1WLZA

Crystal structure of djbp fragment which was obtained by limited proteolysis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
85
structure length
85
Chain Sequence
HMATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAP-binding protein complex interacting protein 1 isoform a
publication title Crystal Structure of DJBP Fragment which was obtained by Limited Proteolysis
rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 30
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08976 EF-hand_11 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wlzA01
1KFXL 1YUSA 1ZACA 3I5IB 1A29A 3GOFA 2O60A 1CFFA 3A4UB 1NYAA 2JTTA 1AVSA 2M1UA 2M3WA 4HREE 1SR6B 1RWYA 4YGCB 1TIZA 1SRAA 3NSIA 4PHMA 4GFTA 1A03A 4MRXA 2KSPA 1BU3A 2HF5A 4ORCB 1M46A 2WCEA 2VRGA 1R6PA 3I5GB 3EVUA 4C0JA 5ER4X 1YURA 2KBIA 2FJUB 1IJ5A 1QXPA 5AANA 2SCPA 4M2OA 1DTLA 2BBMA 1K95A 3CR5X 1XFUO 1KSOA 4OV2A 1QJTA 2KYCA 4MEWA 3ZWHA 1LVCD 3SJSA 1AP4A 1HT9A 2EHBA 3OB2B 4GBAA 3BUXB 3O2PA 1QVIY 2K2FA 1ZFSA 2HQ8A 1W7IB 2ZRTA 1F70A 1AJ4A 2KFGA 1ALVA 2JWWA 1C7WA 2CNPA 1Y1XA 1J1DA 5I8NA 1JFKA 1GQMA 1L2OC 1DJXA 1S6IA 1UUSA 2R2IA 2B1UA 5DKQA 1IH0A 4GPLB 1BR4B 3EKHA 1SCMB 3IF7A 4JWQA 1F71A 2SASA 2BCXA 2CT9A 2JOJA 1XVJA 2LLTA 3PSRA 4MLWA 1JF2A 2JXLA 1QLSA 2FOTA 2MLFC 4NDBA 1B47A 2KAVA 1K9UA 2NLNA 5CSIA 1CLMA 1IGVA 1F55A 5KTYA 4JQ0D 1KK8B 1CTRA 1HQVA 2JTZA 3EKJA 1D1OA 2M7NA 4MBEA 3TDIA 4GAOA 2Y5IA 3RLZA 1A75A 2BE4A 2V53A 4CFQA 4DS7A 3RM1A 3LK0A 1K93D 4MZLA 4GGNA 2A4JA 4BY4A 2AUCA 2KGRA 5FYXA 1JC2A 3LL8B 4PHNA 4GNKB 2K7DA 1UWOA 1BJFA 2G9BA 2JULA 3QRXA 4DIRA 3O6BA 4QJ5B 4CPVA 2LMVA 1DGUA 5HKYA 1MF8B 2MRDA 3EVRA 1QIWA 4MRYA 3VGOA 4AOMA 4PHJA 4WRIA 4HSZA 1TNQA 2JXCA 2L4IA 1Q80A 1QV1A 4XJKA 1OE9B 1SNLA 1YX8A 3OHMB 4NQGA 1SYMA 2EGDA 1Y1UA 1G4YR 1BLQA 3PN7C 1KFXS 1DJYA 1CNPA 2M0RA 1KQMB 2WCBA 1S26D 1JUOA 1IQ5A 2Y1MA 1UP5A 3I5HC 2ZN9A 3BYAA 4Q04A 2NZ0A 1B4CA 1UURA 2L2EA 1IQ3A 1RTP1 2GGMA 3SG2A 2ZNDA 1KWOB 4L9MA 4OR9B 1SKTA 1C7VA 4IL1A 1MXLC 2KI4C 4WQ3A 1UHIA 2FCEA 4MSPA 3DVJA 2CCMA 5CSFA 5HKWA 4I5LB 5D7FA 2OPOA 1A75B 3SG7A 2H61C 2PRUA 3EK8A 3VRQA 1FF1A 3I5FC 2LE9B 3FS7A 3GK2A 4PE7A 2L5XB 3BUWB 3GK4X 3VRRA 1OZOA 2BL0C 2LUCA 2M9GA 1SK6D 2KBMA 1PALA 3C1VA 3SG5A 2AAOA 1DT7B 1B8CA 4YI8A 5PALA 4XJKB 1SMGA 2F2PA 1EH2A 1J1EA 1NSHA 5F6TA 4OCIA 1QX2A 4GGFA 3FWCA 2ZN8A 1LA0A 2LLUA 1DJGA 2M49B 1YVHA 2JT0A 2BCBA 2JC2A 4N1FA 1UHJA 2LUXA 2F2OA 1XFWO 1S1EA 3E3RA 1QV0A 3PALA 1BR1B 5JOLA 4ZCUA 1M31A 1NCXA 3SG4A 1SL9A 4PE4A 4P2YB 2HQWA 5CSNA 2KDHA 1NWDA 1YUTA 3SG3A 1AHRA 2K7BA 3I5IC 1CKKA 4DRWA 1G8IA 3MSEB 1NCYA 5DKRA 2K8MB 3OX6A 1QX5B 1B7TY 1NIWA 1SY9A 5CPVA 5J3XA 1TNXA 1K2HA 1RECA 1SL7A 2LC5A 4FTGA 2F3YA 3KHEA 5I2QA 4C0LA 1MHOA 3SG6A 2LAPA 1J7RA 1JBAA 1LKJA 5TNCA 1CB1A 1H8BA 1DF0A 2AMIA 1VRKA 2BKHB 3ZNIA 4D1EA 2M97A 1PK0D 4BY5A 1CM4A 1X02A 1SW8A 1MXEA 1XFXO 2MBXA 3WXAA 2BECA 4MVFA 4C0KA 3CWGA 2RGIA 1PVAA 1PVBA 3CS1A 4FQOA 4PE0A 1L2OB 4AQJA 2KYFA 5HYDA 1LA3A 3KEVA 2CTNA 1PRWA 3PM8A 1MWNA 2Q4UA 1TTXA 2L50A 1EG4A 1UHHA 3IQOA 4AQIA 2O5GA 2ZKMX 1SCMC 3DD4A 2JPTA 3CR2A 1XK4C 2M7LA 1YTZC 3D10A 2QPTA 4YRUA 2WOSA 1CFDA 4JPZB 3KPXA 1F4QA 4M2QA 1F8HA 1NX2A 2COLB 2PASA 2KI6C 2NXQA 2L0PA 5HLOA 2OS8B 5HLVA 2EC6C 1UHNA 2WC8A 4F0ZB 3NSKA 1A4PA 1SBJA 1Y6WA 5ER5A 3TUYB 2GGZA 1CDPA 1XFVO 2GV5A 2LHIA 4PALA 2WNDA 2JNXA 1IWQA 1DF0B 2LNKA 4NDCA 5AFPA 1RJVA 2CXJA 3DF0A 3O4YA 1K90D 1DGVA 1DJIA 1YR5A 3KO0A 1H4BA 4ORBB 4R1EA 1B8RA 1ZOTB 2LMUA 3AKAA 3NSOA 2ZNEA 1KCYA 1Y0VH 1EJ3A 2I18A 1LXFC 2OTGB 1Y1AA 1XO5A 3BQ3A 3BUNB 1CLLA 2K61A 5BPJA 2JNFA 3PN7B 1XA5A 1JSAA 1DJHA 1OQPA 1DMOA 1XFYO 4N5XA 2K2AA 2H2KA 5AEQA 3H4SE 1G33A 3I5HB 1KQMC 4CFRA 4DCKA 2KFFA 4GUKA 3WHUB 2WCFA 2Y4QA 4UPGA 1S6CA 3D0YA 3NXAA 3OX5A 1V1GA 1K96A 5GQQC 4HRGA 2LVJA 1F4OA 1KWOC 4WQ2A 1WDCC 1PSRA 2LCPA 1B7TZ 1K9PA 1SL8A 3LCPC 1YRTB 1TRFA 5B8IB 1QS7A 1S5GZ 1CMFA 1IJ6A 4U8DA 2LP2A 3IQQA 3TS5B 1GGZA 1YVLA 1TNWA 3JVTB 2BCAA 1XFZO 1L7ZA 2P6BB 5I2OA 1J7PA 1K8UA 1DVIA 1K94A 3DF0B 3EVVA 1NP8A 3KF9A 4NDDA 2BL0B 5JJGA 5G08A 1B8LA 1CM1A 1NX3A 2LANA 4M2PA 1KSMA 1BT6A 1M45A 2HETA 2PALA 5KSZA 1WRZA 3BUMB 1R2UA 1MUXA 2L98A 1ZUZA 2FCDA 1V1FA 1B1GA 3TDZA 1JFJA 2IS9A 3GK1A 1J7OA 3DVEA 3JTDC 1FW4A 1OMDA 1QLKA 1S36A 4ICBA 4YBHB 1DJZA 1YRUB 1J55A 2PVBA 3CTNA 3D0YB 1S6JA 2DOQA 3K21A 3OB1B 1GGWA 4USLA 4YGBB 1SR6C 2KOTA 2KNEA 1S5GY 1YUUA 2M1KB 1EG3A 2KAXA 4YGEB 2ZRSA 3O78A 5D69A 2BE6A 3I5GC 4QJ4B 1M63B 1FBVA 2LHLA 1U5IA 1QTXA 1WLMA 4PE1A 4ETOA 1AJ5A 2L51A 1E8AA 1LINA 3SIAA 4ZCVA 1UHKA 1RROA 3TDUA 3NSLA 4DUQA 1OMVA 2M8UA 3F45A 3M0WA 3BOWA 4A4CA 2KHNA 5I2LA 1SPYA 1M39A 4I5NB 1GJYA 4PDZA 3FIAA 5IBWA 2ISDA 2KQYA 2LVKA 1NCZA 2JT3A 2NCPA 1B9AA 1TCFA 5DKNA 1TOPA 2L4HA 3TZ1A 1AK8A 2F8PA 2Q91A 4GGFC 3AKBA 3OP0A 1XYDA 1WLZA 1KFUL 4CLNA 2MJWB 3HCMA 1ALWA 2KAYA 1N2DA 1CFPA 1NX0A 2KFHA 1C07A 2K0JA 3A8RA 2MLEC 2JQ6A 2LLSA 3SIBA 1PULA 2LM5A 4PHKA 1CDNA 2G2BA 4PCWA 1YX7A 2NCOA 1KK8C 2H61A 4MN0A 1CDLA 1N0YA 1NPQA 2JU0A 1OMRA 2EC6B 4I5KA 4MZJA 1AUIB 1U5IB 1A2XA 1RFJA 1TNPA 3CLNA 1WY9A 2K7OA 2OS8C 3LK1A 2KQ6A 4E68A 1KK7Z 3EK7A 1TN4A 2PMYA 4OVNF 1MQ1A 4OKHA 4HRHA 4ORAB 3PLFB 1OSAA 2K7CA 3AAJA 4CIDA 1FI5A 3TUYC 3VRNA 1EL4A 3WNXB 2LP3A 1CFCA 2MHHA 1K9KA 3BOWB 3PATA 2JRFA 1F54A 1WRKA 2D8NA 1KQVA 3ICBA 3VROA 1DJWA 1WRLA 1CDMA 3VRPA 2KI6D 2MAZA 1TCOB 2KGBC 5HKZA 1IG5A 2OTGC 2I7AA 4YGAA 3HX4A 1MR8A 2Y1NA 2LVIA 2BKIB 3CGAA 3CZTX 1EXRA 3DVMA 2TN4A 1BMOA 1W7JB 1IKUA 1J7QA 1JF0A 2E6WA 3FWBA 3BUOB 2KI4B 4A4BA 1RK9A 2LVVA 2I2RE 1FPWA 2M29A 2HPSA 3LLEA 1IRJA 1JWDA 1OOJA 1BODA 1S3PA 1WDCB 3I5FB 1KK7Y 2F3ZA 2E30A 2JZIA 1QATA 2I94A 5CSJA 1BOCA 1N65A 3AAKA 1BF5A 3PFVA 2BBNA 3BXKA 3WHTB 4QJ3B 2WORA 3TS5C 3JVTC 1FI6A 3EK4A 2LMTA 4YI9A 1BG1A 1QX7A 5AXIA 1NX1A 4YGDB 4MZKA 1CLBA 2CBLA 1QVIZ 2MA2A 2QACA 4N1GA 5K89A 4I5JA 4P5OE 1ODBA 2LV7A 1KFUS 1CMGA 1QASA 5KU1A 1QIVA 2JT8A 5AERA 4XYNA 1OZSA 3CR4X 3DVKA 1PSBA 3JTDB 2F33A 2ZFDA 1NUBA 1XK4A 4TNCA 2PSRA 1SCVA 1ZMZA
chains in the Genus database with same CATH superfamily
1KFXL 1W9ZA 1YUSA 1ZACA 3I5IB 1A29A 2P71A 3GOFA 2O60A 1CFFA 3A4UB 1NYAA 2JTTA 1AVSA 2M1UA 2M3WA 4HREE 1SR6B 1RWYA 3NHIA 4YGCB 1TIZA 1SRAA 3NSIA 3L4AA 4PHMA 4GFTA 1A03A 4MRXA 3PJIA 2KSPA 2L2CA 1BU3A 2HF5A 4ORCB 1M46A 2WCEA 2VRGA 1R6PA 3I5GB 3EVUA 4C0JA 5ER4X 3BFAA 1YURA 2KBIA 2FJUB 1IJ5A 1QXPA 5AANA 2SCPA 4M2OA 1DTLA 2BBMA 1K95A 3CR5X 1XFUO 1KSOA 4OV2A 1QJTA 2KYCA 4MEWA 3ZWHA 1LVCD 3SJSA 1AP4A 1HT9A 2EHBA 3OB2B 3PM2A 3BUXB 3O2PA 4GBAA 1QVIY 2K2FA 1ZFSA 2HQ8A 1W7IB 2ZRTA 5EL2A 3Q8IA 1AJ4A 2KFGA 1ALVA 1F70A 2JWWA 2K60A 1C3ZA 1C7WA 2CNPA 1Y1XA 1J1DA 5I8NA 1JFKA 1GQMA 1L2OC 1DJXA 1S6IA 1UUSA 2P70A 2B1UA 2R2IA 3R1PA 4GPLB 5DKQA 1IH0A 1BR4B 2KLEA 3EKHA 1SCMB 3IF7A 4JWQA 5D3OA 2SASA 2BCXA 2CT9A 2JOJA 1XVJA 2LLTA 3PSRA 4MLWA 3BFBA 1JF2A 1TUZA 2JXLA 1QLSA 2FOTA 2QEBA 3RZSA 2MLFC 4NDBA 1B47A 2KAVA 1K9UA 2NLNA 4IJ7A 5CSIA 1CLMA 2JPOA 5I94A 1IGVA 5FI7A 1F55A 5KTYA 2PYQA 4JQ0D 1DELA 1KK8B 1CTRA 1HQVA 2JTZA 3EKJA 1D1OA 2KPHA 2M7NA 1DEKA 3QMEA 4MBEA 3TDIA 4GAOA 2Y5IA 3RLZA 1A75A 2BE4A 2V53A 4CFQA 1IIOA 4DS7A 3RM1A 3LK0A 1K93D 4MZLA 4GGNA 2A4JA 4BY4A 2AUCA 2KGRA 5FYXA 1JC2A 3LL8B 4PHNA 3CYZA 4GNKB 2K7DA 1UWOA 1BJFA 2G9BA 2JULA 3QRXA 4DIRA 3O6BA 4QJ5B 4CPVA 2LMVA 1DGUA 5HKYA 1MF8B 2MRDA 3UO9A 3EVRA 1QIWA 4MRYA 3VGOA 4AOMA 4PHJA 4WRIA 3L47A 4HSZA 1TNQA 2JXCA 2L4IA 1LS8A 1Q80A 1QV1A 4XJKA 1OE9B 1SNLA 1YX8A 3OHMB 2YGUA 4NQGA 3SS4A 1SYMA 2EGDA 1Y1UA 1G4YR 3D77A 1BLQA 3PN7C 1KFXS 1DJYA 1CNPA 2M0RA 1KQMB 2WCBA 1S26D 1JUOA 1IQ5A 5DICA 2Y1MA 1UP5A 3I5HC 2ZN9A 3BYAA 4Q04A 2NZ0A 1B4CA 1UURA 2WC5A 2L2EA 1IQ3A 1RTP1 2GGMA 3SG2A 2ZNDA 1KWOB 3FE6A 4L9MA 4OR9B 1SKTA 1C7VA 2FJYA 3R1VA 4IL1A 1MXLC 2KI4C 4WQ3A 1UHIA 3V2LA 2FCEA 2WCJA 4MSPA 3DVJA 2CCMA 5CSFA 5HKWA 4I5LB 5D7FA 2OPOA 1A75B 3SG7A 2H61C 2PRUA 3EK8A 3VRQA 3DY9A 1FF1A 3I5FC 2LE9B 1OOHA 3FS7A 3GK2A 4PE7A 2L5XB 3BUWB 3GK4X 3VRRA 1OZOA 2BL0C 2LUCA 2M9GA 1SK6D 2KBMA 1PALA 3C1VA 3SG5A 2AAOA 1DT7B 1B8CA 4YI8A 5PALA 4XJKB 3DZTA 1SMGA 2F2PA 1EH2A 3L4LA 1J1EA 1NSHA 5F6TA 3CDNA 1QX2A 4OCIA 4GGFA 3FWCA 3S0AA 2ZN8A 1LA0A 2LLUA 1DJGA 3B87A 2M49B 1YVHA 2JT0A 2BCBA 2JC2A 4N1FA 1UHJA 2LUXA 2F2OA 1XFWO 1S1EA 3E3RA 1QV0A 2BAPA 3PALA 1BR1B 5JOLA 4ZCUA 1M31A 1NCXA 3D76A 1SL9A 3SG4A 4PE4A 4P2YB 2HQWA 5CSNA 2KDHA 1NWDA 1YUTA 3S0DA 3SG3A 1AHRA 2K7BA 4FQTA 3I5IC 3K1EA 2QEOA 4DRWA 1CKKA 1G8IA 3MSEB 1NCYA 3B6XA 5DKRA 1OOGA 2K8MB 4INWA 3S0GA 3OX6A 1QX5B 1B7TY 1NIWA 1SY9A 5CPVA 5J3XA 1TNXA 1K2HA 1RECA 1SL7A 2LC5A 4FTGA 2F3YA 3KHEA 5I2QA 4C0LA 1MHOA 3SG6A 2LAPA 1J7RA 2WCHA 1LKJA 1JBAA 1ORGA 5TNCA 1CB1A 1H8BA 1DF0A 2AMIA 1VRKA 2BKHB 3ZNIA 4D1EA 3VB1A 1P28A 1PK0D 2M97A 4BY5A 1CM4A 1X02A 2H8VA 2PQLA 1SW8A 1MXEA 1XFXO 2MBXA 3WXAA 2BECA 4MVFA 1GM0A 4C0KA 3CWGA 2RGIA 1PVAA 1PVBA 3CS1A 4FQOA 4PE0A 1L2OB 4AQJA 2KYFA 3OBVA 5HYDA 1LA3A 3KEVA 3N7HA 2CTNA 1PRWA 3PM8A 1MWNA 2Q4UA 4KYNA 1TTXA 2L50A 1EG4A 1UHHA 3IQOA 4AQIA 2O5GA 2ZKMX 1SCMC 3DD4A 2JPTA 3CR2A 1XK4C 2M7LA 3S0EA 1YTZC 3D10A 2QPTA 4YRUA 2WOSA 1CFDA 4JPZB 3KPXA 3NGVA 1F4QA 4M2QA 1F8HA 2L5YA 1NX2A 2COLB 2PASA 2KI6C 2NXQA 2L0PA 3D78A 5HLOA 2OS8B 5HLVA 2EC6C 1UHNA 2WC8A 4F0ZB 3NSKA 1A4PA 1SBJA 1Y6WA 5ER5A 3TUYB 2GGZA 1CDPA 1XFVO 2GV5A 2LHIA 4PALA 4PT1A 5HL1A 2WNDA 2JNXA 1IWQA 1DF0B 2LNKA 4NDCA 5AFPA 1RJVA 2CXJA 3DF0A 3O4YA 1K90D 1DGVA 1DJIA 1YR5A 3KO0A 3S0BA 1H4BA 4ORBB 4R1EA 1B8RA 1ZOTB 2LMUA 3AKAA 3NSOA 2ZNEA 1KCYA 1Y0VH 1EJ3A 2I18A 1LXFC 2QEHA 2QEVA 3FE9A 2OTGB 1Y1AA 1XO5A 3BQ3A 3BUNB 1CLLA 2K61A 5BPJA 2JNFA 2GTEA 4JKTA 3SS5A 4JD9A 3S0FA 3PN7B 1XA5A 1JSAA 1DJHA 1OQPA 1DMOA 1XFYO 4N5XA 2K2AA 2H2KA 3SS3A 5AEQA 3H4SE 1G33A 3I5HB 1KQMC 4CFRA 4DCKA 2KFFA 4GUKA 3WHUB 2WCFA 2Y4QA 4UPGA 1S6CA 3D0YA 3NXAA 3OX5A 3BJHA 1V1GA 1K96A 5GQQC 4HRGA 2LVJA 1F4OA 1KWOC 4WQ2A 1WDCC 1PSRA 2LCPA 1B7TZ 1K9PA 1SL8A 3LCPC 1YRTB 1TRFA 5B8IB 1QS7A 1S5GZ 1CMFA 1SSEB 1IJ6A 4U8DA 2LP2A 3IQQA 3TS5B 1GGZA 1YVLA 1TNWA 3JVTB 2BCAA 1XFZO 1L7ZA 2P6BB 5I2OA 1J7PA 1K8UA 1QWVA 1TUJA 1DVIA 1K94A 3DF0B 3EVVA 4INXA 1NP8A 3KF9A 4NDDA 2BL0B 5JJGA 5G08A 1B8LA 1CM1A 1NX3A 2LANA 4M2PA 1KSMA 3B7AA 1BT6A 1M45A 2HETA 2PALA 5KSZA 1WRZA 2ERBA 3BUMB 1R2UA 1MUXA 2L98A 1ZUZA 2FCDA 1V1FA 1C3YA 1B1GA 3TDZA 1JFJA 2IS9A 3GK1A 2BNXA 1J7OA 3CZ1A 3DVEA 3JTDC 1FW4A 1OMDA 1QLKA 1S36A 4ICBA 4YBHB 1DJZA 1TWOA 1YRUB 1J55A 2PVBA 1XFRA 3CTNA 2QDIA 3D0YB 1S6JA 2DOQA 3K21A 3OB1B 1GGWA 4USLA 4YGBB 1SR6C 2KOTA 1DC1A 2KNEA 5FI2A 1S5GY 1YUUA 2M1KB 1EG3A 2KAXA 4YGEB 2ZRSA 3O78A 5D69A 2BE6A 3I5GC 4QJ4B 1M63B 1FBVA 2LHLA 1U5IA 1QTXA 1WLMA 4PE1A 4ETOA 1AJ5A 2L51A 1E8AA 1LINA 1Z4HA 2WCKA 3SIAA 4ZCVA 3DYEA 1UHKA 1RROA 3R72A 3TDUA 3NSLA 3D75A 4DUQA 1OMVA 2M8UA 3F45A 3M0WA 3BOWA 4A4CA 2KHNA 5I2LA 1SPYA 1M39A 4I5NB 1GJYA 4PDZA 3FIAA 5IBWA 2ISDA 2KQYA 2LVKA 1NCZA 2JT3A 2NCPA 1B9AA 1TCFA 5DKNA 1TOPA 2L4HA 3TZ1A 1AK8A 2F8PA 2Q91A 4GGFC 3AKBA 3OP0A 1XYDA 1WLZA 1KFUL 3IVTA 2MJWB 3HCMA 4CLNA 1ALWA 3NHTA 2KAYA 1N2DA 1CFPA 1NX0A 2KFHA 1C07A 2K0JA 3A8RA 2MLEC 2JQ6A 2LLSA 3SIBA 1DQEA 1PULA 2LM5A 2WCMA 4PHKA 2G2BA 4PCWA 1YX7A 2NCOA 1CDNA 1KK8C 2H61A 4MN0A 1CDLA 1N0YA 1NPQA 2JU0A 1OMRA 2EC6B 4I5KA 4MZJA 1AUIB 2KLDA 1U5IB 1A2XA 1RFJA 1TNPA 3CLNA 1WY9A 2K7OA 3CABA 2OS8C 2WCLA 3LK1A 2KQ6A 4E68A 1KK7Z 3EK7A 1TN4A 2PMYA 4OVNF 1MQ1A 4OKHA 3D73A 4HRHA 4ORAB 3PLFB 1OSAA 2K7CA 3AAJA 4CIDA 1FI5A 3TUYC 3VRNA 1EL4A 3WNXB 2LP3A 1CFCA 2MHHA 3DXLA 1K9KA 3BOWB 3PATA 2JRFA 3CZ2A 1T14A 1F54A 1WRKA 3B88A 1OOIX 2D8NA 1KQVA 3ICBA 3O4XA 3VROA 1DJWA 1WRLA 1CDMA 3VRPA 2KI6D 2MAZA 1TCOB 4OZDA 2KGBC 5HKZA 1IG5A 2OTGC 2I7AA 2WC6A 3HX4A 1MR8A 2Y1NA 3R1OA 2LVIA 4YGAA 2BKIB 3CGAA 3CZTX 1EXRA 3DVMA 2TN4A 1BMOA 1Z2CB 1W7JB 1IKUA 1J7QA 1JF0A 2E6WA 3OGNA 3FWBA 3BUOB 2KI4B 3BFHA 4A4BA 1RK9A 2LVVA 2I2RE 1FPWA 2M29A 2HPSA 3LLEA 1IRJA 3D74A 3UNWA 1JWDA 1F71A 3FE8A 1OOJA 1BODA 1S3PA 1WDCB 3I5FB 1KK7Y 2F3ZA 2E30A 2JZIA 1QATA 2I94A 5CSJA 1BOCA 1N65A 3AAKA 1BF5A 3PFVA 2BBNA 3B86A 3BXKA 3WHTB 4QJ3B 2WORA 3TS5C 3JVTC 1FI6A 3EK4A 1OOFA 2LMTA 4F7FA 4YI9A 1BG1A 1QX7A 5AXIA 1NX1A 1OW4A 4MZKA 4YGDB 1CLBA 2CBLA 1QVIZ 2MA2A 2QACA 4N1GA 5K89A 4I5JA 3CZ0A 4P5OE 1ODBA 2LV7A 1KFUS 1CMGA 1QASA 5KU1A 1QIVA 2JT8A 5AERA 4XYNA 1OZSA 3CR4X 3DVKA 5FI6A 1PSBA 3JTDB 2F33A 2ZFDA 1NUBA 1XK4A 3EG5B 4TNCA 2PSRA 1SCVA 1ZMZA
chains in the Genus database with same CATH topology
1KFXL 1YUSA 1ZACA 3I5IB 1A29A 3GOFA 2O60A 1CFFA 3A4UB 1NYAA 2JTTA 1AVSA 2M1UA 2M3WA 4HREE 1SR6B 1RWYA 4YGCB 1TIZA 1SRAA 3NSIA 4PHMA 4GFTA 1A03A 4MRXA 2KSPA 1BU3A 2HF5A 4ORCB 1M46A 2WCEA 2VRGA 1R6PA 3I5GB 3EVUA 4C0JA 5ER4X 1YURA 2KBIA 2FJUB 1IJ5A 1QXPA 5AANA 2SCPA 4M2OA 1DTLA 2BBMA 1K95A 3CR5X 1XFUO 1KSOA 4OV2A 1QJTA 2KYCA 4MEWA 3ZWHA 1LVCD 3SJSA 1AP4A 1HT9A 2EHBA 3OB2B 4GBAA 3BUXB 3O2PA 1QVIY 2K2FA 1ZFSA 2HQ8A 1W7IB 2ZRTA 1F70A 1AJ4A 2KFGA 1ALVA 2JWWA 1C7WA 2CNPA 1Y1XA 1J1DA 5I8NA 1JFKA 1GQMA 1L2OC 1DJXA 1S6IA 1UUSA 2R2IA 2B1UA 5DKQA 1IH0A 4GPLB 1BR4B 3EKHA 1SCMB 3IF7A 4JWQA 1F71A 2SASA 2BCXA 2CT9A 2JOJA 1XVJA 2LLTA 3PSRA 4MLWA 1JF2A 2JXLA 1QLSA 2FOTA 2MLFC 4NDBA 1B47A 2KAVA 1K9UA 2NLNA 5CSIA 1CLMA 1IGVA 1F55A 5KTYA 4JQ0D 1KK8B 1CTRA 1HQVA 2JTZA 3EKJA 1D1OA 2M7NA 4MBEA 3TDIA 4GAOA 2Y5IA 3RLZA 1A75A 2BE4A 2V53A 4CFQA 4DS7A 3RM1A 3LK0A 1K93D 4MZLA 4GGNA 2A4JA 4BY4A 2AUCA 2KGRA 5FYXA 1JC2A 3LL8B 4PHNA 4GNKB 2K7DA 1UWOA 1BJFA 2G9BA 2JULA 3QRXA 4DIRA 3O6BA 4QJ5B 4CPVA 2LMVA 1DGUA 5HKYA 1MF8B 2MRDA 3EVRA 1QIWA 4MRYA 3VGOA 4AOMA 4PHJA 4WRIA 4HSZA 1TNQA 2JXCA 2L4IA 1Q80A 1QV1A 4XJKA 1OE9B 1SNLA 1YX8A 3OHMB 4NQGA 1SYMA 2EGDA 1Y1UA 1G4YR 1BLQA 3PN7C 1KFXS 1DJYA 1CNPA 2M0RA 1KQMB 2WCBA 1S26D 1JUOA 1IQ5A 2Y1MA 1UP5A 3I5HC 2ZN9A 3BYAA 4Q04A 2NZ0A 1B4CA 1UURA 2L2EA 1IQ3A 1RTP1 2GGMA 3SG2A 2ZNDA 1KWOB 4L9MA 4OR9B 1SKTA 1C7VA 4IL1A 1MXLC 2KI4C 4WQ3A 1UHIA 2FCEA 4MSPA 3DVJA 2CCMA 5CSFA 5HKWA 4I5LB 5D7FA 2OPOA 1A75B 3SG7A 2H61C 2PRUA 3EK8A 3VRQA 1FF1A 3I5FC 2LE9B 3FS7A 3GK2A 4PE7A 2L5XB 3BUWB 3GK4X 3VRRA 1OZOA 2BL0C 2LUCA 2M9GA 1SK6D 2KBMA 1PALA 3C1VA 3SG5A 2AAOA 1DT7B 1B8CA 4YI8A 5PALA 4XJKB 1SMGA 2F2PA 1EH2A 1J1EA 1NSHA 5F6TA 4OCIA 1QX2A 4GGFA 3FWCA 2ZN8A 1LA0A 2LLUA 1DJGA 2M49B 1YVHA 2JT0A 2BCBA 2JC2A 4N1FA 1UHJA 2LUXA 2F2OA 1XFWO 1S1EA 3E3RA 1QV0A 3PALA 1BR1B 5JOLA 4ZCUA 1M31A 1NCXA 3SG4A 1SL9A 4PE4A 4P2YB 2HQWA 5CSNA 2KDHA 1NWDA 1YUTA 3SG3A 1AHRA 2K7BA 3I5IC 1CKKA 4DRWA 1G8IA 3MSEB 1NCYA 5DKRA 2K8MB 3OX6A 1QX5B 1B7TY 1NIWA 1SY9A 5CPVA 5J3XA 1TNXA 1K2HA 1RECA 1SL7A 2LC5A 4FTGA 2F3YA 3KHEA 5I2QA 4C0LA 1MHOA 3SG6A 2LAPA 1J7RA 1JBAA 1LKJA 5TNCA 1CB1A 1H8BA 1DF0A 2AMIA 1VRKA 2BKHB 3ZNIA 4D1EA 2M97A 1PK0D 4BY5A 1CM4A 1X02A 1SW8A 1MXEA 1XFXO 2MBXA 3WXAA 2BECA 4MVFA 4C0KA 3CWGA 2RGIA 1PVAA 1PVBA 3CS1A 4FQOA 4PE0A 1L2OB 4AQJA 2KYFA 5HYDA 1LA3A 3KEVA 2CTNA 1PRWA 3PM8A 1MWNA 2Q4UA 1TTXA 2L50A 1EG4A 1UHHA 3IQOA 4AQIA 2O5GA 2ZKMX 1SCMC 3DD4A 2JPTA 3CR2A 1XK4C 2M7LA 1YTZC 3D10A 2QPTA 4YRUA 2WOSA 1CFDA 4JPZB 3KPXA 1F4QA 4M2QA 1F8HA 1NX2A 2COLB 2PASA 2KI6C 2NXQA 2L0PA 5HLOA 2OS8B 5HLVA 2EC6C 1UHNA 2WC8A 4F0ZB 3NSKA 1A4PA 1SBJA 1Y6WA 5ER5A 3TUYB 2GGZA 1CDPA 1XFVO 2GV5A 2LHIA 4PALA 2WNDA 2JNXA 1IWQA 1DF0B 2LNKA 4NDCA 5AFPA 1RJVA 2CXJA 3DF0A 3O4YA 1K90D 1DGVA 1DJIA 1YR5A 3KO0A 1H4BA 4ORBB 4R1EA 1B8RA 1ZOTB 2LMUA 3AKAA 3NSOA 2ZNEA 1KCYA 1Y0VH 1EJ3A 2I18A 1LXFC 2OTGB 1Y1AA 1XO5A 3BQ3A 3BUNB 1CLLA 2K61A 5BPJA 2JNFA 3PN7B 1XA5A 1JSAA 1DJHA 1OQPA 1DMOA 1XFYO 4N5XA 2K2AA 2H2KA 5AEQA 3H4SE 1G33A 3I5HB 1KQMC 4CFRA 4DCKA 2KFFA 4GUKA 3WHUB 2WCFA 2Y4QA 4UPGA 1S6CA 3D0YA 3NXAA 3OX5A 1V1GA 1K96A 5GQQC 4HRGA 2LVJA 1F4OA 1KWOC 4WQ2A 1WDCC 1PSRA 2LCPA 1B7TZ 1K9PA 1SL8A 3LCPC 1YRTB 1TRFA 5B8IB 1QS7A 1S5GZ 1CMFA 1IJ6A 4U8DA 2LP2A 3IQQA 3TS5B 1GGZA 1YVLA 1TNWA 3JVTB 2BCAA 1XFZO 1L7ZA 2P6BB 5I2OA 1J7PA 1K8UA 1DVIA 1K94A 3DF0B 3EVVA 1NP8A 3KF9A 4NDDA 2BL0B 5JJGA 5G08A 1B8LA 1CM1A 1NX3A 2LANA 4M2PA 1KSMA 1BT6A 1M45A 2HETA 2PALA 5KSZA 1WRZA 3BUMB 1R2UA 1MUXA 2L98A 1ZUZA 2FCDA 1V1FA 1B1GA 3TDZA 1JFJA 2IS9A 3GK1A 1J7OA 3DVEA 3JTDC 1FW4A 1OMDA 1QLKA 1S36A 4ICBA 4YBHB 1DJZA 1YRUB 1J55A 2PVBA 3CTNA 3D0YB 1S6JA 2DOQA 3K21A 3OB1B 1GGWA 4USLA 4YGBB 1SR6C 2KOTA 2KNEA 1S5GY 1YUUA 2M1KB 1EG3A 2KAXA 4YGEB 2ZRSA 3O78A 5D69A 2BE6A 3I5GC 4QJ4B 1M63B 1FBVA 2LHLA 1U5IA 1QTXA 1WLMA 4PE1A 4ETOA 1AJ5A 2L51A 1E8AA 1LINA 3SIAA 4ZCVA 1UHKA 1RROA 3TDUA 3NSLA 4DUQA 1OMVA 2M8UA 3F45A 3M0WA 3BOWA 4A4CA 2KHNA 5I2LA 1SPYA 1M39A 4I5NB 1GJYA 4PDZA 3FIAA 5IBWA 2ISDA 2KQYA 2LVKA 1NCZA 2JT3A 2NCPA 1B9AA 1TCFA 5DKNA 1TOPA 2L4HA 3TZ1A 1AK8A 2F8PA 2Q91A 4GGFC 3AKBA 3OP0A 1XYDA 1WLZA 1KFUL 4CLNA 2MJWB 3HCMA 1ALWA 2KAYA 1N2DA 1CFPA 1NX0A 2KFHA 1C07A 2K0JA 3A8RA 2MLEC 2JQ6A 2LLSA 3SIBA 1PULA 2LM5A 4PHKA 1CDNA 2G2BA 4PCWA 1YX7A 2NCOA 1KK8C 2H61A 4MN0A 1CDLA 1N0YA 1NPQA 2JU0A 1OMRA 2EC6B 4I5KA 4MZJA 1AUIB 1U5IB 1A2XA 1RFJA 1TNPA 3CLNA 1WY9A 2K7OA 2OS8C 3LK1A 2KQ6A 4E68A 1KK7Z 3EK7A 1TN4A 2PMYA 4OVNF 1MQ1A 4OKHA 4HRHA 4ORAB 3PLFB 1OSAA 2K7CA 3AAJA 4CIDA 1FI5A 3TUYC 3VRNA 1EL4A 3WNXB 2LP3A 1CFCA 2MHHA 1K9KA 3BOWB 3PATA 2JRFA 1F54A 1WRKA 2D8NA 1KQVA 3ICBA 3VROA 1DJWA 1WRLA 1CDMA 3VRPA 2KI6D 2MAZA 1TCOB 2KGBC 5HKZA 1IG5A 2OTGC 2I7AA 4YGAA 3HX4A 1MR8A 2Y1NA 2LVIA 2BKIB 3CGAA 3CZTX 1EXRA 3DVMA 2TN4A 1BMOA 1W7JB 1IKUA 1J7QA 1JF0A 2E6WA 3FWBA 3BUOB 2KI4B 4A4BA 1RK9A 2LVVA 2I2RE 1FPWA 2M29A 2HPSA 3LLEA 1IRJA 1JWDA 1OOJA 1BODA 1S3PA 1WDCB 3I5FB 1KK7Y 2F3ZA 2E30A 2JZIA 1QATA 2I94A 5CSJA 1BOCA 1N65A 3AAKA 1BF5A 3PFVA 2BBNA 3BXKA 3WHTB 4QJ3B 2WORA 3TS5C 3JVTC 1FI6A 3EK4A 2LMTA 4YI9A 1BG1A 1QX7A 5AXIA 1NX1A 4YGDB 4MZKA 1CLBA 2CBLA 1QVIZ 2MA2A 2QACA 4N1GA 5K89A 4I5JA 4P5OE 1ODBA 2LV7A 1KFUS 1CMGA 1QASA 5KU1A 1QIVA 2JT8A 5AERA 4XYNA 1OZSA 3CR4X 3DVKA 1PSBA 3JTDB 2F33A 2ZFDA 1NUBA 1XK4A 4TNCA 2PSRA 1SCVA 1ZMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  1YUS A;  1ZAC A;  3I5I B;  1A29 A;  3GOF A;  2O60 A;  1CFF A;  3A4U B;  1NYA A;  2JTT A;  1AVS A;  2M1U A;  2M3W A;  4HRE E;  1SR6 B;  1RWY A;  4YGC B;  1TIZ A;  1SRA A;  3NSI A;  4PHM A;  4GFT A;  1A03 A;  4MRX A;  2KSP A;  1BU3 A;  2HF5 A;  4ORC B;  1M46 A;  2WCE A;  2VRG A;  1R6P A;  3I5G B;  3EVU A;  4C0J A;  5ER4 X;  1YUR A;  2KBI A;  2FJU B;  1IJ5 A;  1QXP A;  5AAN A;  2SCP A;  4M2O A;  1DTL A;  2BBM A;  1K95 A;  3CR5 X;  1XFU O;  1KSO A;  4OV2 A;  1QJT A;  2KYC A;  4MEW A;  3ZWH A;  1LVC D;  3SJS A;  1AP4 A;  1HT9 A;  2EHB A;  3OB2 B;  4GBA A;  3BUX B;  3O2P A;  1QVI Y;  2K2F A;  1ZFS A;  2HQ8 A;  1W7I B;  2ZRT A;  1F70 A;  1AJ4 A;  2KFG A;  1ALV A;  2JWW A;  1C7W A;  2CNP A;  1Y1X A;  1J1D A;  5I8N A;  1JFK A;  1GQM A;  1L2O C;  1DJX A;  1S6I A;  1UUS A;  2R2I A;  2B1U A;  5DKQ A;  1IH0 A;  4GPL B;  1BR4 B;  3EKH A;  1SCM B;  3IF7 A;  4JWQ A;  1F71 A;  2SAS A;  2BCX A;  2CT9 A;  2JOJ A;  1XVJ A;  2LLT A;  3PSR A;  4MLW A;  1JF2 A;  2JXL A;  1QLS A;  2FOT A;  2MLF C;  4NDB A;  1B47 A;  2KAV A;  1K9U A;  2NLN A;  5CSI A;  1CLM A;  1IGV A;  1F55 A;  5KTY A;  4JQ0 D;  1KK8 B;  1CTR A;  1HQV A;  2JTZ A;  3EKJ A;  1D1O A;  2M7N A;  4MBE A;  3TDI A;  4GAO A;  2Y5I A;  3RLZ A;  1A75 A;  2BE4 A;  2V53 A;  4CFQ A;  4DS7 A;  3RM1 A;  3LK0 A;  1K93 D;  4MZL A;  4GGN A;  2A4J A;  4BY4 A;  2AUC A;  2KGR A;  5FYX A;  1JC2 A;  3LL8 B;  4PHN A;  4GNK B;  2K7D A;  1UWO A;  1BJF A;  2G9B A;  2JUL A;  3QRX A;  4DIR A;  3O6B A;  4QJ5 B;  4CPV A;  2LMV A;  1DGU A;  5HKY A;  1MF8 B;  2MRD A;  3EVR A;  1QIW A;  4MRY A;  3VGO A;  4AOM A;  4PHJ A;  4WRI A;  4HSZ A;  1TNQ A;  2JXC A;  2L4I A;  1Q80 A;  1QV1 A;  4XJK A;  1OE9 B;  1SNL A;  1YX8 A;  3OHM B;  4NQG A;  1SYM A;  2EGD A;  1Y1U A;  1G4Y R;  1BLQ A;  3PN7 C;  1KFX S;  1DJY A;  1CNP A;  2M0R A;  1KQM B;  2WCB A;  1S26 D;  1JUO A;  1IQ5 A;  2Y1M A;  1UP5 A;  3I5H C;  2ZN9 A;  3BYA A;  4Q04 A;  2NZ0 A;  1B4C A;  1UUR A;  2L2E A;  1IQ3 A;  1RTP 1;  2GGM A;  3SG2 A;  2ZND A;  1KWO B;  4L9M A;  4OR9 B;  1SKT A;  1C7V A;  4IL1 A;  1MXL C;  2KI4 C;  4WQ3 A;  1UHI A;  2FCE A;  4MSP A;  3DVJ A;  2CCM A;  5CSF A;  5HKW A;  4I5L B;  5D7F A;  2OPO A;  1A75 B;  3SG7 A;  2H61 C;  2PRU A;  3EK8 A;  3VRQ A;  1FF1 A;  3I5F C;  2LE9 B;  3FS7 A;  3GK2 A;  4PE7 A;  2L5X B;  3BUW B;  3GK4 X;  3VRR A;  1OZO A;  2BL0 C;  2LUC A;  2M9G A;  1SK6 D;  2KBM A;  1PAL A;  3C1V A;  3SG5 A;  2AAO A;  1DT7 B;  1B8C A;  4YI8 A;  5PAL A;  4XJK B;  1SMG A;  2F2P A;  1EH2 A;  1J1E A;  1NSH A;  5F6T A;  4OCI A;  1QX2 A;  4GGF A;  3FWC A;  2ZN8 A;  1LA0 A;  2LLU A;  1DJG A;  2M49 B;  1YVH A;  2JT0 A;  2BCB A;  2JC2 A;  4N1F A;  1UHJ A;  2LUX A;  2F2O A;  1XFW O;  1S1E A;  3E3R A;  1QV0 A;  3PAL A;  1BR1 B;  5JOL A;  4ZCU A;  1M31 A;  1NCX A;  3SG4 A;  1SL9 A;  4PE4 A;  4P2Y B;  2HQW A;  5CSN A;  2KDH A;  1NWD A;  1YUT A;  3SG3 A;  1AHR A;  2K7B A;  3I5I C;  1CKK A;  4DRW A;  1G8I A;  3MSE B;  1NCY A;  5DKR A;  2K8M B;  3OX6 A;  1QX5 B;  1B7T Y;  1NIW A;  1SY9 A;  5CPV A;  5J3X A;  1TNX A;  1K2H A;  1REC A;  1SL7 A;  2LC5 A;  4FTG A;  2F3Y A;  3KHE A;  5I2Q A;  4C0L A;  1MHO A;  3SG6 A;  2LAP A;  1J7R A;  1JBA A;  1LKJ A;  5TNC A;  1CB1 A;  1H8B A;  1DF0 A;  2AMI A;  1VRK A;  2BKH B;  3ZNI A;  4D1E A;  2M97 A;  1PK0 D;  4BY5 A;  1CM4 A;  1X02 A;  1SW8 A;  1MXE A;  1XFX O;  2MBX A;  3WXA A;  2BEC A;  4MVF A;  4C0K A;  3CWG A;  2RGI A;  1PVA A;  1PVB A;  3CS1 A;  4FQO A;  4PE0 A;  1L2O B;  4AQJ A;  2KYF A;  5HYD A;  1LA3 A;  3KEV A;  2CTN A;  1PRW A;  3PM8 A;  1MWN A;  2Q4U A;  1TTX A;  2L50 A;  1EG4 A;  1UHH A;  3IQO A;  4AQI A;  2O5G A;  2ZKM X;  1SCM C;  3DD4 A;  2JPT A;  3CR2 A;  1XK4 C;  2M7L A;  1YTZ C;  3D10 A;  2QPT A;  4YRU A;  2WOS A;  1CFD A;  4JPZ B;  3KPX A;  1F4Q A;  4M2Q A;  1F8H A;  1NX2 A;  2COL B;  2PAS A;  2KI6 C;  2NXQ A;  2L0P A;  5HLO A;  2OS8 B;  5HLV A;  2EC6 C;  1UHN A;  2WC8 A;  4F0Z B;  3NSK A;  1A4P A;  1SBJ A;  1Y6W A;  5ER5 A;  3TUY B;  2GGZ A;  1CDP A;  1XFV O;  2GV5 A;  2LHI A;  4PAL A;  2WND A;  2JNX A;  1IWQ A;  1DF0 B;  2LNK A;  4NDC A;  5AFP A;  1RJV A;  2CXJ A;  3DF0 A;  3O4Y A;  1K90 D;  1DGV A;  1DJI A;  1YR5 A;  3KO0 A;  1H4B A;  4ORB B;  4R1E A;  1B8R A;  1ZOT B;  2LMU A;  3AKA A;  3NSO A;  2ZNE A;  1KCY A;  1Y0V H;  1EJ3 A;  2I18 A;  1LXF C;  2OTG B;  1Y1A A;  1XO5 A;  3BQ3 A;  3BUN B;  1CLL A;  2K61 A;  5BPJ A;  2JNF A;  3PN7 B;  1XA5 A;  1JSA A;  1DJH A;  1OQP A;  1DMO A;  1XFY O;  4N5X A;  2K2A A;  2H2K A;  5AEQ A;  3H4S E;  1G33 A;  3I5H B;  1KQM C;  4CFR A;  4DCK A;  2KFF A;  4GUK A;  3WHU B;  2WCF A;  2Y4Q A;  4UPG A;  1S6C A;  3D0Y A;  3NXA A;  3OX5 A;  1V1G A;  1K96 A;  5GQQ C;  4HRG A;  2LVJ A;  1F4O A;  1KWO C;  4WQ2 A;  1WDC C;  1PSR A;  2LCP A;  1B7T Z;  1K9P A;  1SL8 A;  3LCP C;  1YRT B;  1TRF A;  5B8I B;  1QS7 A;  1S5G Z;  1CMF A;  1IJ6 A;  4U8D A;  2LP2 A;  3IQQ A;  3TS5 B;  1GGZ A;  1YVL A;  1TNW A;  3JVT B;  2BCA A;  1XFZ O;  1L7Z A;  2P6B B;  5I2O A;  1J7P A;  1K8U A;  1DVI A;  1K94 A;  3DF0 B;  3EVV A;  1NP8 A;  3KF9 A;  4NDD A;  2BL0 B;  5JJG A;  5G08 A;  1B8L A;  1CM1 A;  1NX3 A;  2LAN A;  4M2P A;  1KSM A;  1BT6 A;  1M45 A;  2HET A;  2PAL A;  5KSZ A;  1WRZ A;  3BUM B;  1R2U A;  1MUX A;  2L98 A;  1ZUZ A;  2FCD A;  1V1F A;  1B1G A;  3TDZ A;  1JFJ A;  2IS9 A;  3GK1 A;  1J7O A;  3DVE A;  3JTD C;  1FW4 A;  1OMD A;  1QLK A;  1S36 A;  4ICB A;  4YBH B;  1DJZ A;  1YRU B;  1J55 A;  2PVB A;  3CTN A;  3D0Y B;  1S6J A;  2DOQ A;  3K21 A;  3OB1 B;  1GGW A;  4USL A;  4YGB B;  1SR6 C;  2KOT A;  2KNE A;  1S5G Y;  1YUU A;  2M1K B;  1EG3 A;  2KAX A;  4YGE B;  2ZRS A;  3O78 A;  5D69 A;  2BE6 A;  3I5G C;  4QJ4 B;  1M63 B;  1FBV A;  2LHL A;  1U5I A;  1QTX A;  1WLM A;  4PE1 A;  4ETO A;  1AJ5 A;  2L51 A;  1E8A A;  1LIN A;  3SIA A;  4ZCV A;  1UHK A;  1RRO A;  3TDU A;  3NSL A;  4DUQ A;  1OMV A;  2M8U A;  3F45 A;  3M0W A;  3BOW A;  4A4C A;  2KHN A;  5I2L A;  1SPY A;  1M39 A;  4I5N B;  1GJY A;  4PDZ A;  3FIA A;  5IBW A;  2ISD A;  2KQY A;  2LVK A;  1NCZ A;  2JT3 A;  2NCP A;  1B9A A;  1TCF A;  5DKN A;  1TOP A;  2L4H A;  3TZ1 A;  1AK8 A;  2F8P A;  2Q91 A;  4GGF C;  3AKB A;  3OP0 A;  1XYD A;  1WLZ A;  1KFU L;  4CLN A;  2MJW B;  3HCM A;  1ALW A;  2KAY A;  1N2D A;  1CFP A;  1NX0 A;  2KFH A;  1C07 A;  2K0J A;  3A8R A;  2MLE C;  2JQ6 A;  2LLS A;  3SIB A;  1PUL A;  2LM5 A;  4PHK A;  1CDN A;  2G2B A;  4PCW A;  1YX7 A;  2NCO A;  1KK8 C;  2H61 A;  4MN0 A;  1CDL A;  1N0Y A;  1NPQ A;  2JU0 A;  1OMR A;  2EC6 B;  4I5K A;  4MZJ A;  1AUI B;  1U5I B;  1A2X A;  1RFJ A;  1TNP A;  3CLN A;  1WY9 A;  2K7O A;  2OS8 C;  3LK1 A;  2KQ6 A;  4E68 A;  1KK7 Z;  3EK7 A;  1TN4 A;  2PMY A;  4OVN F;  1MQ1 A;  4OKH A;  4HRH A;  4ORA B;  3PLF B;  1OSA A;  2K7C A;  3AAJ A;  4CID A;  1FI5 A;  3TUY C;  3VRN A;  1EL4 A;  3WNX B;  2LP3 A;  1CFC A;  2MHH A;  1K9K A;  3BOW B;  3PAT A;  2JRF A;  1F54 A;  1WRK A;  2D8N A;  1KQV A;  3ICB A;  3VRO A;  1DJW A;  1WRL A;  1CDM A;  3VRP A;  2KI6 D;  2MAZ A;  1TCO B;  2KGB C;  5HKZ A;  1IG5 A;  2OTG C;  2I7A A;  4YGA A;  3HX4 A;  1MR8 A;  2Y1N A;  2LVI A;  2BKI B;  3CGA A;  3CZT X;  1EXR A;  3DVM A;  2TN4 A;  1BMO A;  1W7J B;  1IKU A;  1J7Q A;  1JF0 A;  2E6W A;  3FWB A;  3BUO B;  2KI4 B;  4A4B A;  1RK9 A;  2LVV A;  2I2R E;  1FPW A;  2M29 A;  2HPS A;  3LLE A;  1IRJ A;  1JWD A;  1OOJ A;  1BOD A;  1S3P A;  1WDC B;  3I5F B;  1KK7 Y;  2F3Z A;  2E30 A;  2JZI A;  1QAT A;  2I94 A;  5CSJ A;  1BOC A;  1N65 A;  3AAK A;  1BF5 A;  3PFV A;  2BBN A;  3BXK A;  3WHT B;  4QJ3 B;  2WOR A;  3TS5 C;  3JVT C;  1FI6 A;  3EK4 A;  2LMT A;  4YI9 A;  1BG1 A;  1QX7 A;  5AXI A;  1NX1 A;  4YGD B;  4MZK A;  1CLB A;  2CBL A;  1QVI Z;  2MA2 A;  2QAC A;  4N1G A;  5K89 A;  4I5J A;  4P5O E;  1ODB A;  2LV7 A;  1KFU S;  1CMG A;  1QAS A;  5KU1 A;  1QIV A;  2JT8 A;  5AER A;  4XYN A;  1OZS A;  3CR4 X;  3DVK A;  1PSB A;  3JTD B;  2F33 A;  2ZFD A;  1NUB A;  1XK4 A;  4TNC A;  2PSR A;  1SCV A;  1ZMZ A; 
#chains in the Genus database with same CATH topology
 1KFX L;  1W9Z A;  1YUS A;  1ZAC A;  3I5I B;  1A29 A;  2P71 A;  3GOF A;  2O60 A;  1CFF A;  3A4U B;  1NYA A;  2JTT A;  1AVS A;  2M1U A;  2M3W A;  4HRE E;  1SR6 B;  1RWY A;  3NHI A;  4YGC B;  1TIZ A;  1SRA A;  3NSI A;  3L4A A;  4PHM A;  4GFT A;  1A03 A;  4MRX A;  3PJI A;  2KSP A;  2L2C A;  1BU3 A;  2HF5 A;  4ORC B;  1M46 A;  2WCE A;  2VRG A;  1R6P A;  3I5G B;  3EVU A;  4C0J A;  5ER4 X;  3BFA A;  1YUR A;  2KBI A;  2FJU B;  1IJ5 A;  1QXP A;  5AAN A;  2SCP A;  4M2O A;  1DTL A;  2BBM A;  1K95 A;  3CR5 X;  1XFU O;  1KSO A;  4OV2 A;  1QJT A;  2KYC A;  4MEW A;  3ZWH A;  1LVC D;  3SJS A;  1AP4 A;  1HT9 A;  2EHB A;  3OB2 B;  3PM2 A;  3BUX B;  3O2P A;  4GBA A;  1QVI Y;  2K2F A;  1ZFS A;  2HQ8 A;  1W7I B;  2ZRT A;  5EL2 A;  3Q8I A;  1AJ4 A;  2KFG A;  1ALV A;  1F70 A;  2JWW A;  2K60 A;  1C3Z A;  1C7W A;  2CNP A;  1Y1X A;  1J1D A;  5I8N A;  1JFK A;  1GQM A;  1L2O C;  1DJX A;  1S6I A;  1UUS A;  2P70 A;  2B1U A;  2R2I A;  3R1P A;  4GPL B;  5DKQ A;  1IH0 A;  1BR4 B;  2KLE A;  3EKH A;  1SCM B;  3IF7 A;  4JWQ A;  5D3O A;  2SAS A;  2BCX A;  2CT9 A;  2JOJ A;  1XVJ A;  2LLT A;  3PSR A;  4MLW A;  3BFB A;  1JF2 A;  1TUZ A;  2JXL A;  1QLS A;  2FOT A;  2QEB A;  3RZS A;  2MLF C;  4NDB A;  1B47 A;  2KAV A;  1K9U A;  2NLN A;  4IJ7 A;  5CSI A;  1CLM A;  2JPO A;  5I94 A;  1IGV A;  5FI7 A;  1F55 A;  5KTY A;  2PYQ A;  4JQ0 D;  1DEL A;  1KK8 B;  1CTR A;  1HQV A;  2JTZ A;  3EKJ A;  1D1O A;  2KPH A;  2M7N A;  1DEK A;  3QME A;  4MBE A;  3TDI A;  4GAO A;  2Y5I A;  3RLZ A;  1A75 A;  2BE4 A;  2V53 A;  4CFQ A;  1IIO A;  4DS7 A;  3RM1 A;  3LK0 A;  1K93 D;  4MZL A;  4GGN A;  2A4J A;  4BY4 A;  2AUC A;  2KGR A;  5FYX A;  1JC2 A;  3LL8 B;  4PHN A;  3CYZ A;  4GNK B;  2K7D A;  1UWO A;  1BJF A;  2G9B A;  2JUL A;  3QRX A;  4DIR A;  3O6B A;  4QJ5 B;  4CPV A;  2LMV A;  1DGU A;  5HKY A;  1MF8 B;  2MRD A;  3UO9 A;  3EVR A;  1QIW A;  4MRY A;  3VGO A;  4AOM A;  4PHJ A;  4WRI A;  3L47 A;  4HSZ A;  1TNQ A;  2JXC A;  2L4I A;  1LS8 A;  1Q80 A;  1QV1 A;  4XJK A;  1OE9 B;  1SNL A;  1YX8 A;  3OHM B;  2YGU A;  4NQG A;  3SS4 A;  1SYM A;  2EGD A;  1Y1U A;  1G4Y R;  3D77 A;  1BLQ A;  3PN7 C;  1KFX S;  1DJY A;  1CNP A;  2M0R A;  1KQM B;  2WCB A;  1S26 D;  1JUO A;  1IQ5 A;  5DIC A;  2Y1M A;  1UP5 A;  3I5H C;  2ZN9 A;  3BYA A;  4Q04 A;  2NZ0 A;  1B4C A;  1UUR A;  2WC5 A;  2L2E A;  1IQ3 A;  1RTP 1;  2GGM A;  3SG2 A;  2ZND A;  1KWO B;  3FE6 A;  4L9M A;  4OR9 B;  1SKT A;  1C7V A;  2FJY A;  3R1V A;  4IL1 A;  1MXL C;  2KI4 C;  4WQ3 A;  1UHI A;  3V2L A;  2FCE A;  2WCJ A;  4MSP A;  3DVJ A;  2CCM A;  5CSF A;  5HKW A;  4I5L B;  5D7F A;  2OPO A;  1A75 B;  3SG7 A;  2H61 C;  2PRU A;  3EK8 A;  3VRQ A;  3DY9 A;  1FF1 A;  3I5F C;  2LE9 B;  1OOH A;  3FS7 A;  3GK2 A;  4PE7 A;  2L5X B;  3BUW B;  3GK4 X;  3VRR A;  1OZO A;  2BL0 C;  2LUC A;  2M9G A;  1SK6 D;  2KBM A;  1PAL A;  3C1V A;  3SG5 A;  2AAO A;  1DT7 B;  1B8C A;  4YI8 A;  5PAL A;  4XJK B;  3DZT A;  1SMG A;  2F2P A;  1EH2 A;  3L4L A;  1J1E A;  1NSH A;  5F6T A;  3CDN A;  1QX2 A;  4OCI A;  4GGF A;  3FWC A;  3S0A A;  2ZN8 A;  1LA0 A;  2LLU A;  1DJG A;  3B87 A;  2M49 B;  1YVH A;  2JT0 A;  2BCB A;  2JC2 A;  4N1F A;  1UHJ A;  2LUX A;  2F2O A;  1XFW O;  1S1E A;  3E3R A;  1QV0 A;  2BAP A;  3PAL A;  1BR1 B;  5JOL A;  4ZCU A;  1M31 A;  1NCX A;  3D76 A;  1SL9 A;  3SG4 A;  4PE4 A;  4P2Y B;  2HQW A;  5CSN A;  2KDH A;  1NWD A;  1YUT A;  3S0D A;  3SG3 A;  1AHR A;  2K7B A;  4FQT A;  3I5I C;  3K1E A;  2QEO A;  4DRW A;  1CKK A;  1G8I A;  3MSE B;  1NCY A;  3B6X A;  5DKR A;  1OOG A;  2K8M B;  4INW A;  3S0G A;  3OX6 A;  1QX5 B;  1B7T Y;  1NIW A;  1SY9 A;  5CPV A;  5J3X A;  1TNX A;  1K2H A;  1REC A;  1SL7 A;  2LC5 A;  4FTG A;  2F3Y A;  3KHE A;  5I2Q A;  4C0L A;  1MHO A;  3SG6 A;  2LAP A;  1J7R A;  2WCH A;  1LKJ A;  1JBA A;  1ORG A;  5TNC A;  1CB1 A;  1H8B A;  1DF0 A;  2AMI A;  1VRK A;  2BKH B;  3ZNI A;  4D1E A;  3VB1 A;  1P28 A;  1PK0 D;  2M97 A;  4BY5 A;  1CM4 A;  1X02 A;  2H8V A;  2PQL A;  1SW8 A;  1MXE A;  1XFX O;  2MBX A;  3WXA A;  2BEC A;  4MVF A;  1GM0 A;  4C0K A;  3CWG A;  2RGI A;  1PVA A;  1PVB A;  3CS1 A;  4FQO A;  4PE0 A;  1L2O B;  4AQJ A;  2KYF A;  3OBV A;  5HYD A;  1LA3 A;  3KEV A;  3N7H A;  2CTN A;  1PRW A;  3PM8 A;  1MWN A;  2Q4U A;  4KYN A;  1TTX A;  2L50 A;  1EG4 A;  1UHH A;  3IQO A;  4AQI A;  2O5G A;  2ZKM X;  1SCM C;  3DD4 A;  2JPT A;  3CR2 A;  1XK4 C;  2M7L A;  3S0E A;  1YTZ C;  3D10 A;  2QPT A;  4YRU A;  2WOS A;  1CFD A;  4JPZ B;  3KPX A;  3NGV A;  1F4Q A;  4M2Q A;  1F8H A;  2L5Y A;  1NX2 A;  2COL B;  2PAS A;  2KI6 C;  2NXQ A;  2L0P A;  3D78 A;  5HLO A;  2OS8 B;  5HLV A;  2EC6 C;  1UHN A;  2WC8 A;  4F0Z B;  3NSK A;  1A4P A;  1SBJ A;  1Y6W A;  5ER5 A;  3TUY B;  2GGZ A;  1CDP A;  1XFV O;  2GV5 A;  2LHI A;  4PAL A;  4PT1 A;  5HL1 A;  2WND A;  2JNX A;  1IWQ A;  1DF0 B;  2LNK A;  4NDC A;  5AFP A;  1RJV A;  2CXJ A;  3DF0 A;  3O4Y A;  1K90 D;  1DGV A;  1DJI A;  1YR5 A;  3KO0 A;  3S0B A;  1H4B A;  4ORB B;  4R1E A;  1B8R A;  1ZOT B;  2LMU A;  3AKA A;  3NSO A;  2ZNE A;  1KCY A;  1Y0V H;  1EJ3 A;  2I18 A;  1LXF C;  2QEH A;  2QEV A;  3FE9 A;  2OTG B;  1Y1A A;  1XO5 A;  3BQ3 A;  3BUN B;  1CLL A;  2K61 A;  5BPJ A;  2JNF A;  2GTE A;  4JKT A;  3SS5 A;  4JD9 A;  3S0F A;  3PN7 B;  1XA5 A;  1JSA A;  1DJH A;  1OQP A;  1DMO A;  1XFY O;  4N5X A;  2K2A A;  2H2K A;  3SS3 A;  5AEQ A;  3H4S E;  1G33 A;  3I5H B;  1KQM C;  4CFR A;  4DCK A;  2KFF A;  4GUK A;  3WHU B;  2WCF A;  2Y4Q A;  4UPG A;  1S6C A;  3D0Y A;  3NXA A;  3OX5 A;  3BJH A;  1V1G A;  1K96 A;  5GQQ C;  4HRG A;  2LVJ A;  1F4O A;  1KWO C;  4WQ2 A;  1WDC C;  1PSR A;  2LCP A;  1B7T Z;  1K9P A;  1SL8 A;  3LCP C;  1YRT B;  1TRF A;  5B8I B;  1QS7 A;  1S5G Z;  1CMF A;  1SSE B;  1IJ6 A;  4U8D A;  2LP2 A;  3IQQ A;  3TS5 B;  1GGZ A;  1YVL A;  1TNW A;  3JVT B;  2BCA A;  1XFZ O;  1L7Z A;  2P6B B;  5I2O A;  1J7P A;  1K8U A;  1QWV A;  1TUJ A;  1DVI A;  1K94 A;  3DF0 B;  3EVV A;  4INX A;  1NP8 A;  3KF9 A;  4NDD A;  2BL0 B;  5JJG A;  5G08 A;  1B8L A;  1CM1 A;  1NX3 A;  2LAN A;  4M2P A;  1KSM A;  3B7A A;  1BT6 A;  1M45 A;  2HET A;  2PAL A;  5KSZ A;  1WRZ A;  2ERB A;  3BUM B;  1R2U A;  1MUX A;  2L98 A;  1ZUZ A;  2FCD A;  1V1F A;  1C3Y A;  1B1G A;  3TDZ A;  1JFJ A;  2IS9 A;  3GK1 A;  2BNX A;  1J7O A;  3CZ1 A;  3DVE A;  3JTD C;  1FW4 A;  1OMD A;  1QLK A;  1S36 A;  4ICB A;  4YBH B;  1DJZ A;  1TWO A;  1YRU B;  1J55 A;  2PVB A;  1XFR A;  3CTN A;  2QDI A;  3D0Y B;  1S6J A;  2DOQ A;  3K21 A;  3OB1 B;  1GGW A;  4USL A;  4YGB B;  1SR6 C;  2KOT A;  1DC1 A;  2KNE A;  5FI2 A;  1S5G Y;  1YUU A;  2M1K B;  1EG3 A;  2KAX A;  4YGE B;  2ZRS A;  3O78 A;  5D69 A;  2BE6 A;  3I5G C;  4QJ4 B;  1M63 B;  1FBV A;  2LHL A;  1U5I A;  1QTX A;  1WLM A;  4PE1 A;  4ETO A;  1AJ5 A;  2L51 A;  1E8A A;  1LIN A;  1Z4H A;  2WCK A;  3SIA A;  4ZCV A;  3DYE A;  1UHK A;  1RRO A;  3R72 A;  3TDU A;  3NSL A;  3D75 A;  4DUQ A;  1OMV A;  2M8U A;  3F45 A;  3M0W A;  3BOW A;  4A4C A;  2KHN A;  5I2L A;  1SPY A;  1M39 A;  4I5N B;  1GJY A;  4PDZ A;  3FIA A;  5IBW A;  2ISD A;  2KQY A;  2LVK A;  1NCZ A;  2JT3 A;  2NCP A;  1B9A A;  1TCF A;  5DKN A;  1TOP A;  2L4H A;  3TZ1 A;  1AK8 A;  2F8P A;  2Q91 A;  4GGF C;  3AKB A;  3OP0 A;  1XYD A;  1WLZ A;  1KFU L;  3IVT A;  2MJW B;  3HCM A;  4CLN A;  1ALW A;  3NHT A;  2KAY A;  1N2D A;  1CFP A;  1NX0 A;  2KFH A;  1C07 A;  2K0J A;  3A8R A;  2MLE C;  2JQ6 A;  2LLS A;  3SIB A;  1DQE A;  1PUL A;  2LM5 A;  2WCM A;  4PHK A;  2G2B A;  4PCW A;  1YX7 A;  2NCO A;  1CDN A;  1KK8 C;  2H61 A;  4MN0 A;  1CDL A;  1N0Y A;  1NPQ A;  2JU0 A;  1OMR A;  2EC6 B;  4I5K A;  4MZJ A;  1AUI B;  2KLD A;  1U5I B;  1A2X A;  1RFJ A;  1TNP A;  3CLN A;  1WY9 A;  2K7O A;  3CAB A;  2OS8 C;  2WCL A;  3LK1 A;  2KQ6 A;  4E68 A;  1KK7 Z;  3EK7 A;  1TN4 A;  2PMY A;  4OVN F;  1MQ1 A;  4OKH A;  3D73 A;  4HRH A;  4ORA B;  3PLF B;  1OSA A;  2K7C A;  3AAJ A;  4CID A;  1FI5 A;  3TUY C;  3VRN A;  1EL4 A;  3WNX B;  2LP3 A;  1CFC A;  2MHH A;  3DXL A;  1K9K A;  3BOW B;  3PAT A;  2JRF A;  3CZ2 A;  1T14 A;  1F54 A;  1WRK A;  3B88 A;  1OOI X;  2D8N A;  1KQV A;  3ICB A;  3O4X A;  3VRO A;  1DJW A;  1WRL A;  1CDM A;  3VRP A;  2KI6 D;  2MAZ A;  1TCO B;  4OZD A;  2KGB C;  5HKZ A;  1IG5 A;  2OTG C;  2I7A A;  2WC6 A;  3HX4 A;  1MR8 A;  2Y1N A;  3R1O A;  2LVI A;  4YGA A;  2BKI B;  3CGA A;  3CZT X;  1EXR A;  3DVM A;  2TN4 A;  1BMO A;  1Z2C B;  1W7J B;  1IKU A;  1J7Q A;  1JF0 A;  2E6W A;  3OGN A;  3FWB A;  3BUO B;  2KI4 B;  3BFH A;  4A4B A;  1RK9 A;  2LVV A;  2I2R E;  1FPW A;  2M29 A;  2HPS A;  3LLE A;  1IRJ A;  3D74 A;  3UNW A;  1JWD A;  1F71 A;  3FE8 A;  1OOJ A;  1BOD A;  1S3P A;  1WDC B;  3I5F B;  1KK7 Y;  2F3Z A;  2E30 A;  2JZI A;  1QAT A;  2I94 A;  5CSJ A;  1BOC A;  1N65 A;  3AAK A;  1BF5 A;  3PFV A;  2BBN A;  3B86 A;  3BXK A;  3WHT B;  4QJ3 B;  2WOR A;  3TS5 C;  3JVT C;  1FI6 A;  3EK4 A;  1OOF A;  2LMT A;  4F7F A;  4YI9 A;  1BG1 A;  1QX7 A;  5AXI A;  1NX1 A;  1OW4 A;  4MZK A;  4YGD B;  1CLB A;  2CBL A;  1QVI Z;  2MA2 A;  2QAC A;  4N1G A;  5K89 A;  4I5J A;  3CZ0 A;  4P5O E;  1ODB A;  2LV7 A;  1KFU S;  1CMG A;  1QAS A;  5KU1 A;  1QIV A;  2JT8 A;  5AER A;  4XYN A;  1OZS A;  3CR4 X;  3DVK A;  5FI6 A;  1PSB A;  3JTD B;  2F33 A;  2ZFD A;  1NUB A;  1XK4 A;  3EG5 B;  4TNC A;  2PSR A;  1SCV A;  1ZMZ A; 
#chains in the Genus database with same CATH homology
 1KFX L;  1YUS A;  1ZAC A;  3I5I B;  1A29 A;  3GOF A;  2O60 A;  1CFF A;  3A4U B;  1NYA A;  2JTT A;  1AVS A;  2M1U A;  2M3W A;  4HRE E;  1SR6 B;  1RWY A;  4YGC B;  1TIZ A;  1SRA A;  3NSI A;  4PHM A;  4GFT A;  1A03 A;  4MRX A;  2KSP A;  1BU3 A;  2HF5 A;  4ORC B;  1M46 A;  2WCE A;  2VRG A;  1R6P A;  3I5G B;  3EVU A;  4C0J A;  5ER4 X;  1YUR A;  2KBI A;  2FJU B;  1IJ5 A;  1QXP A;  5AAN A;  2SCP A;  4M2O A;  1DTL A;  2BBM A;  1K95 A;  3CR5 X;  1XFU O;  1KSO A;  4OV2 A;  1QJT A;  2KYC A;  4MEW A;  3ZWH A;  1LVC D;  3SJS A;  1AP4 A;  1HT9 A;  2EHB A;  3OB2 B;  4GBA A;  3BUX B;  3O2P A;  1QVI Y;  2K2F A;  1ZFS A;  2HQ8 A;  1W7I B;  2ZRT A;  1F70 A;  1AJ4 A;  2KFG A;  1ALV A;  2JWW A;  1C7W A;  2CNP A;  1Y1X A;  1J1D A;  5I8N A;  1JFK A;  1GQM A;  1L2O C;  1DJX A;  1S6I A;  1UUS A;  2R2I A;  2B1U A;  5DKQ A;  1IH0 A;  4GPL B;  1BR4 B;  3EKH A;  1SCM B;  3IF7 A;  4JWQ A;  1F71 A;  2SAS A;  2BCX A;  2CT9 A;  2JOJ A;  1XVJ A;  2LLT A;  3PSR A;  4MLW A;  1JF2 A;  2JXL A;  1QLS A;  2FOT A;  2MLF C;  4NDB A;  1B47 A;  2KAV A;  1K9U A;  2NLN A;  5CSI A;  1CLM A;  1IGV A;  1F55 A;  5KTY A;  4JQ0 D;  1KK8 B;  1CTR A;  1HQV A;  2JTZ A;  3EKJ A;  1D1O A;  2M7N A;  4MBE A;  3TDI A;  4GAO A;  2Y5I A;  3RLZ A;  1A75 A;  2BE4 A;  2V53 A;  4CFQ A;  4DS7 A;  3RM1 A;  3LK0 A;  1K93 D;  4MZL A;  4GGN A;  2A4J A;  4BY4 A;  2AUC A;  2KGR A;  5FYX A;  1JC2 A;  3LL8 B;  4PHN A;  4GNK B;  2K7D A;  1UWO A;  1BJF A;  2G9B A;  2JUL A;  3QRX A;  4DIR A;  3O6B A;  4QJ5 B;  4CPV A;  2LMV A;  1DGU A;  5HKY A;  1MF8 B;  2MRD A;  3EVR A;  1QIW A;  4MRY A;  3VGO A;  4AOM A;  4PHJ A;  4WRI A;  4HSZ A;  1TNQ A;  2JXC A;  2L4I A;  1Q80 A;  1QV1 A;  4XJK A;  1OE9 B;  1SNL A;  1YX8 A;  3OHM B;  4NQG A;  1SYM A;  2EGD A;  1Y1U A;  1G4Y R;  1BLQ A;  3PN7 C;  1KFX S;  1DJY A;  1CNP A;  2M0R A;  1KQM B;  2WCB A;  1S26 D;  1JUO A;  1IQ5 A;  2Y1M A;  1UP5 A;  3I5H C;  2ZN9 A;  3BYA A;  4Q04 A;  2NZ0 A;  1B4C A;  1UUR A;  2L2E A;  1IQ3 A;  1RTP 1;  2GGM A;  3SG2 A;  2ZND A;  1KWO B;  4L9M A;  4OR9 B;  1SKT A;  1C7V A;  4IL1 A;  1MXL C;  2KI4 C;  4WQ3 A;  1UHI A;  2FCE A;  4MSP A;  3DVJ A;  2CCM A;  5CSF A;  5HKW A;  4I5L B;  5D7F A;  2OPO A;  1A75 B;  3SG7 A;  2H61 C;  2PRU A;  3EK8 A;  3VRQ A;  1FF1 A;  3I5F C;  2LE9 B;  3FS7 A;  3GK2 A;  4PE7 A;  2L5X B;  3BUW B;  3GK4 X;  3VRR A;  1OZO A;  2BL0 C;  2LUC A;  2M9G A;  1SK6 D;  2KBM A;  1PAL A;  3C1V A;  3SG5 A;  2AAO A;  1DT7 B;  1B8C A;  4YI8 A;  5PAL A;  4XJK B;  1SMG A;  2F2P A;  1EH2 A;  1J1E A;  1NSH A;  5F6T A;  4OCI A;  1QX2 A;  4GGF A;  3FWC A;  2ZN8 A;  1LA0 A;  2LLU A;  1DJG A;  2M49 B;  1YVH A;  2JT0 A;  2BCB A;  2JC2 A;  4N1F A;  1UHJ A;  2LUX A;  2F2O A;  1XFW O;  1S1E A;  3E3R A;  1QV0 A;  3PAL A;  1BR1 B;  5JOL A;  4ZCU A;  1M31 A;  1NCX A;  3SG4 A;  1SL9 A;  4PE4 A;  4P2Y B;  2HQW A;  5CSN A;  2KDH A;  1NWD A;  1YUT A;  3SG3 A;  1AHR A;  2K7B A;  3I5I C;  1CKK A;  4DRW A;  1G8I A;  3MSE B;  1NCY A;  5DKR A;  2K8M B;  3OX6 A;  1QX5 B;  1B7T Y;  1NIW A;  1SY9 A;  5CPV A;  5J3X A;  1TNX A;  1K2H A;  1REC A;  1SL7 A;  2LC5 A;  4FTG A;  2F3Y A;  3KHE A;  5I2Q A;  4C0L A;  1MHO A;  3SG6 A;  2LAP A;  1J7R A;  1JBA A;  1LKJ A;  5TNC A;  1CB1 A;  1H8B A;  1DF0 A;  2AMI A;  1VRK A;  2BKH B;  3ZNI A;  4D1E A;  2M97 A;  1PK0 D;  4BY5 A;  1CM4 A;  1X02 A;  1SW8 A;  1MXE A;  1XFX O;  2MBX A;  3WXA A;  2BEC A;  4MVF A;  4C0K A;  3CWG A;  2RGI A;  1PVA A;  1PVB A;  3CS1 A;  4FQO A;  4PE0 A;  1L2O B;  4AQJ A;  2KYF A;  5HYD A;  1LA3 A;  3KEV A;  2CTN A;  1PRW A;  3PM8 A;  1MWN A;  2Q4U A;  1TTX A;  2L50 A;  1EG4 A;  1UHH A;  3IQO A;  4AQI A;  2O5G A;  2ZKM X;  1SCM C;  3DD4 A;  2JPT A;  3CR2 A;  1XK4 C;  2M7L A;  1YTZ C;  3D10 A;  2QPT A;  4YRU A;  2WOS A;  1CFD A;  4JPZ B;  3KPX A;  1F4Q A;  4M2Q A;  1F8H A;  1NX2 A;  2COL B;  2PAS A;  2KI6 C;  2NXQ A;  2L0P A;  5HLO A;  2OS8 B;  5HLV A;  2EC6 C;  1UHN A;  2WC8 A;  4F0Z B;  3NSK A;  1A4P A;  1SBJ A;  1Y6W A;  5ER5 A;  3TUY B;  2GGZ A;  1CDP A;  1XFV O;  2GV5 A;  2LHI A;  4PAL A;  2WND A;  2JNX A;  1IWQ A;  1DF0 B;  2LNK A;  4NDC A;  5AFP A;  1RJV A;  2CXJ A;  3DF0 A;  3O4Y A;  1K90 D;  1DGV A;  1DJI A;  1YR5 A;  3KO0 A;  1H4B A;  4ORB B;  4R1E A;  1B8R A;  1ZOT B;  2LMU A;  3AKA A;  3NSO A;  2ZNE A;  1KCY A;  1Y0V H;  1EJ3 A;  2I18 A;  1LXF C;  2OTG B;  1Y1A A;  1XO5 A;  3BQ3 A;  3BUN B;  1CLL A;  2K61 A;  5BPJ A;  2JNF A;  3PN7 B;  1XA5 A;  1JSA A;  1DJH A;  1OQP A;  1DMO A;  1XFY O;  4N5X A;  2K2A A;  2H2K A;  5AEQ A;  3H4S E;  1G33 A;  3I5H B;  1KQM C;  4CFR A;  4DCK A;  2KFF A;  4GUK A;  3WHU B;  2WCF A;  2Y4Q A;  4UPG A;  1S6C A;  3D0Y A;  3NXA A;  3OX5 A;  1V1G A;  1K96 A;  5GQQ C;  4HRG A;  2LVJ A;  1F4O A;  1KWO C;  4WQ2 A;  1WDC C;  1PSR A;  2LCP A;  1B7T Z;  1K9P A;  1SL8 A;  3LCP C;  1YRT B;  1TRF A;  5B8I B;  1QS7 A;  1S5G Z;  1CMF A;  1IJ6 A;  4U8D A;  2LP2 A;  3IQQ A;  3TS5 B;  1GGZ A;  1YVL A;  1TNW A;  3JVT B;  2BCA A;  1XFZ O;  1L7Z A;  2P6B B;  5I2O A;  1J7P A;  1K8U A;  1DVI A;  1K94 A;  3DF0 B;  3EVV A;  1NP8 A;  3KF9 A;  4NDD A;  2BL0 B;  5JJG A;  5G08 A;  1B8L A;  1CM1 A;  1NX3 A;  2LAN A;  4M2P A;  1KSM A;  1BT6 A;  1M45 A;  2HET A;  2PAL A;  5KSZ A;  1WRZ A;  3BUM B;  1R2U A;  1MUX A;  2L98 A;  1ZUZ A;  2FCD A;  1V1F A;  1B1G A;  3TDZ A;  1JFJ A;  2IS9 A;  3GK1 A;  1J7O A;  3DVE A;  3JTD C;  1FW4 A;  1OMD A;  1QLK A;  1S36 A;  4ICB A;  4YBH B;  1DJZ A;  1YRU B;  1J55 A;  2PVB A;  3CTN A;  3D0Y B;  1S6J A;  2DOQ A;  3K21 A;  3OB1 B;  1GGW A;  4USL A;  4YGB B;  1SR6 C;  2KOT A;  2KNE A;  1S5G Y;  1YUU A;  2M1K B;  1EG3 A;  2KAX A;  4YGE B;  2ZRS A;  3O78 A;  5D69 A;  2BE6 A;  3I5G C;  4QJ4 B;  1M63 B;  1FBV A;  2LHL A;  1U5I A;  1QTX A;  1WLM A;  4PE1 A;  4ETO A;  1AJ5 A;  2L51 A;  1E8A A;  1LIN A;  3SIA A;  4ZCV A;  1UHK A;  1RRO A;  3TDU A;  3NSL A;  4DUQ A;  1OMV A;  2M8U A;  3F45 A;  3M0W A;  3BOW A;  4A4C A;  2KHN A;  5I2L A;  1SPY A;  1M39 A;  4I5N B;  1GJY A;  4PDZ A;  3FIA A;  5IBW A;  2ISD A;  2KQY A;  2LVK A;  1NCZ A;  2JT3 A;  2NCP A;  1B9A A;  1TCF A;  5DKN A;  1TOP A;  2L4H A;  3TZ1 A;  1AK8 A;  2F8P A;  2Q91 A;  4GGF C;  3AKB A;  3OP0 A;  1XYD A;  1WLZ A;  1KFU L;  4CLN A;  2MJW B;  3HCM A;  1ALW A;  2KAY A;  1N2D A;  1CFP A;  1NX0 A;  2KFH A;  1C07 A;  2K0J A;  3A8R A;  2MLE C;  2JQ6 A;  2LLS A;  3SIB A;  1PUL A;  2LM5 A;  4PHK A;  1CDN A;  2G2B A;  4PCW A;  1YX7 A;  2NCO A;  1KK8 C;  2H61 A;  4MN0 A;  1CDL A;  1N0Y A;  1NPQ A;  2JU0 A;  1OMR A;  2EC6 B;  4I5K A;  4MZJ A;  1AUI B;  1U5I B;  1A2X A;  1RFJ A;  1TNP A;  3CLN A;  1WY9 A;  2K7O A;  2OS8 C;  3LK1 A;  2KQ6 A;  4E68 A;  1KK7 Z;  3EK7 A;  1TN4 A;  2PMY A;  4OVN F;  1MQ1 A;  4OKH A;  4HRH A;  4ORA B;  3PLF B;  1OSA A;  2K7C A;  3AAJ A;  4CID A;  1FI5 A;  3TUY C;  3VRN A;  1EL4 A;  3WNX B;  2LP3 A;  1CFC A;  2MHH A;  1K9K A;  3BOW B;  3PAT A;  2JRF A;  1F54 A;  1WRK A;  2D8N A;  1KQV A;  3ICB A;  3VRO A;  1DJW A;  1WRL A;  1CDM A;  3VRP A;  2KI6 D;  2MAZ A;  1TCO B;  2KGB C;  5HKZ A;  1IG5 A;  2OTG C;  2I7A A;  4YGA A;  3HX4 A;  1MR8 A;  2Y1N A;  2LVI A;  2BKI B;  3CGA A;  3CZT X;  1EXR A;  3DVM A;  2TN4 A;  1BMO A;  1W7J B;  1IKU A;  1J7Q A;  1JF0 A;  2E6W A;  3FWB A;  3BUO B;  2KI4 B;  4A4B A;  1RK9 A;  2LVV A;  2I2R E;  1FPW A;  2M29 A;  2HPS A;  3LLE A;  1IRJ A;  1JWD A;  1OOJ A;  1BOD A;  1S3P A;  1WDC B;  3I5F B;  1KK7 Y;  2F3Z A;  2E30 A;  2JZI A;  1QAT A;  2I94 A;  5CSJ A;  1BOC A;  1N65 A;  3AAK A;  1BF5 A;  3PFV A;  2BBN A;  3BXK A;  3WHT B;  4QJ3 B;  2WOR A;  3TS5 C;  3JVT C;  1FI6 A;  3EK4 A;  2LMT A;  4YI9 A;  1BG1 A;  1QX7 A;  5AXI A;  1NX1 A;  4YGD B;  4MZK A;  1CLB A;  2CBL A;  1QVI Z;  2MA2 A;  2QAC A;  4N1G A;  5K89 A;  4I5J A;  4P5O E;  1ODB A;  2LV7 A;  1KFU S;  1CMG A;  1QAS A;  5KU1 A;  1QIV A;  2JT8 A;  5AER A;  4XYN A;  1OZS A;  3CR4 X;  3DVK A;  1PSB A;  3JTD B;  2F33 A;  2ZFD A;  1NUB A;  1XK4 A;  4TNC A;  2PSR A;  1SCV A;  1ZMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...