1F55A

Solution structure of the calcium bound n-terminal domain of yeast calmodulin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
b'SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f55A00
2CBLA 1KFXL 1W7IB 5HKWA 4PHMA 3DVJA 3PSRA 1OOJA 1QATA 1F70A 2GGZA 5HLOA 5CSNA 1YX7A 1BF5A 4GGFA 1MXLC 2HETA 2M8UA 1M63B 1F71A 5F6TA 1LA3A 2KI6C 2ZRTA 4JPZB 1B7TY 2ISDA 3AAKA 1RFJA 3WHUB 5HYDA 2JOJA 5CSJA 4N1FA 1AK8A 2GGMA 4HREE 5AEQA 5B8IB 1BJFA 1WDCB 1Y1AA 1YRTB 2VRGA 3I5FC 1IRJA 2BE6A 2PSRA 2LNKA 1S1EA 5J3XA 5BPJA 2Y4QA 1EL4A 1QLSA 1B4CA 4OV2A 4PHNA 2MBXA 3VROA 2LP2A 1A29A 2D8NA 3BUNB 1RTP1 4QJ3B 3SG4A 1SL7A 1TNQA 2JZIA 1FF1A 2KBIA 1DGVA 1KQMC 1SL9A 1WY9A 1PVAA 1DF0B 5AXIA 2BL0C 2LVIA 3O2PA 3D0YB 1E8AA 2KYFA 1PULA 2LC5A 4AQJA 1K8UA 2CNPA 4OCIA 2BCXA 4GNKB 3QRXA 4C0KA 4MZLA 3D10A 2L0PA 3EKHA 3I5GB 1MQ1A 3JTDC 2E30A 2KDHA 2KOTA 1CMFA 2QACA 1M39A 1IQ5A 2LHIA 5CSIA 1YTZC 2HQWA 1JUOA 2L98A 1YX8A 2M3WA 2ZNEA 3EVUA 1ALWA 3OB1B 3A4UB 2MA2A 1GGZA 4DCKA 1WRLA 2ZRSA 1SY9A 1XO5A 1CFCA 2M49B 1KWOC 2O60A 1OE9B 2OS8C 2I7AA 2CTNA 2G9BA 1QLKA 3GK4X 1JFKA 4JWQA 1AVSA 2BBMA 1K96A 1WLZA 1ZUZA 3CGAA 1Q80A 4PHJA 4ZCVA 3TZ1A 1NUBA 1JC2A 4A4BA 1B8CA 1XFXO 1BR1B 1KQVA 3O78A 1QX5B 2LUXA 2LAPA 1TOPA 1W7JB 2PMYA 1Y1UA 2G2BA 5AERA 4M2OA 1K93D 1U5IA 2F33A 1NX2A 1SKTA 1XFVO 1B7TZ 3TUYB 3SIBA 1UP5A 1VRKA 4AOMA 1TCFA 4MVFA 1QV0A 4XJKA 2K0JA 2KQYA 4IL1A 2AAOA 2F2PA 2LM5A 1A2XA 2WOSA 3EKJA 3PM8A 4NDCA 2KI4B 1AP4A 1SCMC 3M0WA 1TCOB 4NDDA 3SG2A 1CLBA 5CPVA 1CM4A 4HSZA 1XFUO 1DJGA 3FWBA 1JSAA 2LMUA 4A4CA 1QJTA 4MRXA 5JJGA 3LL8B 4HRHA 2LMTA 2I2RE 3O4YA 1K9PA 1RROA 5CSFA 3O6BA 1N65A 3VRQA 2HPSA 1DJYA 1WRZA 3PN7C 1DJHA 2B1UA 2CXJA 3GK1A 4HRGA 5D69A 1C7WA 2LLSA 1D1OA 1G4YR 3C1VA 1IJ6A 2MLFC 1NP8A 4PDZA 4GFTA 2ZKMX 1YUUA 2BKHB 1UHIA 1PK0D 3BOWA 1N2DA 2GV5A 1TIZA 2KQ6A 2JPTA 4M2QA 1YUTA 2I18A 4PCWA 4QJ5B 2BECA 4GAOA 5KU1A 1IKUA 1OSAA 1M31A 3NSOA 2BE4A 2Q4UA 2I94A 4CLNA 3SG5A 1QX7A 4OVNF 2JNFA 1UHNA 4C0LA 1XVJA 3JVTB 1G8IA 1S5GY 1UHKA 2JXCA 1NCZA 3CR4X 3WHTB 2BCAA 2LUCA 4GPLB 1K2HA 1XYDA 3H4SE 2MRDA 3TDZA 2O5GA 1X02A 3TDIA 4JQ0D 3FS7A 2LP3A 1ZOTB 1K9UA 4F0ZB 2P6BB 2JT0A 2K2FA 3FIAA 3BXKA 1ZACA 1OMVA 3F45A 5G08A 5I2OA 1IH0A 2E6WA 1QTXA 2K61A 1SL8A 2ZN8A 1ODBA 2KSPA 1C7VA 3MSEB 4OR9B 2PRUA 2L51A 3OB2B 4MLWA 1SYMA 4YGEB 1DTLA 1SW8A 4R1EA 3EVVA 1AJ5A 1S6IA 2PALA 1KK8B 3E3RA 3KO0A 4U8DA 1CDNA 1YUSA 2KYCA 2NLNA 1SR6B 1KFUS 2EC6C 4WQ2A 1NX1A 3BUOB 4MZJA 4PHKA 1YRUB 2KFGA 2NCOA 4PE4A 3NSLA 1OZOA 1XFYO 2K7BA 3OP0A 1J7QA 1J7RA 1GJYA 1K95A 3CZTX 1JWDA 2M1UA 3DVEA 4USLA 1N0YA 1DGUA 1JF2A 1F54A 1IG5A 2MAZA 1H8BA 5HKZA 4ICBA 2Y1NA 2NZ0A 1CLMA 1OMDA 3SIAA 1DJIA 3EK4A 1KFUL 3I5IC 3I5FB 5IBWA 4C0JA 2M1KB 1BMOA 1MR8A 2MHHA 1GQMA 2F3ZA 4XJKB 1EH2A 2AMIA 2K8MB 4PALA 1JF0A 1J1DA 1OZSA 1S6CA 1B8RA 2LHLA 1S5GZ 2M9GA 1TNPA 3SG7A 1DT7B 1YURA 3IQQA 4GUKA 1UWOA 4ETOA 3PALA 2OTGC 3K21A 2LE9B 1XK4A 4MSPA 1FPWA 1BR4B 4YGCB 3KPXA 1DJXA 1R6PA 3SJSA 1F8HA 3TS5B 2KFHA 2LV7A 3KEVA 2K2AA 4TNCA 4PE0A 1LINA 1K9KA 2JQ6A 3BYAA 3CTNA 4P2YB 3DF0B 3OHMB 4L9MA 5GQQC 1DF0A 3JTDB 2NCPA 1SPYA 4ORBB 1EG4A 3DVKA 2FCEA 1HT9A 3BOWB 1KSOA 3AKAA 4BY4A 1CNPA 2F2OA 1FW4A 1PVBA 2V53A 3TDUA 1RK9A 1Y6WA 2OS8B 1PALA 3SG3A 1K94A 2F3YA 3LK1A 1NSHA 1QIWA 4GGNA 2KGRA 1R2UA 5KSZA 4NQGA 1Y0VH 2HQ8A 1AHRA 1Y1XA 1XFZO 2DOQA 1IJ5A 1UURA 3OX5A 1QV1A 2WORA 2HF5A 3BUMB 3EK7A 1G33A 1NX3A 1BU3A 4DUQA 5I8NA 2LCPA 4FTGA 1KK7Z 2MJWB 3JVTC 2BKIB 2SASA 1CM1A 1LA0A 3VGOA 1GGWA 2Q91A 5K89A 2FCDA 4YGDB 3AKBA 1DVIA 1PRWA 4NDBA 3RM1A 1A03A 2M0RA 2FOTA 4WQ3A 1MXEA 3DVMA 4MRYA 4CPVA 2COLB 4AQIA 4DIRA 1B1GA 1QVIZ 4MEWA 1KFXS 2LVKA 1SCMB 1TTXA 2KAVA 3PATA 2FJUB 1BLQA 1YVLA 1WDCC 2KGBC 1KCYA 5I2LA 1A75A 1CFDA 2R2IA 4P5OE 3LLEA 2RGIA 4CFRA 3CS1A 3EVRA 4YBHB 1SBJA 3I5HB 2BCBA 5AANA 5KTYA 3CR5X 2JT8A 2KAYA 3LCPC 3LK0A 1XK4C 1KK8C 2K7CA 2H61C 2ZFDA 3VRPA 1CKKA 3EK8A 1OQPA 2EHBA 1J7PA 2CCMA 2OPOA 2Y5IA 2KHNA 4OKHA 4DRWA 1S3PA 5D7FA 4DS7A 2EGDA 2JWWA 1LXFC 2L5XB 2K7DA 1QX2A 1S6JA 1NCXA 1CFPA 4YI9A 1YVHA 3DD4A 1UHJA 2KI6D 4I5LB 1J55A 4N1GA 1H4BA 2WC8A 2M7NA 3KF9A 5HKYA 3I5GC 1LKJA 1L2OB 1TN4A 3BQ3A 1CB1A 1B8LA 5DKNA 4YGBB 2JU0A 4M2PA 1RWYA 2KAXA 4E68A 4Q04A 3OX6A 1MWNA 3ZNIA 4FQOA 1J7OA 1SK6D 1OMRA 2JTTA 2H2KA 1FBVA 1KK7Y 1MHOA 5HLVA 4I5JA 5DKQA 3HCMA 1RECA 2TN4A 1QXPA 1WRKA 1U5IB 2Y1MA 1MF8B 1ZFSA 1QASA 2PVBA 5JOLA 4QJ4B 2KBMA 1F4QA 1FI5A 1QIVA 3CLNA 2JT3A 3TS5C 5ER5A 2LLUA 1CTRA 1QVIY 3PLFB 4ZCUA 2SCPA 1AUIB 3TUYC 4XYNA 1CDLA 1DJWA 4PE7A 3WNXB 1IQ3A 2EC6B 5FYXA 4YI8A 5I2QA 1FI6A 1KQMB 1UHHA 5TNCA 3BUWB 5PALA 4YRUA 1NWDA 1TRFA 3BUXB 2WCEA 1NCYA 2H61A 2L50A 2BL0B 2LVJA 2KI4C 1C07A 1A4PA 1YR5A 1RJVA 2JNXA 1ZMZA 3GK2A 4WRIA 1BT6A 1PSBA 2LVVA 3ZWHA 3HX4A 2L4HA 1M45A 2LMVA 1TNWA 3CWGA 2JULA 3PFVA 2PASA 3D0YA 3IF7A 1PSRA 1BODA 1SCVA 2WNDA 1J1EA 1SMGA 1B47A 2CT9A 3I5IB 2JTZA 5DKRA 1KSMA 2F8PA 1CDMA 1KWOB 4GGFC 4BY5A 1HQVA 1IGVA 2JXLA 4MN0A 3GOFA 1MUXA 4N5XA 2JC2A 1XA5A 3WXAA 3FWCA 1S36A 1L7ZA 4GBAA 3VRNA 2WCBA 4MZKA 3CR2A 1BOCA 2AUCA 1LVCD 1A75B 1EJ3A 1DJZA 3AAJA 1WLMA 2OTGB 1TNXA 4CFQA 4ORAB 1JFJA 1F55A 5AFPA 3RLZA 1NPQA 4ORCB 1CDPA 1NYAA 2M7LA 4D1EA 2LANA 3I5HC 3NXAA 2NXQA 2A4JA 3ICBA 4MBEA 3A8RA 1UUSA 1SRAA 1V1FA 2M29A 1NIWA 2WCFA 3DF0A 1AJ4A 1QS7A 4CIDA 2K7OA 4UPGA 2MLEC 1SNLA 1XFWO 1CLLA 1EG3A 4YGAA 1JBAA 4PE1A 2L2EA 2KFFA 1EXRA 2JRFA 3SG6A 4I5NB 1B9AA 1IWQA 2ZNDA 1K90D 3KHEA 2LLTA 3NSKA 1DMOA 1SR6C 1CFFA 3PN7B 1V1GA 5ER4X 1M46A 2M97A 4I5KA 1L2OC 3IQOA 1ALVA 3VRRA 1BG1A 1NX0A 2BBNA 1S26D 2L4IA 2IS9A 3NSIA 2KNEA 2ZN9A 2QPTA 1F4OA 1CMGA
chains in the Genus database with same CATH superfamily
2CBLA 3VB1A 1KFXL 1W7IB 5HKWA 5FI7A 4PHMA 3DVJA 3PSRA 1OOJA 1QATA 1F70A 2GGZA 5HLOA 5CSNA 1YX7A 1BF5A 4GGFA 1MXLC 2HETA 3S0EA 2M8UA 1M63B 1F71A 2GTEA 3K1EA 5F6TA 3SS4A 1LA3A 2KI6C 2ZRTA 4JPZB 1B7TY 3DZTA 3AAKA 1RFJA 4OZDA 2ISDA 3WHUB 2JOJA 5HYDA 5CSJA 4N1FA 1AK8A 2GGMA 4HREE 5AEQA 3FE8A 5B8IB 1BJFA 1WDCB 1Y1AA 1YRTB 2VRGA 3I5FC 1IRJA 2BE6A 2L2CA 2PSRA 2LNKA 1S1EA 5J3XA 5BPJA 2Y4QA 1EL4A 2K60A 1QLSA 1B4CA 1W9ZA 4OV2A 2P71A 4PHNA 2MBXA 3CABA 3VROA 3DY9A 2LP2A 1A29A 2D8NA 3BUNB 1RTP1 4QJ3B 2PYQA 3SG4A 1SL7A 1TNQA 2JZIA 1FF1A 2KBIA 1DGVA 1KQMC 1SL9A 1WY9A 1PVAA 1DF0B 5AXIA 2BL0C 2LVIA 3O2PA 3D0YB 1E8AA 2KYFA 1PULA 2LC5A 4AQJA 1K8UA 1OW4A 2CNPA 4OCIA 2BCXA 4GNKB 3QRXA 4C0KA 4MZLA 3D10A 2L0PA 3EKHA 3I5GB 1MQ1A 3JTDC 2E30A 2KDHA 2KOTA 1CMFA 2QACA 1M39A 1IQ5A 2LHIA 5CSIA 1TUZA 1OOGA 1JUOA 1YTZC 1YX8A 2HQWA 2L98A 1LS8A 2M3WA 2ZNEA 3EVUA 1ALWA 3OB1B 3A4UB 2MA2A 1GGZA 4DCKA 1WRLA 2ZRSA 1SY9A 1XO5A 1CFCA 2M49B 1KWOC 2ERBA 1OE9B 2O60A 2OS8C 2I7AA 2CTNA 2G9BA 1QLKA 3GK4X 1JFKA 4JWQA 1AVSA 3S0GA 5I94A 2BBMA 1K96A 1WLZA 1ZUZA 3CGAA 1Q80A 4PHJA 4ZCVA 3R1PA 1NUBA 3TZ1A 1JC2A 4A4BA 1B8CA 1XFXO 5DICA 1BR1B 1KQVA 3O78A 1QX5B 2LUXA 2LAPA 4JKTA 1TOPA 1W7JB 2PMYA 1Y1UA 2G2BA 5AERA 4M2OA 1K93D 1U5IA 2F33A 1NX2A 3SS5A 1SKTA 1XFVO 1B7TZ 3TUYB 3SIBA 1UP5A 1VRKA 4AOMA 1TCFA 4MVFA 1QV0A 4XJKA 2K0JA 2KQYA 4IL1A 1DC1A 2AAOA 3L4AA 1DELA 2F2PA 2LM5A 1A2XA 2WOSA 3EKJA 3PM8A 1QWVA 4NDCA 2KI4B 1AP4A 1SCMC 4INWA 3M0WA 1TCOB 1XFRA 4NDDA 3SG2A 5CPVA 1CM4A 1CLBA 4HSZA 1XFUO 1DJGA 3PM2A 3FWBA 1JSAA 2LMUA 4A4CA 1QJTA 4MRXA 5JJGA 3LL8B 4HRHA 1C3YA 2LMTA 5HL1A 2I2RE 3O4YA 1K9PA 1RROA 5CSFA 3O6BA 1N65A 3VRQA 3S0AA 2HPSA 2QEHA 1DJYA 1WRZA 3PN7C 1DJHA 2B1UA 2CXJA 3GK1A 4HRGA 5D69A 1C7WA 2LLSA 2WC5A 1G4YR 3C1VA 1D1OA 1IJ6A 2MLFC 3CDNA 1NP8A 4PDZA 4GFTA 2ZKMX 1YUUA 2BKHB 1UHIA 1PK0D 3BOWA 1N2DA 2GV5A 2P70A 3PJIA 1TIZA 2KQ6A 2JPTA 4M2QA 1YUTA 2I18A 4PCWA 4QJ5B 2BECA 4GAOA 5KU1A 1IKUA 3EG5B 1GM0A 1OSAA 3FE6A 1M31A 3NSOA 2BE4A 2Q4UA 2I94A 4CLNA 3SG5A 1QX7A 4OVNF 2JNFA 1UHNA 4C0LA 1XVJA 3JVTB 1G8IA 1S5GY 1UHKA 2JXCA 4KYNA 1NCZA 3SS3A 3CR4X 3WHTB 3BJHA 2BCAA 2LUCA 4GPLB 1K2HA 1XYDA 3H4SE 5FI2A 2MRDA 3TDZA 2O5GA 1X02A 3FE9A 3TDIA 4JQ0D 3FS7A 2LP3A 2WCHA 1ZOTB 3D78A 1K9UA 4F0ZB 2P6BB 2JT0A 2K2FA 3FIAA 3BXKA 1ZACA 1OMVA 3F45A 5G08A 5I2OA 1IH0A 2E6WA 1QTXA 2K61A 1SL8A 2ZN8A 3O4XA 1ODBA 2KLEA 2KSPA 1C7VA 3D73A 3MSEB 4OR9B 2PRUA 2L51A 3OB2B 4MLWA 1SYMA 4YGEB 1DTLA 1SW8A 4R1EA 3EVVA 1AJ5A 1S6IA 2PALA 1KK8B 3E3RA 3KO0A 4U8DA 1CDNA 1YUSA 2KYCA 2NLNA 1SR6B 1KFUS 2EC6C 4WQ2A 1NX1A 3BUOB 4MZJA 4PHKA 1YRUB 2KFGA 2NCOA 4PE4A 3NSLA 1OZOA 1XFYO 2K7BA 3OP0A 1J7QA 1J7RA 1GJYA 2QEOA 1K95A 3CZTX 1JWDA 2M1UA 3DVEA 4JD9A 4USLA 1N0YA 1DGUA 1JF2A 1F54A 1ORGA 4INXA 1IG5A 2MAZA 1H8BA 5HKZA 4ICBA 2Y1NA 2NZ0A 1CLMA 1OMDA 3SIAA 1DJIA 3EK4A 1KFUL 3I5IC 3I5FB 5IBWA 4C0JA 2M1KB 1BMOA 1MR8A 2MHHA 1GQMA 2F3ZA 4XJKB 1EH2A 2AMIA 2K8MB 4PALA 1JF0A 1J1DA 1OZSA 2KPHA 1S6CA 1B8RA 2LHLA 1S5GZ 2M9GA 1TNPA 3SG7A 1DT7B 3V2LA 3R72A 1YURA 3IQQA 4GUKA 3D76A 1UWOA 4ETOA 3PALA 2OTGC 3K21A 2LE9B 1XK4A 4MSPA 1FPWA 1BR4B 4YGCB 3KPXA 1DJXA 1R6PA 3SJSA 1F8HA 3TS5B 2KFHA 2LV7A 2WCLA 3KEVA 2K2AA 3DYEA 3D74A 3OGNA 4TNCA 4PE0A 1LINA 1K9KA 2JQ6A 2QDIA 3BYAA 3CTNA 4P2YB 3DF0B 3OHMB 4L9MA 5GQQC 3RZSA 1DF0A 3JTDB 2NCPA 2WCKA 1SPYA 4ORBB 1EG4A 3DVKA 1OOIX 2FCEA 1HT9A 3BOWB 1KSOA 3AKAA 4BY4A 2WC6A 1CNPA 2F2OA 1FW4A 1PVBA 2V53A 3CYZA 1RK9A 3TDUA 1Y6WA 2OS8B 1PALA 3SG3A 1K94A 2F3YA 3LK1A 1NSHA 1QIWA 4GGNA 2KGRA 1R2UA 5KSZA 4NQGA 1Y0VH 2HQ8A 3D77A 1AHRA 1Y1XA 1XFZO 2DOQA 1IJ5A 1UURA 3OX5A 2YGUA 1QV1A 2WORA 2HF5A 3BUMB 3EK7A 1G33A 1NX3A 4PT1A 1BU3A 4DUQA 5I8NA 2LCPA 4FTGA 1KK7Z 2MJWB 3JVTC 3NHIA 2BKIB 2SASA 1CM1A 1LA0A 3VGOA 1GGWA 2Q91A 5K89A 2QEVA 2FCDA 4YGDB 1P28A 3AKBA 4F7FA 3BFBA 1DVIA 1PRWA 4NDBA 3RM1A 1A03A 3Q8IA 2M0RA 2FOTA 4WQ3A 1MXEA 3DVMA 4MRYA 4CPVA 2COLB 4AQIA 4DIRA 1B1GA 1QVIZ 3B7AA 3CZ2A 4MEWA 1KFXS 2LVKA 1SCMB 1TTXA 2KAVA 3PATA 2FJUB 1BLQA 1YVLA 1WDCC 2KGBC 1KCYA 5I2LA 1A75A 3S0FA 1CFDA 2R2IA 3R1VA 3LLEA 2RGIA 4P5OE 3CS1A 3EVRA 4YBHB 4CFRA 1SBJA 3I5HB 2BCBA 5AANA 5KTYA 3CR5X 2JT8A 2KAYA 3LCPC 3LK0A 1XK4C 1KK8C 2K7CA 2H61C 1TUJA 2ZFDA 3VRPA 1CKKA 3EK8A 1OQPA 2EHBA 1J7PA 2CCMA 2OPOA 2Y5IA 3IVTA 2KHNA 4OKHA 4DRWA 1S3PA 5D7FA 2BAPA 2EGDA 2JWWA 1LXFC 2L5XB 2FJYA 2K7DA 1QX2A 5D3OA 4DS7A 1S6JA 1NCXA 1CFPA 4YI9A 3UO9A 1YVHA 1IIOA 3DD4A 1UHJA 2KI6D 4I5LB 1J55A 4N1GA 1H4BA 2WC8A 2M7NA 3KF9A 5HKYA 3I5GC 1LKJA 1L2OB 1TN4A 3QMEA 3BQ3A 1CB1A 3D75A 1B8LA 5DKNA 3OBVA 4YGBB 2JU0A 4M2PA 1RWYA 2KAXA 4E68A 4Q04A 3OX6A 1MWNA 3ZNIA 2WCJA 4FQOA 1J7OA 1SK6D 1OMRA 3CZ1A 2JTTA 4FQTA 2H2KA 1FBVA 1KK7Y 1MHOA 1T14A 1OOHA 5HLVA 4I5JA 5DKQA 3HCMA 1RECA 2TN4A 5EL2A 1QXPA 1SSEB 1WRKA 1U5IB 2Y1MA 1MF8B 1Z4HA 1QASA 1ZFSA 2PVBA 5JOLA 2KBMA 4QJ4B 1F4QA 1FI5A 1QIVA 3B88A 3CLNA 2JT3A 3TS5C 5ER5A 2LLUA 1CTRA 1QVIY 3PLFB 4ZCUA 2SCPA 1AUIB 3TUYC 4XYNA 3DXLA 1CDLA 1DJWA 4PE7A 3WNXB 1IQ3A 1Z2CB 2EC6B 5FYXA 4YI8A 5I2QA 1FI6A 1KQMB 2QEBA 1UHHA 5TNCA 3BUWB 5PALA 4YRUA 1NWDA 1TRFA 3BUXB 2WCEA 1NCYA 2H61A 2L50A 2BL0B 2LVJA 3N7HA 2KI4C 1C07A 1A4PA 1YR5A 1RJVA 2L5YA 2JNXA 3BFHA 1ZMZA 3GK2A 4WRIA 1BT6A 1PSBA 2LVVA 3ZWHA 3HX4A 2L4HA 1M45A 2LMVA 1TNWA 3CWGA 2JULA 3PFVA 2PASA 3D0YA 3S0DA 3IF7A 3S0BA 3B87A 1PSRA 1BODA 1SCVA 2WNDA 3NHTA 1J1EA 3R1OA 1SMGA 3CZ0A 2PQLA 1DEKA 1B47A 2CT9A 3I5IB 2JTZA 5DKRA 1KSMA 2F8PA 1CDMA 1KWOB 4GGFC 4BY5A 1HQVA 1IGVA 3B86A 2JXLA 4MN0A 3GOFA 1MUXA 4N5XA 1DQEA 4IJ7A 2JC2A 1XA5A 3WXAA 3FWCA 1S36A 1L7ZA 4GBAA 3VRNA 2WCBA 4MZKA 3CR2A 1BOCA 2AUCA 1LVCD 1A75B 1C3ZA 1DJZA 1EJ3A 3AAJA 1WLMA 2OTGB 1TNXA 4CFQA 4ORAB 1JFJA 1F55A 3B6XA 5AFPA 3L4LA 3RLZA 1NPQA 1OOFA 2JPOA 4ORCB 3L47A 1CDPA 1NYAA 2M7LA 4D1EA 2LANA 3I5HC 3NGVA 2BNXA 3NXAA 2WCMA 2NXQA 2A4JA 3ICBA 4MBEA 2KLDA 3A8RA 1UUSA 1SRAA 1V1FA 2M29A 1NIWA 2WCFA 3DF0A 1AJ4A 1QS7A 4CIDA 2K7OA 4UPGA 2MLEC 1SNLA 1XFWO 1CLLA 1EG3A 1TWOA 4YGAA 1JBAA 4PE1A 3UNWA 2L2EA 2KFFA 1EXRA 2JRFA 3SG6A 4I5NB 1B9AA 1IWQA 2ZNDA 1K90D 3KHEA 2LLTA 3NSKA 1DMOA 1SR6C 1CFFA 3PN7B 1V1GA 5ER4X 2H8VA 1M46A 3BFAA 2M97A 4I5KA 1L2OC 3IQOA 1ALVA 3VRRA 1BG1A 1NX0A 2BBNA 1S26D 2L4IA 2IS9A 5FI6A 3NSIA 2KNEA 2ZN9A 2QPTA 1F4OA 1CMGA
chains in the Genus database with same CATH topology
2CBLA 1KFXL 1W7IB 5HKWA 4PHMA 3DVJA 3PSRA 1OOJA 1QATA 1F70A 2GGZA 5HLOA 5CSNA 1YX7A 1BF5A 4GGFA 1MXLC 2HETA 2M8UA 1M63B 1F71A 5F6TA 1LA3A 2KI6C 2ZRTA 4JPZB 1B7TY 2ISDA 3AAKA 1RFJA 3WHUB 5HYDA 2JOJA 5CSJA 4N1FA 1AK8A 2GGMA 4HREE 5AEQA 5B8IB 1BJFA 1WDCB 1Y1AA 1YRTB 2VRGA 3I5FC 1IRJA 2BE6A 2PSRA 2LNKA 1S1EA 5J3XA 5BPJA 2Y4QA 1EL4A 1QLSA 1B4CA 4OV2A 4PHNA 2MBXA 3VROA 2LP2A 1A29A 2D8NA 3BUNB 1RTP1 4QJ3B 3SG4A 1SL7A 1TNQA 2JZIA 1FF1A 2KBIA 1DGVA 1KQMC 1SL9A 1WY9A 1PVAA 1DF0B 5AXIA 2BL0C 2LVIA 3O2PA 3D0YB 1E8AA 2KYFA 1PULA 2LC5A 4AQJA 1K8UA 2CNPA 4OCIA 2BCXA 4GNKB 3QRXA 4C0KA 4MZLA 3D10A 2L0PA 3EKHA 3I5GB 1MQ1A 3JTDC 2E30A 2KDHA 2KOTA 1CMFA 2QACA 1M39A 1IQ5A 2LHIA 5CSIA 1YTZC 2HQWA 1JUOA 2L98A 1YX8A 2M3WA 2ZNEA 3EVUA 1ALWA 3OB1B 3A4UB 2MA2A 1GGZA 4DCKA 1WRLA 2ZRSA 1SY9A 1XO5A 1CFCA 2M49B 1KWOC 2O60A 1OE9B 2OS8C 2I7AA 2CTNA 2G9BA 1QLKA 3GK4X 1JFKA 4JWQA 1AVSA 2BBMA 1K96A 1WLZA 1ZUZA 3CGAA 1Q80A 4PHJA 4ZCVA 3TZ1A 1NUBA 1JC2A 4A4BA 1B8CA 1XFXO 1BR1B 1KQVA 3O78A 1QX5B 2LUXA 2LAPA 1TOPA 1W7JB 2PMYA 1Y1UA 2G2BA 5AERA 4M2OA 1K93D 1U5IA 2F33A 1NX2A 1SKTA 1XFVO 1B7TZ 3TUYB 3SIBA 1UP5A 1VRKA 4AOMA 1TCFA 4MVFA 1QV0A 4XJKA 2K0JA 2KQYA 4IL1A 2AAOA 2F2PA 2LM5A 1A2XA 2WOSA 3EKJA 3PM8A 4NDCA 2KI4B 1AP4A 1SCMC 3M0WA 1TCOB 4NDDA 3SG2A 1CLBA 5CPVA 1CM4A 4HSZA 1XFUO 1DJGA 3FWBA 1JSAA 2LMUA 4A4CA 1QJTA 4MRXA 5JJGA 3LL8B 4HRHA 2LMTA 2I2RE 3O4YA 1K9PA 1RROA 5CSFA 3O6BA 1N65A 3VRQA 2HPSA 1DJYA 1WRZA 3PN7C 1DJHA 2B1UA 2CXJA 3GK1A 4HRGA 5D69A 1C7WA 2LLSA 1D1OA 1G4YR 3C1VA 1IJ6A 2MLFC 1NP8A 4PDZA 4GFTA 2ZKMX 1YUUA 2BKHB 1UHIA 1PK0D 3BOWA 1N2DA 2GV5A 1TIZA 2KQ6A 2JPTA 4M2QA 1YUTA 2I18A 4PCWA 4QJ5B 2BECA 4GAOA 5KU1A 1IKUA 1OSAA 1M31A 3NSOA 2BE4A 2Q4UA 2I94A 4CLNA 3SG5A 1QX7A 4OVNF 2JNFA 1UHNA 4C0LA 1XVJA 3JVTB 1G8IA 1S5GY 1UHKA 2JXCA 1NCZA 3CR4X 3WHTB 2BCAA 2LUCA 4GPLB 1K2HA 1XYDA 3H4SE 2MRDA 3TDZA 2O5GA 1X02A 3TDIA 4JQ0D 3FS7A 2LP3A 1ZOTB 1K9UA 4F0ZB 2P6BB 2JT0A 2K2FA 3FIAA 3BXKA 1ZACA 1OMVA 3F45A 5G08A 5I2OA 1IH0A 2E6WA 1QTXA 2K61A 1SL8A 2ZN8A 1ODBA 2KSPA 1C7VA 3MSEB 4OR9B 2PRUA 2L51A 3OB2B 4MLWA 1SYMA 4YGEB 1DTLA 1SW8A 4R1EA 3EVVA 1AJ5A 1S6IA 2PALA 1KK8B 3E3RA 3KO0A 4U8DA 1CDNA 1YUSA 2KYCA 2NLNA 1SR6B 1KFUS 2EC6C 4WQ2A 1NX1A 3BUOB 4MZJA 4PHKA 1YRUB 2KFGA 2NCOA 4PE4A 3NSLA 1OZOA 1XFYO 2K7BA 3OP0A 1J7QA 1J7RA 1GJYA 1K95A 3CZTX 1JWDA 2M1UA 3DVEA 4USLA 1N0YA 1DGUA 1JF2A 1F54A 1IG5A 2MAZA 1H8BA 5HKZA 4ICBA 2Y1NA 2NZ0A 1CLMA 1OMDA 3SIAA 1DJIA 3EK4A 1KFUL 3I5IC 3I5FB 5IBWA 4C0JA 2M1KB 1BMOA 1MR8A 2MHHA 1GQMA 2F3ZA 4XJKB 1EH2A 2AMIA 2K8MB 4PALA 1JF0A 1J1DA 1OZSA 1S6CA 1B8RA 2LHLA 1S5GZ 2M9GA 1TNPA 3SG7A 1DT7B 1YURA 3IQQA 4GUKA 1UWOA 4ETOA 3PALA 2OTGC 3K21A 2LE9B 1XK4A 4MSPA 1FPWA 1BR4B 4YGCB 3KPXA 1DJXA 1R6PA 3SJSA 1F8HA 3TS5B 2KFHA 2LV7A 3KEVA 2K2AA 4TNCA 4PE0A 1LINA 1K9KA 2JQ6A 3BYAA 3CTNA 4P2YB 3DF0B 3OHMB 4L9MA 5GQQC 1DF0A 3JTDB 2NCPA 1SPYA 4ORBB 1EG4A 3DVKA 2FCEA 1HT9A 3BOWB 1KSOA 3AKAA 4BY4A 1CNPA 2F2OA 1FW4A 1PVBA 2V53A 3TDUA 1RK9A 1Y6WA 2OS8B 1PALA 3SG3A 1K94A 2F3YA 3LK1A 1NSHA 1QIWA 4GGNA 2KGRA 1R2UA 5KSZA 4NQGA 1Y0VH 2HQ8A 1AHRA 1Y1XA 1XFZO 2DOQA 1IJ5A 1UURA 3OX5A 1QV1A 2WORA 2HF5A 3BUMB 3EK7A 1G33A 1NX3A 1BU3A 4DUQA 5I8NA 2LCPA 4FTGA 1KK7Z 2MJWB 3JVTC 2BKIB 2SASA 1CM1A 1LA0A 3VGOA 1GGWA 2Q91A 5K89A 2FCDA 4YGDB 3AKBA 1DVIA 1PRWA 4NDBA 3RM1A 1A03A 2M0RA 2FOTA 4WQ3A 1MXEA 3DVMA 4MRYA 4CPVA 2COLB 4AQIA 4DIRA 1B1GA 1QVIZ 4MEWA 1KFXS 2LVKA 1SCMB 1TTXA 2KAVA 3PATA 2FJUB 1BLQA 1YVLA 1WDCC 2KGBC 1KCYA 5I2LA 1A75A 1CFDA 2R2IA 4P5OE 3LLEA 2RGIA 4CFRA 3CS1A 3EVRA 4YBHB 1SBJA 3I5HB 2BCBA 5AANA 5KTYA 3CR5X 2JT8A 2KAYA 3LCPC 3LK0A 1XK4C 1KK8C 2K7CA 2H61C 2ZFDA 3VRPA 1CKKA 3EK8A 1OQPA 2EHBA 1J7PA 2CCMA 2OPOA 2Y5IA 2KHNA 4OKHA 4DRWA 1S3PA 5D7FA 4DS7A 2EGDA 2JWWA 1LXFC 2L5XB 2K7DA 1QX2A 1S6JA 1NCXA 1CFPA 4YI9A 1YVHA 3DD4A 1UHJA 2KI6D 4I5LB 1J55A 4N1GA 1H4BA 2WC8A 2M7NA 3KF9A 5HKYA 3I5GC 1LKJA 1L2OB 1TN4A 3BQ3A 1CB1A 1B8LA 5DKNA 4YGBB 2JU0A 4M2PA 1RWYA 2KAXA 4E68A 4Q04A 3OX6A 1MWNA 3ZNIA 4FQOA 1J7OA 1SK6D 1OMRA 2JTTA 2H2KA 1FBVA 1KK7Y 1MHOA 5HLVA 4I5JA 5DKQA 3HCMA 1RECA 2TN4A 1QXPA 1WRKA 1U5IB 2Y1MA 1MF8B 1ZFSA 1QASA 2PVBA 5JOLA 4QJ4B 2KBMA 1F4QA 1FI5A 1QIVA 3CLNA 2JT3A 3TS5C 5ER5A 2LLUA 1CTRA 1QVIY 3PLFB 4ZCUA 2SCPA 1AUIB 3TUYC 4XYNA 1CDLA 1DJWA 4PE7A 3WNXB 1IQ3A 2EC6B 5FYXA 4YI8A 5I2QA 1FI6A 1KQMB 1UHHA 5TNCA 3BUWB 5PALA 4YRUA 1NWDA 1TRFA 3BUXB 2WCEA 1NCYA 2H61A 2L50A 2BL0B 2LVJA 2KI4C 1C07A 1A4PA 1YR5A 1RJVA 2JNXA 1ZMZA 3GK2A 4WRIA 1BT6A 1PSBA 2LVVA 3ZWHA 3HX4A 2L4HA 1M45A 2LMVA 1TNWA 3CWGA 2JULA 3PFVA 2PASA 3D0YA 3IF7A 1PSRA 1BODA 1SCVA 2WNDA 1J1EA 1SMGA 1B47A 2CT9A 3I5IB 2JTZA 5DKRA 1KSMA 2F8PA 1CDMA 1KWOB 4GGFC 4BY5A 1HQVA 1IGVA 2JXLA 4MN0A 3GOFA 1MUXA 4N5XA 2JC2A 1XA5A 3WXAA 3FWCA 1S36A 1L7ZA 4GBAA 3VRNA 2WCBA 4MZKA 3CR2A 1BOCA 2AUCA 1LVCD 1A75B 1EJ3A 1DJZA 3AAJA 1WLMA 2OTGB 1TNXA 4CFQA 4ORAB 1JFJA 1F55A 5AFPA 3RLZA 1NPQA 4ORCB 1CDPA 1NYAA 2M7LA 4D1EA 2LANA 3I5HC 3NXAA 2NXQA 2A4JA 3ICBA 4MBEA 3A8RA 1UUSA 1SRAA 1V1FA 2M29A 1NIWA 2WCFA 3DF0A 1AJ4A 1QS7A 4CIDA 2K7OA 4UPGA 2MLEC 1SNLA 1XFWO 1CLLA 1EG3A 4YGAA 1JBAA 4PE1A 2L2EA 2KFFA 1EXRA 2JRFA 3SG6A 4I5NB 1B9AA 1IWQA 2ZNDA 1K90D 3KHEA 2LLTA 3NSKA 1DMOA 1SR6C 1CFFA 3PN7B 1V1GA 5ER4X 1M46A 2M97A 4I5KA 1L2OC 3IQOA 1ALVA 3VRRA 1BG1A 1NX0A 2BBNA 1S26D 2L4IA 2IS9A 3NSIA 2KNEA 2ZN9A 2QPTA 1F4OA 1CMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBL A;  1KFX L;  1W7I B;  5HKW A;  4PHM A;  3DVJ A;  3PSR A;  1OOJ A;  1QAT A;  1F70 A;  2GGZ A;  5HLO A;  5CSN A;  1YX7 A;  1BF5 A;  4GGF A;  1MXL C;  2HET A;  2M8U A;  1M63 B;  1F71 A;  5F6T A;  1LA3 A;  2KI6 C;  2ZRT A;  4JPZ B;  1B7T Y;  2ISD A;  3AAK A;  1RFJ A;  3WHU B;  5HYD A;  2JOJ A;  5CSJ A;  4N1F A;  1AK8 A;  2GGM A;  4HRE E;  5AEQ A;  5B8I B;  1BJF A;  1WDC B;  1Y1A A;  1YRT B;  2VRG A;  3I5F C;  1IRJ A;  2BE6 A;  2PSR A;  2LNK A;  1S1E A;  5J3X A;  5BPJ A;  2Y4Q A;  1EL4 A;  1QLS A;  1B4C A;  4OV2 A;  4PHN A;  2MBX A;  3VRO A;  2LP2 A;  1A29 A;  2D8N A;  3BUN B;  1RTP 1;  4QJ3 B;  3SG4 A;  1SL7 A;  1TNQ A;  2JZI A;  1FF1 A;  2KBI A;  1DGV A;  1KQM C;  1SL9 A;  1WY9 A;  1PVA A;  1DF0 B;  5AXI A;  2BL0 C;  2LVI A;  3O2P A;  3D0Y B;  1E8A A;  2KYF A;  1PUL A;  2LC5 A;  4AQJ A;  1K8U A;  2CNP A;  4OCI A;  2BCX A;  4GNK B;  3QRX A;  4C0K A;  4MZL A;  3D10 A;  2L0P A;  3EKH A;  3I5G B;  1MQ1 A;  3JTD C;  2E30 A;  2KDH A;  2KOT A;  1CMF A;  2QAC A;  1M39 A;  1IQ5 A;  2LHI A;  5CSI A;  1YTZ C;  2HQW A;  1JUO A;  2L98 A;  1YX8 A;  2M3W A;  2ZNE A;  3EVU A;  1ALW A;  3OB1 B;  3A4U B;  2MA2 A;  1GGZ A;  4DCK A;  1WRL A;  2ZRS A;  1SY9 A;  1XO5 A;  1CFC A;  2M49 B;  1KWO C;  2O60 A;  1OE9 B;  2OS8 C;  2I7A A;  2CTN A;  2G9B A;  1QLK A;  3GK4 X;  1JFK A;  4JWQ A;  1AVS A;  2BBM A;  1K96 A;  1WLZ A;  1ZUZ A;  3CGA A;  1Q80 A;  4PHJ A;  4ZCV A;  3TZ1 A;  1NUB A;  1JC2 A;  4A4B A;  1B8C A;  1XFX O;  1BR1 B;  1KQV A;  3O78 A;  1QX5 B;  2LUX A;  2LAP A;  1TOP A;  1W7J B;  2PMY A;  1Y1U A;  2G2B A;  5AER A;  4M2O A;  1K93 D;  1U5I A;  2F33 A;  1NX2 A;  1SKT A;  1XFV O;  1B7T Z;  3TUY B;  3SIB A;  1UP5 A;  1VRK A;  4AOM A;  1TCF A;  4MVF A;  1QV0 A;  4XJK A;  2K0J A;  2KQY A;  4IL1 A;  2AAO A;  2F2P A;  2LM5 A;  1A2X A;  2WOS A;  3EKJ A;  3PM8 A;  4NDC A;  2KI4 B;  1AP4 A;  1SCM C;  3M0W A;  1TCO B;  4NDD A;  3SG2 A;  1CLB A;  5CPV A;  1CM4 A;  4HSZ A;  1XFU O;  1DJG A;  3FWB A;  1JSA A;  2LMU A;  4A4C A;  1QJT A;  4MRX A;  5JJG A;  3LL8 B;  4HRH A;  2LMT A;  2I2R E;  3O4Y A;  1K9P A;  1RRO A;  5CSF A;  3O6B A;  1N65 A;  3VRQ A;  2HPS A;  1DJY A;  1WRZ A;  3PN7 C;  1DJH A;  2B1U A;  2CXJ A;  3GK1 A;  4HRG A;  5D69 A;  1C7W A;  2LLS A;  1D1O A;  1G4Y R;  3C1V A;  1IJ6 A;  2MLF C;  1NP8 A;  4PDZ A;  4GFT A;  2ZKM X;  1YUU A;  2BKH B;  1UHI A;  1PK0 D;  3BOW A;  1N2D A;  2GV5 A;  1TIZ A;  2KQ6 A;  2JPT A;  4M2Q A;  1YUT A;  2I18 A;  4PCW A;  4QJ5 B;  2BEC A;  4GAO A;  5KU1 A;  1IKU A;  1OSA A;  1M31 A;  3NSO A;  2BE4 A;  2Q4U A;  2I94 A;  4CLN A;  3SG5 A;  1QX7 A;  4OVN F;  2JNF A;  1UHN A;  4C0L A;  1XVJ A;  3JVT B;  1G8I A;  1S5G Y;  1UHK A;  2JXC A;  1NCZ A;  3CR4 X;  3WHT B;  2BCA A;  2LUC A;  4GPL B;  1K2H A;  1XYD A;  3H4S E;  2MRD A;  3TDZ A;  2O5G A;  1X02 A;  3TDI A;  4JQ0 D;  3FS7 A;  2LP3 A;  1ZOT B;  1K9U A;  4F0Z B;  2P6B B;  2JT0 A;  2K2F A;  3FIA A;  3BXK A;  1ZAC A;  1OMV A;  3F45 A;  5G08 A;  5I2O A;  1IH0 A;  2E6W A;  1QTX A;  2K61 A;  1SL8 A;  2ZN8 A;  1ODB A;  2KSP A;  1C7V A;  3MSE B;  4OR9 B;  2PRU A;  2L51 A;  3OB2 B;  4MLW A;  1SYM A;  4YGE B;  1DTL A;  1SW8 A;  4R1E A;  3EVV A;  1AJ5 A;  1S6I A;  2PAL A;  1KK8 B;  3E3R A;  3KO0 A;  4U8D A;  1CDN A;  1YUS A;  2KYC A;  2NLN A;  1SR6 B;  1KFU S;  2EC6 C;  4WQ2 A;  1NX1 A;  3BUO B;  4MZJ A;  4PHK A;  1YRU B;  2KFG A;  2NCO A;  4PE4 A;  3NSL A;  1OZO A;  1XFY O;  2K7B A;  3OP0 A;  1J7Q A;  1J7R A;  1GJY A;  1K95 A;  3CZT X;  1JWD A;  2M1U A;  3DVE A;  4USL A;  1N0Y A;  1DGU A;  1JF2 A;  1F54 A;  1IG5 A;  2MAZ A;  1H8B A;  5HKZ A;  4ICB A;  2Y1N A;  2NZ0 A;  1CLM A;  1OMD A;  3SIA A;  1DJI A;  3EK4 A;  1KFU L;  3I5I C;  3I5F B;  5IBW A;  4C0J A;  2M1K B;  1BMO A;  1MR8 A;  2MHH A;  1GQM A;  2F3Z A;  4XJK B;  1EH2 A;  2AMI A;  2K8M B;  4PAL A;  1JF0 A;  1J1D A;  1OZS A;  1S6C A;  1B8R A;  2LHL A;  1S5G Z;  2M9G A;  1TNP A;  3SG7 A;  1DT7 B;  1YUR A;  3IQQ A;  4GUK A;  1UWO A;  4ETO A;  3PAL A;  2OTG C;  3K21 A;  2LE9 B;  1XK4 A;  4MSP A;  1FPW A;  1BR4 B;  4YGC B;  3KPX A;  1DJX A;  1R6P A;  3SJS A;  1F8H A;  3TS5 B;  2KFH A;  2LV7 A;  3KEV A;  2K2A A;  4TNC A;  4PE0 A;  1LIN A;  1K9K A;  2JQ6 A;  3BYA A;  3CTN A;  4P2Y B;  3DF0 B;  3OHM B;  4L9M A;  5GQQ C;  1DF0 A;  3JTD B;  2NCP A;  1SPY A;  4ORB B;  1EG4 A;  3DVK A;  2FCE A;  1HT9 A;  3BOW B;  1KSO A;  3AKA A;  4BY4 A;  1CNP A;  2F2O A;  1FW4 A;  1PVB A;  2V53 A;  3TDU A;  1RK9 A;  1Y6W A;  2OS8 B;  1PAL A;  3SG3 A;  1K94 A;  2F3Y A;  3LK1 A;  1NSH A;  1QIW A;  4GGN A;  2KGR A;  1R2U A;  5KSZ A;  4NQG A;  1Y0V H;  2HQ8 A;  1AHR A;  1Y1X A;  1XFZ O;  2DOQ A;  1IJ5 A;  1UUR A;  3OX5 A;  1QV1 A;  2WOR A;  2HF5 A;  3BUM B;  3EK7 A;  1G33 A;  1NX3 A;  1BU3 A;  4DUQ A;  5I8N A;  2LCP A;  4FTG A;  1KK7 Z;  2MJW B;  3JVT C;  2BKI B;  2SAS A;  1CM1 A;  1LA0 A;  3VGO A;  1GGW A;  2Q91 A;  5K89 A;  2FCD A;  4YGD B;  3AKB A;  1DVI A;  1PRW A;  4NDB A;  3RM1 A;  1A03 A;  2M0R A;  2FOT A;  4WQ3 A;  1MXE A;  3DVM A;  4MRY A;  4CPV A;  2COL B;  4AQI A;  4DIR A;  1B1G A;  1QVI Z;  4MEW A;  1KFX S;  2LVK A;  1SCM B;  1TTX A;  2KAV A;  3PAT A;  2FJU B;  1BLQ A;  1YVL A;  1WDC C;  2KGB C;  1KCY A;  5I2L A;  1A75 A;  1CFD A;  2R2I A;  4P5O E;  3LLE A;  2RGI A;  4CFR A;  3CS1 A;  3EVR A;  4YBH B;  1SBJ A;  3I5H B;  2BCB A;  5AAN A;  5KTY A;  3CR5 X;  2JT8 A;  2KAY A;  3LCP C;  3LK0 A;  1XK4 C;  1KK8 C;  2K7C A;  2H61 C;  2ZFD A;  3VRP A;  1CKK A;  3EK8 A;  1OQP A;  2EHB A;  1J7P A;  2CCM A;  2OPO A;  2Y5I A;  2KHN A;  4OKH A;  4DRW A;  1S3P A;  5D7F A;  4DS7 A;  2EGD A;  2JWW A;  1LXF C;  2L5X B;  2K7D A;  1QX2 A;  1S6J A;  1NCX A;  1CFP A;  4YI9 A;  1YVH A;  3DD4 A;  1UHJ A;  2KI6 D;  4I5L B;  1J55 A;  4N1G A;  1H4B A;  2WC8 A;  2M7N A;  3KF9 A;  5HKY A;  3I5G C;  1LKJ A;  1L2O B;  1TN4 A;  3BQ3 A;  1CB1 A;  1B8L A;  5DKN A;  4YGB B;  2JU0 A;  4M2P A;  1RWY A;  2KAX A;  4E68 A;  4Q04 A;  3OX6 A;  1MWN A;  3ZNI A;  4FQO A;  1J7O A;  1SK6 D;  1OMR A;  2JTT A;  2H2K A;  1FBV A;  1KK7 Y;  1MHO A;  5HLV A;  4I5J A;  5DKQ A;  3HCM A;  1REC A;  2TN4 A;  1QXP A;  1WRK A;  1U5I B;  2Y1M A;  1MF8 B;  1ZFS A;  1QAS A;  2PVB A;  5JOL A;  4QJ4 B;  2KBM A;  1F4Q A;  1FI5 A;  1QIV A;  3CLN A;  2JT3 A;  3TS5 C;  5ER5 A;  2LLU A;  1CTR A;  1QVI Y;  3PLF B;  4ZCU A;  2SCP A;  1AUI B;  3TUY C;  4XYN A;  1CDL A;  1DJW A;  4PE7 A;  3WNX B;  1IQ3 A;  2EC6 B;  5FYX A;  4YI8 A;  5I2Q A;  1FI6 A;  1KQM B;  1UHH A;  5TNC A;  3BUW B;  5PAL A;  4YRU A;  1NWD A;  1TRF A;  3BUX B;  2WCE A;  1NCY A;  2H61 A;  2L50 A;  2BL0 B;  2LVJ A;  2KI4 C;  1C07 A;  1A4P A;  1YR5 A;  1RJV A;  2JNX A;  1ZMZ A;  3GK2 A;  4WRI A;  1BT6 A;  1PSB A;  2LVV A;  3ZWH A;  3HX4 A;  2L4H A;  1M45 A;  2LMV A;  1TNW A;  3CWG A;  2JUL A;  3PFV A;  2PAS A;  3D0Y A;  3IF7 A;  1PSR A;  1BOD A;  1SCV A;  2WND A;  1J1E A;  1SMG A;  1B47 A;  2CT9 A;  3I5I B;  2JTZ A;  5DKR A;  1KSM A;  2F8P A;  1CDM A;  1KWO B;  4GGF C;  4BY5 A;  1HQV A;  1IGV A;  2JXL A;  4MN0 A;  3GOF A;  1MUX A;  4N5X A;  2JC2 A;  1XA5 A;  3WXA A;  3FWC A;  1S36 A;  1L7Z A;  4GBA A;  3VRN A;  2WCB A;  4MZK A;  3CR2 A;  1BOC A;  2AUC A;  1LVC D;  1A75 B;  1EJ3 A;  1DJZ A;  3AAJ A;  1WLM A;  2OTG B;  1TNX A;  4CFQ A;  4ORA B;  1JFJ A;  1F55 A;  5AFP A;  3RLZ A;  1NPQ A;  4ORC B;  1CDP A;  1NYA A;  2M7L A;  4D1E A;  2LAN A;  3I5H C;  3NXA A;  2NXQ A;  2A4J A;  3ICB A;  4MBE A;  3A8R A;  1UUS A;  1SRA A;  1V1F A;  2M29 A;  1NIW A;  2WCF A;  3DF0 A;  1AJ4 A;  1QS7 A;  4CID A;  2K7O A;  4UPG A;  2MLE C;  1SNL A;  1XFW O;  1CLL A;  1EG3 A;  4YGA A;  1JBA A;  4PE1 A;  2L2E A;  2KFF A;  1EXR A;  2JRF A;  3SG6 A;  4I5N B;  1B9A A;  1IWQ A;  2ZND A;  1K90 D;  3KHE A;  2LLT A;  3NSK A;  1DMO A;  1SR6 C;  1CFF A;  3PN7 B;  1V1G A;  5ER4 X;  1M46 A;  2M97 A;  4I5K A;  1L2O C;  3IQO A;  1ALV A;  3VRR A;  1BG1 A;  1NX0 A;  2BBN A;  1S26 D;  2L4I A;  2IS9 A;  3NSI A;  2KNE A;  2ZN9 A;  2QPT A;  1F4O A;  1CMG A; 
#chains in the Genus database with same CATH topology
 2CBL A;  3VB1 A;  1KFX L;  1W7I B;  5HKW A;  5FI7 A;  4PHM A;  3DVJ A;  3PSR A;  1OOJ A;  1QAT A;  1F70 A;  2GGZ A;  5HLO A;  5CSN A;  1YX7 A;  1BF5 A;  4GGF A;  1MXL C;  2HET A;  3S0E A;  2M8U A;  1M63 B;  1F71 A;  2GTE A;  3K1E A;  5F6T A;  3SS4 A;  1LA3 A;  2KI6 C;  2ZRT A;  4JPZ B;  1B7T Y;  3DZT A;  3AAK A;  1RFJ A;  4OZD A;  2ISD A;  3WHU B;  2JOJ A;  5HYD A;  5CSJ A;  4N1F A;  1AK8 A;  2GGM A;  4HRE E;  5AEQ A;  3FE8 A;  5B8I B;  1BJF A;  1WDC B;  1Y1A A;  1YRT B;  2VRG A;  3I5F C;  1IRJ A;  2BE6 A;  2L2C A;  2PSR A;  2LNK A;  1S1E A;  5J3X A;  5BPJ A;  2Y4Q A;  1EL4 A;  2K60 A;  1QLS A;  1B4C A;  1W9Z A;  4OV2 A;  2P71 A;  4PHN A;  2MBX A;  3CAB A;  3VRO A;  3DY9 A;  2LP2 A;  1A29 A;  2D8N A;  3BUN B;  1RTP 1;  4QJ3 B;  2PYQ A;  3SG4 A;  1SL7 A;  1TNQ A;  2JZI A;  1FF1 A;  2KBI A;  1DGV A;  1KQM C;  1SL9 A;  1WY9 A;  1PVA A;  1DF0 B;  5AXI A;  2BL0 C;  2LVI A;  3O2P A;  3D0Y B;  1E8A A;  2KYF A;  1PUL A;  2LC5 A;  4AQJ A;  1K8U A;  1OW4 A;  2CNP A;  4OCI A;  2BCX A;  4GNK B;  3QRX A;  4C0K A;  4MZL A;  3D10 A;  2L0P A;  3EKH A;  3I5G B;  1MQ1 A;  3JTD C;  2E30 A;  2KDH A;  2KOT A;  1CMF A;  2QAC A;  1M39 A;  1IQ5 A;  2LHI A;  5CSI A;  1TUZ A;  1OOG A;  1JUO A;  1YTZ C;  1YX8 A;  2HQW A;  2L98 A;  1LS8 A;  2M3W A;  2ZNE A;  3EVU A;  1ALW A;  3OB1 B;  3A4U B;  2MA2 A;  1GGZ A;  4DCK A;  1WRL A;  2ZRS A;  1SY9 A;  1XO5 A;  1CFC A;  2M49 B;  1KWO C;  2ERB A;  1OE9 B;  2O60 A;  2OS8 C;  2I7A A;  2CTN A;  2G9B A;  1QLK A;  3GK4 X;  1JFK A;  4JWQ A;  1AVS A;  3S0G A;  5I94 A;  2BBM A;  1K96 A;  1WLZ A;  1ZUZ A;  3CGA A;  1Q80 A;  4PHJ A;  4ZCV A;  3R1P A;  1NUB A;  3TZ1 A;  1JC2 A;  4A4B A;  1B8C A;  1XFX O;  5DIC A;  1BR1 B;  1KQV A;  3O78 A;  1QX5 B;  2LUX A;  2LAP A;  4JKT A;  1TOP A;  1W7J B;  2PMY A;  1Y1U A;  2G2B A;  5AER A;  4M2O A;  1K93 D;  1U5I A;  2F33 A;  1NX2 A;  3SS5 A;  1SKT A;  1XFV O;  1B7T Z;  3TUY B;  3SIB A;  1UP5 A;  1VRK A;  4AOM A;  1TCF A;  4MVF A;  1QV0 A;  4XJK A;  2K0J A;  2KQY A;  4IL1 A;  1DC1 A;  2AAO A;  3L4A A;  1DEL A;  2F2P A;  2LM5 A;  1A2X A;  2WOS A;  3EKJ A;  3PM8 A;  1QWV A;  4NDC A;  2KI4 B;  1AP4 A;  1SCM C;  4INW A;  3M0W A;  1TCO B;  1XFR A;  4NDD A;  3SG2 A;  5CPV A;  1CM4 A;  1CLB A;  4HSZ A;  1XFU O;  1DJG A;  3PM2 A;  3FWB A;  1JSA A;  2LMU A;  4A4C A;  1QJT A;  4MRX A;  5JJG A;  3LL8 B;  4HRH A;  1C3Y A;  2LMT A;  5HL1 A;  2I2R E;  3O4Y A;  1K9P A;  1RRO A;  5CSF A;  3O6B A;  1N65 A;  3VRQ A;  3S0A A;  2HPS A;  2QEH A;  1DJY A;  1WRZ A;  3PN7 C;  1DJH A;  2B1U A;  2CXJ A;  3GK1 A;  4HRG A;  5D69 A;  1C7W A;  2LLS A;  2WC5 A;  1G4Y R;  3C1V A;  1D1O A;  1IJ6 A;  2MLF C;  3CDN A;  1NP8 A;  4PDZ A;  4GFT A;  2ZKM X;  1YUU A;  2BKH B;  1UHI A;  1PK0 D;  3BOW A;  1N2D A;  2GV5 A;  2P70 A;  3PJI A;  1TIZ A;  2KQ6 A;  2JPT A;  4M2Q A;  1YUT A;  2I18 A;  4PCW A;  4QJ5 B;  2BEC A;  4GAO A;  5KU1 A;  1IKU A;  3EG5 B;  1GM0 A;  1OSA A;  3FE6 A;  1M31 A;  3NSO A;  2BE4 A;  2Q4U A;  2I94 A;  4CLN A;  3SG5 A;  1QX7 A;  4OVN F;  2JNF A;  1UHN A;  4C0L A;  1XVJ A;  3JVT B;  1G8I A;  1S5G Y;  1UHK A;  2JXC A;  4KYN A;  1NCZ A;  3SS3 A;  3CR4 X;  3WHT B;  3BJH A;  2BCA A;  2LUC A;  4GPL B;  1K2H A;  1XYD A;  3H4S E;  5FI2 A;  2MRD A;  3TDZ A;  2O5G A;  1X02 A;  3FE9 A;  3TDI A;  4JQ0 D;  3FS7 A;  2LP3 A;  2WCH A;  1ZOT B;  3D78 A;  1K9U A;  4F0Z B;  2P6B B;  2JT0 A;  2K2F A;  3FIA A;  3BXK A;  1ZAC A;  1OMV A;  3F45 A;  5G08 A;  5I2O A;  1IH0 A;  2E6W A;  1QTX A;  2K61 A;  1SL8 A;  2ZN8 A;  3O4X A;  1ODB A;  2KLE A;  2KSP A;  1C7V A;  3D73 A;  3MSE B;  4OR9 B;  2PRU A;  2L51 A;  3OB2 B;  4MLW A;  1SYM A;  4YGE B;  1DTL A;  1SW8 A;  4R1E A;  3EVV A;  1AJ5 A;  1S6I A;  2PAL A;  1KK8 B;  3E3R A;  3KO0 A;  4U8D A;  1CDN A;  1YUS A;  2KYC A;  2NLN A;  1SR6 B;  1KFU S;  2EC6 C;  4WQ2 A;  1NX1 A;  3BUO B;  4MZJ A;  4PHK A;  1YRU B;  2KFG A;  2NCO A;  4PE4 A;  3NSL A;  1OZO A;  1XFY O;  2K7B A;  3OP0 A;  1J7Q A;  1J7R A;  1GJY A;  2QEO A;  1K95 A;  3CZT X;  1JWD A;  2M1U A;  3DVE A;  4JD9 A;  4USL A;  1N0Y A;  1DGU A;  1JF2 A;  1F54 A;  1ORG A;  4INX A;  1IG5 A;  2MAZ A;  1H8B A;  5HKZ A;  4ICB A;  2Y1N A;  2NZ0 A;  1CLM A;  1OMD A;  3SIA A;  1DJI A;  3EK4 A;  1KFU L;  3I5I C;  3I5F B;  5IBW A;  4C0J A;  2M1K B;  1BMO A;  1MR8 A;  2MHH A;  1GQM A;  2F3Z A;  4XJK B;  1EH2 A;  2AMI A;  2K8M B;  4PAL A;  1JF0 A;  1J1D A;  1OZS A;  2KPH A;  1S6C A;  1B8R A;  2LHL A;  1S5G Z;  2M9G A;  1TNP A;  3SG7 A;  1DT7 B;  3V2L A;  3R72 A;  1YUR A;  3IQQ A;  4GUK A;  3D76 A;  1UWO A;  4ETO A;  3PAL A;  2OTG C;  3K21 A;  2LE9 B;  1XK4 A;  4MSP A;  1FPW A;  1BR4 B;  4YGC B;  3KPX A;  1DJX A;  1R6P A;  3SJS A;  1F8H A;  3TS5 B;  2KFH A;  2LV7 A;  2WCL A;  3KEV A;  2K2A A;  3DYE A;  3D74 A;  3OGN A;  4TNC A;  4PE0 A;  1LIN A;  1K9K A;  2JQ6 A;  2QDI A;  3BYA A;  3CTN A;  4P2Y B;  3DF0 B;  3OHM B;  4L9M A;  5GQQ C;  3RZS A;  1DF0 A;  3JTD B;  2NCP A;  2WCK A;  1SPY A;  4ORB B;  1EG4 A;  3DVK A;  1OOI X;  2FCE A;  1HT9 A;  3BOW B;  1KSO A;  3AKA A;  4BY4 A;  2WC6 A;  1CNP A;  2F2O A;  1FW4 A;  1PVB A;  2V53 A;  3CYZ A;  1RK9 A;  3TDU A;  1Y6W A;  2OS8 B;  1PAL A;  3SG3 A;  1K94 A;  2F3Y A;  3LK1 A;  1NSH A;  1QIW A;  4GGN A;  2KGR A;  1R2U A;  5KSZ A;  4NQG A;  1Y0V H;  2HQ8 A;  3D77 A;  1AHR A;  1Y1X A;  1XFZ O;  2DOQ A;  1IJ5 A;  1UUR A;  3OX5 A;  2YGU A;  1QV1 A;  2WOR A;  2HF5 A;  3BUM B;  3EK7 A;  1G33 A;  1NX3 A;  4PT1 A;  1BU3 A;  4DUQ A;  5I8N A;  2LCP A;  4FTG A;  1KK7 Z;  2MJW B;  3JVT C;  3NHI A;  2BKI B;  2SAS A;  1CM1 A;  1LA0 A;  3VGO A;  1GGW A;  2Q91 A;  5K89 A;  2QEV A;  2FCD A;  4YGD B;  1P28 A;  3AKB A;  4F7F A;  3BFB A;  1DVI A;  1PRW A;  4NDB A;  3RM1 A;  1A03 A;  3Q8I A;  2M0R A;  2FOT A;  4WQ3 A;  1MXE A;  3DVM A;  4MRY A;  4CPV A;  2COL B;  4AQI A;  4DIR A;  1B1G A;  1QVI Z;  3B7A A;  3CZ2 A;  4MEW A;  1KFX S;  2LVK A;  1SCM B;  1TTX A;  2KAV A;  3PAT A;  2FJU B;  1BLQ A;  1YVL A;  1WDC C;  2KGB C;  1KCY A;  5I2L A;  1A75 A;  3S0F A;  1CFD A;  2R2I A;  3R1V A;  3LLE A;  2RGI A;  4P5O E;  3CS1 A;  3EVR A;  4YBH B;  4CFR A;  1SBJ A;  3I5H B;  2BCB A;  5AAN A;  5KTY A;  3CR5 X;  2JT8 A;  2KAY A;  3LCP C;  3LK0 A;  1XK4 C;  1KK8 C;  2K7C A;  2H61 C;  1TUJ A;  2ZFD A;  3VRP A;  1CKK A;  3EK8 A;  1OQP A;  2EHB A;  1J7P A;  2CCM A;  2OPO A;  2Y5I A;  3IVT A;  2KHN A;  4OKH A;  4DRW A;  1S3P A;  5D7F A;  2BAP A;  2EGD A;  2JWW A;  1LXF C;  2L5X B;  2FJY A;  2K7D A;  1QX2 A;  5D3O A;  4DS7 A;  1S6J A;  1NCX A;  1CFP A;  4YI9 A;  3UO9 A;  1YVH A;  1IIO A;  3DD4 A;  1UHJ A;  2KI6 D;  4I5L B;  1J55 A;  4N1G A;  1H4B A;  2WC8 A;  2M7N A;  3KF9 A;  5HKY A;  3I5G C;  1LKJ A;  1L2O B;  1TN4 A;  3QME A;  3BQ3 A;  1CB1 A;  3D75 A;  1B8L A;  5DKN A;  3OBV A;  4YGB B;  2JU0 A;  4M2P A;  1RWY A;  2KAX A;  4E68 A;  4Q04 A;  3OX6 A;  1MWN A;  3ZNI A;  2WCJ A;  4FQO A;  1J7O A;  1SK6 D;  1OMR A;  3CZ1 A;  2JTT A;  4FQT A;  2H2K A;  1FBV A;  1KK7 Y;  1MHO A;  1T14 A;  1OOH A;  5HLV A;  4I5J A;  5DKQ A;  3HCM A;  1REC A;  2TN4 A;  5EL2 A;  1QXP A;  1SSE B;  1WRK A;  1U5I B;  2Y1M A;  1MF8 B;  1Z4H A;  1QAS A;  1ZFS A;  2PVB A;  5JOL A;  2KBM A;  4QJ4 B;  1F4Q A;  1FI5 A;  1QIV A;  3B88 A;  3CLN A;  2JT3 A;  3TS5 C;  5ER5 A;  2LLU A;  1CTR A;  1QVI Y;  3PLF B;  4ZCU A;  2SCP A;  1AUI B;  3TUY C;  4XYN A;  3DXL A;  1CDL A;  1DJW A;  4PE7 A;  3WNX B;  1IQ3 A;  1Z2C B;  2EC6 B;  5FYX A;  4YI8 A;  5I2Q A;  1FI6 A;  1KQM B;  2QEB A;  1UHH A;  5TNC A;  3BUW B;  5PAL A;  4YRU A;  1NWD A;  1TRF A;  3BUX B;  2WCE A;  1NCY A;  2H61 A;  2L50 A;  2BL0 B;  2LVJ A;  3N7H A;  2KI4 C;  1C07 A;  1A4P A;  1YR5 A;  1RJV A;  2L5Y A;  2JNX A;  3BFH A;  1ZMZ A;  3GK2 A;  4WRI A;  1BT6 A;  1PSB A;  2LVV A;  3ZWH A;  3HX4 A;  2L4H A;  1M45 A;  2LMV A;  1TNW A;  3CWG A;  2JUL A;  3PFV A;  2PAS A;  3D0Y A;  3S0D A;  3IF7 A;  3S0B A;  3B87 A;  1PSR A;  1BOD A;  1SCV A;  2WND A;  3NHT A;  1J1E A;  3R1O A;  1SMG A;  3CZ0 A;  2PQL A;  1DEK A;  1B47 A;  2CT9 A;  3I5I B;  2JTZ A;  5DKR A;  1KSM A;  2F8P A;  1CDM A;  1KWO B;  4GGF C;  4BY5 A;  1HQV A;  1IGV A;  3B86 A;  2JXL A;  4MN0 A;  3GOF A;  1MUX A;  4N5X A;  1DQE A;  4IJ7 A;  2JC2 A;  1XA5 A;  3WXA A;  3FWC A;  1S36 A;  1L7Z A;  4GBA A;  3VRN A;  2WCB A;  4MZK A;  3CR2 A;  1BOC A;  2AUC A;  1LVC D;  1A75 B;  1C3Z A;  1DJZ A;  1EJ3 A;  3AAJ A;  1WLM A;  2OTG B;  1TNX A;  4CFQ A;  4ORA B;  1JFJ A;  1F55 A;  3B6X A;  5AFP A;  3L4L A;  3RLZ A;  1NPQ A;  1OOF A;  2JPO A;  4ORC B;  3L47 A;  1CDP A;  1NYA A;  2M7L A;  4D1E A;  2LAN A;  3I5H C;  3NGV A;  2BNX A;  3NXA A;  2WCM A;  2NXQ A;  2A4J A;  3ICB A;  4MBE A;  2KLD A;  3A8R A;  1UUS A;  1SRA A;  1V1F A;  2M29 A;  1NIW A;  2WCF A;  3DF0 A;  1AJ4 A;  1QS7 A;  4CID A;  2K7O A;  4UPG A;  2MLE C;  1SNL A;  1XFW O;  1CLL A;  1EG3 A;  1TWO A;  4YGA A;  1JBA A;  4PE1 A;  3UNW A;  2L2E A;  2KFF A;  1EXR A;  2JRF A;  3SG6 A;  4I5N B;  1B9A A;  1IWQ A;  2ZND A;  1K90 D;  3KHE A;  2LLT A;  3NSK A;  1DMO A;  1SR6 C;  1CFF A;  3PN7 B;  1V1G A;  5ER4 X;  2H8V A;  1M46 A;  3BFA A;  2M97 A;  4I5K A;  1L2O C;  3IQO A;  1ALV A;  3VRR A;  1BG1 A;  1NX0 A;  2BBN A;  1S26 D;  2L4I A;  2IS9 A;  5FI6 A;  3NSI A;  2KNE A;  2ZN9 A;  2QPT A;  1F4O A;  1CMG A; 
#chains in the Genus database with same CATH homology
 2CBL A;  1KFX L;  1W7I B;  5HKW A;  4PHM A;  3DVJ A;  3PSR A;  1OOJ A;  1QAT A;  1F70 A;  2GGZ A;  5HLO A;  5CSN A;  1YX7 A;  1BF5 A;  4GGF A;  1MXL C;  2HET A;  2M8U A;  1M63 B;  1F71 A;  5F6T A;  1LA3 A;  2KI6 C;  2ZRT A;  4JPZ B;  1B7T Y;  2ISD A;  3AAK A;  1RFJ A;  3WHU B;  5HYD A;  2JOJ A;  5CSJ A;  4N1F A;  1AK8 A;  2GGM A;  4HRE E;  5AEQ A;  5B8I B;  1BJF A;  1WDC B;  1Y1A A;  1YRT B;  2VRG A;  3I5F C;  1IRJ A;  2BE6 A;  2PSR A;  2LNK A;  1S1E A;  5J3X A;  5BPJ A;  2Y4Q A;  1EL4 A;  1QLS A;  1B4C A;  4OV2 A;  4PHN A;  2MBX A;  3VRO A;  2LP2 A;  1A29 A;  2D8N A;  3BUN B;  1RTP 1;  4QJ3 B;  3SG4 A;  1SL7 A;  1TNQ A;  2JZI A;  1FF1 A;  2KBI A;  1DGV A;  1KQM C;  1SL9 A;  1WY9 A;  1PVA A;  1DF0 B;  5AXI A;  2BL0 C;  2LVI A;  3O2P A;  3D0Y B;  1E8A A;  2KYF A;  1PUL A;  2LC5 A;  4AQJ A;  1K8U A;  2CNP A;  4OCI A;  2BCX A;  4GNK B;  3QRX A;  4C0K A;  4MZL A;  3D10 A;  2L0P A;  3EKH A;  3I5G B;  1MQ1 A;  3JTD C;  2E30 A;  2KDH A;  2KOT A;  1CMF A;  2QAC A;  1M39 A;  1IQ5 A;  2LHI A;  5CSI A;  1YTZ C;  2HQW A;  1JUO A;  2L98 A;  1YX8 A;  2M3W A;  2ZNE A;  3EVU A;  1ALW A;  3OB1 B;  3A4U B;  2MA2 A;  1GGZ A;  4DCK A;  1WRL A;  2ZRS A;  1SY9 A;  1XO5 A;  1CFC A;  2M49 B;  1KWO C;  2O60 A;  1OE9 B;  2OS8 C;  2I7A A;  2CTN A;  2G9B A;  1QLK A;  3GK4 X;  1JFK A;  4JWQ A;  1AVS A;  2BBM A;  1K96 A;  1WLZ A;  1ZUZ A;  3CGA A;  1Q80 A;  4PHJ A;  4ZCV A;  3TZ1 A;  1NUB A;  1JC2 A;  4A4B A;  1B8C A;  1XFX O;  1BR1 B;  1KQV A;  3O78 A;  1QX5 B;  2LUX A;  2LAP A;  1TOP A;  1W7J B;  2PMY A;  1Y1U A;  2G2B A;  5AER A;  4M2O A;  1K93 D;  1U5I A;  2F33 A;  1NX2 A;  1SKT A;  1XFV O;  1B7T Z;  3TUY B;  3SIB A;  1UP5 A;  1VRK A;  4AOM A;  1TCF A;  4MVF A;  1QV0 A;  4XJK A;  2K0J A;  2KQY A;  4IL1 A;  2AAO A;  2F2P A;  2LM5 A;  1A2X A;  2WOS A;  3EKJ A;  3PM8 A;  4NDC A;  2KI4 B;  1AP4 A;  1SCM C;  3M0W A;  1TCO B;  4NDD A;  3SG2 A;  1CLB A;  5CPV A;  1CM4 A;  4HSZ A;  1XFU O;  1DJG A;  3FWB A;  1JSA A;  2LMU A;  4A4C A;  1QJT A;  4MRX A;  5JJG A;  3LL8 B;  4HRH A;  2LMT A;  2I2R E;  3O4Y A;  1K9P A;  1RRO A;  5CSF A;  3O6B A;  1N65 A;  3VRQ A;  2HPS A;  1DJY A;  1WRZ A;  3PN7 C;  1DJH A;  2B1U A;  2CXJ A;  3GK1 A;  4HRG A;  5D69 A;  1C7W A;  2LLS A;  1D1O A;  1G4Y R;  3C1V A;  1IJ6 A;  2MLF C;  1NP8 A;  4PDZ A;  4GFT A;  2ZKM X;  1YUU A;  2BKH B;  1UHI A;  1PK0 D;  3BOW A;  1N2D A;  2GV5 A;  1TIZ A;  2KQ6 A;  2JPT A;  4M2Q A;  1YUT A;  2I18 A;  4PCW A;  4QJ5 B;  2BEC A;  4GAO A;  5KU1 A;  1IKU A;  1OSA A;  1M31 A;  3NSO A;  2BE4 A;  2Q4U A;  2I94 A;  4CLN A;  3SG5 A;  1QX7 A;  4OVN F;  2JNF A;  1UHN A;  4C0L A;  1XVJ A;  3JVT B;  1G8I A;  1S5G Y;  1UHK A;  2JXC A;  1NCZ A;  3CR4 X;  3WHT B;  2BCA A;  2LUC A;  4GPL B;  1K2H A;  1XYD A;  3H4S E;  2MRD A;  3TDZ A;  2O5G A;  1X02 A;  3TDI A;  4JQ0 D;  3FS7 A;  2LP3 A;  1ZOT B;  1K9U A;  4F0Z B;  2P6B B;  2JT0 A;  2K2F A;  3FIA A;  3BXK A;  1ZAC A;  1OMV A;  3F45 A;  5G08 A;  5I2O A;  1IH0 A;  2E6W A;  1QTX A;  2K61 A;  1SL8 A;  2ZN8 A;  1ODB A;  2KSP A;  1C7V A;  3MSE B;  4OR9 B;  2PRU A;  2L51 A;  3OB2 B;  4MLW A;  1SYM A;  4YGE B;  1DTL A;  1SW8 A;  4R1E A;  3EVV A;  1AJ5 A;  1S6I A;  2PAL A;  1KK8 B;  3E3R A;  3KO0 A;  4U8D A;  1CDN A;  1YUS A;  2KYC A;  2NLN A;  1SR6 B;  1KFU S;  2EC6 C;  4WQ2 A;  1NX1 A;  3BUO B;  4MZJ A;  4PHK A;  1YRU B;  2KFG A;  2NCO A;  4PE4 A;  3NSL A;  1OZO A;  1XFY O;  2K7B A;  3OP0 A;  1J7Q A;  1J7R A;  1GJY A;  1K95 A;  3CZT X;  1JWD A;  2M1U A;  3DVE A;  4USL A;  1N0Y A;  1DGU A;  1JF2 A;  1F54 A;  1IG5 A;  2MAZ A;  1H8B A;  5HKZ A;  4ICB A;  2Y1N A;  2NZ0 A;  1CLM A;  1OMD A;  3SIA A;  1DJI A;  3EK4 A;  1KFU L;  3I5I C;  3I5F B;  5IBW A;  4C0J A;  2M1K B;  1BMO A;  1MR8 A;  2MHH A;  1GQM A;  2F3Z A;  4XJK B;  1EH2 A;  2AMI A;  2K8M B;  4PAL A;  1JF0 A;  1J1D A;  1OZS A;  1S6C A;  1B8R A;  2LHL A;  1S5G Z;  2M9G A;  1TNP A;  3SG7 A;  1DT7 B;  1YUR A;  3IQQ A;  4GUK A;  1UWO A;  4ETO A;  3PAL A;  2OTG C;  3K21 A;  2LE9 B;  1XK4 A;  4MSP A;  1FPW A;  1BR4 B;  4YGC B;  3KPX A;  1DJX A;  1R6P A;  3SJS A;  1F8H A;  3TS5 B;  2KFH A;  2LV7 A;  3KEV A;  2K2A A;  4TNC A;  4PE0 A;  1LIN A;  1K9K A;  2JQ6 A;  3BYA A;  3CTN A;  4P2Y B;  3DF0 B;  3OHM B;  4L9M A;  5GQQ C;  1DF0 A;  3JTD B;  2NCP A;  1SPY A;  4ORB B;  1EG4 A;  3DVK A;  2FCE A;  1HT9 A;  3BOW B;  1KSO A;  3AKA A;  4BY4 A;  1CNP A;  2F2O A;  1FW4 A;  1PVB A;  2V53 A;  3TDU A;  1RK9 A;  1Y6W A;  2OS8 B;  1PAL A;  3SG3 A;  1K94 A;  2F3Y A;  3LK1 A;  1NSH A;  1QIW A;  4GGN A;  2KGR A;  1R2U A;  5KSZ A;  4NQG A;  1Y0V H;  2HQ8 A;  1AHR A;  1Y1X A;  1XFZ O;  2DOQ A;  1IJ5 A;  1UUR A;  3OX5 A;  1QV1 A;  2WOR A;  2HF5 A;  3BUM B;  3EK7 A;  1G33 A;  1NX3 A;  1BU3 A;  4DUQ A;  5I8N A;  2LCP A;  4FTG A;  1KK7 Z;  2MJW B;  3JVT C;  2BKI B;  2SAS A;  1CM1 A;  1LA0 A;  3VGO A;  1GGW A;  2Q91 A;  5K89 A;  2FCD A;  4YGD B;  3AKB A;  1DVI A;  1PRW A;  4NDB A;  3RM1 A;  1A03 A;  2M0R A;  2FOT A;  4WQ3 A;  1MXE A;  3DVM A;  4MRY A;  4CPV A;  2COL B;  4AQI A;  4DIR A;  1B1G A;  1QVI Z;  4MEW A;  1KFX S;  2LVK A;  1SCM B;  1TTX A;  2KAV A;  3PAT A;  2FJU B;  1BLQ A;  1YVL A;  1WDC C;  2KGB C;  1KCY A;  5I2L A;  1A75 A;  1CFD A;  2R2I A;  4P5O E;  3LLE A;  2RGI A;  4CFR A;  3CS1 A;  3EVR A;  4YBH B;  1SBJ A;  3I5H B;  2BCB A;  5AAN A;  5KTY A;  3CR5 X;  2JT8 A;  2KAY A;  3LCP C;  3LK0 A;  1XK4 C;  1KK8 C;  2K7C A;  2H61 C;  2ZFD A;  3VRP A;  1CKK A;  3EK8 A;  1OQP A;  2EHB A;  1J7P A;  2CCM A;  2OPO A;  2Y5I A;  2KHN A;  4OKH A;  4DRW A;  1S3P A;  5D7F A;  4DS7 A;  2EGD A;  2JWW A;  1LXF C;  2L5X B;  2K7D A;  1QX2 A;  1S6J A;  1NCX A;  1CFP A;  4YI9 A;  1YVH A;  3DD4 A;  1UHJ A;  2KI6 D;  4I5L B;  1J55 A;  4N1G A;  1H4B A;  2WC8 A;  2M7N A;  3KF9 A;  5HKY A;  3I5G C;  1LKJ A;  1L2O B;  1TN4 A;  3BQ3 A;  1CB1 A;  1B8L A;  5DKN A;  4YGB B;  2JU0 A;  4M2P A;  1RWY A;  2KAX A;  4E68 A;  4Q04 A;  3OX6 A;  1MWN A;  3ZNI A;  4FQO A;  1J7O A;  1SK6 D;  1OMR A;  2JTT A;  2H2K A;  1FBV A;  1KK7 Y;  1MHO A;  5HLV A;  4I5J A;  5DKQ A;  3HCM A;  1REC A;  2TN4 A;  1QXP A;  1WRK A;  1U5I B;  2Y1M A;  1MF8 B;  1ZFS A;  1QAS A;  2PVB A;  5JOL A;  4QJ4 B;  2KBM A;  1F4Q A;  1FI5 A;  1QIV A;  3CLN A;  2JT3 A;  3TS5 C;  5ER5 A;  2LLU A;  1CTR A;  1QVI Y;  3PLF B;  4ZCU A;  2SCP A;  1AUI B;  3TUY C;  4XYN A;  1CDL A;  1DJW A;  4PE7 A;  3WNX B;  1IQ3 A;  2EC6 B;  5FYX A;  4YI8 A;  5I2Q A;  1FI6 A;  1KQM B;  1UHH A;  5TNC A;  3BUW B;  5PAL A;  4YRU A;  1NWD A;  1TRF A;  3BUX B;  2WCE A;  1NCY A;  2H61 A;  2L50 A;  2BL0 B;  2LVJ A;  2KI4 C;  1C07 A;  1A4P A;  1YR5 A;  1RJV A;  2JNX A;  1ZMZ A;  3GK2 A;  4WRI A;  1BT6 A;  1PSB A;  2LVV A;  3ZWH A;  3HX4 A;  2L4H A;  1M45 A;  2LMV A;  1TNW A;  3CWG A;  2JUL A;  3PFV A;  2PAS A;  3D0Y A;  3IF7 A;  1PSR A;  1BOD A;  1SCV A;  2WND A;  1J1E A;  1SMG A;  1B47 A;  2CT9 A;  3I5I B;  2JTZ A;  5DKR A;  1KSM A;  2F8P A;  1CDM A;  1KWO B;  4GGF C;  4BY5 A;  1HQV A;  1IGV A;  2JXL A;  4MN0 A;  3GOF A;  1MUX A;  4N5X A;  2JC2 A;  1XA5 A;  3WXA A;  3FWC A;  1S36 A;  1L7Z A;  4GBA A;  3VRN A;  2WCB A;  4MZK A;  3CR2 A;  1BOC A;  2AUC A;  1LVC D;  1A75 B;  1EJ3 A;  1DJZ A;  3AAJ A;  1WLM A;  2OTG B;  1TNX A;  4CFQ A;  4ORA B;  1JFJ A;  1F55 A;  5AFP A;  3RLZ A;  1NPQ A;  4ORC B;  1CDP A;  1NYA A;  2M7L A;  4D1E A;  2LAN A;  3I5H C;  3NXA A;  2NXQ A;  2A4J A;  3ICB A;  4MBE A;  3A8R A;  1UUS A;  1SRA A;  1V1F A;  2M29 A;  1NIW A;  2WCF A;  3DF0 A;  1AJ4 A;  1QS7 A;  4CID A;  2K7O A;  4UPG A;  2MLE C;  1SNL A;  1XFW O;  1CLL A;  1EG3 A;  4YGA A;  1JBA A;  4PE1 A;  2L2E A;  2KFF A;  1EXR A;  2JRF A;  3SG6 A;  4I5N B;  1B9A A;  1IWQ A;  2ZND A;  1K90 D;  3KHE A;  2LLT A;  3NSK A;  1DMO A;  1SR6 C;  1CFF A;  3PN7 B;  1V1G A;  5ER4 X;  1M46 A;  2M97 A;  4I5K A;  1L2O C;  3IQO A;  1ALV A;  3VRR A;  1BG1 A;  1NX0 A;  2BBN A;  1S26 D;  2L4I A;  2IS9 A;  3NSI A;  2KNE A;  2ZN9 A;  2QPT A;  1F4O A;  1CMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...