB 1KK8C 1JSAA 3LK1A 2DOQA 1NX3A 2KI6D 1IQ5A 2KFGA 1YX7A 1WDCC 1G4YR 2L0PA 2K8MB 1DJYA 2WNDA 1ZUZA 5AERA 2JOJA 4YI8A 1IH0A 1MWNA 4AQJA 1BR1B 2I18A 2COLB 1L7ZA 2LHLA 1K9UA 1CLMA 1WLMA 3AKBA 5CSIA 5AFPA 1CMFA 1XK4A 3NXAA 1QX2A 1OZOA 1VRKA 1YURA 2LUXA 2KBMA 2PALA 3D10A 4P5OE 5FYXA 1SCVA 1CFCA 1DGVA 4YGBB 2LVIA 2Q91A 2E6WA 1AJ4A 2HETA 1Q80A 2ZKMX 2H61A 2JC2A 2GGZA 1AHRA 2Y5IA 1QLKA 3I5FB 3TZ1A 5KU1A 1S6CA 5DKNA 2KSPA 1E8AA 2LP3A 1Y6WA 1N65A 2JT3A 5PALA 2OTGC 5GQQC 4JPZB 1XFWO 3IQOA 4TNCA 3BUXB 2JT8A 1J7PA 2K61A 1LXFC 5HKWA 2BBNA 2ZRTA 3OX5A 1JBAA 1YRUB 1NP8A 4WRIA 1DGUA 1RJVA 3EK7A 1CKKA 1QVIZ 1OMRA 2CBLA 4PHMA 1AUIB 4R1EA 1XVJA 1XFUO 1CM4A 1DJWA 4M2PA 2JXLA 1XA5A 1TNXA 1S1EA 4DS7A 2WC8A 1IGVA 4N1GA 1AK8A 1NCYA 3EVRA 4FTGA 1F54A 1IJ5A 1KCYA 5JJGA 1DJHA 4A4BA 1R6PA 1TN4A 2JZIA 2M49B 2EC6C 4GNKB 4MZKA 3DF0B 3OB2B 1QTXA 1MQ1A 3CZTX 5HLVA 1SRAA 1V1FA 3GK2A 1B47A 1SMGA 1GJYA 4A4CA 1HQVA 3E3RA 4PHNA 4YGCB 4YBHB 3SJSA 2EGDA 4N5XA 4GGFC 3ZNIA 2MLEC 5I2OA 1EG4A 1KWOC 3EVUA 1CLLA 4C0JA 1CB1A 2JRFA 1B7TZ 4M2OA 2K0JA 3KF9A 2BE4A 1EXRA 1WLZA 2D8NA 1QS7A 1TOPA 1A2XA 2WORA 1Y1UA 2R2IA 1F8HA 1YR5A 3VRRA 1GGZA 2MHHA 4CPVA 5HYDA 1RK9A 4MSPA 4PDZA 2LAPA 2LVKA 1PSBA 2K2FA 4MZLA 4ZCUA 2BL0C 1XYDA 1B8CA 3I5HC 1F70A 5I2LA 5DKQA 2ZFDA 1N0YA 5TNCA 4HRGA 3FWCA 4MEWA 4E68A 1K95A 1M45A 1UHNA 3SG5A 5CSFA 1C7WA 1DJIA 5AEQA 2MJWB 4DUQA 4C0KA 2KGRA 2M9GA 1NPQA 4I5LB 3BXKA 5KTYA 1QIVA 2KI4B 3RLZA 3HX4A 3AKAA 3NSKA 4FQOA 3VGOA 3CLNA 1B4CA 3I5GC 1XFZO 5ER4X 1SCMB 4L9MA 5B8IB 1BOCA 2JU0A 1IQ3A 3JTDB 3SG7A 3TUYC 2L51A 4YRUA 3BQ3A 2BKHB 2M7NA 4MZJA 3LLEA 1KFXL 2KAVA 2OS8B 4YGEB 3TS5C 2M8UA 5K89A 1NWDA 3SG6A 1SR6C 4XYNA 4OKHA 1C07A 4YI9A 5ER5A 1A29A 2L4HA 2ZN9A 1MUXA 1SKTA 2AMIA 3WHUB 4UPGA 1IRJA 1SK6D 2I94A 3BUWB 4P2YB 1KFUL 1QIWA 3BYAA 4OV2A 4PHKA 2GV5A 1K8UA 2F2PA 4NQGA 2LC5A 3LCPC 1PK0D 1V1GA 2F3YA 2LNKA 4I5JA 1QLSA 1GQMA 1N2DA 2KDHA 2QACA 2LVJA 4GGNA 1SW8A 1S5GY 1K90D 1X02A 3KEVA 4U8DA 1BODA 4WQ3A 1G33A 5F6TA 1CTRA 3HCMA 1J7OA 1JFJA 1YUUA 3KPXA 1KK7Y 2BCAA 1SL8A 1AJ5A 1WRKA 1TNPA 1YTZC 2B1UA 3BUNB 2LMUA 2KYFA 1DJGA 2F8PA 1S6JA 2M0RA 3DVMA 1G8IA 4PALA 2KFHA 1BU3A 3PN7B 1FW4A 2BCXA 4WQ2A 1TCOB 4GBAA 3AAKA 1NSHA 1Y0VH 1W7IB 3EK8A 2BKIB 1DTLA 2L2EA 2ZRSA 2SCPA 1EG3A 2TN4A 2PASA 4HRHA 2L98A 5CPVA 3VROA 1RECA 4D1EA 2NCPA 4ORBB 1Y1XA 3EVVA 3WHTB 4GAOA 2NLNA 2O5GA 2F2OA 1FPWA 1KK8B 2K7BA 2AUCA 4HREE 1LA0A 1EJ3A 2KI6C 1FI6A 3F45A 1WDCB 3GK4X 2NZ0A 1H4BA 2LM5A 2CCMA 4AQIA 2V53A 3BUOB 2SASA 1MHOA 2KOTA 1FI5A 3CTNA 2L5XB 1UWOA 1XO5A 2MLFC 3M0WA 1UHKA 1J55A 3I5IB 1QX5B 3DVKA 1RROA 5HKZA 2FOTA 1S36A 1A4PA 3LK0A 3FIAA 3FS7A 4I5KA 1KQMC 2P6BB 1DJXA 1XK4C 1Y1AA 3EKJA 1BG1A 3NSLA 2HPSA 2OS8C 1YUTA 3NSIA 1YUSA 2BBMA 2CT9A 1C7VA 1UHJA 1A75A 1CFPA 2KQ6A 1DJZA 1MXEA 2ZNEA 1BJFA 1B1GA 3C1VA 2PRUA 2H61C 1JF2A 1YVLA 2KYCA 1KQVA 1K9PA 2QPTA 4OCIA 5AANA 2MRDA 1ZFSA 1PVAA 1QVIY 2JXCA 2ZN8A 5J3XA 4ETOA 2KBIA 1EL4A 3AAJA 2OPOA 3CR2A 1UURA 2LV7A 3BOWB 3DD4A 2L4IA 3KO0A 1FBVA 4CIDA 1CMGA 1K96A 2JNXA 3K21A 3D0YA 2KQYA 4YGDB 1NCXA 5I2QA 3I5FC 4GFTA 4NDDA 4PE0A 3CR4X 4USLA 3O2PA 5DKRA 1IKUA 1YX8A 1EH2A 1SL9A 2EHBA 2HQWA 1CDNA 2LCPA 3BOWA 1NX2A 4QJ5B 2LP2A 1YVHA 5BPJA 1QATA 1DMOA 3GOFA 5I8NA 3OX6A 2KAYA 2KFFA 1U5IA 4ZCVA 1BT6A 1J1EA 1DVIA 2NCOA 5KSZA 1ALWA 4CLNA 3VRPA 1S26D 1XFXO 2MA2A 3PN7C 4GUKA 1NUBA 1K93D 1JF0A 1W7JB 3PALA 3SG2A 5D69A 2EC6B 1LA3A 2L50A 4NDBA 3A4UB 4AOMA 1S6IA 4I5NB 5CSNA 1B7TY 2NXQA 2RGIA 1DF0B 4M2QA 1NX1A 3PM8A 3GK1A 1L2OB 4HSZA 4NDCA 1JC2A 1OMDA 3QRXA 2M7LA 1SNLA 1OMVA 1PULA 4CFRA 2Y4QA 2KNEA 3EK4A 3PFVA 2CTNA 1OE9B 2LLSA 1DF0A 3ICBA 2Y1MA 2KHNA 1OQPA 3A8RA 4GGFA 1AVSA 1OSAA 2Q4UA 1H8BA 2M1UA 5JOLA 1SL7A 3O78A 4BY5A 1LINA 1XFYO 2ZNDA 3I5IC 2Y1NA 4PCWA 4ORAB 4OR9B 3CS1A 3JVTB 1KSOA 3SG3A 2I2RE 2BL0B 3I5HB 2JULA 2H2KA 5G08A 3OP0A 1WRZA 2JWWA 1KSMA 4PE1A 4DRWA 1R2UA 5IBWA 1ODBA 2K2AA 2M97A 2LMTA 1LVCD 1PALA 1FF1A 2AAOA 4ICBA 1F71A 1CNPA 3SIAA 1XFVO 1CLBA 3OB1B 1ZMZA 1F4OA 4MVFA 1BF5A 1CDLA 1QJTA 1IG5A 1OOJA 1GGWA 1HT9A 1JFKA 3DVEA 4PE7A 1A03A 2IS9A 3TDIA 1IJ6A 2JT0A 2CNPA 2FJUB 3I5GB 1TNWA 1OZSA 4QJ4B 1JUOA 4IL1A 3ZWHA 1NIWA 3PSRA 4DCKA 3TUYB 2M29A 1AP4A 2GGMA 2LUCA 1NYAA 3TS5B 1QV1A 1K9KA 1ALVA 2ISDA 2KGBC 1YRTB 2KI4C 1SR6B 2HQ8A 1D1OA 1JWDA 3O4YA 5HLOA 2HF5A 1A75B 1NX0A 2BECA 2LE9B 3VRQA 2G9BA 2LLTA 1SPYA 2F3ZA 2F33A 1NCZA 1CM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TCF A;  1UHI A;  1K94 A;  4F0Z B;  1SCM C;  2JTZ A;  4YGA A;  3EKH A;  3JTD C;  2FCD A;  4CFQ A;  3KHE A;  1PVB A;  2PMY A;  1ZOT B;  3IF7 A;  1PSR A;  2LHI A;  4BY4 A;  4JWQ A;  1J7Q A;  1QX7 A;  2KAX A;  3BUM B;  2PSR A;  2G2B A;  4MRX A;  2LAN A;  3SG4 A;  1MXL C;  3CGA A;  3D0Y B;  1F55 A;  1SBJ A;  1WRL A;  1CFD A;  3RM1 A;  1J7R A;  1IWQ A;  2PVB A;  1L2O C;  1S3P A;  3FWB A;  1DT7 B;  2OTG B;  2K7C A;  2M3W A;  3NSO A;  3DF0 A;  2I7A A;  5AXI A;  1RFJ A;  1MR8 A;  2JNF A;  1UUS A;  1M39 A;  1CDP A;  2LLU A;  4PHJ A;  1CDM A;  2WCE A;  1B9A A;  3DVJ A;  1F4Q A;  1U5I B;  2K7O A;  2WCB A;  3PLF B;  4MBE A;  1LKJ A;  3OHM B;  1TTX A;  3CR5 X;  2LVV A;  1B8R A;  2CXJ A;  1M63 B;  4XJK B;  1UHH A;  1RWY A;  1MF8 B;  3WNX B;  4OVN F;  1RTP 1;  2BCB A;  4MRY A;  1K2H A;  3IQQ A;  1J1D A;  3JVT C;  1UP5 A;  5CSJ A;  1M31 A;  2FCE A;  2JPT A;  3TDZ A;  2WOS A;  1QXP A;  4Q04 A;  4C0L A;  1S5G Z;  1KFX S;  2K7D A;  2M1K B;  2E30 A;  2LMV A;  2JQ6 A;  1SYM A;  4XJK A;  3WXA A;  4MLW A;  1KK7 Z;  3H4S E;  3PAT A;  1TNQ A;  1WY9 A;  4PE4 A;  1PRW A;  1BLQ A;  1BMO A;  4GPL B;  4N1F A;  1SY9 A;  3LL8 B;  3TDU A;  1TIZ A;  2A4J A;  2MAZ A;  1M46 A;  1KFU S;  5HKY A;  4MN0 A;  4DIR A;  2BE6 A;  1BR4 B;  1ZAC A;  3MSE B;  1QV0 A;  1B8L A;  2JTT A;  1QAS A;  4QJ3 B;  2MBX A;  4ORC B;  5D7F A;  3SIB A;  4JQ0 D;  3CWG A;  3O6B A;  2VRG A;  1KWO B;  3VRN A;  1TRF A;  2O60 A;  2WCF A;  1CFF A;  1KQM B;  1KK8 C;  1JSA A;  3LK1 A;  2DOQ A;  1NX3 A;  2KI6 D;  1IQ5 A;  2KFG A;  1YX7 A;  1WDC C;  1G4Y R;  2L0P A;  2K8M B;  1DJY A;  2WND A;  1ZUZ A;  5AER A;  2JOJ A;  4YI8 A;  1IH0 A;  1MWN A;  4AQJ A;  1BR1 B;  2I18 A;  2COL B;  1L7Z A;  2LHL A;  1K9U A;  1CLM A;  1WLM A;  3AKB A;  5CSI A;  5AFP A;  1CMF A;  1XK4 A;  3NXA A;  1QX2 A;  1OZO A;  1VRK A;  1YUR A;  2LUX A;  2KBM A;  2PAL A;  3D10 A;  4P5O E;  5FYX A;  1SCV A;  1CFC A;  1DGV A;  4YGB B;  2LVI A;  2Q91 A;  2E6W A;  1AJ4 A;  2HET A;  1Q80 A;  2ZKM X;  2H61 A;  2JC2 A;  2GGZ A;  1AHR A;  2Y5I A;  1QLK A;  3I5F B;  3TZ1 A;  5KU1 A;  1S6C A;  5DKN A;  2KSP A;  1E8A A;  2LP3 A;  1Y6W A;  1N65 A;  2JT3 A;  5PAL A;  2OTG C;  5GQQ C;  4JPZ B;  1XFW O;  3IQO A;  4TNC A;  3BUX B;  2JT8 A;  1J7P A;  2K61 A;  1LXF C;  5HKW A;  2BBN A;  2ZRT A;  3OX5 A;  1JBA A;  1YRU B;  1NP8 A;  4WRI A;  1DGU A;  1RJV A;  3EK7 A;  1CKK A;  1QVI Z;  1OMR A;  2CBL A;  4PHM A;  1AUI B;  4R1E A;  1XVJ A;  1XFU O;  1CM4 A;  1DJW A;  4M2P A;  2JXL A;  1XA5 A;  1TNX A;  1S1E A;  4DS7 A;  2WC8 A;  1IGV A;  4N1G A;  1AK8 A;  1NCY A;  3EVR A;  4FTG A;  1F54 A;  1IJ5 A;  1KCY A;  5JJG A;  1DJH A;  4A4B A;  1R6P A;  1TN4 A;  2JZI A;  2M49 B;  2EC6 C;  4GNK B;  4MZK A;  3DF0 B;  3OB2 B;  1QTX A;  1MQ1 A;  3CZT X;  5HLV A;  1SRA A;  1V1F A;  3GK2 A;  1B47 A;  1SMG A;  1GJY A;  4A4C A;  1HQV A;  3E3R A;  4PHN A;  4YGC B;  4YBH B;  3SJS A;  2EGD A;  4N5X A;  4GGF C;  3ZNI A;  2MLE C;  5I2O A;  1EG4 A;  1KWO C;  3EVU A;  1CLL A;  4C0J A;  1CB1 A;  2JRF A;  1B7T Z;  4M2O A;  2K0J A;  3KF9 A;  2BE4 A;  1EXR A;  1WLZ A;  2D8N A;  1QS7 A;  1TOP A;  1A2X A;  2WOR A;  1Y1U A;  2R2I A;  1F8H A;  1YR5 A;  3VRR A;  1GGZ A;  2MHH A;  4CPV A;  5HYD A;  1RK9 A;  4MSP A;  4PDZ A;  2LAP A;  2LVK A;  1PSB A;  2K2F A;  4MZL A;  4ZCU A;  2BL0 C;  1XYD A;  1B8C A;  3I5H C;  1F70 A;  5I2L A;  5DKQ A;  2ZFD A;  1N0Y A;  5TNC A;  4HRG A;  3FWC A;  4MEW A;  4E68 A;  1K95 A;  1M45 A;  1UHN A;  3SG5 A;  5CSF A;  1C7W A;  1DJI A;  5AEQ A;  2MJW B;  4DUQ A;  4C0K A;  2KGR A;  2M9G A;  1NPQ A;  4I5L B;  3BXK A;  5KTY A;  1QIV A;  2KI4 B;  3RLZ A;  3HX4 A;  3AKA A;  3NSK A;  4FQO A;  3VGO A;  3CLN A;  1B4C A;  3I5G C;  1XFZ O;  5ER4 X;  1SCM B;  4L9M A;  5B8I B;  1BOC A;  2JU0 A;  1IQ3 A;  3JTD B;  3SG7 A;  3TUY C;  2L51 A;  4YRU A;  3BQ3 A;  2BKH B;  2M7N A;  4MZJ A;  3LLE A;  1KFX L;  2KAV A;  2OS8 B;  4YGE B;  3TS5 C;  2M8U A;  5K89 A;  1NWD A;  3SG6 A;  1SR6 C;  4XYN A;  4OKH A;  1C07 A;  4YI9 A;  5ER5 A;  1A29 A;  2L4H A;  2ZN9 A;  1MUX A;  1SKT A;  2AMI A;  3WHU B;  4UPG A;  1IRJ A;  1SK6 D;  2I94 A;  3BUW B;  4P2Y B;  1KFU L;  1QIW A;  3BYA A;  4OV2 A;  4PHK A;  2GV5 A;  1K8U A;  2F2P A;  4NQG A;  2LC5 A;  3LCP C;  1PK0 D;  1V1G A;  2F3Y A;  2LNK A;  4I5J A;  1QLS A;  1GQM A;  1N2D A;  2KDH A;  2QAC A;  2LVJ A;  4GGN A;  1SW8 A;  1S5G Y;  1K90 D;  1X02 A;  3KEV A;  4U8D A;  1BOD A;  4WQ3 A;  1G33 A;  5F6T A;  1CTR A;  3HCM A;  1J7O A;  1JFJ A;  1YUU A;  3KPX A;  1KK7 Y;  2BCA A;  1SL8 A;  1AJ5 A;  1WRK A;  1TNP A;  1YTZ C;  2B1U A;  3BUN B;  2LMU A;  2KYF A;  1DJG A;  2F8P A;  1S6J A;  2M0R A;  3DVM A;  1G8I A;  4PAL A;  2KFH A;  1BU3 A;  3PN7 B;  1FW4 A;  2BCX A;  4WQ2 A;  1TCO B;  4GBA A;  3AAK A;  1NSH A;  1Y0V H;  1W7I B;  3EK8 A;  2BKI B;  1DTL A;  2L2E A;  2ZRS A;  2SCP A;  1EG3 A;  2TN4 A;  2PAS A;  4HRH A;  2L98 A;  5CPV A;  3VRO A;  1REC A;  4D1E A;  2NCP A;  4ORB B;  1Y1X A;  3EVV A;  3WHT B;  4GAO A;  2NLN A;  2O5G A;  2F2O A;  1FPW A;  1KK8 B;  2K7B A;  2AUC A;  4HRE E;  1LA0 A;  1EJ3 A;  2KI6 C;  1FI6 A;  3F45 A;  1WDC B;  3GK4 X;  2NZ0 A;  1H4B A;  2LM5 A;  2CCM A;  4AQI A;  2V53 A;  3BUO B;  2SAS A;  1MHO A;  2KOT A;  1FI5 A;  3CTN A;  2L5X B;  1UWO A;  1XO5 A;  2MLF C;  3M0W A;  1UHK A;  1J55 A;  3I5I B;  1QX5 B;  3DVK A;  1RRO A;  5HKZ A;  2FOT A;  1S36 A;  1A4P A;  3LK0 A;  3FIA A;  3FS7 A;  4I5K A;  1KQM C;  2P6B B;  1DJX A;  1XK4 C;  1Y1A A;  3EKJ A;  1BG1 A;  3NSL A;  2HPS A;  2OS8 C;  1YUT A;  3NSI A;  1YUS A;  2BBM A;  2CT9 A;  1C7V A;  1UHJ A;  1A75 A;  1CFP A;  2KQ6 A;  1DJZ A;  1MXE A;  2ZNE A;  1BJF A;  1B1G A;  3C1V A;  2PRU A;  2H61 C;  1JF2 A;  1YVL A;  2KYC A;  1KQV A;  1K9P A;  2QPT A;  4OCI A;  5AAN A;  2MRD A;  1ZFS A;  1PVA A;  1QVI Y;  2JXC A;  2ZN8 A;  5J3X A;  4ETO A;  2KBI A;  1EL4 A;  3AAJ A;  2OPO A;  3CR2 A;  1UUR A;  2LV7 A;  3BOW B;  3DD4 A;  2L4I A;  3KO0 A;  1FBV A;  4CID A;  1CMG A;  1K96 A;  2JNX A;  3K21 A;  3D0Y A;  2KQY A;  4YGD B;  1NCX A;  5I2Q A;  3I5F C;  4GFT A;  4NDD A;  4PE0 A;  3CR4 X;  4USL A;  3O2P A;  5DKR A;  1IKU A;  1YX8 A;  1EH2 A;  1SL9 A;  2EHB A;  2HQW A;  1CDN A;  2LCP A;  3BOW A;  1NX2 A;  4QJ5 B;  2LP2 A;  1YVH A;  5BPJ A;  1QAT A;  1DMO A;  3GOF A;  5I8N A;  3OX6 A;  2KAY A;  2KFF A;  1U5I A;  4ZCV A;  1BT6 A;  1J1E A;  1DVI A;  2NCO A;  5KSZ A;  1ALW A;  4CLN A;  3VRP A;  1S26 D;  1XFX O;  2MA2 A;  3PN7 C;  4GUK A;  1NUB A;  1K93 D;  1JF0 A;  1W7J B;  3PAL A;  3SG2 A;  5D69 A;  2EC6 B;  1LA3 A;  2L50 A;  4NDB A;  3A4U B;  4AOM A;  1S6I A;  4I5N B;  5CSN A;  1B7T Y;  2NXQ A;  2RGI A;  1DF0 B;  4M2Q A;  1NX1 A;  3PM8 A;  3GK1 A;  1L2O B;  4HSZ A;  4NDC A;  1JC2 A;  1OMD A;  3QRX A;  2M7L A;  1SNL A;  1OMV A;  1PUL A;  4CFR A;  2Y4Q A;  2KNE A;  3EK4 A;  3PFV A;  2CTN A;  1OE9 B;  2LLS A;  1DF0 A;  3ICB A;  2Y1M A;  2KHN A;  1OQP A;  3A8R A;  4GGF A;  1AVS A;  1OSA A;  2Q4U A;  1H8B A;  2M1U A;  5JOL A;  1SL7 A;  3O78 A;  4BY5 A;  1LIN A;  1XFY O;  2ZND A;  3I5I C;  2Y1N A;  4PCW A;  4ORA B;  4OR9 B;  3CS1 A;  3JVT B;  1KSO A;  3SG3 A;  2I2R E;  2BL0 B;  3I5H B;  2JUL A;  2H2K A;  5G08 A;  3OP0 A;  1WRZ A;  2JWW A;  1KSM A;  4PE1 A;  4DRW A;  1R2U A;  5IBW A;  1ODB A;  2K2A A;  2M97 A;  2LMT A;  1LVC D;  1PAL A;  1FF1 A;  2AAO A;  4ICB A;  1F71 A;  1CNP A;  3SIA A;  1XFV O;  1CLB A;  3OB1 B;  1ZMZ A;  1F4O A;  4MVF A;  1BF5 A;  1CDL A;  1QJT A;  1IG5 A;  1OOJ A;  1GGW A;  1HT9 A;  1JFK A;  3DVE A;  4PE7 A;  1A03 A;  2IS9 A;  3TDI A;  1IJ6 A;  2JT0 A;  2CNP A;  2FJU B;  3I5G B;  1TNW A;  1OZS A;  4QJ4 B;  1JUO A;  4IL1 A;  3ZWH A;  1NIW A;  3PSR A;  4DCK A;  3TUY B;  2M29 A;  1AP4 A;  2GGM A;  2LUC A;  1NYA A;  3TS5 B;  1QV1 A;  1K9K A;  1ALV A;  2ISD A;  2KGB C;  1YRT B;  2KI4 C;  1SR6 B;  2HQ8 A;  1D1O A;  1JWD A;  3O4Y A;  5HLO A;  2HF5 A;  1A75 B;  1NX0 A;  2BEC A;  2LE9 B;  3VRQ A;  2G9B A;  2LLT A;  1SPY A;  2F3Z A;  2F33 A;  1NCZ A;  1CM1 A; 
#chains in the Genus database with same CATH topology
 1TCF A;  1UHI A;  1K94 A;  4F0Z B;  1SCM C;  2JTZ A;  4YGA A;  3EKH A;  3JTD C;  2FCD A;  4CFQ A;  3KHE A;  1PVB A;  2PMY A;  5EL2 A;  1ZOT B;  3IF7 A;  1PSR A;  2LHI A;  3BFA A;  4BY4 A;  4JWQ A;  1J7Q A;  3SS3 A;  1QX7 A;  2KAX A;  3QME A;  3S0G A;  3BUM B;  2PSR A;  2KPH A;  2G2B A;  4MRX A;  3D74 A;  2LAN A;  3SG4 A;  1MXL C;  3CGA A;  3D0Y B;  1F55 A;  1SBJ A;  1WRL A;  1CFD A;  3RM1 A;  1J7R A;  1IWQ A;  1DQE A;  1L2O C;  1S3P A;  2PVB A;  3FWB A;  1DT7 B;  2OTG B;  2K7C A;  2M3W A;  3NSO A;  3DF0 A;  2I7A A;  4IJ7 A;  5AXI A;  1RFJ A;  1MR8 A;  3V2L A;  2JNF A;  1UUS A;  1M39 A;  1CDP A;  2LLU A;  4PHJ A;  1CDM A;  2WCE A;  1B9A A;  3DVJ A;  5I94 A;  1F4Q A;  1U5I B;  2K7O A;  2WCB A;  3PLF B;  4MBE A;  1LKJ A;  3OHM B;  1TTX A;  3CR5 X;  2LVV A;  1B8R A;  2CXJ A;  1M63 B;  2GTE A;  1UHH A;  4XJK B;  1RWY A;  1MF8 B;  3WNX B;  4OVN F;  1RTP 1;  2BCB A;  4MRY A;  1C3Y A;  3IQQ A;  1K2H A;  1J1D A;  1W9Z A;  3OBV A;  1SSE B;  1UP5 A;  3JVT C;  1M31 A;  5CSJ A;  2FCE A;  2JPT A;  2YGU A;  3TDZ A;  2WOS A;  1QXP A;  4Q04 A;  4C0L A;  1S5G Z;  1KFX S;  2K7D A;  2M1K B;  2E30 A;  2KLE A;  2LMV A;  5DIC A;  2JQ6 A;  1SYM A;  3R1O A;  4XJK A;  3WXA A;  4MLW A;  1KK7 Z;  3H4S E;  3PAT A;  1TNQ A;  1WY9 A;  4PE4 A;  1PRW A;  1BLQ A;  1BMO A;  4GPL B;  4N1F A;  1SY9 A;  3LL8 B;  3TDU A;  1TIZ A;  2A4J A;  2MAZ A;  1M46 A;  1KFU S;  5HKY A;  4MN0 A;  4DIR A;  2BE6 A;  1BR4 B;  1ZAC A;  3MSE B;  2QEO A;  1QV0 A;  1B8L A;  2JTT A;  1QAS A;  2WCL A;  4QJ3 B;  4ORC B;  4INX A;  3CYZ A;  5D7F A;  4JQ0 D;  3CWG A;  3O6B A;  1OOF A;  2MBX A;  3DZT A;  2VRG A;  1KWO B;  3VRN A;  1TRF A;  2O60 A;  1DC1 A;  2WCF A;  1CFF A;  1KQM B;  1KK8 C;  1TUZ A;  3L47 A;  3LK1 A;  1JSA A;  2DOQ A;  4JD9 A;  1NX3 A;  2KI6 D;  1IQ5 A;  1TWO A;  1YX7 A;  2KFG A;  1WDC C;  1G4Y R;  2L0P A;  2K8M B;  1DJY A;  2WND A;  1ZUZ A;  3FE8 A;  2JOJ A;  5AER A;  4YI8 A;  1IH0 A;  1MWN A;  4AQJ A;  1BR1 B;  2I18 A;  2COL B;  3RZS A;  1L7Z A;  2LHL A;  1K9U A;  1CLM A;  1WLM A;  3AKB A;  5CSI A;  5AFP A;  1CMF A;  1XK4 A;  3NXA A;  1QX2 A;  1OZO A;  1VRK A;  1YUR A;  2LUX A;  2KBM A;  2PAL A;  2QEB A;  3D10 A;  4P5O E;  5FYX A;  2P71 A;  1SCV A;  5FI6 A;  1CFC A;  1DGV A;  4YGB B;  2LVI A;  2Q91 A;  2E6W A;  4INW A;  1AJ4 A;  2HET A;  1Q80 A;  2ZKM X;  2H61 A;  2JC2 A;  3Q8I A;  2GGZ A;  3CZ1 A;  1AHR A;  3L4L A;  2Y5I A;  1QLK A;  3I5F B;  3TZ1 A;  5KU1 A;  1S6C A;  5DKN A;  2KSP A;  1E8A A;  2LP3 A;  2QEH A;  1Y6W A;  1N65 A;  2JT3 A;  5PAL A;  2OTG C;  5GQQ C;  3S0A A;  4JPZ B;  1XFW O;  3IQO A;  4TNC A;  3BUX B;  2JT8 A;  1J7P A;  2K61 A;  1LXF C;  4JKT A;  5HKW A;  3S0E A;  2BBN A;  2ZRT A;  3OX5 A;  1JBA A;  1YRU B;  1NP8 A;  4WRI A;  1DGU A;  1RJV A;  3EK7 A;  1CKK A;  1QVI Z;  3O4X A;  1OMR A;  3DYE A;  2P70 A;  2CBL A;  1OOH A;  1AUI B;  1OOI X;  4PHM A;  1XVJ A;  4R1E A;  1XFU O;  1CM4 A;  1DJW A;  3R1V A;  2JXL A;  4M2P A;  1XA5 A;  1TNX A;  1S1E A;  3FE9 A;  4DS7 A;  2WC8 A;  1IGV A;  4N1G A;  1Z4H A;  1AK8 A;  1NCY A;  3EVR A;  4FTG A;  1F54 A;  1IJ5 A;  1KCY A;  5JJG A;  1DJH A;  4A4B A;  1R6P A;  1TN4 A;  2JZI A;  2M49 B;  2EC6 C;  4GNK B;  4MZK A;  3DF0 B;  3OB2 B;  3B7A A;  1QTX A;  1MQ1 A;  3CZT X;  5HLV A;  1SRA A;  1V1F A;  3GK2 A;  1B47 A;  1SMG A;  1GJY A;  4A4C A;  1HQV A;  1LS8 A;  3E3R A;  3PJI A;  4PHN A;  4YGC B;  4YBH B;  3SJS A;  2EGD A;  4N5X A;  4GGF C;  3ZNI A;  2MLE C;  3NGV A;  5I2O A;  3CZ0 A;  1EG4 A;  1KWO C;  3EVU A;  1CLL A;  4C0J A;  1CB1 A;  2WCM A;  2JRF A;  1B7T Z;  4M2O A;  2K0J A;  3KF9 A;  2BE4 A;  1EXR A;  1WLZ A;  2D8N A;  1QS7 A;  1TOP A;  1A2X A;  2WOR A;  1Y1U A;  2R2I A;  3VB1 A;  4KYN A;  1F8H A;  1YR5 A;  3VRR A;  1GGZ A;  2MHH A;  4CPV A;  5HYD A;  1RK9 A;  4MSP A;  4PDZ A;  2LAP A;  2LVK A;  1PSB A;  2K2F A;  4MZL A;  4ZCU A;  2BL0 C;  1XYD A;  5D3O A;  1B8C A;  2ERB A;  2PYQ A;  3I5H C;  1F70 A;  5HL1 A;  5I2L A;  5DKQ A;  2ZFD A;  1N0Y A;  5TNC A;  4HRG A;  3FWC A;  4MEW A;  4E68 A;  1K95 A;  1M45 A;  1UHN A;  3SG5 A;  5CSF A;  1C7W A;  1DJI A;  5AEQ A;  2MJW B;  4DUQ A;  4C0K A;  2KGR A;  2M9G A;  1NPQ A;  2L2C A;  4I5L B;  3BXK A;  5KTY A;  1GM0 A;  1QIV A;  2KI4 B;  3RLZ A;  3HX4 A;  3AKA A;  3NSK A;  4FQO A;  3VGO A;  3CLN A;  1B4C A;  1Z2C B;  2KLD A;  3I5G C;  3BFB A;  3L4A A;  1XFZ O;  3N7H A;  5ER4 X;  1SCM B;  4L9M A;  5B8I B;  1BOC A;  2JU0 A;  1IQ3 A;  3JTD B;  3SG7 A;  3TUY C;  1OOG A;  2L51 A;  4YRU A;  3B88 A;  3BQ3 A;  2BKH B;  2M7N A;  4MZJ A;  3LLE A;  1KFX L;  2KAV A;  2OS8 B;  4YGE B;  3TS5 C;  2M8U A;  5K89 A;  1NWD A;  3SG6 A;  1SR6 C;  4XYN A;  4OKH A;  1C07 A;  4YI9 A;  5ER5 A;  1A29 A;  2L4H A;  2ZN9 A;  1MUX A;  1SKT A;  2AMI A;  3WHU B;  4UPG A;  1IRJ A;  1SK6 D;  2I94 A;  3BUW B;  4P2Y B;  1KFU L;  3SS5 A;  2WCH A;  1QIW A;  3BYA A;  4OV2 A;  4PHK A;  2GV5 A;  5FI7 A;  1K8U A;  2F2P A;  4NQG A;  2LC5 A;  3LCP C;  1PK0 D;  1V1G A;  2F3Y A;  2LNK A;  3CAB A;  4I5J A;  1QLS A;  1GQM A;  1N2D A;  1ORG A;  2KDH A;  2QAC A;  3R72 A;  2LVJ A;  4GGN A;  1X02 A;  1SW8 A;  1S5G Y;  1K90 D;  3KEV A;  4U8D A;  1BOD A;  4WQ3 A;  1G33 A;  5F6T A;  1CTR A;  3HCM A;  1J7O A;  1JFJ A;  1YUU A;  3D76 A;  3KPX A;  1KK7 Y;  3FE6 A;  2BCA A;  3CZ2 A;  1SL8 A;  1AJ5 A;  1WRK A;  1TNP A;  1YTZ C;  2B1U A;  2QEV A;  3BUN B;  2LMU A;  2KYF A;  1DJG A;  2F8P A;  1S6J A;  2M0R A;  3DVM A;  3PM2 A;  1G8I A;  4PAL A;  2KFH A;  1BU3 A;  3PN7 B;  3UNW A;  1FW4 A;  2BCX A;  4WQ2 A;  1C3Z A;  1TCO B;  4GBA A;  4PT1 A;  3AAK A;  1NSH A;  1Y0V H;  1W7I B;  2WCK A;  3EK8 A;  2BKI B;  1DTL A;  2L2E A;  1QWV A;  2ZRS A;  2SCP A;  1EG3 A;  2TN4 A;  2PAS A;  4HRH A;  2L98 A;  5CPV A;  3VRO A;  1REC A;  4D1E A;  2NCP A;  4ORB B;  1Y1X A;  2WC6 A;  3EVV A;  1TUJ A;  4GAO A;  3WHT B;  2NLN A;  2O5G A;  2F2O A;  1DEK A;  1FPW A;  1KK8 B;  2K7B A;  2AUC A;  4HRE E;  1LA0 A;  1EJ3 A;  2KI6 C;  1FI6 A;  1XFR A;  3F45 A;  1WDC B;  3GK4 X;  2NZ0 A;  1H4B A;  2L5Y A;  2LM5 A;  2CCM A;  4AQI A;  2V53 A;  3BUO B;  2SAS A;  1MHO A;  3BFH A;  2KOT A;  1FI5 A;  3CTN A;  2L5X B;  1UWO A;  1XO5 A;  2MLF C;  3M0W A;  1UHK A;  1DEL A;  2K60 A;  1J55 A;  3I5I B;  1QX5 B;  3DVK A;  1RRO A;  5HKZ A;  2FOT A;  1S36 A;  1A4P A;  3LK0 A;  3FIA A;  3FS7 A;  4I5K A;  1KQM C;  2P6B B;  4F7F A;  1DJX A;  1XK4 C;  1Y1A A;  3EKJ A;  1BG1 A;  3NSL A;  2HPS A;  2OS8 C;  1YUT A;  3NSI A;  1YUS A;  2BBM A;  2CT9 A;  1C7V A;  1UHJ A;  1A75 A;  1CFP A;  1OW4 A;  3B87 A;  2KQ6 A;  1DJZ A;  1MXE A;  2ZNE A;  1BJF A;  1B1G A;  3C1V A;  2PRU A;  2H61 C;  1JF2 A;  1YVL A;  2KYC A;  3S0F A;  1KQV A;  1K9P A;  2QPT A;  4OCI A;  5AAN A;  2MRD A;  1ZFS A;  1PVA A;  1QVI Y;  2JXC A;  3SS4 A;  2ZN8 A;  5J3X A;  2QDI A;  4ETO A;  2KBI A;  1EL4 A;  3AAJ A;  2OPO A;  3CR2 A;  1UUR A;  2LV7 A;  3BOW B;  3DD4 A;  2L4I A;  3KO0 A;  1FBV A;  4CID A;  1CMG A;  1K96 A;  2JNX A;  3K21 A;  3D0Y A;  2KQY A;  4YGD B;  1NCX A;  5I2Q A;  3I5F C;  4GFT A;  4NDD A;  4PE0 A;  3CR4 X;  4USL A;  3O2P A;  3DXL A;  2BNX A;  5DKR A;  1YX8 A;  3D75 A;  1IKU A;  1EH2 A;  1SL9 A;  2EHB A;  2HQW A;  1CDN A;  2LCP A;  3BOW A;  1NX2 A;  4QJ5 B;  2LP2 A;  1YVH A;  5BPJ A;  1IIO A;  1QAT A;  1DMO A;  3GOF A;  5I8N A;  3OX6 A;  2KAY A;  2KFF A;  1U5I A;  4ZCV A;  1BT6 A;  1J1E A;  1DVI A;  2NCO A;  5KSZ A;  1ALW A;  4CLN A;  3VRP A;  1S26 D;  1XFX O;  2MA2 A;  3PN7 C;  4GUK A;  1NUB A;  3IVT A;  4FQT A;  1P28 A;  1K93 D;  1JF0 A;  1W7J B;  3PAL A;  3SIB A;  3SG2 A;  5D69 A;  2EC6 B;  1LA3 A;  2L50 A;  4NDB A;  3A4U B;  2JPO A;  4AOM A;  1S6I A;  3DY9 A;  4I5N B;  5CSN A;  1B7T Y;  2NXQ A;  2RGI A;  1DF0 B;  4M2Q A;  1NX1 A;  3PM8 A;  3NHT A;  3CDN A;  3GK1 A;  1L2O B;  4HSZ A;  4NDC A;  3UO9 A;  1JC2 A;  1OMD A;  3QRX A;  2M7L A;  1SNL A;  1OMV A;  3S0D A;  2WCJ A;  3S0B A;  1PUL A;  4CFR A;  2Y4Q A;  2KNE A;  3EK4 A;  3PFV A;  5FI2 A;  2CTN A;  1OE9 B;  3B6X A;  2LLS A;  1DF0 A;  3ICB A;  2Y1M A;  2KHN A;  1OQP A;  3A8R A;  4GGF A;  1AVS A;  1OSA A;  2Q4U A;  3K1E A;  1T14 A;  1H8B A;  2M1U A;  5JOL A;  1SL7 A;  3O78 A;  4BY5 A;  2BAP A;  1LIN A;  1XFY O;  2ZND A;  3I5I C;  2Y1N A;  3NHI A;  4ORA B;  4PCW A;  4OR9 B;  3CS1 A;  3JVT B;  1KSO A;  3SG3 A;  2I2R E;  2BL0 B;  3I5H B;  2JUL A;  2H2K A;  5G08 A;  3OP0 A;  1WRZ A;  2JWW A;  1KSM A;  2WC5 A;  4PE1 A;  4DRW A;  1R2U A;  5IBW A;  1ODB A;  2K2A A;  2M97 A;  2LMT A;  1LVC D;  1PAL A;  1FF1 A;  2AAO A;  4ICB A;  1F71 A;  1CNP A;  3SIA A;  1XFV O;  1CLB A;  3OB1 B;  1ZMZ A;  1F4O A;  4MVF A;  1BF5 A;  1CDL A;  4OZD A;  1QJT A;  1IG5 A;  1OOJ A;  1GGW A;  1HT9 A;  1JFK A;  3DVE A;  4PE7 A;  1A03 A;  2IS9 A;  3TDI A;  1IJ6 A;  2JT0 A;  3EG5 B;  2CNP A;  2FJY A;  2FJU B;  3I5G B;  3R1P A;  1TNW A;  1OZS A;  3D77 A;  4QJ4 B;  1JUO A;  3D78 A;  4IL1 A;  3ZWH A;  1NIW A;  3PSR A;  4DCK A;  3TUY B;  2M29 A;  1AP4 A;  2GGM A;  2LUC A;  1NYA A;  3TS5 B;  1QV1 A;  1K9K A;  1ALV A;  2H8V A;  2ISD A;  2KGB C;  3B86 A;  1YRT B;  3OGN A;  2KI4 C;  1SR6 B;  2HQ8 A;  1D1O A;  1JWD A;  3O4Y A;  5HLO A;  2HF5 A;  1A75 B;  1NX0 A;  2BEC A;  2LE9 B;  3BJH A;  3VRQ A;  2G9B A;  2LLT A;  2PQL A;  3D73 A;  1SPY A;  2F3Z A;  2F33 A;  1NCZ A;  1CM1 A; 
#chains in the Genus database with same CATH homology
 1TCF A;  1UHI A;  1K94 A;  4F0Z B;  1SCM C;  2JTZ A;  4YGA A;  3EKH A;  3JTD C;  2FCD A;  4CFQ A;  3KHE A;  1PVB A;  2PMY A;  1ZOT B;  3IF7 A;  1PSR A;  2LHI A;  4BY4 A;  4JWQ A;  1J7Q A;  1QX7 A;  2KAX A;  3BUM B;  2PSR A;  2G2B A;  4MRX A;  2LAN A;  3SG4 A;  1MXL C;  3CGA A;  3D0Y B;  1F55 A;  1SBJ A;  1WRL A;  1CFD A;  3RM1 A;  1J7R A;  1IWQ A;  2PVB A;  1L2O C;  1S3P A;  3FWB A;  1DT7 B;  2OTG B;  2K7C A;  2M3W A;  3NSO A;  3DF0 A;  2I7A A;  5AXI A;  1RFJ A;  1MR8 A;  2JNF A;  1UUS A;  1M39 A;  1CDP A;  2LLU A;  4PHJ A;  1CDM A;  2WCE A;  1B9A A;  3DVJ A;  1F4Q A;  1U5I B;  2K7O A;  2WCB A;  3PLF B;  4MBE A;  1LKJ A;  3OHM B;  1TTX A;  3CR5 X;  2LVV A;  1B8R A;  2CXJ A;  1M63 B;  4XJK B;  1UHH A;  1RWY A;  1MF8 B;  3WNX B;  4OVN F;  1RTP 1;  2BCB A;  4MRY A;  1K2H A;  3IQQ A;  1J1D A;  3JVT C;  1UP5 A;  5CSJ A;  1M31 A;  2FCE A;  2JPT A;  3TDZ A;  2WOS A;  1QXP A;  4Q04 A;  4C0L A;  1S5G Z;  1KFX S;  2K7D A;  2M1K B;  2E30 A;  2LMV A;  2JQ6 A;  1SYM A;  4XJK A;  3WXA A;  4MLW A;  1KK7 Z;  3H4S E;  3PAT A;  1TNQ A;  1WY9 A;  4PE4 A;  1PRW A;  1BLQ A;  1BMO A;  4GPL B;  4N1F A;  1SY9 A;  3LL8 B;  3TDU A;  1TIZ A;  2A4J A;  2MAZ A;  1M46 A;  1KFU S;  5HKY A;  4MN0 A;  4DIR A;  2BE6 A;  1BR4 B;  1ZAC A;  3MSE B;  1QV0 A;  1B8L A;  2JTT A;  1QAS A;  4QJ3 B;  2MBX A;  4ORC B;  5D7F A;  3SIB A;  4JQ0 D;  3CWG A;  3O6B A;  2VRG A;  1KWO B;  3VRN A;  1TRF A;  2O60 A;  2WCF A;  1CFF A;  1KQM B;  1KK8 C;  1JSA A;  3LK1 A;  2DOQ A;  1NX3 A;  2KI6 D;  1IQ5 A;  2KFG A;  1YX7 A;  1WDC C;  1G4Y R;  2L0P A;  2K8M B;  1DJY A;  2WND A;  1ZUZ A;  5AER A;  2JOJ A;  4YI8 A;  1IH0 A;  1MWN A;  4AQJ A;  1BR1 B;  2I18 A;  2COL B;  1L7Z A;  2LHL A;  1K9U A;  1CLM A;  1WLM A;  3AKB A;  5CSI A;  5AFP A;  1CMF A;  1XK4 A;  3NXA A;  1QX2 A;  1OZO A;  1VRK A;  1YUR A;  2LUX A;  2KBM A;  2PAL A;  3D10 A;  4P5O E;  5FYX A;  1SCV A;  1CFC A;  1DGV A;  4YGB B;  2LVI A;  2Q91 A;  2E6W A;  1AJ4 A;  2HET A;  1Q80 A;  2ZKM X;  2H61 A;  2JC2 A;  2GGZ A;  1AHR A;  2Y5I A;  1QLK A;  3I5F B;  3TZ1 A;  5KU1 A;  1S6C A;  5DKN A;  2KSP A;  1E8A A;  2LP3 A;  1Y6W A;  1N65 A;  2JT3 A;  5PAL A;  2OTG C;  5GQQ C;  4JPZ B;  1XFW O;  3IQO A;  4TNC A;  3BUX B;  2JT8 A;  1J7P A;  2K61 A;  1LXF C;  5HKW A;  2BBN A;  2ZRT A;  3OX5 A;  1JBA A;  1YRU B;  1NP8 A;  4WRI A;  1DGU A;  1RJV A;  3EK7 A;  1CKK A;  1QVI Z;  1OMR A;  2CBL A;  4PHM A;  1AUI B;  4R1E A;  1XVJ A;  1XFU O;  1CM4 A;  1DJW A;  4M2P A;  2JXL A;  1XA5 A;  1TNX A;  1S1E A;  4DS7 A;  2WC8 A;  1IGV A;  4N1G A;  1AK8 A;  1NCY A;  3EVR A;  4FTG A;  1F54 A;  1IJ5 A;  1KCY A;  5JJG A;  1DJH A;  4A4B A;  1R6P A;  1TN4 A;  2JZI A;  2M49 B;  2EC6 C;  4GNK B;  4MZK A;  3DF0 B;  3OB2 B;  1QTX A;  1MQ1 A;  3CZT X;  5HLV A;  1SRA A;  1V1F A;  3GK2 A;  1B47 A;  1SMG A;  1GJY A;  4A4C A;  1HQV A;  3E3R A;  4PHN A;  4YGC B;  4YBH B;  3SJS A;  2EGD A;  4N5X A;  4GGF C;  3ZNI A;  2MLE C;  5I2O A;  1EG4 A;  1KWO C;  3EVU A;  1CLL A;  4C0J A;  1CB1 A;  2JRF A;  1B7T Z;  4M2O A;  2K0J A;  3KF9 A;  2BE4 A;  1EXR A;  1WLZ A;  2D8N A;  1QS7 A;  1TOP A;  1A2X A;  2WOR A;  1Y1U A;  2R2I A;  1F8H A;  1YR5 A;  3VRR A;  1GGZ A;  2MHH A;  4CPV A;  5HYD A;  1RK9 A;  4MSP A;  4PDZ A;  2LAP A;  2LVK A;  1PSB A;  2K2F A;  4MZL A;  4ZCU A;  2BL0 C;  1XYD A;  1B8C A;  3I5H C;  1F70 A;  5I2L A;  5DKQ A;  2ZFD A;  1N0Y A;  5TNC A;  4HRG A;  3FWC A;  4MEW A;  4E68 A;  1K95 A;  1M45 A;  1UHN A;  3SG5 A;  5CSF A;  1C7W A;  1DJI A;  5AEQ A;  2MJW B;  4DUQ A;  4C0K A;  2KGR A;  2M9G A;  1NPQ A;  4I5L B;  3BXK A;  5KTY A;  1QIV A;  2KI4 B;  3RLZ A;  3HX4 A;  3AKA A;  3NSK A;  4FQO A;  3VGO A;  3CLN A;  1B4C A;  3I5G C;  1XFZ O;  5ER4 X;  1SCM B;  4L9M A;  5B8I B;  1BOC A;  2JU0 A;  1IQ3 A;  3JTD B;  3SG7 A;  3TUY C;  2L51 A;  4YRU A;  3BQ3 A;  2BKH B;  2M7N A;  4MZJ A;  3LLE A;  1KFX L;  2KAV A;  2OS8 B;  4YGE B;  3TS5 C;  2M8U A;  5K89 A;  1NWD A;  3SG6 A;  1SR6 C;  4XYN A;  4OKH A;  1C07 A;  4YI9 A;  5ER5 A;  1A29 A;  2L4H A;  2ZN9 A;  1MUX A;  1SKT A;  2AMI A;  3WHU B;  4UPG A;  1IRJ A;  1SK6 D;  2I94 A;  3BUW B;  4P2Y B;  1KFU L;  1QIW A;  3BYA A;  4OV2 A;  4PHK A;  2GV5 A;  1K8U A;  2F2P A;  4NQG A;  2LC5 A;  3LCP C;  1PK0 D;  1V1G A;  2F3Y A;  2LNK A;  4I5J A;  1QLS A;  1GQM A;  1N2D A;  2KDH A;  2QAC A;  2LVJ A;  4GGN A;  1SW8 A;  1S5G Y;  1K90 D;  1X02 A;  3KEV A;  4U8D A;  1BOD A;  4WQ3 A;  1G33 A;  5F6T A;  1CTR A;  3HCM A;  1J7O A;  1JFJ A;  1YUU A;  3KPX A;  1KK7 Y;  2BCA A;  1SL8 A;  1AJ5 A;  1WRK A;  1TNP A;  1YTZ C;  2B1U A;  3BUN B;  2LMU A;  2KYF A;  1DJG A;  2F8P A;  1S6J A;  2M0R A;  3DVM A;  1G8I A;  4PAL A;  2KFH A;  1BU3 A;  3PN7 B;  1FW4 A;  2BCX A;  4WQ2 A;  1TCO B;  4GBA A;  3AAK A;  1NSH A;  1Y0V H;  1W7I B;  3EK8 A;  2BKI B;  1DTL A;  2L2E A;  2ZRS A;  2SCP A;  1EG3 A;  2TN4 A;  2PAS A;  4HRH A;  2L98 A;  5CPV A;  3VRO A;  1REC A;  4D1E A;  2NCP A;  4ORB B;  1Y1X A;  3EVV A;  3WHT B;  4GAO A;  2NLN A;  2O5G A;  2F2O A;  1FPW A;  1KK8 B;  2K7B A;  2AUC A;  4HRE E;  1LA0 A;  1EJ3 A;  2KI6 C;  1FI6 A;  3F45 A;  1WDC B;  3GK4 X;  2NZ0 A;  1H4B A;  2LM5 A;  2CCM A;  4AQI A;  2V53 A;  3BUO B;  2SAS A;  1MHO A;  2KOT A;  1FI5 A;  3CTN A;  2L5X B;  1UWO A;  1XO5 A;  2MLF C;  3M0W A;  1UHK A;  1J55 A;  3I5I B;  1QX5 B;  3DVK A;  1RRO A;  5HKZ A;  2FOT A;  1S36 A;  1A4P A;  3LK0 A;  3FIA A;  3FS7 A;  4I5K A;  1KQM C;  2P6B B;  1DJX A;  1XK4 C;  1Y1A A;  3EKJ A;  1BG1 A;  3NSL A;  2HPS A;  2OS8 C;  1YUT A;  3NSI A;  1YUS A;  2BBM A;  2CT9 A;  1C7V A;  1UHJ A;  1A75 A;  1CFP A;  2KQ6 A;  1DJZ A;  1MXE A;  2ZNE A;  1BJF A;  1B1G A;  3C1V A;  2PRU A;  2H61 C;  1JF2 A;  1YVL A;  2KYC A;  1KQV A;  1K9P A;  2QPT A;  4OCI A;  5AAN A;  2MRD A;  1ZFS A;  1PVA A;  1QVI Y;  2JXC A;  2ZN8 A;  5J3X A;  4ETO A;  2KBI A;  1EL4 A;  3AAJ A;  2OPO A;  3CR2 A;  1UUR A;  2LV7 A;  3BOW B;  3DD4 A;  2L4I A;  3KO0 A;  1FBV A;  4CID A;  1CMG A;  1K96 A;  2JNX A;  3K21 A;  3D0Y A;  2KQY A;  4YGD B;  1NCX A;  5I2Q A;  3I5F C;  4GFT A;  4NDD A;  4PE0 A;  3CR4 X;  4USL A;  3O2P A;  5DKR A;  1IKU A;  1YX8 A;  1EH2 A;  1SL9 A;  2EHB A;  2HQW A;  1CDN A;  2LCP A;  3BOW A;  1NX2 A;  4QJ5 B;  2LP2 A;  1YVH A;  5BPJ A;  1QAT A;  1DMO A;  3GOF A;  5I8N A;  3OX6 A;  2KAY A;  2KFF A;  1U5I A;  4ZCV A;  1BT6 A;  1J1E A;  1DVI A;  2NCO A;  5KSZ A;  1ALW A;  4CLN A;  3VRP A;  1S26 D;  1XFX O;  2MA2 A;  3PN7 C;  4GUK A;  1NUB A;  1K93 D;  1JF0 A;  1W7J B;  3PAL A;  3SG2 A;  5D69 A;  2EC6 B;  1LA3 A;  2L50 A;  4NDB A;  3A4U B;  4AOM A;  1S6I A;  4I5N B;  5CSN A;  1B7T Y;  2NXQ A;  2RGI A;  1DF0 B;  4M2Q A;  1NX1 A;  3PM8 A;  3GK1 A;  1L2O B;  4HSZ A;  4NDC A;  1JC2 A;  1OMD A;  3QRX A;  2M7L A;  1SNL A;  1OMV A;  1PUL A;  4CFR A;  2Y4Q A;  2KNE A;  3EK4 A;  3PFV A;  2CTN A;  1OE9 B;  2LLS A;  1DF0 A;  3ICB A;  2Y1M A;  2KHN A;  1OQP A;  3A8R A;  4GGF A;  1AVS A;  1OSA A;  2Q4U A;  1H8B A;  2M1U A;  5JOL A;  1SL7 A;  3O78 A;  4BY5 A;  1LIN A;  1XFY O;  2ZND A;  3I5I C;  2Y1N A;  4PCW A;  4ORA B;  4OR9 B;  3CS1 A;  3JVT B;  1KSO A;  3SG3 A;  2I2R E;  2BL0 B;  3I5H B;  2JUL A;  2H2K A;  5G08 A;  3OP0 A;  1WRZ A;  2JWW A;  1KSM A;  4PE1 A;  4DRW A;  1R2U A;  5IBW A;  1ODB A;  2K2A A;  2M97 A;  2LMT A;  1LVC D;  1PAL A;  1FF1 A;  2AAO A;  4ICB A;  1F71 A;  1CNP A;  3SIA A;  1XFV O;  1CLB A;  3OB1 B;  1ZMZ A;  1F4O A;  4MVF A;  1BF5 A;  1CDL A;  1QJT A;  1IG5 A;  1OOJ A;  1GGW A;  1HT9 A;  1JFK A;  3DVE A;  4PE7 A;  1A03 A;  2IS9 A;  3TDI A;  1IJ6 A;  2JT0 A;  2CNP A;  2FJU B;  3I5G B;  1TNW A;  1OZS A;  4QJ4 B;  1JUO A;  4IL1 A;  3ZWH A;  1NIW A;  3PSR A;  4DCK A;  3TUY B;  2M29 A;  1AP4 A;  2GGM A;  2LUC A;  1NYA A;  3TS5 B;  1QV1 A;  1K9K A;  1ALV A;  2ISD A;  2KGB C;  1YRT B;  2KI4 C;  1SR6 B;  2HQ8 A;  1D1O A;  1JWD A;  3O4Y A;  5HLO A;  2HF5 A;  1A75 B;  1NX0 A;  2BEC A;  2LE9 B;  3VRQ A;  2G9B A;  2LLT A;  1SPY A;  2F3Z A;  2F33 A;  1NCZ A;  1CM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...