1F55A

Solution structure of the calcium bound n-terminal domain of yeast calmodulin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords CALMODULIN
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f55A00
1LA3A 2M0RA 1IGVA 4PE4A 2AAOA 1LVCD 1K93D 3PATA 2LVIA 2B1UA 3CTNA 1NP8A 2WCFA 1CLMA 1S6JA 3PALA 1TCOB 3LK0A 3CLNA 2KI4C 1MXLC 2CTNA 1NCYA 1QATA 1UHJA 2L4HA 2LLSA 1R2UA 2MLFC 1J7PA 4YRUA 1SL7A 1CFDA 1EL4A 1K9KA 2CNPA 2WNDA 2L0PA 3KPXA 4C0LA 2JXLA 1SMGA 3CR5X 2E6WA 1B4CA 5DKQA 3WHTB 1OMDA 2LVJA 2ZFDA 3DVKA 3FWCA 3PN7C 5KU1A 1BR4B 2EC6B 3JVTB 1QVIY 3O4YA 2KGRA 3IQOA 1L2OC 2MHHA 5AXIA 4PE1A 2K7CA 1Y1UA 2Y1MA 3A8RA 4GFTA 2LNKA 3AKBA 4CLNA 2BCXA 1K8UA 1BMOA 1HQVA 1QLSA 5HLOA 4HRGA 1TTXA 1DF0B 1DJYA 5FYXA 4NQGA 1S1EA 1ALVA 1ZFSA 2FJUB 3D0YA 4OR9B 1S26D 2KAYA 3H4SE 4HRHA 1XFUO 1YURA 2CT9A 1UHHA 3BQ3A 1CMGA 1CKKA 1BODA 1LINA 4YGCB 3O78A 1SW8A 2JOJA 4N1FA 2KAVA 1TOPA 2HF5A 1U5IB 4PHJA 1KWOC 2QPTA 3BUMB 1JBAA 3KF9A 4MN0A 2GV5A 2L2EA 4M2OA 1XFXO 1UP5A 4MRXA 1RFJA 5CSJA 3GOFA 1H4BA 2JULA 4WRIA 5GQQC 4GPLB 1KQMC 1QX7A 4WQ2A 2JQ6A 2KQ6A 1HT9A 1YVLA 3DF0B 1DJGA 3I5GC 1SCMB 1XYDA 2EC6C 3CR4X 1RJVA 1VRKA 3KO0A 4C0JA 5CSIA 1NUBA 2LCPA 5KTYA 1CFFA 1J1DA 1K9UA 3IQQA 1LXFC 1XO5A 2K0JA 1YR5A 2WCEA 1CDPA 2F2OA 2I2RE 1SL8A 1SR6C 5I8NA 1CMFA 1NSHA 2KSPA 2H2KA 3NSLA 4YI8A 3FIAA 4M2PA 1AP4A 1AUIB 2K7OA 3LL8B 3OP0A 3RLZA 2LUXA 4A4CA 4DRWA 4AQJA 1Y0VH 2JXCA 3AAKA 4PDZA 5IBWA 3WNXB 2G9BA 1QX2A 1F70A 1K90D 2KQYA 2E30A 1B8LA 4GBAA 3AKAA 2I18A 1CB1A 3JTDB 4YGBB 1KWOB 2H61C 1A4PA 4CFQA 1D1OA 1YVHA 1CM4A 1ZOTB 2JNXA 4NDCA 2BL0C 1F71A 3EK8A 2CCMA 2HQ8A 3O2PA 1SCVA 3OHMB 4OV2A 2Q91A 1DJZA 3D0YB 4ORBB 1JUOA 3A4UB 1PSRA 2D8NA 2QACA 2KYCA 4C0KA 3SG6A 4GGNA 4YI9A 4MZKA 3SIBA 2F2PA 3I5FC 4CFRA 1NIWA 4I5LB 1TNPA 2KFHA 4BY4A 2VRGA 1F8HA 2LUCA 1KK7Y 1JF0A 1UHNA 2M9GA 2JU0A 1YX8A 2JZIA 1JWDA 2JNFA 3ZWHA 1TNWA 4ORAB 4YGEB 1JC2A 2KDHA 2LV7A 1RECA 1TCFA 2A4JA 2FCEA 2KI6C 1BG1A 3VRPA 4XJKB 1KK8C 2JT3A 5HYDA 1EJ3A 2HETA 4MBEA 4MSPA 1DTLA 4JQ0D 4OKHA 1UHIA 2OTGC 4USLA 1GJYA 1UURA 1FBVA 2Y4QA 1YTZC 2TN4A 2K8MB 1DMOA 1FPWA 3NSIA 4D1EA 2F8PA 1PULA 1NX0A 5PALA 2SASA 3AAJA 5JJGA 3BOWA 1CLLA 1FI5A 1SCMC 3TDIA 3TUYC 3BOWB 2HPSA 2KHNA 2L50A 4GGFA 3SG4A 2KBIA 4A4BA 1DGVA 2JWWA 1DJXA 1SBJA 1JFKA 1MXEA 1BLQA 2BCAA 1QV0A 1Y1AA 1WLZA 3DF0A 1J7RA 3WHUB 1B47A 3SIAA 3LK1A 2BKIB 1DT7B 4HSZA 2M97A 2MAZA 1IKUA 2LVKA 3WXAA 1NYAA 1EG3A 5HKZA 2EHBA 2PSRA 2BCBA 1KCYA 2JT0A 3LLEA 4HREE 1CFCA 1TRFA 1K96A 1A2XA 2L4IA 5AANA 2LHLA 3BUNB 3CWGA 4YBHB 3SG3A 2GGMA 2ZNEA 3MSEB 1ZMZA 1QASA 1DVIA 1NWDA 1CTRA 3SG7A 1YX7A 1RROA 5DKNA 1XK4A 4I5KA 2OPOA 4L9MA 1OSAA 2LP2A 1E8AA 1CLBA 1DJIA 1B8CA 2EGDA 3CR2A 1WY9A 2WOSA 5B8IB 4JPZB 5AEQA 1KK7Z 1N0YA 1MF8B 1S36A 3TUYB 1RTP1 3GK4X 4MRYA 4PALA 5CSFA 5TNCA 1KSOA 1OZOA 4PHKA 3VROA 5AERA 1FF1A 4PHNA 1F4QA 2ZRSA 3NSOA 1WDCC 4CPVA 4ORCB 2L98A 1XFVO 1FI6A 3SG2A 1K2HA 2F3YA 1JSAA 1AJ4A 1K94A 2KI6D 5I2OA 2MLEC 3I5IB 1YRTB 2PRUA 5G08A 3EKJA 3BUOB 1SL9A 2LLUA 1ZACA 3DD4A 3PSRA 2WCBA 2ZN8A 2LM5A 1KFUL 3D10A 1AK8A 1WRLA 1XK4C 1QV1A 1Y1XA 2K2AA 2JRFA 3ICBA 5ER4X 2LANA 1CM1A 1NX2A 2I94A 4BY5A 1CFPA 1XFYO 1QX5B 3EVVA 3EK7A 1F55A 1M63B 1TNQA 1M31A 2MA2A 5BPJA 2BBNA 3BXKA 2SCPA 2CXJA 1QIWA 2KNEA 2AMIA 3EKHA 2JTTA 1NX3A 2M7NA 1OMRA 1C07A 2IS9A 1AVSA 5KSZA 2GGZA 3TDUA 4DCKA 2KYFA 1M46A 1OE9B 1SYMA 3NXAA 1RK9A 4PE7A 1W7JB 1K95A 1QLKA 1GQMA 2LLTA 1XVJA 3EVRA 2LMVA 2WC8A 1JF2A 1QTXA 1M45A 4M2QA 4OCIA 1OQPA 4ETOA 3DVEA 2LHIA 1S6IA 2K61A 2Y1NA 3RM1A 1A75A 4OVNF 4U8DA 1S3PA 5HKYA 1IWQA 1H8BA 4WQ3A 1J55A 1SKTA 2BE4A 4QJ3B 2KAXA 2K7BA 1CDNA 1A03A 2I7AA 3OB2B 4Q04A 4F0ZB 1ODBA 5I2QA 1LA0A 1IQ3A 1CDMA 4UPGA 2K2FA 1DF0A 2NXQA 5ER5A 1NPQA 1TIZA 2LVVA 2BL0B 2WORA 2JC2A 2LP3A 2ISDA 1G8IA 2OS8C 4XJKA 1Y6WA 1DGUA 5AFPA 1NCZA 3LCPC 2ZNDA 3OB1B 1X02A 5DKRA 2BECA 2LMTA 3VRQA 1B1GA 1IG5A 4ICBA 1KSMA 3DVJA 2KFFA 5HLVA 2PMYA 5JOLA 1F4OA 1FW4A 1K9PA 1WDCB 1MUXA 4DS7A 1MHOA 3OX5A 4I5JA 2Y5IA 1GGWA 2G2BA 1LKJA 3BYAA 3SJSA 1AJ5A 2M7LA 1NX1A 2LC5A 5D69A 2LAPA 1W7IB 2LE9B 2JTZA 3I5FB 3I5HB 3GK1A 2M49B 4DUQA 2HQWA 4NDBA 1NCXA 1SRAA 2BE6A 2OTGB 1S5GZ 3SG5A 1DJWA 1EXRA 1KFUS 1PRWA 2NLNA 4TNCA 4IL1A 2CBLA 2KFGA 4AQIA 1QXPA 2LMUA 1YUSA 1BU3A 3I5GB 4P2YB 3QRXA 1KK8B 1ZUZA 1TN4A 1S6CA 3C1VA 4ZCVA 4MZLA 5F6TA 2JPTA 3DVMA 5CSNA 5D7FA 1M39A 1Q80A 3HX4A 5I2LA 1PSBA 4PCWA 4QJ5B 2O60A 4NDDA 2P6BB 1JFJA 4MVFA 1KFXS 1SK6D 2M3WA 4DIRA 1BJFA 2KGBC 2Q4UA 2ZRTA 1F54A 2H61A 1IJ5A 1KFXL 5J3XA 3HCMA 2F33A 1GGZA 4GNKB 2M29A 4N5XA 2DOQA 3F45A 1QIVA 4QJ4B 2M1UA 2MBXA 4YGAA 4I5NB 4CIDA 1SR6B 4MLWA 1BF5A 1PALA 4AOMA 1N2DA 3KHEA 2COLB 2BKHB 2PASA 3JTDC 3I5HC 3BUXB 1YRUB 1BR1B 1UHKA 4GAOA 3BUWB 3VGOA 2AUCA 3GK2A 1UWOA 5HKWA 1MQ1A 4FQOA 1C7VA 4JWQA 4MZJA 2NCPA 2RGIA 1EG4A 1MWNA 1A29A 1KQMB 1U5IA 4MEWA 3TS5C 3PN7B 3NSKA 3PLFB 1PVBA 1B7TY 1XFWO 1C7WA 3O6BA 4P5OE 1V1GA 1YUTA 4XYNA 4E68A 2R2IA 1IQ5A 3IF7A 2KBMA 2M1KB 2MJWB 2ZN9A 1BT6A 1IRJA 1QVIZ 1AHRA 1XA5A 1CDLA 3CS1A 2NZ0A 3OX6A 3VRRA 2K7DA 3CGAA 1KQVA 1N65A 2MRDA 1WLMA 2FCDA 1QS7A 2M8UA 1CNPA 3CZTX 3ZNIA 3I5IC 1L7ZA 1WRKA 4N1GA 1TNXA 2KI4B 2BBMA 3EVUA 3E3RA 1EH2A 3M0WA 4ZCUA 2NCOA 1PK0D 1B7TZ 1PVAA 1R6PA 1UUSA 1SPYA 4GGFC 1IH0A 1BOCA 2JT8A 1B9AA 4PE0A 1IJ6A 5K89A 2PVBA 3EK4A 2L5XB 3TS5B 2ZKMX 3VRNA 2V53A 1SNLA 3FWBA 3JVTC 1MR8A 1XFZO 1J7OA 1V1FA 1A75B 1S5GY 3FS7A 3PFVA 3PM8A 5CPVA 2PALA 1J1EA 3TDZA 3TZ1A 1L2OB 4PHMA 1YUUA 4GUKA 1B8RA 4FTGA 1OZSA 1SY9A 1G33A 1DJHA 2OS8B 3KEVA 4YGDB 1ALWA 1RWYA 3K21A 2FOTA 2KOTA 1J7QA 2L51A 1OOJA 1QJTA 2O5GA 1WRZA 1OMVA 4R1EA 2F3ZA 1G4YR
chains in the Genus database with same CATH superfamily
1LA3A 2M0RA 1IGVA 4PE4A 2AAOA 3L47A 1LVCD 1K93D 3PATA 5EL2A 2LVIA 2B1UA 3RZSA 3CTNA 1NP8A 1LS8A 2WCFA 1CLMA 1S6JA 3PALA 1TCOB 3LK0A 3CLNA 2KI4C 1MXLC 2CTNA 1NCYA 3O4XA 1QATA 1UHJA 2L4HA 2LLSA 1R2UA 2MLFC 1J7PA 3UNWA 4YRUA 1SL7A 1Z2CB 1CFDA 1EL4A 1K9KA 2CNPA 2WNDA 2L0PA 3KPXA 4C0LA 2JXLA 1SMGA 3CR5X 3V2LA 1OOIX 2E6WA 1B4CA 5DKQA 3WHTB 1OMDA 2LVJA 2ZFDA 3DVKA 3FWCA 3PN7C 5KU1A 1BR4B 2EC6B 3JVTB 4JD9A 1QVIY 3O4YA 2KGRA 5FI7A 3IQOA 1L2OC 2MHHA 5AXIA 4PE1A 2K7CA 1Y1UA 2Y1MA 3A8RA 4GFTA 2LNKA 3AKBA 4CLNA 2BCXA 1K8UA 1BMOA 1HQVA 1QLSA 5HLOA 4HRGA 1TTXA 1DF0B 1DJYA 5FYXA 4NQGA 1S1EA 1ALVA 1ZFSA 1C3ZA 2FJUB 3D0YA 2P70A 4OR9B 1S26D 2KAYA 3H4SE 4HRHA 1XFUO 1YURA 2CT9A 1UHHA 3BQ3A 1CMGA 1CKKA 1BODA 1LINA 4YGCB 3O78A 1SW8A 2JOJA 4N1FA 4OZDA 2KAVA 3BFHA 1TOPA 1AK8A 3FE9A 4JKTA 5D3OA 2L5YA 2HF5A 1U5IB 5DICA 4PHJA 1KWOC 1ORGA 2QPTA 3BUMB 1JBAA 2L2CA 3KF9A 4MN0A 2GV5A 5I94A 2L2EA 3IVTA 4M2OA 1XFXO 1UP5A 4MRXA 1RFJA 5CSJA 3GOFA 4KYNA 1H4BA 2JULA 4WRIA 5GQQC 3FE6A 4GPLB 1KQMC 1QX7A 4WQ2A 2JQ6A 3QMEA 1OOFA 2KQ6A 1DQEA 1HT9A 4PT1A 3D74A 1YVLA 3DF0B 1DJGA 3I5GC 1SCMB 1XYDA 2EC6C 3CR4X 3L4LA 1RJVA 1VRKA 3KO0A 4C0JA 5CSIA 1NUBA 2LCPA 5KTYA 1CFFA 1J1DA 1K9UA 3IQQA 1LXFC 1XO5A 2K0JA 1YR5A 2WCEA 1CDPA 2F2OA 2I2RE 1SL8A 1P28A 1SR6C 5I8NA 1NSHA 1CMFA 2KSPA 2H2KA 3NSLA 1OW4A 4YI8A 3FIAA 4M2PA 1AP4A 1AUIB 2K7OA 3LL8B 3OP0A 3RLZA 2LUXA 4A4CA 4DRWA 4AQJA 1Y0VH 2JXCA 3DXLA 3AAKA 4PDZA 5IBWA 3WNXB 1QX2A 2G9BA 2WCJA 1F70A 1K90D 2KQYA 2E30A 3B87A 3UO9A 1B8LA 4GBAA 3AKAA 2I18A 1CB1A 3JTDB 4YGBB 1KWOB 2H61C 1A4PA 4CFQA 3BFBA 3PM2A 1D1OA 1YVHA 1CM4A 1ZOTB 2JNXA 4NDCA 2BL0C 5FI2A 1F71A 3EK8A 2CCMA 2HQ8A 3O2PA 1SCVA 3OHMB 3R72A 4OV2A 2Q91A 3CYZA 1DJZA 3D0YB 4ORBB 2WC6A 1JUOA 2JPOA 1PSRA 2D8NA 2QACA 2KYCA 3A4UB 3SG6A 4GGNA 4YI9A 4MZKA 3SIBA 2F2PA 3I5FC 4CFRA 1NIWA 4I5LB 1TNPA 2KFHA 4BY4A 2VRGA 3OBVA 2LUCA 1F8HA 1KK7Y 2WCHA 1DC1A 1JF0A 1UHNA 2M9GA 3R1OA 2JU0A 1YX8A 2JZIA 1JWDA 2JNFA 3ZWHA 1TNWA 4ORAB 4INWA 4YGEB 1JC2A 2KDHA 2LV7A 1RECA 1TCFA 2A4JA 2FCEA 2KI6C 1BG1A 3VRPA 2WCMA 4XJKB 1KK8C 2JT3A 5HYDA 3S0FA 1EJ3A 2HETA 3B86A 4MBEA 4MSPA 1DTLA 4JQ0D 4OKHA 1UHIA 2OTGC 4USLA 5FI6A 1GJYA 1UURA 1FBVA 2Y4QA 1YTZC 2TN4A 2K8MB 3S0AA 3D75A 1DMOA 1FPWA 3NSIA 4D1EA 2F8PA 1PULA 1NX0A 5PALA 2SASA 3AAJA 5JJGA 3BOWA 1CLLA 1FI5A 1SCMC 1SSEB 2KLDA 3TDIA 3BOWB 3TUYC 2QEHA 2HPSA 2KHNA 2L50A 4GGFA 3SG4A 2KBIA 4A4BA 1DGVA 2JWWA 1DJXA 1SBJA 1JFKA 1MXEA 1BLQA 2BCAA 1QV0A 1Y1AA 1WLZA 3DF0A 1J7RA 3WHUB 1B47A 3SIAA 3CDNA 3LK1A 2BKIB 3N7HA 4HSZA 2M97A 1DT7B 2MAZA 1IKUA 2LVKA 3WXAA 2FJYA 1NYAA 1EG3A 3DYEA 5HKZA 2EHBA 2PSRA 2BCBA 3SS4A 1KCYA 2JT0A 3LLEA 4HREE 1CFCA 1TRFA 1K96A 1A2XA 3B6XA 2L4IA 5AANA 2LHLA 3BUNB 3CWGA 4YBHB 3SG3A 2GGMA 1C3YA 2ZNEA 3MSEB 1ZMZA 1QASA 1DVIA 1NWDA 1CTRA 3SG7A 1YX7A 1RROA 2WC5A 1XK4A 2WCKA 5DKNA 3Q8IA 2OPOA 4I5KA 4L9MA 1OSAA 2LP2A 1E8AA 1CLBA 1DJIA 1B8CA 2EGDA 3CR2A 1WY9A 2WOSA 5B8IB 4JPZB 5AEQA 1KK7Z 1N0YA 1MF8B 1S36A 2K60A 5HL1A 3TUYB 1RTP1 3GK4X 4MRYA 4PALA 5CSFA 5TNCA 1KSOA 1OZOA 4PHKA 3VROA 5AERA 3VB1A 1FF1A 4PHNA 1F4QA 2ZRSA 3NSOA 1WDCC 4CPVA 4ORCB 2L98A 1XFVO 1FI6A 3SG2A 2ERBA 1K2HA 2F3YA 1JSAA 1AJ4A 1K94A 2KI6D 5I2OA 2MLEC 3I5IB 1YRTB 2PRUA 3CZ2A 5G08A 3EKJA 3BUOB 1SL9A 2LLUA 1ZACA 3DD4A 2BAPA 3PSRA 2WCBA 2ZN8A 2LM5A 1KFUL 3D10A 3D73A 1WRLA 1XK4C 1QV1A 1Y1XA 2K2AA 2JRFA 3ICBA 3R1PA 5ER4X 2LANA 4C0KA 1CM1A 1NX2A 2I94A 4BY5A 1CFPA 1XFYO 1QX5B 3EVVA 3EK7A 2KPHA 1M63B 1TNQA 1M31A 2MA2A 3L4AA 5BPJA 2BBNA 1F55A 3OGNA 4IJ7A 3BXKA 2SCPA 2CXJA 2QEBA 3S0BA 1QIWA 1QWVA 2PYQA 2KNEA 2AMIA 3EKHA 2JTTA 2QEOA 1NX3A 2M7NA 2P71A 1OMRA 1C07A 2IS9A 3EG5B 1AVSA 5KSZA 3BFAA 2GGZA 3TDUA 2H8VA 4DCKA 2KYFA 1M46A 3D76A 1OE9B 1SYMA 3NXAA 1RK9A 4PE7A 1W7JB 1K95A 1QLKA 1GQMA 2LLTA 1XVJA 3EVRA 2LMVA 3NHIA 3CABA 2WC8A 1JF2A 1QTXA 1M45A 4M2QA 4OCIA 1OQPA 4ETOA 3DVEA 2LHIA 1S6IA 2K61A 2Y1NA 3RM1A 1A75A 4OVNF 4U8DA 1S3PA 5HKYA 1IWQA 1H8BA 4WQ3A 1J55A 1SKTA 2BE4A 4QJ3B 2KAXA 2K7BA 1CDNA 1A03A 2I7AA 3OB2B 3PJIA 4Q04A 1ODBA 3SS3A 1LA0A 4F0ZB 5I2QA 1IQ3A 1CDMA 4UPGA 2K2FA 1DF0A 2NXQA 5ER5A 1NPQA 1TIZA 2LVVA 2BL0B 2WORA 1Z4HA 2JC2A 2LP3A 2WCLA 2ISDA 1G8IA 2OS8C 4XJKA 1Y6WA 1DGUA 5AFPA 1NCZA 3LCPC 1W9ZA 2ZNDA 3OB1B 1X02A 5DKRA 2BECA 2LMTA 3VRQA 1B1GA 1IG5A 4ICBA 1OOHA 3BJHA 1KSMA 3DVJA 2KFFA 5HLVA 2PMYA 5JOLA 1F4OA 1FW4A 1K9PA 1WDCB 1MUXA 4DS7A 1MHOA 3OX5A 4I5JA 2Y5IA 1GGWA 2G2BA 1LKJA 3BYAA 3SJSA 1AJ5A 2M7LA 1NX1A 2LC5A 5D69A 3S0EA 2QEVA 2LAPA 1W7IB 2LE9B 2JTZA 3I5FB 3I5HB 3GK1A 2M49B 4DUQA 2QDIA 2HQWA 4NDBA 1NCXA 3S0DA 1SRAA 2BE6A 2OTGB 1S5GZ 3SG5A 1DJWA 1EXRA 1KFUS 1PRWA 2NLNA 4TNCA 4IL1A 2CBLA 2KFGA 4AQIA 1QXPA 3R1VA 2LMUA 1YUSA 1BU3A 3I5GB 4P2YB 3QRXA 1KK8B 1ZUZA 1TN4A 3D78A 1S6CA 3C1VA 4ZCVA 4MZLA 5F6TA 2JPTA 3SS5A 3DVMA 5CSNA 5D7FA 1M39A 1Q80A 3HX4A 5I2LA 1OOGA 1PSBA 4PCWA 4QJ5B 2O60A 4NDDA 2P6BB 1JFJA 4MVFA 1KFXS 1SK6D 2M3WA 2YGUA 4DIRA 1BJFA 2KGBC 2Q4UA 2ZRTA 4FQTA 1F54A 1DEKA 2H61A 1IJ5A 1KFXL 3B7AA 5J3XA 2KLEA 3HCMA 2F33A 1GGZA 4GNKB 2M29A 4N5XA 2DOQA 3F45A 1QIVA 4QJ4B 2M1UA 2MBXA 4YGAA 4I5NB 4CIDA 1SR6B 3K1EA 4MLWA 1BF5A 1PALA 4AOMA 1N2DA 3KHEA 2COLB 2BKHB 2PASA 3JTDC 3NGVA 3I5HC 3BUXB 1YRUB 1BR1B 1UHKA 4GAOA 3BUWB 3VGOA 2AUCA 3GK2A 1UWOA 1TWOA 5HKWA 2BNXA 1MQ1A 3DY9A 4FQOA 1C7VA 4JWQA 4MZJA 2NCPA 2RGIA 1EG4A 1MWNA 1A29A 1KQMB 1U5IA 4MEWA 3TS5C 3PN7B 3NSKA 3PLFB 1PVBA 1B7TY 1XFWO 1C7WA 3CZ0A 3O6BA 1V1GA 1YUTA 4P5OE 4XYNA 2R2IA 4E68A 1IQ5A 3IF7A 2KBMA 2M1KB 2MJWB 2ZN9A 1BT6A 1IRJA 1QVIZ 3CZ1A 1AHRA 1T14A 1XA5A 1CDLA 3CS1A 2NZ0A 3OX6A 3VRRA 2K7DA 3CGAA 1KQVA 1N65A 2MRDA 3S0GA 1WLMA 2FCDA 1QS7A 2M8UA 1CNPA 3CZTX 3ZNIA 3I5IC 3D77A 3DZTA 1L7ZA 1WRKA 4N1GA 1TNXA 2KI4B 2BBMA 2PQLA 3EVUA 3E3RA 1EH2A 3M0WA 1IIOA 4ZCUA 2NCOA 1PK0D 1B7TZ 1PVAA 1R6PA 1UUSA 1SPYA 4GGFC 3B88A 1IH0A 1BOCA 2JT8A 1B9AA 1XFRA 4PE0A 1IJ6A 5K89A 2PVBA 3EK4A 2L5XB 3TS5B 2ZKMX 3VRNA 2V53A 1SNLA 3FWBA 3JVTC 1MR8A 1XFZO 1J7OA 1V1FA 1A75B 1S5GY 3FS7A 3PFVA 3PM8A 5CPVA 2PALA 1J1EA 1TUJA 3TDZA 1L2OB 3TZ1A 4PHMA 1YUUA 4GUKA 1B8RA 4FTGA 1OZSA 1SY9A 4INXA 1G33A 1GM0A 1DJHA 2OS8B 3KEVA 4YGDB 1ALWA 1RWYA 3FE8A 3K21A 2FOTA 2KOTA 4F7FA 1J7QA 2L51A 1TUZA 1OOJA 1QJTA 2GTEA 2O5GA 1WRZA 1DELA 1OMVA 4R1EA 2F3ZA 1G4YR 3NHTA
chains in the Genus database with same CATH topology
1LA3A 2M0RA 1IGVA 4PE4A 2AAOA 1LVCD 1K93D 3PATA 2LVIA 2B1UA 3CTNA 1NP8A 2WCFA 1CLMA 1S6JA 3PALA 1TCOB 3LK0A 3CLNA 2KI4C 1MXLC 2CTNA 1NCYA 1QATA 1UHJA 2L4HA 2LLSA 1R2UA 2MLFC 1J7PA 4YRUA 1SL7A 1CFDA 1EL4A 1K9KA 2CNPA 2WNDA 2L0PA 3KPXA 4C0LA 2JXLA 1SMGA 3CR5X 2E6WA 1B4CA 5DKQA 3WHTB 1OMDA 2LVJA 2ZFDA 3DVKA 3FWCA 3PN7C 5KU1A 1BR4B 2EC6B 3JVTB 1QVIY 3O4YA 2KGRA 3IQOA 1L2OC 2MHHA 5AXIA 4PE1A 2K7CA 1Y1UA 2Y1MA 3A8RA 4GFTA 2LNKA 3AKBA 4CLNA 2BCXA 1K8UA 1BMOA 1HQVA 1QLSA 5HLOA 4HRGA 1TTXA 1DF0B 1DJYA 5FYXA 4NQGA 1S1EA 1ALVA 1ZFSA 2FJUB 3D0YA 4OR9B 1S26D 2KAYA 3H4SE 4HRHA 1XFUO 1YURA 2CT9A 1UHHA 3BQ3A 1CMGA 1CKKA 1BODA 1LINA 4YGCB 3O78A 1SW8A 2JOJA 4N1FA 2KAVA 1TOPA 2HF5A 1U5IB 4PHJA 1KWOC 2QPTA 3BUMB 1JBAA 3KF9A 4MN0A 2GV5A 2L2EA 4M2OA 1XFXO 1UP5A 4MRXA 1RFJA 5CSJA 3GOFA 1H4BA 2JULA 4WRIA 5GQQC 4GPLB 1KQMC 1QX7A 4WQ2A 2JQ6A 2KQ6A 1HT9A 1YVLA 3DF0B 1DJGA 3I5GC 1SCMB 1XYDA 2EC6C 3CR4X 1RJVA 1VRKA 3KO0A 4C0JA 5CSIA 1NUBA 2LCPA 5KTYA 1CFFA 1J1DA 1K9UA 3IQQA 1LXFC 1XO5A 2K0JA 1YR5A 2WCEA 1CDPA 2F2OA 2I2RE 1SL8A 1SR6C 5I8NA 1CMFA 1NSHA 2KSPA 2H2KA 3NSLA 4YI8A 3FIAA 4M2PA 1AP4A 1AUIB 2K7OA 3LL8B 3OP0A 3RLZA 2LUXA 4A4CA 4DRWA 4AQJA 1Y0VH 2JXCA 3AAKA 4PDZA 5IBWA 3WNXB 2G9BA 1QX2A 1F70A 1K90D 2KQYA 2E30A 1B8LA 4GBAA 3AKAA 2I18A 1CB1A 3JTDB 4YGBB 1KWOB 2H61C 1A4PA 4CFQA 1D1OA 1YVHA 1CM4A 1ZOTB 2JNXA 4NDCA 2BL0C 1F71A 3EK8A 2CCMA 2HQ8A 3O2PA 1SCVA 3OHMB 4OV2A 2Q91A 1DJZA 3D0YB 4ORBB 1JUOA 3A4UB 1PSRA 2D8NA 2QACA 2KYCA 4C0KA 3SG6A 4GGNA 4YI9A 4MZKA 3SIBA 2F2PA 3I5FC 4CFRA 1NIWA 4I5LB 1TNPA 2KFHA 4BY4A 2VRGA 1F8HA 2LUCA 1KK7Y 1JF0A 1UHNA 2M9GA 2JU0A 1YX8A 2JZIA 1JWDA 2JNFA 3ZWHA 1TNWA 4ORAB 4YGEB 1JC2A 2KDHA 2LV7A 1RECA 1TCFA 2A4JA 2FCEA 2KI6C 1BG1A 3VRPA 4XJKB 1KK8C 2JT3A 5HYDA 1EJ3A 2HETA 4MBEA 4MSPA 1DTLA 4JQ0D 4OKHA 1UHIA 2OTGC 4USLA 1GJYA 1UURA 1FBVA 2Y4QA 1YTZC 2TN4A 2K8MB 1DMOA 1FPWA 3NSIA 4D1EA 2F8PA 1PULA 1NX0A 5PALA 2SASA 3AAJA 5JJGA 3BOWA 1CLLA 1FI5A 1SCMC 3TDIA 3TUYC 3BOWB 2HPSA 2KHNA 2L50A 4GGFA 3SG4A 2KBIA 4A4BA 1DGVA 2JWWA 1DJXA 1SBJA 1JFKA 1MXEA 1BLQA 2BCAA 1QV0A 1Y1AA 1WLZA 3DF0A 1J7RA 3WHUB 1B47A 3SIAA 3LK1A 2BKIB 1DT7B 4HSZA 2M97A 2MAZA 1IKUA 2LVKA 3WXAA 1NYAA 1EG3A 5HKZA 2EHBA 2PSRA 2BCBA 1KCYA 2JT0A 3LLEA 4HREE 1CFCA 1TRFA 1K96A 1A2XA 2L4IA 5AANA 2LHLA 3BUNB 3CWGA 4YBHB 3SG3A 2GGMA 2ZNEA 3MSEB 1ZMZA 1QASA 1DVIA 1NWDA 1CTRA 3SG7A 1YX7A 1RROA 5DKNA 1XK4A 4I5KA 2OPOA 4L9MA 1OSAA 2LP2A 1E8AA 1CLBA 1DJIA 1B8CA 2EGDA 3CR2A 1WY9A 2WOSA 5B8IB 4JPZB 5AEQA 1KK7Z 1N0YA 1MF8B 1S36A 3TUYB 1RTP1 3GK4X 4MRYA 4PALA 5CSFA 5TNCA 1KSOA 1OZOA 4PHKA 3VROA 5AERA 1FF1A 4PHNA 1F4QA 2ZRSA 3NSOA 1WDCC 4CPVA 4ORCB 2L98A 1XFVO 1FI6A 3SG2A 1K2HA 2F3YA 1JSAA 1AJ4A 1K94A 2KI6D 5I2OA 2MLEC 3I5IB 1YRTB 2PRUA 5G08A 3EKJA 3BUOB 1SL9A 2LLUA 1ZACA 3DD4A 3PSRA 2WCBA 2ZN8A 2LM5A 1KFUL 3D10A 1AK8A 1WRLA 1XK4C 1QV1A 1Y1XA 2K2AA 2JRFA 3ICBA 5ER4X 2LANA 1CM1A 1NX2A 2I94A 4BY5A 1CFPA 1XFYO 1QX5B 3EVVA 3EK7A 1F55A 1M63B 1TNQA 1M31A 2MA2A 5BPJA 2BBNA 3BXKA 2SCPA 2CXJA 1QIWA 2KNEA 2AMIA 3EKHA 2JTTA 1NX3A 2M7NA 1OMRA 1C07A 2IS9A 1AVSA 5KSZA 2GGZA 3TDUA 4DCKA 2KYFA 1M46A 1OE9B 1SYMA 3NXAA 1RK9A 4PE7A 1W7JB 1K95A 1QLKA 1GQMA 2LLTA 1XVJA 3EVRA 2LMVA 2WC8A 1JF2A 1QTXA 1M45A 4M2QA 4OCIA 1OQPA 4ETOA 3DVEA 2LHIA 1S6IA 2K61A 2Y1NA 3RM1A 1A75A 4OVNF 4U8DA 1S3PA 5HKYA 1IWQA 1H8BA 4WQ3A 1J55A 1SKTA 2BE4A 4QJ3B 2KAXA 2K7BA 1CDNA 1A03A 2I7AA 3OB2B 4Q04A 4F0ZB 1ODBA 5I2QA 1LA0A 1IQ3A 1CDMA 4UPGA 2K2FA 1DF0A 2NXQA 5ER5A 1NPQA 1TIZA 2LVVA 2BL0B 2WORA 2JC2A 2LP3A 2ISDA 1G8IA 2OS8C 4XJKA 1Y6WA 1DGUA 5AFPA 1NCZA 3LCPC 2ZNDA 3OB1B 1X02A 5DKRA 2BECA 2LMTA 3VRQA 1B1GA 1IG5A 4ICBA 1KSMA 3DVJA 2KFFA 5HLVA 2PMYA 5JOLA 1F4OA 1FW4A 1K9PA 1WDCB 1MUXA 4DS7A 1MHOA 3OX5A 4I5JA 2Y5IA 1GGWA 2G2BA 1LKJA 3BYAA 3SJSA 1AJ5A 2M7LA 1NX1A 2LC5A 5D69A 2LAPA 1W7IB 2LE9B 2JTZA 3I5FB 3I5HB 3GK1A 2M49B 4DUQA 2HQWA 4NDBA 1NCXA 1SRAA 2BE6A 2OTGB 1S5GZ 3SG5A 1DJWA 1EXRA 1KFUS 1PRWA 2NLNA 4TNCA 4IL1A 2CBLA 2KFGA 4AQIA 1QXPA 2LMUA 1YUSA 1BU3A 3I5GB 4P2YB 3QRXA 1KK8B 1ZUZA 1TN4A 1S6CA 3C1VA 4ZCVA 4MZLA 5F6TA 2JPTA 3DVMA 5CSNA 5D7FA 1M39A 1Q80A 3HX4A 5I2LA 1PSBA 4PCWA 4QJ5B 2O60A 4NDDA 2P6BB 1JFJA 4MVFA 1KFXS 1SK6D 2M3WA 4DIRA 1BJFA 2KGBC 2Q4UA 2ZRTA 1F54A 2H61A 1IJ5A 1KFXL 5J3XA 3HCMA 2F33A 1GGZA 4GNKB 2M29A 4N5XA 2DOQA 3F45A 1QIVA 4QJ4B 2M1UA 2MBXA 4YGAA 4I5NB 4CIDA 1SR6B 4MLWA 1BF5A 1PALA 4AOMA 1N2DA 3KHEA 2COLB 2BKHB 2PASA 3JTDC 3I5HC 3BUXB 1YRUB 1BR1B 1UHKA 4GAOA 3BUWB 3VGOA 2AUCA 3GK2A 1UWOA 5HKWA 1MQ1A 4FQOA 1C7VA 4JWQA 4MZJA 2NCPA 2RGIA 1EG4A 1MWNA 1A29A 1KQMB 1U5IA 4MEWA 3TS5C 3PN7B 3NSKA 3PLFB 1PVBA 1B7TY 1XFWO 1C7WA 3O6BA 4P5OE 1V1GA 1YUTA 4XYNA 4E68A 2R2IA 1IQ5A 3IF7A 2KBMA 2M1KB 2MJWB 2ZN9A 1BT6A 1IRJA 1QVIZ 1AHRA 1XA5A 1CDLA 3CS1A 2NZ0A 3OX6A 3VRRA 2K7DA 3CGAA 1KQVA 1N65A 2MRDA 1WLMA 2FCDA 1QS7A 2M8UA 1CNPA 3CZTX 3ZNIA 3I5IC 1L7ZA 1WRKA 4N1GA 1TNXA 2KI4B 2BBMA 3EVUA 3E3RA 1EH2A 3M0WA 4ZCUA 2NCOA 1PK0D 1B7TZ 1PVAA 1R6PA 1UUSA 1SPYA 4GGFC 1IH0A 1BOCA 2JT8A 1B9AA 4PE0A 1IJ6A 5K89A 2PVBA 3EK4A 2L5XB 3TS5B 2ZKMX 3VRNA 2V53A 1SNLA 3FWBA 3JVTC 1MR8A 1XFZO 1J7OA 1V1FA 1A75B 1S5GY 3FS7A 3PFVA 3PM8A 5CPVA 2PALA 1J1EA 3TDZA 3TZ1A 1L2OB 4PHMA 1YUUA 4GUKA 1B8RA 4FTGA 1OZSA 1SY9A 1G33A 1DJHA 2OS8B 3KEVA 4YGDB 1ALWA 1RWYA 3K21A 2FOTA 2KOTA 1J7QA 2L51A 1OOJA 1QJTA 2O5GA 1WRZA 1OMVA 4R1EA 2F3ZA 1G4YR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LA3 A;  2M0R A;  1IGV A;  4PE4 A;  2AAO A;  1LVC D;  1K93 D;  3PAT A;  2LVI A;  2B1U A;  3CTN A;  1NP8 A;  2WCF A;  1CLM A;  1S6J A;  3PAL A;  1TCO B;  3LK0 A;  3CLN A;  2KI4 C;  1MXL C;  2CTN A;  1NCY A;  1QAT A;  1UHJ A;  2L4H A;  2LLS A;  1R2U A;  2MLF C;  1J7P A;  4YRU A;  1SL7 A;  1CFD A;  1EL4 A;  1K9K A;  2CNP A;  2WND A;  2L0P A;  3KPX A;  4C0L A;  2JXL A;  1SMG A;  3CR5 X;  2E6W A;  1B4C A;  5DKQ A;  3WHT B;  1OMD A;  2LVJ A;  2ZFD A;  3DVK A;  3FWC A;  3PN7 C;  5KU1 A;  1BR4 B;  2EC6 B;  3JVT B;  1QVI Y;  3O4Y A;  2KGR A;  3IQO A;  1L2O C;  2MHH A;  5AXI A;  4PE1 A;  2K7C A;  1Y1U A;  2Y1M A;  3A8R A;  4GFT A;  2LNK A;  3AKB A;  4CLN A;  2BCX A;  1K8U A;  1BMO A;  1HQV A;  1QLS A;  5HLO A;  4HRG A;  1TTX A;  1DF0 B;  1DJY A;  5FYX A;  4NQG A;  1S1E A;  1ALV A;  1ZFS A;  2FJU B;  3D0Y A;  4OR9 B;  1S26 D;  2KAY A;  3H4S E;  4HRH A;  1XFU O;  1YUR A;  2CT9 A;  1UHH A;  3BQ3 A;  1CMG A;  1CKK A;  1BOD A;  1LIN A;  4YGC B;  3O78 A;  1SW8 A;  2JOJ A;  4N1F A;  2KAV A;  1TOP A;  2HF5 A;  1U5I B;  4PHJ A;  1KWO C;  2QPT A;  3BUM B;  1JBA A;  3KF9 A;  4MN0 A;  2GV5 A;  2L2E A;  4M2O A;  1XFX O;  1UP5 A;  4MRX A;  1RFJ A;  5CSJ A;  3GOF A;  1H4B A;  2JUL A;  4WRI A;  5GQQ C;  4GPL B;  1KQM C;  1QX7 A;  4WQ2 A;  2JQ6 A;  2KQ6 A;  1HT9 A;  1YVL A;  3DF0 B;  1DJG A;  3I5G C;  1SCM B;  1XYD A;  2EC6 C;  3CR4 X;  1RJV A;  1VRK A;  3KO0 A;  4C0J A;  5CSI A;  1NUB A;  2LCP A;  5KTY A;  1CFF A;  1J1D A;  1K9U A;  3IQQ A;  1LXF C;  1XO5 A;  2K0J A;  1YR5 A;  2WCE A;  1CDP A;  2F2O A;  2I2R E;  1SL8 A;  1SR6 C;  5I8N A;  1CMF A;  1NSH A;  2KSP A;  2H2K A;  3NSL A;  4YI8 A;  3FIA A;  4M2P A;  1AP4 A;  1AUI B;  2K7O A;  3LL8 B;  3OP0 A;  3RLZ A;  2LUX A;  4A4C A;  4DRW A;  4AQJ A;  1Y0V H;  2JXC A;  3AAK A;  4PDZ A;  5IBW A;  3WNX B;  2G9B A;  1QX2 A;  1F70 A;  1K90 D;  2KQY A;  2E30 A;  1B8L A;  4GBA A;  3AKA A;  2I18 A;  1CB1 A;  3JTD B;  4YGB B;  1KWO B;  2H61 C;  1A4P A;  4CFQ A;  1D1O A;  1YVH A;  1CM4 A;  1ZOT B;  2JNX A;  4NDC A;  2BL0 C;  1F71 A;  3EK8 A;  2CCM A;  2HQ8 A;  3O2P A;  1SCV A;  3OHM B;  4OV2 A;  2Q91 A;  1DJZ A;  3D0Y B;  4ORB B;  1JUO A;  3A4U B;  1PSR A;  2D8N A;  2QAC A;  2KYC A;  4C0K A;  3SG6 A;  4GGN A;  4YI9 A;  4MZK A;  3SIB A;  2F2P A;  3I5F C;  4CFR A;  1NIW A;  4I5L B;  1TNP A;  2KFH A;  4BY4 A;  2VRG A;  1F8H A;  2LUC A;  1KK7 Y;  1JF0 A;  1UHN A;  2M9G A;  2JU0 A;  1YX8 A;  2JZI A;  1JWD A;  2JNF A;  3ZWH A;  1TNW A;  4ORA B;  4YGE B;  1JC2 A;  2KDH A;  2LV7 A;  1REC A;  1TCF A;  2A4J A;  2FCE A;  2KI6 C;  1BG1 A;  3VRP A;  4XJK B;  1KK8 C;  2JT3 A;  5HYD A;  1EJ3 A;  2HET A;  4MBE A;  4MSP A;  1DTL A;  4JQ0 D;  4OKH A;  1UHI A;  2OTG C;  4USL A;  1GJY A;  1UUR A;  1FBV A;  2Y4Q A;  1YTZ C;  2TN4 A;  2K8M B;  1DMO A;  1FPW A;  3NSI A;  4D1E A;  2F8P A;  1PUL A;  1NX0 A;  5PAL A;  2SAS A;  3AAJ A;  5JJG A;  3BOW A;  1CLL A;  1FI5 A;  1SCM C;  3TDI A;  3TUY C;  3BOW B;  2HPS A;  2KHN A;  2L50 A;  4GGF A;  3SG4 A;  2KBI A;  4A4B A;  1DGV A;  2JWW A;  1DJX A;  1SBJ A;  1JFK A;  1MXE A;  1BLQ A;  2BCA A;  1QV0 A;  1Y1A A;  1WLZ A;  3DF0 A;  1J7R A;  3WHU B;  1B47 A;  3SIA A;  3LK1 A;  2BKI B;  1DT7 B;  4HSZ A;  2M97 A;  2MAZ A;  1IKU A;  2LVK A;  3WXA A;  1NYA A;  1EG3 A;  5HKZ A;  2EHB A;  2PSR A;  2BCB A;  1KCY A;  2JT0 A;  3LLE A;  4HRE E;  1CFC A;  1TRF A;  1K96 A;  1A2X A;  2L4I A;  5AAN A;  2LHL A;  3BUN B;  3CWG A;  4YBH B;  3SG3 A;  2GGM A;  2ZNE A;  3MSE B;  1ZMZ A;  1QAS A;  1DVI A;  1NWD A;  1CTR A;  3SG7 A;  1YX7 A;  1RRO A;  5DKN A;  1XK4 A;  4I5K A;  2OPO A;  4L9M A;  1OSA A;  2LP2 A;  1E8A A;  1CLB A;  1DJI A;  1B8C A;  2EGD A;  3CR2 A;  1WY9 A;  2WOS A;  5B8I B;  4JPZ B;  5AEQ A;  1KK7 Z;  1N0Y A;  1MF8 B;  1S36 A;  3TUY B;  1RTP 1;  3GK4 X;  4MRY A;  4PAL A;  5CSF A;  5TNC A;  1KSO A;  1OZO A;  4PHK A;  3VRO A;  5AER A;  1FF1 A;  4PHN A;  1F4Q A;  2ZRS A;  3NSO A;  1WDC C;  4CPV A;  4ORC B;  2L98 A;  1XFV O;  1FI6 A;  3SG2 A;  1K2H A;  2F3Y A;  1JSA A;  1AJ4 A;  1K94 A;  2KI6 D;  5I2O A;  2MLE C;  3I5I B;  1YRT B;  2PRU A;  5G08 A;  3EKJ A;  3BUO B;  1SL9 A;  2LLU A;  1ZAC A;  3DD4 A;  3PSR A;  2WCB A;  2ZN8 A;  2LM5 A;  1KFU L;  3D10 A;  1AK8 A;  1WRL A;  1XK4 C;  1QV1 A;  1Y1X A;  2K2A A;  2JRF A;  3ICB A;  5ER4 X;  2LAN A;  1CM1 A;  1NX2 A;  2I94 A;  4BY5 A;  1CFP A;  1XFY O;  1QX5 B;  3EVV A;  3EK7 A;  1F55 A;  1M63 B;  1TNQ A;  1M31 A;  2MA2 A;  5BPJ A;  2BBN A;  3BXK A;  2SCP A;  2CXJ A;  1QIW A;  2KNE A;  2AMI A;  3EKH A;  2JTT A;  1NX3 A;  2M7N A;  1OMR A;  1C07 A;  2IS9 A;  1AVS A;  5KSZ A;  2GGZ A;  3TDU A;  4DCK A;  2KYF A;  1M46 A;  1OE9 B;  1SYM A;  3NXA A;  1RK9 A;  4PE7 A;  1W7J B;  1K95 A;  1QLK A;  1GQM A;  2LLT A;  1XVJ A;  3EVR A;  2LMV A;  2WC8 A;  1JF2 A;  1QTX A;  1M45 A;  4M2Q A;  4OCI A;  1OQP A;  4ETO A;  3DVE A;  2LHI A;  1S6I A;  2K61 A;  2Y1N A;  3RM1 A;  1A75 A;  4OVN F;  4U8D A;  1S3P A;  5HKY A;  1IWQ A;  1H8B A;  4WQ3 A;  1J55 A;  1SKT A;  2BE4 A;  4QJ3 B;  2KAX A;  2K7B A;  1CDN A;  1A03 A;  2I7A A;  3OB2 B;  4Q04 A;  4F0Z B;  1ODB A;  5I2Q A;  1LA0 A;  1IQ3 A;  1CDM A;  4UPG A;  2K2F A;  1DF0 A;  2NXQ A;  5ER5 A;  1NPQ A;  1TIZ A;  2LVV A;  2BL0 B;  2WOR A;  2JC2 A;  2LP3 A;  2ISD A;  1G8I A;  2OS8 C;  4XJK A;  1Y6W A;  1DGU A;  5AFP A;  1NCZ A;  3LCP C;  2ZND A;  3OB1 B;  1X02 A;  5DKR A;  2BEC A;  2LMT A;  3VRQ A;  1B1G A;  1IG5 A;  4ICB A;  1KSM A;  3DVJ A;  2KFF A;  5HLV A;  2PMY A;  5JOL A;  1F4O A;  1FW4 A;  1K9P A;  1WDC B;  1MUX A;  4DS7 A;  1MHO A;  3OX5 A;  4I5J A;  2Y5I A;  1GGW A;  2G2B A;  1LKJ A;  3BYA A;  3SJS A;  1AJ5 A;  2M7L A;  1NX1 A;  2LC5 A;  5D69 A;  2LAP A;  1W7I B;  2LE9 B;  2JTZ A;  3I5F B;  3I5H B;  3GK1 A;  2M49 B;  4DUQ A;  2HQW A;  4NDB A;  1NCX A;  1SRA A;  2BE6 A;  2OTG B;  1S5G Z;  3SG5 A;  1DJW A;  1EXR A;  1KFU S;  1PRW A;  2NLN A;  4TNC A;  4IL1 A;  2CBL A;  2KFG A;  4AQI A;  1QXP A;  2LMU A;  1YUS A;  1BU3 A;  3I5G B;  4P2Y B;  3QRX A;  1KK8 B;  1ZUZ A;  1TN4 A;  1S6C A;  3C1V A;  4ZCV A;  4MZL A;  5F6T A;  2JPT A;  3DVM A;  5CSN A;  5D7F A;  1M39 A;  1Q80 A;  3HX4 A;  5I2L A;  1PSB A;  4PCW A;  4QJ5 B;  2O60 A;  4NDD A;  2P6B B;  1JFJ A;  4MVF A;  1KFX S;  1SK6 D;  2M3W A;  4DIR A;  1BJF A;  2KGB C;  2Q4U A;  2ZRT A;  1F54 A;  2H61 A;  1IJ5 A;  1KFX L;  5J3X A;  3HCM A;  2F33 A;  1GGZ A;  4GNK B;  2M29 A;  4N5X A;  2DOQ A;  3F45 A;  1QIV A;  4QJ4 B;  2M1U A;  2MBX A;  4YGA A;  4I5N B;  4CID A;  1SR6 B;  4MLW A;  1BF5 A;  1PAL A;  4AOM A;  1N2D A;  3KHE A;  2COL B;  2BKH B;  2PAS A;  3JTD C;  3I5H C;  3BUX B;  1YRU B;  1BR1 B;  1UHK A;  4GAO A;  3BUW B;  3VGO A;  2AUC A;  3GK2 A;  1UWO A;  5HKW A;  1MQ1 A;  4FQO A;  1C7V A;  4JWQ A;  4MZJ A;  2NCP A;  2RGI A;  1EG4 A;  1MWN A;  1A29 A;  1KQM B;  1U5I A;  4MEW A;  3TS5 C;  3PN7 B;  3NSK A;  3PLF B;  1PVB A;  1B7T Y;  1XFW O;  1C7W A;  3O6B A;  4P5O E;  1V1G A;  1YUT A;  4XYN A;  4E68 A;  2R2I A;  1IQ5 A;  3IF7 A;  2KBM A;  2M1K B;  2MJW B;  2ZN9 A;  1BT6 A;  1IRJ A;  1QVI Z;  1AHR A;  1XA5 A;  1CDL A;  3CS1 A;  2NZ0 A;  3OX6 A;  3VRR A;  2K7D A;  3CGA A;  1KQV A;  1N65 A;  2MRD A;  1WLM A;  2FCD A;  1QS7 A;  2M8U A;  1CNP A;  3CZT X;  3ZNI A;  3I5I C;  1L7Z A;  1WRK A;  4N1G A;  1TNX A;  2KI4 B;  2BBM A;  3EVU A;  3E3R A;  1EH2 A;  3M0W A;  4ZCU A;  2NCO A;  1PK0 D;  1B7T Z;  1PVA A;  1R6P A;  1UUS A;  1SPY A;  4GGF C;  1IH0 A;  1BOC A;  2JT8 A;  1B9A A;  4PE0 A;  1IJ6 A;  5K89 A;  2PVB A;  3EK4 A;  2L5X B;  3TS5 B;  2ZKM X;  3VRN A;  2V53 A;  1SNL A;  3FWB A;  3JVT C;  1MR8 A;  1XFZ O;  1J7O A;  1V1F A;  1A75 B;  1S5G Y;  3FS7 A;  3PFV A;  3PM8 A;  5CPV A;  2PAL A;  1J1E A;  3TDZ A;  3TZ1 A;  1L2O B;  4PHM A;  1YUU A;  4GUK A;  1B8R A;  4FTG A;  1OZS A;  1SY9 A;  1G33 A;  1DJH A;  2OS8 B;  3KEV A;  4YGD B;  1ALW A;  1RWY A;  3K21 A;  2FOT A;  2KOT A;  1J7Q A;  2L51 A;  1OOJ A;  1QJT A;  2O5G A;  1WRZ A;  1OMV A;  4R1E A;  2F3Z A;  1G4Y R; 
#chains in the Genus database with same CATH topology
 1LA3 A;  2M0R A;  1IGV A;  4PE4 A;  2AAO A;  3L47 A;  1LVC D;  1K93 D;  3PAT A;  5EL2 A;  2LVI A;  2B1U A;  3RZS A;  3CTN A;  1NP8 A;  1LS8 A;  2WCF A;  1CLM A;  1S6J A;  3PAL A;  1TCO B;  3LK0 A;  3CLN A;  2KI4 C;  1MXL C;  2CTN A;  1NCY A;  3O4X A;  1QAT A;  1UHJ A;  2L4H A;  2LLS A;  1R2U A;  2MLF C;  1J7P A;  3UNW A;  4YRU A;  1SL7 A;  1Z2C B;  1CFD A;  1EL4 A;  1K9K A;  2CNP A;  2WND A;  2L0P A;  3KPX A;  4C0L A;  2JXL A;  1SMG A;  3CR5 X;  3V2L A;  1OOI X;  2E6W A;  1B4C A;  5DKQ A;  3WHT B;  1OMD A;  2LVJ A;  2ZFD A;  3DVK A;  3FWC A;  3PN7 C;  5KU1 A;  1BR4 B;  2EC6 B;  3JVT B;  4JD9 A;  1QVI Y;  3O4Y A;  2KGR A;  5FI7 A;  3IQO A;  1L2O C;  2MHH A;  5AXI A;  4PE1 A;  2K7C A;  1Y1U A;  2Y1M A;  3A8R A;  4GFT A;  2LNK A;  3AKB A;  4CLN A;  2BCX A;  1K8U A;  1BMO A;  1HQV A;  1QLS A;  5HLO A;  4HRG A;  1TTX A;  1DF0 B;  1DJY A;  5FYX A;  4NQG A;  1S1E A;  1ALV A;  1ZFS A;  1C3Z A;  2FJU B;  3D0Y A;  2P70 A;  4OR9 B;  1S26 D;  2KAY A;  3H4S E;  4HRH A;  1XFU O;  1YUR A;  2CT9 A;  1UHH A;  3BQ3 A;  1CMG A;  1CKK A;  1BOD A;  1LIN A;  4YGC B;  3O78 A;  1SW8 A;  2JOJ A;  4N1F A;  4OZD A;  2KAV A;  3BFH A;  1TOP A;  1AK8 A;  3FE9 A;  4JKT A;  5D3O A;  2L5Y A;  2HF5 A;  1U5I B;  5DIC A;  4PHJ A;  1KWO C;  1ORG A;  2QPT A;  3BUM B;  1JBA A;  2L2C A;  3KF9 A;  4MN0 A;  2GV5 A;  5I94 A;  2L2E A;  3IVT A;  4M2O A;  1XFX O;  1UP5 A;  4MRX A;  1RFJ A;  5CSJ A;  3GOF A;  4KYN A;  1H4B A;  2JUL A;  4WRI A;  5GQQ C;  3FE6 A;  4GPL B;  1KQM C;  1QX7 A;  4WQ2 A;  2JQ6 A;  3QME A;  1OOF A;  2KQ6 A;  1DQE A;  1HT9 A;  4PT1 A;  3D74 A;  1YVL A;  3DF0 B;  1DJG A;  3I5G C;  1SCM B;  1XYD A;  2EC6 C;  3CR4 X;  3L4L A;  1RJV A;  1VRK A;  3KO0 A;  4C0J A;  5CSI A;  1NUB A;  2LCP A;  5KTY A;  1CFF A;  1J1D A;  1K9U A;  3IQQ A;  1LXF C;  1XO5 A;  2K0J A;  1YR5 A;  2WCE A;  1CDP A;  2F2O A;  2I2R E;  1SL8 A;  1P28 A;  1SR6 C;  5I8N A;  1NSH A;  1CMF A;  2KSP A;  2H2K A;  3NSL A;  1OW4 A;  4YI8 A;  3FIA A;  4M2P A;  1AP4 A;  1AUI B;  2K7O A;  3LL8 B;  3OP0 A;  3RLZ A;  2LUX A;  4A4C A;  4DRW A;  4AQJ A;  1Y0V H;  2JXC A;  3DXL A;  3AAK A;  4PDZ A;  5IBW A;  3WNX B;  1QX2 A;  2G9B A;  2WCJ A;  1F70 A;  1K90 D;  2KQY A;  2E30 A;  3B87 A;  3UO9 A;  1B8L A;  4GBA A;  3AKA A;  2I18 A;  1CB1 A;  3JTD B;  4YGB B;  1KWO B;  2H61 C;  1A4P A;  4CFQ A;  3BFB A;  3PM2 A;  1D1O A;  1YVH A;  1CM4 A;  1ZOT B;  2JNX A;  4NDC A;  2BL0 C;  5FI2 A;  1F71 A;  3EK8 A;  2CCM A;  2HQ8 A;  3O2P A;  1SCV A;  3OHM B;  3R72 A;  4OV2 A;  2Q91 A;  3CYZ A;  1DJZ A;  3D0Y B;  4ORB B;  2WC6 A;  1JUO A;  2JPO A;  1PSR A;  2D8N A;  2QAC A;  2KYC A;  3A4U B;  3SG6 A;  4GGN A;  4YI9 A;  4MZK A;  3SIB A;  2F2P A;  3I5F C;  4CFR A;  1NIW A;  4I5L B;  1TNP A;  2KFH A;  4BY4 A;  2VRG A;  3OBV A;  2LUC A;  1F8H A;  1KK7 Y;  2WCH A;  1DC1 A;  1JF0 A;  1UHN A;  2M9G A;  3R1O A;  2JU0 A;  1YX8 A;  2JZI A;  1JWD A;  2JNF A;  3ZWH A;  1TNW A;  4ORA B;  4INW A;  4YGE B;  1JC2 A;  2KDH A;  2LV7 A;  1REC A;  1TCF A;  2A4J A;  2FCE A;  2KI6 C;  1BG1 A;  3VRP A;  2WCM A;  4XJK B;  1KK8 C;  2JT3 A;  5HYD A;  3S0F A;  1EJ3 A;  2HET A;  3B86 A;  4MBE A;  4MSP A;  1DTL A;  4JQ0 D;  4OKH A;  1UHI A;  2OTG C;  4USL A;  5FI6 A;  1GJY A;  1UUR A;  1FBV A;  2Y4Q A;  1YTZ C;  2TN4 A;  2K8M B;  3S0A A;  3D75 A;  1DMO A;  1FPW A;  3NSI A;  4D1E A;  2F8P A;  1PUL A;  1NX0 A;  5PAL A;  2SAS A;  3AAJ A;  5JJG A;  3BOW A;  1CLL A;  1FI5 A;  1SCM C;  1SSE B;  2KLD A;  3TDI A;  3BOW B;  3TUY C;  2QEH A;  2HPS A;  2KHN A;  2L50 A;  4GGF A;  3SG4 A;  2KBI A;  4A4B A;  1DGV A;  2JWW A;  1DJX A;  1SBJ A;  1JFK A;  1MXE A;  1BLQ A;  2BCA A;  1QV0 A;  1Y1A A;  1WLZ A;  3DF0 A;  1J7R A;  3WHU B;  1B47 A;  3SIA A;  3CDN A;  3LK1 A;  2BKI B;  3N7H A;  4HSZ A;  2M97 A;  1DT7 B;  2MAZ A;  1IKU A;  2LVK A;  3WXA A;  2FJY A;  1NYA A;  1EG3 A;  3DYE A;  5HKZ A;  2EHB A;  2PSR A;  2BCB A;  3SS4 A;  1KCY A;  2JT0 A;  3LLE A;  4HRE E;  1CFC A;  1TRF A;  1K96 A;  1A2X A;  3B6X A;  2L4I A;  5AAN A;  2LHL A;  3BUN B;  3CWG A;  4YBH B;  3SG3 A;  2GGM A;  1C3Y A;  2ZNE A;  3MSE B;  1ZMZ A;  1QAS A;  1DVI A;  1NWD A;  1CTR A;  3SG7 A;  1YX7 A;  1RRO A;  2WC5 A;  1XK4 A;  2WCK A;  5DKN A;  3Q8I A;  2OPO A;  4I5K A;  4L9M A;  1OSA A;  2LP2 A;  1E8A A;  1CLB A;  1DJI A;  1B8C A;  2EGD A;  3CR2 A;  1WY9 A;  2WOS A;  5B8I B;  4JPZ B;  5AEQ A;  1KK7 Z;  1N0Y A;  1MF8 B;  1S36 A;  2K60 A;  5HL1 A;  3TUY B;  1RTP 1;  3GK4 X;  4MRY A;  4PAL A;  5CSF A;  5TNC A;  1KSO A;  1OZO A;  4PHK A;  3VRO A;  5AER A;  3VB1 A;  1FF1 A;  4PHN A;  1F4Q A;  2ZRS A;  3NSO A;  1WDC C;  4CPV A;  4ORC B;  2L98 A;  1XFV O;  1FI6 A;  3SG2 A;  2ERB A;  1K2H A;  2F3Y A;  1JSA A;  1AJ4 A;  1K94 A;  2KI6 D;  5I2O A;  2MLE C;  3I5I B;  1YRT B;  2PRU A;  3CZ2 A;  5G08 A;  3EKJ A;  3BUO B;  1SL9 A;  2LLU A;  1ZAC A;  3DD4 A;  2BAP A;  3PSR A;  2WCB A;  2ZN8 A;  2LM5 A;  1KFU L;  3D10 A;  3D73 A;  1WRL A;  1XK4 C;  1QV1 A;  1Y1X A;  2K2A A;  2JRF A;  3ICB A;  3R1P A;  5ER4 X;  2LAN A;  4C0K A;  1CM1 A;  1NX2 A;  2I94 A;  4BY5 A;  1CFP A;  1XFY O;  1QX5 B;  3EVV A;  3EK7 A;  2KPH A;  1M63 B;  1TNQ A;  1M31 A;  2MA2 A;  3L4A A;  5BPJ A;  2BBN A;  1F55 A;  3OGN A;  4IJ7 A;  3BXK A;  2SCP A;  2CXJ A;  2QEB A;  3S0B A;  1QIW A;  1QWV A;  2PYQ A;  2KNE A;  2AMI A;  3EKH A;  2JTT A;  2QEO A;  1NX3 A;  2M7N A;  2P71 A;  1OMR A;  1C07 A;  2IS9 A;  3EG5 B;  1AVS A;  5KSZ A;  3BFA A;  2GGZ A;  3TDU A;  2H8V A;  4DCK A;  2KYF A;  1M46 A;  3D76 A;  1OE9 B;  1SYM A;  3NXA A;  1RK9 A;  4PE7 A;  1W7J B;  1K95 A;  1QLK A;  1GQM A;  2LLT A;  1XVJ A;  3EVR A;  2LMV A;  3NHI A;  3CAB A;  2WC8 A;  1JF2 A;  1QTX A;  1M45 A;  4M2Q A;  4OCI A;  1OQP A;  4ETO A;  3DVE A;  2LHI A;  1S6I A;  2K61 A;  2Y1N A;  3RM1 A;  1A75 A;  4OVN F;  4U8D A;  1S3P A;  5HKY A;  1IWQ A;  1H8B A;  4WQ3 A;  1J55 A;  1SKT A;  2BE4 A;  4QJ3 B;  2KAX A;  2K7B A;  1CDN A;  1A03 A;  2I7A A;  3OB2 B;  3PJI A;  4Q04 A;  1ODB A;  3SS3 A;  1LA0 A;  4F0Z B;  5I2Q A;  1IQ3 A;  1CDM A;  4UPG A;  2K2F A;  1DF0 A;  2NXQ A;  5ER5 A;  1NPQ A;  1TIZ A;  2LVV A;  2BL0 B;  2WOR A;  1Z4H A;  2JC2 A;  2LP3 A;  2WCL A;  2ISD A;  1G8I A;  2OS8 C;  4XJK A;  1Y6W A;  1DGU A;  5AFP A;  1NCZ A;  3LCP C;  1W9Z A;  2ZND A;  3OB1 B;  1X02 A;  5DKR A;  2BEC A;  2LMT A;  3VRQ A;  1B1G A;  1IG5 A;  4ICB A;  1OOH A;  3BJH A;  1KSM A;  3DVJ A;  2KFF A;  5HLV A;  2PMY A;  5JOL A;  1F4O A;  1FW4 A;  1K9P A;  1WDC B;  1MUX A;  4DS7 A;  1MHO A;  3OX5 A;  4I5J A;  2Y5I A;  1GGW A;  2G2B A;  1LKJ A;  3BYA A;  3SJS A;  1AJ5 A;  2M7L A;  1NX1 A;  2LC5 A;  5D69 A;  3S0E A;  2QEV A;  2LAP A;  1W7I B;  2LE9 B;  2JTZ A;  3I5F B;  3I5H B;  3GK1 A;  2M49 B;  4DUQ A;  2QDI A;  2HQW A;  4NDB A;  1NCX A;  3S0D A;  1SRA A;  2BE6 A;  2OTG B;  1S5G Z;  3SG5 A;  1DJW A;  1EXR A;  1KFU S;  1PRW A;  2NLN A;  4TNC A;  4IL1 A;  2CBL A;  2KFG A;  4AQI A;  1QXP A;  3R1V A;  2LMU A;  1YUS A;  1BU3 A;  3I5G B;  4P2Y B;  3QRX A;  1KK8 B;  1ZUZ A;  1TN4 A;  3D78 A;  1S6C A;  3C1V A;  4ZCV A;  4MZL A;  5F6T A;  2JPT A;  3SS5 A;  3DVM A;  5CSN A;  5D7F A;  1M39 A;  1Q80 A;  3HX4 A;  5I2L A;  1OOG A;  1PSB A;  4PCW A;  4QJ5 B;  2O60 A;  4NDD A;  2P6B B;  1JFJ A;  4MVF A;  1KFX S;  1SK6 D;  2M3W A;  2YGU A;  4DIR A;  1BJF A;  2KGB C;  2Q4U A;  2ZRT A;  4FQT A;  1F54 A;  1DEK A;  2H61 A;  1IJ5 A;  1KFX L;  3B7A A;  5J3X A;  2KLE A;  3HCM A;  2F33 A;  1GGZ A;  4GNK B;  2M29 A;  4N5X A;  2DOQ A;  3F45 A;  1QIV A;  4QJ4 B;  2M1U A;  2MBX A;  4YGA A;  4I5N B;  4CID A;  1SR6 B;  3K1E A;  4MLW A;  1BF5 A;  1PAL A;  4AOM A;  1N2D A;  3KHE A;  2COL B;  2BKH B;  2PAS A;  3JTD C;  3NGV A;  3I5H C;  3BUX B;  1YRU B;  1BR1 B;  1UHK A;  4GAO A;  3BUW B;  3VGO A;  2AUC A;  3GK2 A;  1UWO A;  1TWO A;  5HKW A;  2BNX A;  1MQ1 A;  3DY9 A;  4FQO A;  1C7V A;  4JWQ A;  4MZJ A;  2NCP A;  2RGI A;  1EG4 A;  1MWN A;  1A29 A;  1KQM B;  1U5I A;  4MEW A;  3TS5 C;  3PN7 B;  3NSK A;  3PLF B;  1PVB A;  1B7T Y;  1XFW O;  1C7W A;  3CZ0 A;  3O6B A;  1V1G A;  1YUT A;  4P5O E;  4XYN A;  2R2I A;  4E68 A;  1IQ5 A;  3IF7 A;  2KBM A;  2M1K B;  2MJW B;  2ZN9 A;  1BT6 A;  1IRJ A;  1QVI Z;  3CZ1 A;  1AHR A;  1T14 A;  1XA5 A;  1CDL A;  3CS1 A;  2NZ0 A;  3OX6 A;  3VRR A;  2K7D A;  3CGA A;  1KQV A;  1N65 A;  2MRD A;  3S0G A;  1WLM A;  2FCD A;  1QS7 A;  2M8U A;  1CNP A;  3CZT X;  3ZNI A;  3I5I C;  3D77 A;  3DZT A;  1L7Z A;  1WRK A;  4N1G A;  1TNX A;  2KI4 B;  2BBM A;  2PQL A;  3EVU A;  3E3R A;  1EH2 A;  3M0W A;  1IIO A;  4ZCU A;  2NCO A;  1PK0 D;  1B7T Z;  1PVA A;  1R6P A;  1UUS A;  1SPY A;  4GGF C;  3B88 A;  1IH0 A;  1BOC A;  2JT8 A;  1B9A A;  1XFR A;  4PE0 A;  1IJ6 A;  5K89 A;  2PVB A;  3EK4 A;  2L5X B;  3TS5 B;  2ZKM X;  3VRN A;  2V53 A;  1SNL A;  3FWB A;  3JVT C;  1MR8 A;  1XFZ O;  1J7O A;  1V1F A;  1A75 B;  1S5G Y;  3FS7 A;  3PFV A;  3PM8 A;  5CPV A;  2PAL A;  1J1E A;  1TUJ A;  3TDZ A;  1L2O B;  3TZ1 A;  4PHM A;  1YUU A;  4GUK A;  1B8R A;  4FTG A;  1OZS A;  1SY9 A;  4INX A;  1G33 A;  1GM0 A;  1DJH A;  2OS8 B;  3KEV A;  4YGD B;  1ALW A;  1RWY A;  3FE8 A;  3K21 A;  2FOT A;  2KOT A;  4F7F A;  1J7Q A;  2L51 A;  1TUZ A;  1OOJ A;  1QJT A;  2GTE A;  2O5G A;  1WRZ A;  1DEL A;  1OMV A;  4R1E A;  2F3Z A;  1G4Y R;  3NHT A; 
#chains in the Genus database with same CATH homology
 1LA3 A;  2M0R A;  1IGV A;  4PE4 A;  2AAO A;  1LVC D;  1K93 D;  3PAT A;  2LVI A;  2B1U A;  3CTN A;  1NP8 A;  2WCF A;  1CLM A;  1S6J A;  3PAL A;  1TCO B;  3LK0 A;  3CLN A;  2KI4 C;  1MXL C;  2CTN A;  1NCY A;  1QAT A;  1UHJ A;  2L4H A;  2LLS A;  1R2U A;  2MLF C;  1J7P A;  4YRU A;  1SL7 A;  1CFD A;  1EL4 A;  1K9K A;  2CNP A;  2WND A;  2L0P A;  3KPX A;  4C0L A;  2JXL A;  1SMG A;  3CR5 X;  2E6W A;  1B4C A;  5DKQ A;  3WHT B;  1OMD A;  2LVJ A;  2ZFD A;  3DVK A;  3FWC A;  3PN7 C;  5KU1 A;  1BR4 B;  2EC6 B;  3JVT B;  1QVI Y;  3O4Y A;  2KGR A;  3IQO A;  1L2O C;  2MHH A;  5AXI A;  4PE1 A;  2K7C A;  1Y1U A;  2Y1M A;  3A8R A;  4GFT A;  2LNK A;  3AKB A;  4CLN A;  2BCX A;  1K8U A;  1BMO A;  1HQV A;  1QLS A;  5HLO A;  4HRG A;  1TTX A;  1DF0 B;  1DJY A;  5FYX A;  4NQG A;  1S1E A;  1ALV A;  1ZFS A;  2FJU B;  3D0Y A;  4OR9 B;  1S26 D;  2KAY A;  3H4S E;  4HRH A;  1XFU O;  1YUR A;  2CT9 A;  1UHH A;  3BQ3 A;  1CMG A;  1CKK A;  1BOD A;  1LIN A;  4YGC B;  3O78 A;  1SW8 A;  2JOJ A;  4N1F A;  2KAV A;  1TOP A;  2HF5 A;  1U5I B;  4PHJ A;  1KWO C;  2QPT A;  3BUM B;  1JBA A;  3KF9 A;  4MN0 A;  2GV5 A;  2L2E A;  4M2O A;  1XFX O;  1UP5 A;  4MRX A;  1RFJ A;  5CSJ A;  3GOF A;  1H4B A;  2JUL A;  4WRI A;  5GQQ C;  4GPL B;  1KQM C;  1QX7 A;  4WQ2 A;  2JQ6 A;  2KQ6 A;  1HT9 A;  1YVL A;  3DF0 B;  1DJG A;  3I5G C;  1SCM B;  1XYD A;  2EC6 C;  3CR4 X;  1RJV A;  1VRK A;  3KO0 A;  4C0J A;  5CSI A;  1NUB A;  2LCP A;  5KTY A;  1CFF A;  1J1D A;  1K9U A;  3IQQ A;  1LXF C;  1XO5 A;  2K0J A;  1YR5 A;  2WCE A;  1CDP A;  2F2O A;  2I2R E;  1SL8 A;  1SR6 C;  5I8N A;  1CMF A;  1NSH A;  2KSP A;  2H2K A;  3NSL A;  4YI8 A;  3FIA A;  4M2P A;  1AP4 A;  1AUI B;  2K7O A;  3LL8 B;  3OP0 A;  3RLZ A;  2LUX A;  4A4C A;  4DRW A;  4AQJ A;  1Y0V H;  2JXC A;  3AAK A;  4PDZ A;  5IBW A;  3WNX B;  2G9B A;  1QX2 A;  1F70 A;  1K90 D;  2KQY A;  2E30 A;  1B8L A;  4GBA A;  3AKA A;  2I18 A;  1CB1 A;  3JTD B;  4YGB B;  1KWO B;  2H61 C;  1A4P A;  4CFQ A;  1D1O A;  1YVH A;  1CM4 A;  1ZOT B;  2JNX A;  4NDC A;  2BL0 C;  1F71 A;  3EK8 A;  2CCM A;  2HQ8 A;  3O2P A;  1SCV A;  3OHM B;  4OV2 A;  2Q91 A;  1DJZ A;  3D0Y B;  4ORB B;  1JUO A;  3A4U B;  1PSR A;  2D8N A;  2QAC A;  2KYC A;  4C0K A;  3SG6 A;  4GGN A;  4YI9 A;  4MZK A;  3SIB A;  2F2P A;  3I5F C;  4CFR A;  1NIW A;  4I5L B;  1TNP A;  2KFH A;  4BY4 A;  2VRG A;  1F8H A;  2LUC A;  1KK7 Y;  1JF0 A;  1UHN A;  2M9G A;  2JU0 A;  1YX8 A;  2JZI A;  1JWD A;  2JNF A;  3ZWH A;  1TNW A;  4ORA B;  4YGE B;  1JC2 A;  2KDH A;  2LV7 A;  1REC A;  1TCF A;  2A4J A;  2FCE A;  2KI6 C;  1BG1 A;  3VRP A;  4XJK B;  1KK8 C;  2JT3 A;  5HYD A;  1EJ3 A;  2HET A;  4MBE A;  4MSP A;  1DTL A;  4JQ0 D;  4OKH A;  1UHI A;  2OTG C;  4USL A;  1GJY A;  1UUR A;  1FBV A;  2Y4Q A;  1YTZ C;  2TN4 A;  2K8M B;  1DMO A;  1FPW A;  3NSI A;  4D1E A;  2F8P A;  1PUL A;  1NX0 A;  5PAL A;  2SAS A;  3AAJ A;  5JJG A;  3BOW A;  1CLL A;  1FI5 A;  1SCM C;  3TDI A;  3TUY C;  3BOW B;  2HPS A;  2KHN A;  2L50 A;  4GGF A;  3SG4 A;  2KBI A;  4A4B A;  1DGV A;  2JWW A;  1DJX A;  1SBJ A;  1JFK A;  1MXE A;  1BLQ A;  2BCA A;  1QV0 A;  1Y1A A;  1WLZ A;  3DF0 A;  1J7R A;  3WHU B;  1B47 A;  3SIA A;  3LK1 A;  2BKI B;  1DT7 B;  4HSZ A;  2M97 A;  2MAZ A;  1IKU A;  2LVK A;  3WXA A;  1NYA A;  1EG3 A;  5HKZ A;  2EHB A;  2PSR A;  2BCB A;  1KCY A;  2JT0 A;  3LLE A;  4HRE E;  1CFC A;  1TRF A;  1K96 A;  1A2X A;  2L4I A;  5AAN A;  2LHL A;  3BUN B;  3CWG A;  4YBH B;  3SG3 A;  2GGM A;  2ZNE A;  3MSE B;  1ZMZ A;  1QAS A;  1DVI A;  1NWD A;  1CTR A;  3SG7 A;  1YX7 A;  1RRO A;  5DKN A;  1XK4 A;  4I5K A;  2OPO A;  4L9M A;  1OSA A;  2LP2 A;  1E8A A;  1CLB A;  1DJI A;  1B8C A;  2EGD A;  3CR2 A;  1WY9 A;  2WOS A;  5B8I B;  4JPZ B;  5AEQ A;  1KK7 Z;  1N0Y A;  1MF8 B;  1S36 A;  3TUY B;  1RTP 1;  3GK4 X;  4MRY A;  4PAL A;  5CSF A;  5TNC A;  1KSO A;  1OZO A;  4PHK A;  3VRO A;  5AER A;  1FF1 A;  4PHN A;  1F4Q A;  2ZRS A;  3NSO A;  1WDC C;  4CPV A;  4ORC B;  2L98 A;  1XFV O;  1FI6 A;  3SG2 A;  1K2H A;  2F3Y A;  1JSA A;  1AJ4 A;  1K94 A;  2KI6 D;  5I2O A;  2MLE C;  3I5I B;  1YRT B;  2PRU A;  5G08 A;  3EKJ A;  3BUO B;  1SL9 A;  2LLU A;  1ZAC A;  3DD4 A;  3PSR A;  2WCB A;  2ZN8 A;  2LM5 A;  1KFU L;  3D10 A;  1AK8 A;  1WRL A;  1XK4 C;  1QV1 A;  1Y1X A;  2K2A A;  2JRF A;  3ICB A;  5ER4 X;  2LAN A;  1CM1 A;  1NX2 A;  2I94 A;  4BY5 A;  1CFP A;  1XFY O;  1QX5 B;  3EVV A;  3EK7 A;  1F55 A;  1M63 B;  1TNQ A;  1M31 A;  2MA2 A;  5BPJ A;  2BBN A;  3BXK A;  2SCP A;  2CXJ A;  1QIW A;  2KNE A;  2AMI A;  3EKH A;  2JTT A;  1NX3 A;  2M7N A;  1OMR A;  1C07 A;  2IS9 A;  1AVS A;  5KSZ A;  2GGZ A;  3TDU A;  4DCK A;  2KYF A;  1M46 A;  1OE9 B;  1SYM A;  3NXA A;  1RK9 A;  4PE7 A;  1W7J B;  1K95 A;  1QLK A;  1GQM A;  2LLT A;  1XVJ A;  3EVR A;  2LMV A;  2WC8 A;  1JF2 A;  1QTX A;  1M45 A;  4M2Q A;  4OCI A;  1OQP A;  4ETO A;  3DVE A;  2LHI A;  1S6I A;  2K61 A;  2Y1N A;  3RM1 A;  1A75 A;  4OVN F;  4U8D A;  1S3P A;  5HKY A;  1IWQ A;  1H8B A;  4WQ3 A;  1J55 A;  1SKT A;  2BE4 A;  4QJ3 B;  2KAX A;  2K7B A;  1CDN A;  1A03 A;  2I7A A;  3OB2 B;  4Q04 A;  4F0Z B;  1ODB A;  5I2Q A;  1LA0 A;  1IQ3 A;  1CDM A;  4UPG A;  2K2F A;  1DF0 A;  2NXQ A;  5ER5 A;  1NPQ A;  1TIZ A;  2LVV A;  2BL0 B;  2WOR A;  2JC2 A;  2LP3 A;  2ISD A;  1G8I A;  2OS8 C;  4XJK A;  1Y6W A;  1DGU A;  5AFP A;  1NCZ A;  3LCP C;  2ZND A;  3OB1 B;  1X02 A;  5DKR A;  2BEC A;  2LMT A;  3VRQ A;  1B1G A;  1IG5 A;  4ICB A;  1KSM A;  3DVJ A;  2KFF A;  5HLV A;  2PMY A;  5JOL A;  1F4O A;  1FW4 A;  1K9P A;  1WDC B;  1MUX A;  4DS7 A;  1MHO A;  3OX5 A;  4I5J A;  2Y5I A;  1GGW A;  2G2B A;  1LKJ A;  3BYA A;  3SJS A;  1AJ5 A;  2M7L A;  1NX1 A;  2LC5 A;  5D69 A;  2LAP A;  1W7I B;  2LE9 B;  2JTZ A;  3I5F B;  3I5H B;  3GK1 A;  2M49 B;  4DUQ A;  2HQW A;  4NDB A;  1NCX A;  1SRA A;  2BE6 A;  2OTG B;  1S5G Z;  3SG5 A;  1DJW A;  1EXR A;  1KFU S;  1PRW A;  2NLN A;  4TNC A;  4IL1 A;  2CBL A;  2KFG A;  4AQI A;  1QXP A;  2LMU A;  1YUS A;  1BU3 A;  3I5G B;  4P2Y B;  3QRX A;  1KK8 B;  1ZUZ A;  1TN4 A;  1S6C A;  3C1V A;  4ZCV A;  4MZL A;  5F6T A;  2JPT A;  3DVM A;  5CSN A;  5D7F A;  1M39 A;  1Q80 A;  3HX4 A;  5I2L A;  1PSB A;  4PCW A;  4QJ5 B;  2O60 A;  4NDD A;  2P6B B;  1JFJ A;  4MVF A;  1KFX S;  1SK6 D;  2M3W A;  4DIR A;  1BJF A;  2KGB C;  2Q4U A;  2ZRT A;  1F54 A;  2H61 A;  1IJ5 A;  1KFX L;  5J3X A;  3HCM A;  2F33 A;  1GGZ A;  4GNK B;  2M29 A;  4N5X A;  2DOQ A;  3F45 A;  1QIV A;  4QJ4 B;  2M1U A;  2MBX A;  4YGA A;  4I5N B;  4CID A;  1SR6 B;  4MLW A;  1BF5 A;  1PAL A;  4AOM A;  1N2D A;  3KHE A;  2COL B;  2BKH B;  2PAS A;  3JTD C;  3I5H C;  3BUX B;  1YRU B;  1BR1 B;  1UHK A;  4GAO A;  3BUW B;  3VGO A;  2AUC A;  3GK2 A;  1UWO A;  5HKW A;  1MQ1 A;  4FQO A;  1C7V A;  4JWQ A;  4MZJ A;  2NCP A;  2RGI A;  1EG4 A;  1MWN A;  1A29 A;  1KQM B;  1U5I A;  4MEW A;  3TS5 C;  3PN7 B;  3NSK A;  3PLF B;  1PVB A;  1B7T Y;  1XFW O;  1C7W A;  3O6B A;  4P5O E;  1V1G A;  1YUT A;  4XYN A;  4E68 A;  2R2I A;  1IQ5 A;  3IF7 A;  2KBM A;  2M1K B;  2MJW B;  2ZN9 A;  1BT6 A;  1IRJ A;  1QVI Z;  1AHR A;  1XA5 A;  1CDL A;  3CS1 A;  2NZ0 A;  3OX6 A;  3VRR A;  2K7D A;  3CGA A;  1KQV A;  1N65 A;  2MRD A;  1WLM A;  2FCD A;  1QS7 A;  2M8U A;  1CNP A;  3CZT X;  3ZNI A;  3I5I C;  1L7Z A;  1WRK A;  4N1G A;  1TNX A;  2KI4 B;  2BBM A;  3EVU A;  3E3R A;  1EH2 A;  3M0W A;  4ZCU A;  2NCO A;  1PK0 D;  1B7T Z;  1PVA A;  1R6P A;  1UUS A;  1SPY A;  4GGF C;  1IH0 A;  1BOC A;  2JT8 A;  1B9A A;  4PE0 A;  1IJ6 A;  5K89 A;  2PVB A;  3EK4 A;  2L5X B;  3TS5 B;  2ZKM X;  3VRN A;  2V53 A;  1SNL A;  3FWB A;  3JVT C;  1MR8 A;  1XFZ O;  1J7O A;  1V1F A;  1A75 B;  1S5G Y;  3FS7 A;  3PFV A;  3PM8 A;  5CPV A;  2PAL A;  1J1E A;  3TDZ A;  3TZ1 A;  1L2O B;  4PHM A;  1YUU A;  4GUK A;  1B8R A;  4FTG A;  1OZS A;  1SY9 A;  1G33 A;  1DJH A;  2OS8 B;  3KEV A;  4YGD B;  1ALW A;  1RWY A;  3K21 A;  2FOT A;  2KOT A;  1J7Q A;  2L51 A;  1OOJ A;  1QJT A;  2O5G A;  1WRZ A;  1OMV A;  4R1E A;  2F3Z A;  1G4Y R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...