1F55A

Solution structure of the calcium bound n-terminal domain of yeast calmodulin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f55A00
1GQMA 1IG5A 1YVLA 4QJ5B 2JC2A 1SCMC 2M3WA 1Y0VH 4A4CA 3AKAA 3HX4A 5HYDA 2VRGA 1S5GY 1WDCC 2KOTA 2BECA 4YI8A 2KFHA 2MA2A 1LVCD 4WQ3A 4P5OE 1B7TZ 3FWBA 2JNFA 1CDNA 1B9AA 1BODA 2Y4QA 1SL7A 1IGVA 2KAVA 4F0ZB 2JTZA 3OB2B 1QXPA 4MRXA 4IL1A 1KFXS 2E6WA 2JT8A 1PULA 1QVIZ 1RK9A 1M31A 2LHIA 3IQQA 4ZCUA 2JRFA 2KBIA 2H61C 2G2BA 3DVMA 3IQOA 5GQQC 1QIVA 3TDIA 1RWYA 1KFUL 3LCPC 4NQGA 2ZN8A 1DT7B 5AFPA 3ICBA 1K2HA 3PM8A 4BY5A 4PE7A 4MLWA 2PASA 1EH2A 3DVEA 2Y1MA 1G33A 1PVAA 4NDDA 4E68A 1YR5A 1LXFC 1XFZO 3DVJA 1QTXA 3BUXB 1UHIA 2F2OA 1BU3A 2LVIA 1F4OA 4R1EA 3EKHA 1B8LA 1OMDA 2K61A 2WCFA 3CWGA 3SG6A 3O6BA 2MAZA 2ZNEA 1QJTA 3CZTX 3O4YA 2L50A 1N0YA 3M0WA 2R2IA 3AAJA 1YUTA 1S26D 2AUCA 1BT6A 2JPTA 3F45A 4QJ4B 3BOWB 1RTP1 1K90D 3DF0B 4ZCVA 3TDUA 3NSIA 1WY9A 3SG4A 1S6IA 1L2OB 1OMRA 2AMIA 1OZOA 4PALA 4TNCA 5HKWA 3VRQA 4OVNF 1UUSA 1J1DA 1NUBA 3BUMB 5I2QA 1NCZA 1TN4A 2HF5A 2KGBC 2OS8B 3D10A 1WRKA 1L2OC 1A4PA 2EC6B 4JWQA 4N1FA 4M2QA 3EKJA 2K7CA 1MUXA 1LA3A 1NWDA 2K0JA 1TIZA 2NZ0A 3PALA 3QRXA 1OOJA 2OS8C 1A2XA 1YVHA 1KK7Z 1A75A 1EJ3A 1KQMB 2EC6C 1K96A 2PVBA 4PHMA 3FIAA 3WHUB 1IWQA 4PE4A 1AJ4A 2LLSA 1UHJA 1B1GA 4M2OA 1IQ3A 1OQPA 2PSRA 1QV1A 2FCEA 3GK2A 1AUIB 1TNXA 4PHKA 1CTRA 4CPVA 2M9GA 2KSPA 2LMVA 3GK4X 3LLEA 5CSFA 1KQMC 4DUQA 3KHEA 5JOLA 2L98A 5BPJA 1SCVA 1DF0A 5KTYA 1HQVA 1PRWA 4C0JA 2LUCA 1FBVA 3FWCA 1BOCA 4HREE 2QACA 2JT0A 4JQ0D 5K89A 2L0PA 2LVJA 2BL0B 1L7ZA 4YBHB 1CMFA 1S6JA 2KQYA 3NSKA 1WLZA 3KF9A 4PHNA 1JBAA 1FI5A 1NP8A 4OCIA 2IS9A 4WQ2A 2GGZA 3EK7A 1S3PA 2QPTA 2F3ZA 1QX5B 1TCFA 1YTZC 2L4HA 2I2RE 2BL0C 1RFJA 1C7VA 2KI6D 1RECA 5J3XA 4YGDB 1N65A 1SW8A 2KFFA 2MHHA 3KPXA 4I5LB 3BXKA 1NX0A 2ZN9A 4PCWA 5DKNA 4N5XA 1AP4A 1XK4A 2CTNA 3DVKA 4C0KA 2LE9B 1IKUA 4ORBB 2BKHB 2O60A 5HKZA 1DMOA 2LUXA 1DJIA 1NSHA 2BCBA 1DF0B 5I2OA 2KBMA 2GV5A 3I5IB 2I94A 4ICBA 1IRJA 3WNXB 1KFUS 3NSOA 4HRHA 2JXLA 2BBMA 1V1FA 1B7TY 1IQ5A 3CTNA 1SK6D 2KYCA 3PFVA 1DJGA 1JF2A 1NCYA 5DKQA 3I5GB 1S6CA 3AKBA 4DRWA 3I5IC 3OB1B 4OV2A 1QIWA 2K7DA 1S36A 4I5KA 4GAOA 1U5IA 1DVIA 1S5GZ 2M8UA 1H4BA 3I5GC 3PLFB 3PN7B 2H2KA 1CKKA 4N1GA 1PK0D 1V1GA 2LV7A 1XFYO 3TDZA 3SIAA 2M97A 4CFQA 2COLB 5AXIA 3SJSA 1PSRA 2DOQA 1CLMA 5ER4X 5HKYA 5JJGA 1SYMA 3PN7C 3BUOB 4Q04A 4CIDA 1B8CA 1YURA 1KQVA 4XJKA 1NIWA 4YGBB 1J7OA 1JC2A 1AHRA 2MJWB 1M39A 1MWNA 2M7NA 3BQ3A 1CM4A 1EL4A 4AOMA 2KAXA 1K9UA 1KK8B 5PALA 1J7PA 4YRUA 2KAYA 1DJWA 1QATA 1S1EA 3ZNIA 1B4CA 4GNKB 1SNLA 1WLMA 3SG5A 1U5IB 3OX6A 3IF7A 1KFXL 2NLNA 4PE1A 2K8MB 4HRGA 3RLZA 1QX7A 1UHNA 1K8UA 5B8IB 1KK8C 3O2PA 1IJ5A 1SMGA 3O78A 1DJYA 1RROA 1K93D 4DIRA 1W7IB 5CSIA 1K9KA 5HLVA 1AVSA 2D8NA 2MRDA 3BUWB 2K2FA 1OMVA 1NPQA 2LC5A 1IH0A 5AEQA 2M7LA 1CLBA 1SBJA 1NX3A 1DJZA 2CBLA 2JXCA 2KI6C 2LM5A 3TZ1A 4QJ3B 2ISDA 3RM1A 1Y1UA 4XJKB 2LLUA 3LK1A 2JU0A 1MXEA 2HQ8A 2JULA 3D0YA 4FQOA 4USLA 1HT9A 2LP2A 2Q4UA 4ETOA 2JT3A 3H4SE 2OPOA 1B8RA 1VRKA 4PHJA 1XFUO 2LCPA 2ZFDA 4NDCA 3VRRA 1KK7Y 3SG7A 4XYNA 2GGMA 1A03A 3OX5A 2KDHA 3E3RA 3CR2A 4AQJA 2K7BA 2JZIA 4C0LA 2KHNA 4GBAA 2LAPA 2B1UA 4AQIA 1UP5A 2L4IA 1MXLC 2BE4A 1QV0A 2PMYA 3KO0A 4D1EA 1A29A 1QLSA 2JOJA 2I7AA 5CPVA 1FW4A 1WRLA 4MRYA 1ALVA 2HPSA 2TN4A 2SASA 1MHOA 5ER5A 4MSPA 1KCYA 3D0YB 1SL8A 1KWOB 3JVTB 3NXAA 1LA0A 1CFPA 2KFGA 2CT9A 4ORCB 1A75B 1WRZA 4PE0A 3CR4X 3I5FB 2AAOA 3A4UB 2OTGB 1DJXA 5IBWA 5I8NA 4BY4A 5D69A 1CM1A 2WORA 1KWOC 3JVTC 1LKJA 5F6TA 5G08A 1SRAA 2BE6A 1UURA 4YGCB 1MR8A 3WXAA 1DTLA 2FOTA 2M29A 4GGNA 1TRFA 2RGIA 3I5FC 1JWDA 2OTGC 1B47A 2Y1NA 4U8DA 4GPLB 2ZKMX 2M49B 1GGWA 2I18A 1SL9A 1G8IA 3FS7A 1YUUA 4M2PA 3EK8A 2KQ6A 5D7FA 1JF0A 1NX1A 3EK4A 3OP0A 4ORAB 1IJ6A 4MN0A 2CCMA 1ZFSA 1QVIY 4GGFA 4I5NB 3VROA 2FJUB 2BBNA 1X02A 3TUYB 1BF5A 1AK8A 1CDMA 1CNPA 4MEWA 4MZLA 3SG3A 1H8BA 1KSMA 1Y6WA 2F33A 4MZKA 4I5JA 1NX2A 3GK1A 1JUOA 2LHLA 2BCXA 2O5GA 1KSOA 1PSBA 1Y1AA 1ALWA 1J1EA 3TUYC 1SPYA 2LP3A 2EHBA 1FI6A 1UHKA 2JWWA 3LK0A 4GUKA 3CS1A 1ZACA 2MBXA 1C07A 4OR9B 2WCBA 4UPGA 1XK4C 1FF1A 3VRNA 1QLKA 2K7OA 3TS5B 1XVJA 5DKRA 2ZRTA 1J55A 5AERA 4YI9A 3BOWA 3DF0A 3EVUA 1F70A 2Q91A 1M45A 1RJVA 3CLNA 3HCMA 1YRTB 4CLNA 2KNEA 1BMOA 1LINA 4OKHA 1F4QA 2LLTA 3TS5C 1NYAA 1F55A 1XA5A 1PVBA 1MF8B 1TCOB 1YX8A 3K21A 1EG4A 2F3YA 2F8PA 2P6BB 1ZOTB 1TNQA 5AANA 5CSNA 1F71A 1YUSA 4YGEB 1CDLA 1OE9B 1N2DA 4GGFC 3CGAA 1YX7A 1XYDA 4FTGA 1CFDA 5CSJA 1F54A 1QS7A 3PATA 2WNDA 5I2LA 3JTDB 1TNWA 2M0RA 1CDPA 2CXJA 2WOSA 1M63B 4NDBA 4WRIA 4DS7A 2NCOA 1E8AA 1R2UA 2WC8A 4MBEA 1JSAA 3A8RA 2NXQA 1DJHA 2L2EA 2KGRA 1ZMZA 2EGDA 1GGZA 2A4JA 3JTDC 1CFCA 1G4YR 2L51A 3SG2A 1AJ5A 1K9PA 4MZJA 3AAKA 3LL8B 5KU1A 2LVKA 3EVVA 1EG3A 1R6PA 2BKIB 2Y5IA 1ZUZA 3SIBA 2MLFC 1J7QA 2PALA 1XFVO 2V53A 4JPZB 1GJYA 1EXRA 2ZNDA 2WCEA 4GFTA 2G9BA 1MQ1A 3VRPA 4MVFA 2JNXA 1NCXA 2L5XB 1CFFA 2E30A 2LANA 1CMGA 1UHHA 4P2YB 3VGOA 5HLOA 2PRUA 1BR4B 1M46A 1Q80A 1ODBA 1W7JB 2FCDA 3GOFA 4PDZA 5KSZA 1BG1A 1JFJA 1OZSA 1F8HA 2LNKA 3MSEB 1D1OA 1DGVA 2JTTA 1TOPA 3C1VA 4DCKA 1DGUA 1OSAA 1K95A 1C7WA 1BLQA 1QX2A 1UWOA 3OHMB 4CFRA 1TTXA 3PSRA 1JFKA 2NCPA 4HSZA 2K2AA 1SR6B 2LVVA 3I5HB 3BYAA 1XFXO 1K94A 1XO5A 4A4BA 2H61A 1XFWO 1PALA 3ZWHA 2LMUA 2BCAA 2KI4B 3KEVA 1FPWA 2SCPA 1Y1XA 1BR1B 2M1UA 2JQ6A 1CB1A 1SR6C 2LMTA 2ZRSA 3I5HC 3NSLA 2CNPA 1SCMB 3BUNB 1YRUB 5FYXA 2F2PA 5TNCA 2M1KB 3CR5X 2HETA 1WDCB 1QASA 2KYFA 2MLEC 4YGAA 3WHTB 3EVRA 2KI4C 1CLLA 1J7RA 1BJFA 1SKTA 2HQWA 3DD4A 1SY9A 4L9MA 1TNPA
chains in the Genus database with same CATH superfamily
1GQMA 1IG5A 1YVLA 3SS3A 4QJ5B 2JC2A 1SCMC 2M3WA 1Y0VH 4A4CA 3AKAA 3HX4A 5HYDA 2VRGA 1S5GY 1WDCC 2KOTA 2BECA 4YI8A 2KFHA 2MA2A 1LVCD 4WQ3A 3CZ2A 4P5OE 1B7TZ 3FWBA 2JNFA 1CDNA 1TUJA 1B9AA 3QMEA 3R1OA 2Y4QA 1BODA 1SL7A 1IGVA 2KAVA 4F0ZB 2JTZA 3OB2B 1QXPA 4MRXA 4IL1A 1KFXS 2E6WA 2JT8A 1W9ZA 1PULA 1QVIZ 1RK9A 1M31A 2LHIA 3IQQA 4ZCUA 3DYEA 2JRFA 1OOHA 3D74A 3B87A 2KBIA 2H61C 2G2BA 3DVMA 3IQOA 5GQQC 1QIVA 3TDIA 2QEVA 1RWYA 1KFUL 3EG5B 3LCPC 2ZN8A 4NQGA 1DT7B 5AFPA 3ICBA 2PQLA 1K2HA 3PM8A 4BY5A 4PE7A 4MLWA 2PASA 1EH2A 3DVEA 2Y1MA 1G33A 1PVAA 4NDDA 4E68A 1YR5A 1LXFC 1XFZO 3DVJA 1QTXA 3BUXB 1UHIA 1TWOA 2F2OA 1BU3A 2LVIA 1F4OA 3NGVA 3EKHA 4R1EA 1B8LA 1OMDA 2K61A 2WCFA 3CWGA 3SG6A 3O6BA 2MAZA 2ZNEA 1QJTA 3CZTX 3O4YA 2L50A 1N0YA 3M0WA 2R2IA 3AAJA 3R1VA 1YUTA 1S26D 2AUCA 4PT1A 1BT6A 1C3ZA 2JPTA 3F45A 4QJ4B 3S0BA 3BOWB 1RTP1 1K90D 3DF0B 4ZCVA 3TDUA 1OOIX 3NSIA 1WY9A 3SG4A 1S6IA 1L2OB 1OMRA 2AMIA 1OZOA 4PALA 4TNCA 5HKWA 3VRQA 4OVNF 1UUSA 1J1DA 1NUBA 3BUMB 5I2QA 1NCZA 3FE8A 1TN4A 2HF5A 2KGBC 3SS4A 1Z4HA 2OS8B 3D10A 1WRKA 5EL2A 1L2OC 1A4PA 2EC6B 4JWQA 4N1FA 4M2QA 3EKJA 2K7CA 3BJHA 1MUXA 1LA3A 4INWA 1NWDA 2WC6A 2K0JA 1TIZA 2NZ0A 3D73A 3PALA 3QRXA 1OOJA 2OS8C 4INXA 1A2XA 1YVHA 1P28A 1KK7Z 1A75A 1EJ3A 1KQMB 2EC6C 1K96A 2PVBA 4PHMA 3FIAA 3WHUB 1IWQA 4PE4A 1AJ4A 2LLSA 1UHJA 1B1GA 4M2OA 1IQ3A 1OQPA 2PSRA 1QV1A 2FCEA 3GK2A 1AUIB 1TNXA 4PHKA 1CTRA 4CPVA 2M9GA 2KSPA 2LMVA 3GK4X 3LLEA 5CSFA 1KQMC 4DUQA 3KHEA 5JOLA 2L98A 5BPJA 3K1EA 1SCVA 1DF0A 5KTYA 1HQVA 1PRWA 4C0JA 2LUCA 1FBVA 3FWCA 1BOCA 4HREE 5FI6A 2QACA 2JT0A 4JQ0D 5K89A 2L0PA 3BFHA 2LVJA 2BL0B 1L7ZA 2H8VA 4YBHB 1CMFA 1S6JA 2KQYA 3NSKA 1WLZA 3KF9A 4PHNA 3S0DA 1JBAA 1FI5A 1NP8A 4OCIA 2IS9A 4WQ2A 1DC1A 2GGZA 3EK7A 1S3PA 2QPTA 2F3ZA 1QX5B 1TCFA 1YTZC 2L4HA 2I2RE 2BL0C 1RFJA 3NHTA 2KI6D 1C7VA 1RECA 2L5YA 5J3XA 4YGDB 1N65A 1SW8A 3CYZA 2KFFA 2MHHA 3KPXA 4I5LB 3BXKA 1NX0A 2ZN9A 4PCWA 2QEOA 5DKNA 4N5XA 1AP4A 1XK4A 2CTNA 3DVKA 4C0KA 2LE9B 1OW4A 4ORBB 1IKUA 2BKHB 1Z2CB 2O60A 5HKZA 2L2CA 2LUXA 1DMOA 1DJIA 1NSHA 2BCBA 1DF0B 5I2OA 1QWVA 2KBMA 2GV5A 3I5IB 2I94A 4ICBA 1IRJA 3UNWA 3WNXB 1KFUS 3NSOA 4HRHA 2FJYA 2JXLA 2BBMA 1V1FA 1B7TY 1IQ5A 3CTNA 1SK6D 2KYCA 3PFVA 1DJGA 1JF2A 1NCYA 5DKQA 3I5GB 1S6CA 3AKBA 4DRWA 3I5IC 3OB1B 4OV2A 1QIWA 2WCJA 2K7DA 1S36A 4I5KA 4GAOA 1U5IA 1DVIA 1S5GZ 2M8UA 1H4BA 3I5GC 3PLFB 3PN7B 2H2KA 3VB1A 1CKKA 4N1GA 1PK0D 1V1GA 5D3OA 5DICA 3B6XA 2BNXA 2LV7A 4JKTA 3N7HA 1XFYO 3TDZA 3SIAA 2M97A 4CFQA 2COLB 5AXIA 3SJSA 1PSRA 2DOQA 1CLMA 5ER4X 5HKYA 5JJGA 1SYMA 3PN7C 3BUOB 4Q04A 4CIDA 1B8CA 1YURA 1KQVA 4XJKA 1NIWA 4YGBB 1J7OA 1JC2A 1AHRA 2MJWB 1M39A 1MWNA 4JD9A 2M7NA 3BQ3A 3DY9A 1CM4A 1EL4A 4AOMA 2KAXA 1K9UA 1KK8B 5PALA 1J7PA 4YRUA 2KAYA 1ORGA 1DJWA 1QATA 1S1EA 3ZNIA 1IIOA 1B4CA 4GNKB 1SNLA 1WLMA 3OGNA 3SG5A 1U5IB 3OX6A 3IF7A 1KFXL 2NLNA 4PE1A 2K8MB 4HRGA 3RLZA 1QX7A 1UHNA 3R72A 1K8UA 5B8IB 1KK8C 3O2PA 2WCKA 1IJ5A 1SMGA 2K60A 3O78A 1DJYA 1RROA 1K93D 4DIRA 1W7IB 5CSIA 1K9KA 5HLVA 1AVSA 2D8NA 2MRDA 3BUWB 2K2FA 1OMVA 3B7AA 1NPQA 2LC5A 1IH0A 5AEQA 3DXLA 2M7LA 1CLBA 1SBJA 1NX3A 1DJZA 2CBLA 2JXCA 2KI6C 2LM5A 2QEHA 3TZ1A 1GM0A 2JPOA 4QJ3B 2ISDA 3RM1A 1Y1UA 4XJKB 2LLUA 3LK1A 2JU0A 3FE9A 1OOGA 1MXEA 2HQ8A 2JULA 3D0YA 4FQOA 4USLA 1HT9A 2LP2A 2Q4UA 4ETOA 3L4LA 2JT3A 3H4SE 2OPOA 1B8RA 1VRKA 4PHJA 1XFUO 2LCPA 2ZFDA 4NDCA 3DZTA 3VRRA 1KK7Y 3SG7A 4XYNA 2GGMA 1A03A 3OX5A 2KDHA 3D78A 3E3RA 3CR2A 1DEKA 4AQJA 2K7BA 3Q8IA 2ERBA 2JZIA 2KHNA 3R1PA 2LAPA 3CZ0A 4GBAA 3SS5A 4C0LA 2B1UA 4AQIA 1UP5A 2P70A 2L4IA 1MXLC 2BE4A 1QV0A 2PMYA 3KO0A 4D1EA 1A29A 1QLSA 2JOJA 2I7AA 5CPVA 1FW4A 1WRLA 4MRYA 3D77A 1ALVA 2HPSA 2TN4A 3O4XA 3PM2A 2SASA 1MHOA 5ER5A 4MSPA 1KCYA 3D0YB 1SL8A 1KWOB 3JVTB 3NXAA 1LA0A 1CFPA 2KFGA 2CT9A 2WCMA 4ORCB 2BAPA 3UO9A 3V2LA 1A75B 1WRZA 4PE0A 3CR4X 3I5FB 2AAOA 3A4UB 2OTGB 1DJXA 5IBWA 5I8NA 3S0GA 1TUZA 4BY4A 5D69A 1CM1A 2WORA 1KWOC 3JVTC 1LKJA 5F6TA 5G08A 3B88A 1SRAA 2BE6A 3B86A 5I94A 1UURA 4YGCB 1MR8A 3WXAA 2KPHA 1DTLA 2FOTA 2M29A 4GGNA 1TRFA 2RGIA 3I5FC 1JWDA 2OTGC 1B47A 2Y1NA 4FQTA 4U8DA 4IJ7A 4GPLB 2ZKMX 2M49B 1GGWA 2I18A 1SL9A 1G8IA 3FS7A 3D76A 1YUUA 2KLEA 4M2PA 3EK8A 2KQ6A 5D7FA 1JF0A 1OOFA 1NX1A 3EK4A 3OP0A 5FI2A 4ORAB 1IJ6A 4MN0A 2CCMA 3RZSA 1ZFSA 1QVIY 4GGFA 4I5NB 3VROA 2FJUB 2BBNA 1X02A 3S0FA 3TUYB 1BF5A 1AK8A 1CDMA 1CNPA 4MEWA 4MZLA 3SG3A 1H8BA 1KSMA 1SSEB 1Y6WA 2F33A 4MZKA 4I5JA 1NX2A 3GK1A 3CDNA 1JUOA 2LHLA 1C3YA 3NHIA 2BCXA 2O5GA 1KSOA 1PSBA 1Y1AA 1ALWA 1J1EA 2YGUA 1SPYA 3S0AA 3TUYC 2LP3A 2EHBA 1FI6A 1UHKA 2JWWA 3LK0A 4GUKA 3CS1A 1ZACA 2MBXA 3L47A 1C07A 4OR9B 2WCBA 4UPGA 1XK4C 1FF1A 5FI7A 3VRNA 1QLKA 3IVTA 2K7OA 3TS5B 1XVJA 5DKRA 2ZRTA 1J55A 5AERA 4YI9A 3BOWA 3DF0A 3EVUA 4KYNA 1F70A 2Q91A 1M45A 1RJVA 3CLNA 3HCMA 1YRTB 4CLNA 2KNEA 1BMOA 1LINA 4OKHA 1F4QA 2LLTA 3BFAA 3TS5C 1NYAA 1F55A 1XA5A 1PVBA 1MF8B 1TCOB 1YX8A 3K21A 1EG4A 2F3YA 2F8PA 2P6BB 3BFBA 1ZOTB 1TNQA 5AANA 5HL1A 5CSNA 1F71A 1YUSA 4YGEB 1CDLA 1OE9B 1N2DA 4GGFC 3CGAA 1YX7A 1XYDA 4FTGA 1CFDA 5CSJA 1F54A 1QS7A 3PATA 2WNDA 5I2LA 3JTDB 1TNWA 2M0RA 1CDPA 4F7FA 2CXJA 2WOSA 1M63B 4NDBA 4WRIA 4DS7A 2NCOA 1E8AA 1R2UA 2WC8A 4MBEA 1JSAA 3A8RA 2NXQA 1DJHA 2L2EA 2KGRA 1ZMZA 2EGDA 1GGZA 2A4JA 3JTDC 1CFCA 1G4YR 2L51A 3SG2A 1AJ5A 1K9PA 4MZJA 3AAKA 3LL8B 5KU1A 2LVKA 3OBVA 3EVVA 1EG3A 1R6PA 2BKIB 2Y5IA 1ZUZA 3SIBA 2MLFC 1J7QA 2PALA 1XFVO 2V53A 4JPZB 1GJYA 1EXRA 2PYQA 2ZNDA 2WCEA 4GFTA 2G9BA 1MQ1A 3VRPA 4MVFA 2JNXA 1NCXA 2L5XB 1CFFA 2E30A 2LANA 1CMGA 1UHHA 2QDIA 2GTEA 4P2YB 3VGOA 5HLOA 2PRUA 1T14A 1BR4B 1M46A 1Q80A 1ODBA 1W7JB 2FCDA 3GOFA 4PDZA 5KSZA 1BG1A 1JFJA 1OZSA 3PJIA 1F8HA 2LNKA 3MSEB 1D1OA 1DGVA 2JTTA 1TOPA 3CZ1A 3S0EA 3C1VA 4DCKA 2WCHA 1DGUA 1OSAA 1K95A 1C7WA 4OZDA 1QX2A 1BLQA 1UWOA 2P71A 3OHMB 4CFRA 1XFRA 1TTXA 3PSRA 1JFKA 1LS8A 2WCLA 2NCPA 3FE6A 4HSZA 3CABA 2K2AA 1SR6B 2LVVA 3I5HB 3BYAA 1XFXO 1K94A 1XO5A 4A4BA 2H61A 1XFWO 1PALA 3ZWHA 2LMUA 2BCAA 2KI4B 3KEVA 1FPWA 2SCPA 1Y1XA 1BR1B 2M1UA 1DQEA 2JQ6A 1CB1A 1SR6C 2LMTA 2ZRSA 3I5HC 2WC5A 3NSLA 2CNPA 1SCMB 3BUNB 1YRUB 3D75A 5FYXA 2F2PA 5TNCA 2M1KB 3CR5X 2HETA 1WDCB 1QASA 2KYFA 2MLEC 4YGAA 3WHTB 2QEBA 2KI4C 1CLLA 1J7RA 3EVRA 1BJFA 1DELA 1SKTA 2HQWA 3L4AA 3DD4A 2KLDA 1SY9A 4L9MA 1TNPA
chains in the Genus database with same CATH topology
1GQMA 1IG5A 1YVLA 4QJ5B 2JC2A 1SCMC 2M3WA 1Y0VH 4A4CA 3AKAA 3HX4A 5HYDA 2VRGA 1S5GY 1WDCC 2KOTA 2BECA 4YI8A 2KFHA 2MA2A 1LVCD 4WQ3A 4P5OE 1B7TZ 3FWBA 2JNFA 1CDNA 1B9AA 1BODA 2Y4QA 1SL7A 1IGVA 2KAVA 4F0ZB 2JTZA 3OB2B 1QXPA 4MRXA 4IL1A 1KFXS 2E6WA 2JT8A 1PULA 1QVIZ 1RK9A 1M31A 2LHIA 3IQQA 4ZCUA 2JRFA 2KBIA 2H61C 2G2BA 3DVMA 3IQOA 5GQQC 1QIVA 3TDIA 1RWYA 1KFUL 3LCPC 4NQGA 2ZN8A 1DT7B 5AFPA 3ICBA 1K2HA 3PM8A 4BY5A 4PE7A 4MLWA 2PASA 1EH2A 3DVEA 2Y1MA 1G33A 1PVAA 4NDDA 4E68A 1YR5A 1LXFC 1XFZO 3DVJA 1QTXA 3BUXB 1UHIA 2F2OA 1BU3A 2LVIA 1F4OA 4R1EA 3EKHA 1B8LA 1OMDA 2K61A 2WCFA 3CWGA 3SG6A 3O6BA 2MAZA 2ZNEA 1QJTA 3CZTX 3O4YA 2L50A 1N0YA 3M0WA 2R2IA 3AAJA 1YUTA 1S26D 2AUCA 1BT6A 2JPTA 3F45A 4QJ4B 3BOWB 1RTP1 1K90D 3DF0B 4ZCVA 3TDUA 3NSIA 1WY9A 3SG4A 1S6IA 1L2OB 1OMRA 2AMIA 1OZOA 4PALA 4TNCA 5HKWA 3VRQA 4OVNF 1UUSA 1J1DA 1NUBA 3BUMB 5I2QA 1NCZA 1TN4A 2HF5A 2KGBC 2OS8B 3D10A 1WRKA 1L2OC 1A4PA 2EC6B 4JWQA 4N1FA 4M2QA 3EKJA 2K7CA 1MUXA 1LA3A 1NWDA 2K0JA 1TIZA 2NZ0A 3PALA 3QRXA 1OOJA 2OS8C 1A2XA 1YVHA 1KK7Z 1A75A 1EJ3A 1KQMB 2EC6C 1K96A 2PVBA 4PHMA 3FIAA 3WHUB 1IWQA 4PE4A 1AJ4A 2LLSA 1UHJA 1B1GA 4M2OA 1IQ3A 1OQPA 2PSRA 1QV1A 2FCEA 3GK2A 1AUIB 1TNXA 4PHKA 1CTRA 4CPVA 2M9GA 2KSPA 2LMVA 3GK4X 3LLEA 5CSFA 1KQMC 4DUQA 3KHEA 5JOLA 2L98A 5BPJA 1SCVA 1DF0A 5KTYA 1HQVA 1PRWA 4C0JA 2LUCA 1FBVA 3FWCA 1BOCA 4HREE 2QACA 2JT0A 4JQ0D 5K89A 2L0PA 2LVJA 2BL0B 1L7ZA 4YBHB 1CMFA 1S6JA 2KQYA 3NSKA 1WLZA 3KF9A 4PHNA 1JBAA 1FI5A 1NP8A 4OCIA 2IS9A 4WQ2A 2GGZA 3EK7A 1S3PA 2QPTA 2F3ZA 1QX5B 1TCFA 1YTZC 2L4HA 2I2RE 2BL0C 1RFJA 1C7VA 2KI6D 1RECA 5J3XA 4YGDB 1N65A 1SW8A 2KFFA 2MHHA 3KPXA 4I5LB 3BXKA 1NX0A 2ZN9A 4PCWA 5DKNA 4N5XA 1AP4A 1XK4A 2CTNA 3DVKA 4C0KA 2LE9B 1IKUA 4ORBB 2BKHB 2O60A 5HKZA 1DMOA 2LUXA 1DJIA 1NSHA 2BCBA 1DF0B 5I2OA 2KBMA 2GV5A 3I5IB 2I94A 4ICBA 1IRJA 3WNXB 1KFUS 3NSOA 4HRHA 2JXLA 2BBMA 1V1FA 1B7TY 1IQ5A 3CTNA 1SK6D 2KYCA 3PFVA 1DJGA 1JF2A 1NCYA 5DKQA 3I5GB 1S6CA 3AKBA 4DRWA 3I5IC 3OB1B 4OV2A 1QIWA 2K7DA 1S36A 4I5KA 4GAOA 1U5IA 1DVIA 1S5GZ 2M8UA 1H4BA 3I5GC 3PLFB 3PN7B 2H2KA 1CKKA 4N1GA 1PK0D 1V1GA 2LV7A 1XFYO 3TDZA 3SIAA 2M97A 4CFQA 2COLB 5AXIA 3SJSA 1PSRA 2DOQA 1CLMA 5ER4X 5HKYA 5JJGA 1SYMA 3PN7C 3BUOB 4Q04A 4CIDA 1B8CA 1YURA 1KQVA 4XJKA 1NIWA 4YGBB 1J7OA 1JC2A 1AHRA 2MJWB 1M39A 1MWNA 2M7NA 3BQ3A 1CM4A 1EL4A 4AOMA 2KAXA 1K9UA 1KK8B 5PALA 1J7PA 4YRUA 2KAYA 1DJWA 1QATA 1S1EA 3ZNIA 1B4CA 4GNKB 1SNLA 1WLMA 3SG5A 1U5IB 3OX6A 3IF7A 1KFXL 2NLNA 4PE1A 2K8MB 4HRGA 3RLZA 1QX7A 1UHNA 1K8UA 5B8IB 1KK8C 3O2PA 1IJ5A 1SMGA 3O78A 1DJYA 1RROA 1K93D 4DIRA 1W7IB 5CSIA 1K9KA 5HLVA 1AVSA 2D8NA 2MRDA 3BUWB 2K2FA 1OMVA 1NPQA 2LC5A 1IH0A 5AEQA 2M7LA 1CLBA 1SBJA 1NX3A 1DJZA 2CBLA 2JXCA 2KI6C 2LM5A 3TZ1A 4QJ3B 2ISDA 3RM1A 1Y1UA 4XJKB 2LLUA 3LK1A 2JU0A 1MXEA 2HQ8A 2JULA 3D0YA 4FQOA 4USLA 1HT9A 2LP2A 2Q4UA 4ETOA 2JT3A 3H4SE 2OPOA 1B8RA 1VRKA 4PHJA 1XFUO 2LCPA 2ZFDA 4NDCA 3VRRA 1KK7Y 3SG7A 4XYNA 2GGMA 1A03A 3OX5A 2KDHA 3E3RA 3CR2A 4AQJA 2K7BA 2JZIA 4C0LA 2KHNA 4GBAA 2LAPA 2B1UA 4AQIA 1UP5A 2L4IA 1MXLC 2BE4A 1QV0A 2PMYA 3KO0A 4D1EA 1A29A 1QLSA 2JOJA 2I7AA 5CPVA 1FW4A 1WRLA 4MRYA 1ALVA 2HPSA 2TN4A 2SASA 1MHOA 5ER5A 4MSPA 1KCYA 3D0YB 1SL8A 1KWOB 3JVTB 3NXAA 1LA0A 1CFPA 2KFGA 2CT9A 4ORCB 1A75B 1WRZA 4PE0A 3CR4X 3I5FB 2AAOA 3A4UB 2OTGB 1DJXA 5IBWA 5I8NA 4BY4A 5D69A 1CM1A 2WORA 1KWOC 3JVTC 1LKJA 5F6TA 5G08A 1SRAA 2BE6A 1UURA 4YGCB 1MR8A 3WXAA 1DTLA 2FOTA 2M29A 4GGNA 1TRFA 2RGIA 3I5FC 1JWDA 2OTGC 1B47A 2Y1NA 4U8DA 4GPLB 2ZKMX 2M49B 1GGWA 2I18A 1SL9A 1G8IA 3FS7A 1YUUA 4M2PA 3EK8A 2KQ6A 5D7FA 1JF0A 1NX1A 3EK4A 3OP0A 4ORAB 1IJ6A 4MN0A 2CCMA 1ZFSA 1QVIY 4GGFA 4I5NB 3VROA 2FJUB 2BBNA 1X02A 3TUYB 1BF5A 1AK8A 1CDMA 1CNPA 4MEWA 4MZLA 3SG3A 1H8BA 1KSMA 1Y6WA 2F33A 4MZKA 4I5JA 1NX2A 3GK1A 1JUOA 2LHLA 2BCXA 2O5GA 1KSOA 1PSBA 1Y1AA 1ALWA 1J1EA 3TUYC 1SPYA 2LP3A 2EHBA 1FI6A 1UHKA 2JWWA 3LK0A 4GUKA 3CS1A 1ZACA 2MBXA 1C07A 4OR9B 2WCBA 4UPGA 1XK4C 1FF1A 3VRNA 1QLKA 2K7OA 3TS5B 1XVJA 5DKRA 2ZRTA 1J55A 5AERA 4YI9A 3BOWA 3DF0A 3EVUA 1F70A 2Q91A 1M45A 1RJVA 3CLNA 3HCMA 1YRTB 4CLNA 2KNEA 1BMOA 1LINA 4OKHA 1F4QA 2LLTA 3TS5C 1NYAA 1F55A 1XA5A 1PVBA 1MF8B 1TCOB 1YX8A 3K21A 1EG4A 2F3YA 2F8PA 2P6BB 1ZOTB 1TNQA 5AANA 5CSNA 1F71A 1YUSA 4YGEB 1CDLA 1OE9B 1N2DA 4GGFC 3CGAA 1YX7A 1XYDA 4FTGA 1CFDA 5CSJA 1F54A 1QS7A 3PATA 2WNDA 5I2LA 3JTDB 1TNWA 2M0RA 1CDPA 2CXJA 2WOSA 1M63B 4NDBA 4WRIA 4DS7A 2NCOA 1E8AA 1R2UA 2WC8A 4MBEA 1JSAA 3A8RA 2NXQA 1DJHA 2L2EA 2KGRA 1ZMZA 2EGDA 1GGZA 2A4JA 3JTDC 1CFCA 1G4YR 2L51A 3SG2A 1AJ5A 1K9PA 4MZJA 3AAKA 3LL8B 5KU1A 2LVKA 3EVVA 1EG3A 1R6PA 2BKIB 2Y5IA 1ZUZA 3SIBA 2MLFC 1J7QA 2PALA 1XFVO 2V53A 4JPZB 1GJYA 1EXRA 2ZNDA 2WCEA 4GFTA 2G9BA 1MQ1A 3VRPA 4MVFA 2JNXA 1NCXA 2L5XB 1CFFA 2E30A 2LANA 1CMGA 1UHHA 4P2YB 3VGOA 5HLOA 2PRUA 1BR4B 1M46A 1Q80A 1ODBA 1W7JB 2FCDA 3GOFA 4PDZA 5KSZA 1BG1A 1JFJA 1OZSA 1F8HA 2LNKA 3MSEB 1D1OA 1DGVA 2JTTA 1TOPA 3C1VA 4DCKA 1DGUA 1OSAA 1K95A 1C7WA 1BLQA 1QX2A 1UWOA 3OHMB 4CFRA 1TTXA 3PSRA 1JFKA 2NCPA 4HSZA 2K2AA 1SR6B 2LVVA 3I5HB 3BYAA 1XFXO 1K94A 1XO5A 4A4BA 2H61A 1XFWO 1PALA 3ZWHA 2LMUA 2BCAA 2KI4B 3KEVA 1FPWA 2SCPA 1Y1XA 1BR1B 2M1UA 2JQ6A 1CB1A 1SR6C 2LMTA 2ZRSA 3I5HC 3NSLA 2CNPA 1SCMB 3BUNB 1YRUB 5FYXA 2F2PA 5TNCA 2M1KB 3CR5X 2HETA 1WDCB 1QASA 2KYFA 2MLEC 4YGAA 3WHTB 3EVRA 2KI4C 1CLLA 1J7RA 1BJFA 1SKTA 2HQWA 3DD4A 1SY9A 4L9MA 1TNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQM A;  1IG5 A;  1YVL A;  4QJ5 B;  2JC2 A;  1SCM C;  2M3W A;  1Y0V H;  4A4C A;  3AKA A;  3HX4 A;  5HYD A;  2VRG A;  1S5G Y;  1WDC C;  2KOT A;  2BEC A;  4YI8 A;  2KFH A;  2MA2 A;  1LVC D;  4WQ3 A;  4P5O E;  1B7T Z;  3FWB A;  2JNF A;  1CDN A;  1B9A A;  1BOD A;  2Y4Q A;  1SL7 A;  1IGV A;  2KAV A;  4F0Z B;  2JTZ A;  3OB2 B;  1QXP A;  4MRX A;  4IL1 A;  1KFX S;  2E6W A;  2JT8 A;  1PUL A;  1QVI Z;  1RK9 A;  1M31 A;  2LHI A;  3IQQ A;  4ZCU A;  2JRF A;  2KBI A;  2H61 C;  2G2B A;  3DVM A;  3IQO A;  5GQQ C;  1QIV A;  3TDI A;  1RWY A;  1KFU L;  3LCP C;  4NQG A;  2ZN8 A;  1DT7 B;  5AFP A;  3ICB A;  1K2H A;  3PM8 A;  4BY5 A;  4PE7 A;  4MLW A;  2PAS A;  1EH2 A;  3DVE A;  2Y1M A;  1G33 A;  1PVA A;  4NDD A;  4E68 A;  1YR5 A;  1LXF C;  1XFZ O;  3DVJ A;  1QTX A;  3BUX B;  1UHI A;  2F2O A;  1BU3 A;  2LVI A;  1F4O A;  4R1E A;  3EKH A;  1B8L A;  1OMD A;  2K61 A;  2WCF A;  3CWG A;  3SG6 A;  3O6B A;  2MAZ A;  2ZNE A;  1QJT A;  3CZT X;  3O4Y A;  2L50 A;  1N0Y A;  3M0W A;  2R2I A;  3AAJ A;  1YUT A;  1S26 D;  2AUC A;  1BT6 A;  2JPT A;  3F45 A;  4QJ4 B;  3BOW B;  1RTP 1;  1K90 D;  3DF0 B;  4ZCV A;  3TDU A;  3NSI A;  1WY9 A;  3SG4 A;  1S6I A;  1L2O B;  1OMR A;  2AMI A;  1OZO A;  4PAL A;  4TNC A;  5HKW A;  3VRQ A;  4OVN F;  1UUS A;  1J1D A;  1NUB A;  3BUM B;  5I2Q A;  1NCZ A;  1TN4 A;  2HF5 A;  2KGB C;  2OS8 B;  3D10 A;  1WRK A;  1L2O C;  1A4P A;  2EC6 B;  4JWQ A;  4N1F A;  4M2Q A;  3EKJ A;  2K7C A;  1MUX A;  1LA3 A;  1NWD A;  2K0J A;  1TIZ A;  2NZ0 A;  3PAL A;  3QRX A;  1OOJ A;  2OS8 C;  1A2X A;  1YVH A;  1KK7 Z;  1A75 A;  1EJ3 A;  1KQM B;  2EC6 C;  1K96 A;  2PVB A;  4PHM A;  3FIA A;  3WHU B;  1IWQ A;  4PE4 A;  1AJ4 A;  2LLS A;  1UHJ A;  1B1G A;  4M2O A;  1IQ3 A;  1OQP A;  2PSR A;  1QV1 A;  2FCE A;  3GK2 A;  1AUI B;  1TNX A;  4PHK A;  1CTR A;  4CPV A;  2M9G A;  2KSP A;  2LMV A;  3GK4 X;  3LLE A;  5CSF A;  1KQM C;  4DUQ A;  3KHE A;  5JOL A;  2L98 A;  5BPJ A;  1SCV A;  1DF0 A;  5KTY A;  1HQV A;  1PRW A;  4C0J A;  2LUC A;  1FBV A;  3FWC A;  1BOC A;  4HRE E;  2QAC A;  2JT0 A;  4JQ0 D;  5K89 A;  2L0P A;  2LVJ A;  2BL0 B;  1L7Z A;  4YBH B;  1CMF A;  1S6J A;  2KQY A;  3NSK A;  1WLZ A;  3KF9 A;  4PHN A;  1JBA A;  1FI5 A;  1NP8 A;  4OCI A;  2IS9 A;  4WQ2 A;  2GGZ A;  3EK7 A;  1S3P A;  2QPT A;  2F3Z A;  1QX5 B;  1TCF A;  1YTZ C;  2L4H A;  2I2R E;  2BL0 C;  1RFJ A;  1C7V A;  2KI6 D;  1REC A;  5J3X A;  4YGD B;  1N65 A;  1SW8 A;  2KFF A;  2MHH A;  3KPX A;  4I5L B;  3BXK A;  1NX0 A;  2ZN9 A;  4PCW A;  5DKN A;  4N5X A;  1AP4 A;  1XK4 A;  2CTN A;  3DVK A;  4C0K A;  2LE9 B;  1IKU A;  4ORB B;  2BKH B;  2O60 A;  5HKZ A;  1DMO A;  2LUX A;  1DJI A;  1NSH A;  2BCB A;  1DF0 B;  5I2O A;  2KBM A;  2GV5 A;  3I5I B;  2I94 A;  4ICB A;  1IRJ A;  3WNX B;  1KFU S;  3NSO A;  4HRH A;  2JXL A;  2BBM A;  1V1F A;  1B7T Y;  1IQ5 A;  3CTN A;  1SK6 D;  2KYC A;  3PFV A;  1DJG A;  1JF2 A;  1NCY A;  5DKQ A;  3I5G B;  1S6C A;  3AKB A;  4DRW A;  3I5I C;  3OB1 B;  4OV2 A;  1QIW A;  2K7D A;  1S36 A;  4I5K A;  4GAO A;  1U5I A;  1DVI A;  1S5G Z;  2M8U A;  1H4B A;  3I5G C;  3PLF B;  3PN7 B;  2H2K A;  1CKK A;  4N1G A;  1PK0 D;  1V1G A;  2LV7 A;  1XFY O;  3TDZ A;  3SIA A;  2M97 A;  4CFQ A;  2COL B;  5AXI A;  3SJS A;  1PSR A;  2DOQ A;  1CLM A;  5ER4 X;  5HKY A;  5JJG A;  1SYM A;  3PN7 C;  3BUO B;  4Q04 A;  4CID A;  1B8C A;  1YUR A;  1KQV A;  4XJK A;  1NIW A;  4YGB B;  1J7O A;  1JC2 A;  1AHR A;  2MJW B;  1M39 A;  1MWN A;  2M7N A;  3BQ3 A;  1CM4 A;  1EL4 A;  4AOM A;  2KAX A;  1K9U A;  1KK8 B;  5PAL A;  1J7P A;  4YRU A;  2KAY A;  1DJW A;  1QAT A;  1S1E A;  3ZNI A;  1B4C A;  4GNK B;  1SNL A;  1WLM A;  3SG5 A;  1U5I B;  3OX6 A;  3IF7 A;  1KFX L;  2NLN A;  4PE1 A;  2K8M B;  4HRG A;  3RLZ A;  1QX7 A;  1UHN A;  1K8U A;  5B8I B;  1KK8 C;  3O2P A;  1IJ5 A;  1SMG A;  3O78 A;  1DJY A;  1RRO A;  1K93 D;  4DIR A;  1W7I B;  5CSI A;  1K9K A;  5HLV A;  1AVS A;  2D8N A;  2MRD A;  3BUW B;  2K2F A;  1OMV A;  1NPQ A;  2LC5 A;  1IH0 A;  5AEQ A;  2M7L A;  1CLB A;  1SBJ A;  1NX3 A;  1DJZ A;  2CBL A;  2JXC A;  2KI6 C;  2LM5 A;  3TZ1 A;  4QJ3 B;  2ISD A;  3RM1 A;  1Y1U A;  4XJK B;  2LLU A;  3LK1 A;  2JU0 A;  1MXE A;  2HQ8 A;  2JUL A;  3D0Y A;  4FQO A;  4USL A;  1HT9 A;  2LP2 A;  2Q4U A;  4ETO A;  2JT3 A;  3H4S E;  2OPO A;  1B8R A;  1VRK A;  4PHJ A;  1XFU O;  2LCP A;  2ZFD A;  4NDC A;  3VRR A;  1KK7 Y;  3SG7 A;  4XYN A;  2GGM A;  1A03 A;  3OX5 A;  2KDH A;  3E3R A;  3CR2 A;  4AQJ A;  2K7B A;  2JZI A;  4C0L A;  2KHN A;  4GBA A;  2LAP A;  2B1U A;  4AQI A;  1UP5 A;  2L4I A;  1MXL C;  2BE4 A;  1QV0 A;  2PMY A;  3KO0 A;  4D1E A;  1A29 A;  1QLS A;  2JOJ A;  2I7A A;  5CPV A;  1FW4 A;  1WRL A;  4MRY A;  1ALV A;  2HPS A;  2TN4 A;  2SAS A;  1MHO A;  5ER5 A;  4MSP A;  1KCY A;  3D0Y B;  1SL8 A;  1KWO B;  3JVT B;  3NXA A;  1LA0 A;  1CFP A;  2KFG A;  2CT9 A;  4ORC B;  1A75 B;  1WRZ A;  4PE0 A;  3CR4 X;  3I5F B;  2AAO A;  3A4U B;  2OTG B;  1DJX A;  5IBW A;  5I8N A;  4BY4 A;  5D69 A;  1CM1 A;  2WOR A;  1KWO C;  3JVT C;  1LKJ A;  5F6T A;  5G08 A;  1SRA A;  2BE6 A;  1UUR A;  4YGC B;  1MR8 A;  3WXA A;  1DTL A;  2FOT A;  2M29 A;  4GGN A;  1TRF A;  2RGI A;  3I5F C;  1JWD A;  2OTG C;  1B47 A;  2Y1N A;  4U8D A;  4GPL B;  2ZKM X;  2M49 B;  1GGW A;  2I18 A;  1SL9 A;  1G8I A;  3FS7 A;  1YUU A;  4M2P A;  3EK8 A;  2KQ6 A;  5D7F A;  1JF0 A;  1NX1 A;  3EK4 A;  3OP0 A;  4ORA B;  1IJ6 A;  4MN0 A;  2CCM A;  1ZFS A;  1QVI Y;  4GGF A;  4I5N B;  3VRO A;  2FJU B;  2BBN A;  1X02 A;  3TUY B;  1BF5 A;  1AK8 A;  1CDM A;  1CNP A;  4MEW A;  4MZL A;  3SG3 A;  1H8B A;  1KSM A;  1Y6W A;  2F33 A;  4MZK A;  4I5J A;  1NX2 A;  3GK1 A;  1JUO A;  2LHL A;  2BCX A;  2O5G A;  1KSO A;  1PSB A;  1Y1A A;  1ALW A;  1J1E A;  3TUY C;  1SPY A;  2LP3 A;  2EHB A;  1FI6 A;  1UHK A;  2JWW A;  3LK0 A;  4GUK A;  3CS1 A;  1ZAC A;  2MBX A;  1C07 A;  4OR9 B;  2WCB A;  4UPG A;  1XK4 C;  1FF1 A;  3VRN A;  1QLK A;  2K7O A;  3TS5 B;  1XVJ A;  5DKR A;  2ZRT A;  1J55 A;  5AER A;  4YI9 A;  3BOW A;  3DF0 A;  3EVU A;  1F70 A;  2Q91 A;  1M45 A;  1RJV A;  3CLN A;  3HCM A;  1YRT B;  4CLN A;  2KNE A;  1BMO A;  1LIN A;  4OKH A;  1F4Q A;  2LLT A;  3TS5 C;  1NYA A;  1F55 A;  1XA5 A;  1PVB A;  1MF8 B;  1TCO B;  1YX8 A;  3K21 A;  1EG4 A;  2F3Y A;  2F8P A;  2P6B B;  1ZOT B;  1TNQ A;  5AAN A;  5CSN A;  1F71 A;  1YUS A;  4YGE B;  1CDL A;  1OE9 B;  1N2D A;  4GGF C;  3CGA A;  1YX7 A;  1XYD A;  4FTG A;  1CFD A;  5CSJ A;  1F54 A;  1QS7 A;  3PAT A;  2WND A;  5I2L A;  3JTD B;  1TNW A;  2M0R A;  1CDP A;  2CXJ A;  2WOS A;  1M63 B;  4NDB A;  4WRI A;  4DS7 A;  2NCO A;  1E8A A;  1R2U A;  2WC8 A;  4MBE A;  1JSA A;  3A8R A;  2NXQ A;  1DJH A;  2L2E A;  2KGR A;  1ZMZ A;  2EGD A;  1GGZ A;  2A4J A;  3JTD C;  1CFC A;  1G4Y R;  2L51 A;  3SG2 A;  1AJ5 A;  1K9P A;  4MZJ A;  3AAK A;  3LL8 B;  5KU1 A;  2LVK A;  3EVV A;  1EG3 A;  1R6P A;  2BKI B;  2Y5I A;  1ZUZ A;  3SIB A;  2MLF C;  1J7Q A;  2PAL A;  1XFV O;  2V53 A;  4JPZ B;  1GJY A;  1EXR A;  2ZND A;  2WCE A;  4GFT A;  2G9B A;  1MQ1 A;  3VRP A;  4MVF A;  2JNX A;  1NCX A;  2L5X B;  1CFF A;  2E30 A;  2LAN A;  1CMG A;  1UHH A;  4P2Y B;  3VGO A;  5HLO A;  2PRU A;  1BR4 B;  1M46 A;  1Q80 A;  1ODB A;  1W7J B;  2FCD A;  3GOF A;  4PDZ A;  5KSZ A;  1BG1 A;  1JFJ A;  1OZS A;  1F8H A;  2LNK A;  3MSE B;  1D1O A;  1DGV A;  2JTT A;  1TOP A;  3C1V A;  4DCK A;  1DGU A;  1OSA A;  1K95 A;  1C7W A;  1BLQ A;  1QX2 A;  1UWO A;  3OHM B;  4CFR A;  1TTX A;  3PSR A;  1JFK A;  2NCP A;  4HSZ A;  2K2A A;  1SR6 B;  2LVV A;  3I5H B;  3BYA A;  1XFX O;  1K94 A;  1XO5 A;  4A4B A;  2H61 A;  1XFW O;  1PAL A;  3ZWH A;  2LMU A;  2BCA A;  2KI4 B;  3KEV A;  1FPW A;  2SCP A;  1Y1X A;  1BR1 B;  2M1U A;  2JQ6 A;  1CB1 A;  1SR6 C;  2LMT A;  2ZRS A;  3I5H C;  3NSL A;  2CNP A;  1SCM B;  3BUN B;  1YRU B;  5FYX A;  2F2P A;  5TNC A;  2M1K B;  3CR5 X;  2HET A;  1WDC B;  1QAS A;  2KYF A;  2MLE C;  4YGA A;  3WHT B;  3EVR A;  2KI4 C;  1CLL A;  1J7R A;  1BJF A;  1SKT A;  2HQW A;  3DD4 A;  1SY9 A;  4L9M A;  1TNP A; 
#chains in the Genus database with same CATH topology
 1GQM A;  1IG5 A;  1YVL A;  3SS3 A;  4QJ5 B;  2JC2 A;  1SCM C;  2M3W A;  1Y0V H;  4A4C A;  3AKA A;  3HX4 A;  5HYD A;  2VRG A;  1S5G Y;  1WDC C;  2KOT A;  2BEC A;  4YI8 A;  2KFH A;  2MA2 A;  1LVC D;  4WQ3 A;  3CZ2 A;  4P5O E;  1B7T Z;  3FWB A;  2JNF A;  1CDN A;  1TUJ A;  1B9A A;  3QME A;  3R1O A;  2Y4Q A;  1BOD A;  1SL7 A;  1IGV A;  2KAV A;  4F0Z B;  2JTZ A;  3OB2 B;  1QXP A;  4MRX A;  4IL1 A;  1KFX S;  2E6W A;  2JT8 A;  1W9Z A;  1PUL A;  1QVI Z;  1RK9 A;  1M31 A;  2LHI A;  3IQQ A;  4ZCU A;  3DYE A;  2JRF A;  1OOH A;  3D74 A;  3B87 A;  2KBI A;  2H61 C;  2G2B A;  3DVM A;  3IQO A;  5GQQ C;  1QIV A;  3TDI A;  2QEV A;  1RWY A;  1KFU L;  3EG5 B;  3LCP C;  2ZN8 A;  4NQG A;  1DT7 B;  5AFP A;  3ICB A;  2PQL A;  1K2H A;  3PM8 A;  4BY5 A;  4PE7 A;  4MLW A;  2PAS A;  1EH2 A;  3DVE A;  2Y1M A;  1G33 A;  1PVA A;  4NDD A;  4E68 A;  1YR5 A;  1LXF C;  1XFZ O;  3DVJ A;  1QTX A;  3BUX B;  1UHI A;  1TWO A;  2F2O A;  1BU3 A;  2LVI A;  1F4O A;  3NGV A;  3EKH A;  4R1E A;  1B8L A;  1OMD A;  2K61 A;  2WCF A;  3CWG A;  3SG6 A;  3O6B A;  2MAZ A;  2ZNE A;  1QJT A;  3CZT X;  3O4Y A;  2L50 A;  1N0Y A;  3M0W A;  2R2I A;  3AAJ A;  3R1V A;  1YUT A;  1S26 D;  2AUC A;  4PT1 A;  1BT6 A;  1C3Z A;  2JPT A;  3F45 A;  4QJ4 B;  3S0B A;  3BOW B;  1RTP 1;  1K90 D;  3DF0 B;  4ZCV A;  3TDU A;  1OOI X;  3NSI A;  1WY9 A;  3SG4 A;  1S6I A;  1L2O B;  1OMR A;  2AMI A;  1OZO A;  4PAL A;  4TNC A;  5HKW A;  3VRQ A;  4OVN F;  1UUS A;  1J1D A;  1NUB A;  3BUM B;  5I2Q A;  1NCZ A;  3FE8 A;  1TN4 A;  2HF5 A;  2KGB C;  3SS4 A;  1Z4H A;  2OS8 B;  3D10 A;  1WRK A;  5EL2 A;  1L2O C;  1A4P A;  2EC6 B;  4JWQ A;  4N1F A;  4M2Q A;  3EKJ A;  2K7C A;  3BJH A;  1MUX A;  1LA3 A;  4INW A;  1NWD A;  2WC6 A;  2K0J A;  1TIZ A;  2NZ0 A;  3D73 A;  3PAL A;  3QRX A;  1OOJ A;  2OS8 C;  4INX A;  1A2X A;  1YVH A;  1P28 A;  1KK7 Z;  1A75 A;  1EJ3 A;  1KQM B;  2EC6 C;  1K96 A;  2PVB A;  4PHM A;  3FIA A;  3WHU B;  1IWQ A;  4PE4 A;  1AJ4 A;  2LLS A;  1UHJ A;  1B1G A;  4M2O A;  1IQ3 A;  1OQP A;  2PSR A;  1QV1 A;  2FCE A;  3GK2 A;  1AUI B;  1TNX A;  4PHK A;  1CTR A;  4CPV A;  2M9G A;  2KSP A;  2LMV A;  3GK4 X;  3LLE A;  5CSF A;  1KQM C;  4DUQ A;  3KHE A;  5JOL A;  2L98 A;  5BPJ A;  3K1E A;  1SCV A;  1DF0 A;  5KTY A;  1HQV A;  1PRW A;  4C0J A;  2LUC A;  1FBV A;  3FWC A;  1BOC A;  4HRE E;  5FI6 A;  2QAC A;  2JT0 A;  4JQ0 D;  5K89 A;  2L0P A;  3BFH A;  2LVJ A;  2BL0 B;  1L7Z A;  2H8V A;  4YBH B;  1CMF A;  1S6J A;  2KQY A;  3NSK A;  1WLZ A;  3KF9 A;  4PHN A;  3S0D A;  1JBA A;  1FI5 A;  1NP8 A;  4OCI A;  2IS9 A;  4WQ2 A;  1DC1 A;  2GGZ A;  3EK7 A;  1S3P A;  2QPT A;  2F3Z A;  1QX5 B;  1TCF A;  1YTZ C;  2L4H A;  2I2R E;  2BL0 C;  1RFJ A;  3NHT A;  2KI6 D;  1C7V A;  1REC A;  2L5Y A;  5J3X A;  4YGD B;  1N65 A;  1SW8 A;  3CYZ A;  2KFF A;  2MHH A;  3KPX A;  4I5L B;  3BXK A;  1NX0 A;  2ZN9 A;  4PCW A;  2QEO A;  5DKN A;  4N5X A;  1AP4 A;  1XK4 A;  2CTN A;  3DVK A;  4C0K A;  2LE9 B;  1OW4 A;  4ORB B;  1IKU A;  2BKH B;  1Z2C B;  2O60 A;  5HKZ A;  2L2C A;  2LUX A;  1DMO A;  1DJI A;  1NSH A;  2BCB A;  1DF0 B;  5I2O A;  1QWV A;  2KBM A;  2GV5 A;  3I5I B;  2I94 A;  4ICB A;  1IRJ A;  3UNW A;  3WNX B;  1KFU S;  3NSO A;  4HRH A;  2FJY A;  2JXL A;  2BBM A;  1V1F A;  1B7T Y;  1IQ5 A;  3CTN A;  1SK6 D;  2KYC A;  3PFV A;  1DJG A;  1JF2 A;  1NCY A;  5DKQ A;  3I5G B;  1S6C A;  3AKB A;  4DRW A;  3I5I C;  3OB1 B;  4OV2 A;  1QIW A;  2WCJ A;  2K7D A;  1S36 A;  4I5K A;  4GAO A;  1U5I A;  1DVI A;  1S5G Z;  2M8U A;  1H4B A;  3I5G C;  3PLF B;  3PN7 B;  2H2K A;  3VB1 A;  1CKK A;  4N1G A;  1PK0 D;  1V1G A;  5D3O A;  5DIC A;  3B6X A;  2BNX A;  2LV7 A;  4JKT A;  3N7H A;  1XFY O;  3TDZ A;  3SIA A;  2M97 A;  4CFQ A;  2COL B;  5AXI A;  3SJS A;  1PSR A;  2DOQ A;  1CLM A;  5ER4 X;  5HKY A;  5JJG A;  1SYM A;  3PN7 C;  3BUO B;  4Q04 A;  4CID A;  1B8C A;  1YUR A;  1KQV A;  4XJK A;  1NIW A;  4YGB B;  1J7O A;  1JC2 A;  1AHR A;  2MJW B;  1M39 A;  1MWN A;  4JD9 A;  2M7N A;  3BQ3 A;  3DY9 A;  1CM4 A;  1EL4 A;  4AOM A;  2KAX A;  1K9U A;  1KK8 B;  5PAL A;  1J7P A;  4YRU A;  2KAY A;  1ORG A;  1DJW A;  1QAT A;  1S1E A;  3ZNI A;  1IIO A;  1B4C A;  4GNK B;  1SNL A;  1WLM A;  3OGN A;  3SG5 A;  1U5I B;  3OX6 A;  3IF7 A;  1KFX L;  2NLN A;  4PE1 A;  2K8M B;  4HRG A;  3RLZ A;  1QX7 A;  1UHN A;  3R72 A;  1K8U A;  5B8I B;  1KK8 C;  3O2P A;  2WCK A;  1IJ5 A;  1SMG A;  2K60 A;  3O78 A;  1DJY A;  1RRO A;  1K93 D;  4DIR A;  1W7I B;  5CSI A;  1K9K A;  5HLV A;  1AVS A;  2D8N A;  2MRD A;  3BUW B;  2K2F A;  1OMV A;  3B7A A;  1NPQ A;  2LC5 A;  1IH0 A;  5AEQ A;  3DXL A;  2M7L A;  1CLB A;  1SBJ A;  1NX3 A;  1DJZ A;  2CBL A;  2JXC A;  2KI6 C;  2LM5 A;  2QEH A;  3TZ1 A;  1GM0 A;  2JPO A;  4QJ3 B;  2ISD A;  3RM1 A;  1Y1U A;  4XJK B;  2LLU A;  3LK1 A;  2JU0 A;  3FE9 A;  1OOG A;  1MXE A;  2HQ8 A;  2JUL A;  3D0Y A;  4FQO A;  4USL A;  1HT9 A;  2LP2 A;  2Q4U A;  4ETO A;  3L4L A;  2JT3 A;  3H4S E;  2OPO A;  1B8R A;  1VRK A;  4PHJ A;  1XFU O;  2LCP A;  2ZFD A;  4NDC A;  3DZT A;  3VRR A;  1KK7 Y;  3SG7 A;  4XYN A;  2GGM A;  1A03 A;  3OX5 A;  2KDH A;  3D78 A;  3E3R A;  3CR2 A;  1DEK A;  4AQJ A;  2K7B A;  3Q8I A;  2ERB A;  2JZI A;  2KHN A;  3R1P A;  2LAP A;  3CZ0 A;  4GBA A;  3SS5 A;  4C0L A;  2B1U A;  4AQI A;  1UP5 A;  2P70 A;  2L4I A;  1MXL C;  2BE4 A;  1QV0 A;  2PMY A;  3KO0 A;  4D1E A;  1A29 A;  1QLS A;  2JOJ A;  2I7A A;  5CPV A;  1FW4 A;  1WRL A;  4MRY A;  3D77 A;  1ALV A;  2HPS A;  2TN4 A;  3O4X A;  3PM2 A;  2SAS A;  1MHO A;  5ER5 A;  4MSP A;  1KCY A;  3D0Y B;  1SL8 A;  1KWO B;  3JVT B;  3NXA A;  1LA0 A;  1CFP A;  2KFG A;  2CT9 A;  2WCM A;  4ORC B;  2BAP A;  3UO9 A;  3V2L A;  1A75 B;  1WRZ A;  4PE0 A;  3CR4 X;  3I5F B;  2AAO A;  3A4U B;  2OTG B;  1DJX A;  5IBW A;  5I8N A;  3S0G A;  1TUZ A;  4BY4 A;  5D69 A;  1CM1 A;  2WOR A;  1KWO C;  3JVT C;  1LKJ A;  5F6T A;  5G08 A;  3B88 A;  1SRA A;  2BE6 A;  3B86 A;  5I94 A;  1UUR A;  4YGC B;  1MR8 A;  3WXA A;  2KPH A;  1DTL A;  2FOT A;  2M29 A;  4GGN A;  1TRF A;  2RGI A;  3I5F C;  1JWD A;  2OTG C;  1B47 A;  2Y1N A;  4FQT A;  4U8D A;  4IJ7 A;  4GPL B;  2ZKM X;  2M49 B;  1GGW A;  2I18 A;  1SL9 A;  1G8I A;  3FS7 A;  3D76 A;  1YUU A;  2KLE A;  4M2P A;  3EK8 A;  2KQ6 A;  5D7F A;  1JF0 A;  1OOF A;  1NX1 A;  3EK4 A;  3OP0 A;  5FI2 A;  4ORA B;  1IJ6 A;  4MN0 A;  2CCM A;  3RZS A;  1ZFS A;  1QVI Y;  4GGF A;  4I5N B;  3VRO A;  2FJU B;  2BBN A;  1X02 A;  3S0F A;  3TUY B;  1BF5 A;  1AK8 A;  1CDM A;  1CNP A;  4MEW A;  4MZL A;  3SG3 A;  1H8B A;  1KSM A;  1SSE B;  1Y6W A;  2F33 A;  4MZK A;  4I5J A;  1NX2 A;  3GK1 A;  3CDN A;  1JUO A;  2LHL A;  1C3Y A;  3NHI A;  2BCX A;  2O5G A;  1KSO A;  1PSB A;  1Y1A A;  1ALW A;  1J1E A;  2YGU A;  1SPY A;  3S0A A;  3TUY C;  2LP3 A;  2EHB A;  1FI6 A;  1UHK A;  2JWW A;  3LK0 A;  4GUK A;  3CS1 A;  1ZAC A;  2MBX A;  3L47 A;  1C07 A;  4OR9 B;  2WCB A;  4UPG A;  1XK4 C;  1FF1 A;  5FI7 A;  3VRN A;  1QLK A;  3IVT A;  2K7O A;  3TS5 B;  1XVJ A;  5DKR A;  2ZRT A;  1J55 A;  5AER A;  4YI9 A;  3BOW A;  3DF0 A;  3EVU A;  4KYN A;  1F70 A;  2Q91 A;  1M45 A;  1RJV A;  3CLN A;  3HCM A;  1YRT B;  4CLN A;  2KNE A;  1BMO A;  1LIN A;  4OKH A;  1F4Q A;  2LLT A;  3BFA A;  3TS5 C;  1NYA A;  1F55 A;  1XA5 A;  1PVB A;  1MF8 B;  1TCO B;  1YX8 A;  3K21 A;  1EG4 A;  2F3Y A;  2F8P A;  2P6B B;  3BFB A;  1ZOT B;  1TNQ A;  5AAN A;  5HL1 A;  5CSN A;  1F71 A;  1YUS A;  4YGE B;  1CDL A;  1OE9 B;  1N2D A;  4GGF C;  3CGA A;  1YX7 A;  1XYD A;  4FTG A;  1CFD A;  5CSJ A;  1F54 A;  1QS7 A;  3PAT A;  2WND A;  5I2L A;  3JTD B;  1TNW A;  2M0R A;  1CDP A;  4F7F A;  2CXJ A;  2WOS A;  1M63 B;  4NDB A;  4WRI A;  4DS7 A;  2NCO A;  1E8A A;  1R2U A;  2WC8 A;  4MBE A;  1JSA A;  3A8R A;  2NXQ A;  1DJH A;  2L2E A;  2KGR A;  1ZMZ A;  2EGD A;  1GGZ A;  2A4J A;  3JTD C;  1CFC A;  1G4Y R;  2L51 A;  3SG2 A;  1AJ5 A;  1K9P A;  4MZJ A;  3AAK A;  3LL8 B;  5KU1 A;  2LVK A;  3OBV A;  3EVV A;  1EG3 A;  1R6P A;  2BKI B;  2Y5I A;  1ZUZ A;  3SIB A;  2MLF C;  1J7Q A;  2PAL A;  1XFV O;  2V53 A;  4JPZ B;  1GJY A;  1EXR A;  2PYQ A;  2ZND A;  2WCE A;  4GFT A;  2G9B A;  1MQ1 A;  3VRP A;  4MVF A;  2JNX A;  1NCX A;  2L5X B;  1CFF A;  2E30 A;  2LAN A;  1CMG A;  1UHH A;  2QDI A;  2GTE A;  4P2Y B;  3VGO A;  5HLO A;  2PRU A;  1T14 A;  1BR4 B;  1M46 A;  1Q80 A;  1ODB A;  1W7J B;  2FCD A;  3GOF A;  4PDZ A;  5KSZ A;  1BG1 A;  1JFJ A;  1OZS A;  3PJI A;  1F8H A;  2LNK A;  3MSE B;  1D1O A;  1DGV A;  2JTT A;  1TOP A;  3CZ1 A;  3S0E A;  3C1V A;  4DCK A;  2WCH A;  1DGU A;  1OSA A;  1K95 A;  1C7W A;  4OZD A;  1QX2 A;  1BLQ A;  1UWO A;  2P71 A;  3OHM B;  4CFR A;  1XFR A;  1TTX A;  3PSR A;  1JFK A;  1LS8 A;  2WCL A;  2NCP A;  3FE6 A;  4HSZ A;  3CAB A;  2K2A A;  1SR6 B;  2LVV A;  3I5H B;  3BYA A;  1XFX O;  1K94 A;  1XO5 A;  4A4B A;  2H61 A;  1XFW O;  1PAL A;  3ZWH A;  2LMU A;  2BCA A;  2KI4 B;  3KEV A;  1FPW A;  2SCP A;  1Y1X A;  1BR1 B;  2M1U A;  1DQE A;  2JQ6 A;  1CB1 A;  1SR6 C;  2LMT A;  2ZRS A;  3I5H C;  2WC5 A;  3NSL A;  2CNP A;  1SCM B;  3BUN B;  1YRU B;  3D75 A;  5FYX A;  2F2P A;  5TNC A;  2M1K B;  3CR5 X;  2HET A;  1WDC B;  1QAS A;  2KYF A;  2MLE C;  4YGA A;  3WHT B;  2QEB A;  2KI4 C;  1CLL A;  1J7R A;  3EVR A;  1BJF A;  1DEL A;  1SKT A;  2HQW A;  3L4A A;  3DD4 A;  2KLD A;  1SY9 A;  4L9M A;  1TNP A; 
#chains in the Genus database with same CATH homology
 1GQM A;  1IG5 A;  1YVL A;  4QJ5 B;  2JC2 A;  1SCM C;  2M3W A;  1Y0V H;  4A4C A;  3AKA A;  3HX4 A;  5HYD A;  2VRG A;  1S5G Y;  1WDC C;  2KOT A;  2BEC A;  4YI8 A;  2KFH A;  2MA2 A;  1LVC D;  4WQ3 A;  4P5O E;  1B7T Z;  3FWB A;  2JNF A;  1CDN A;  1B9A A;  1BOD A;  2Y4Q A;  1SL7 A;  1IGV A;  2KAV A;  4F0Z B;  2JTZ A;  3OB2 B;  1QXP A;  4MRX A;  4IL1 A;  1KFX S;  2E6W A;  2JT8 A;  1PUL A;  1QVI Z;  1RK9 A;  1M31 A;  2LHI A;  3IQQ A;  4ZCU A;  2JRF A;  2KBI A;  2H61 C;  2G2B A;  3DVM A;  3IQO A;  5GQQ C;  1QIV A;  3TDI A;  1RWY A;  1KFU L;  3LCP C;  4NQG A;  2ZN8 A;  1DT7 B;  5AFP A;  3ICB A;  1K2H A;  3PM8 A;  4BY5 A;  4PE7 A;  4MLW A;  2PAS A;  1EH2 A;  3DVE A;  2Y1M A;  1G33 A;  1PVA A;  4NDD A;  4E68 A;  1YR5 A;  1LXF C;  1XFZ O;  3DVJ A;  1QTX A;  3BUX B;  1UHI A;  2F2O A;  1BU3 A;  2LVI A;  1F4O A;  4R1E A;  3EKH A;  1B8L A;  1OMD A;  2K61 A;  2WCF A;  3CWG A;  3SG6 A;  3O6B A;  2MAZ A;  2ZNE A;  1QJT A;  3CZT X;  3O4Y A;  2L50 A;  1N0Y A;  3M0W A;  2R2I A;  3AAJ A;  1YUT A;  1S26 D;  2AUC A;  1BT6 A;  2JPT A;  3F45 A;  4QJ4 B;  3BOW B;  1RTP 1;  1K90 D;  3DF0 B;  4ZCV A;  3TDU A;  3NSI A;  1WY9 A;  3SG4 A;  1S6I A;  1L2O B;  1OMR A;  2AMI A;  1OZO A;  4PAL A;  4TNC A;  5HKW A;  3VRQ A;  4OVN F;  1UUS A;  1J1D A;  1NUB A;  3BUM B;  5I2Q A;  1NCZ A;  1TN4 A;  2HF5 A;  2KGB C;  2OS8 B;  3D10 A;  1WRK A;  1L2O C;  1A4P A;  2EC6 B;  4JWQ A;  4N1F A;  4M2Q A;  3EKJ A;  2K7C A;  1MUX A;  1LA3 A;  1NWD A;  2K0J A;  1TIZ A;  2NZ0 A;  3PAL A;  3QRX A;  1OOJ A;  2OS8 C;  1A2X A;  1YVH A;  1KK7 Z;  1A75 A;  1EJ3 A;  1KQM B;  2EC6 C;  1K96 A;  2PVB A;  4PHM A;  3FIA A;  3WHU B;  1IWQ A;  4PE4 A;  1AJ4 A;  2LLS A;  1UHJ A;  1B1G A;  4M2O A;  1IQ3 A;  1OQP A;  2PSR A;  1QV1 A;  2FCE A;  3GK2 A;  1AUI B;  1TNX A;  4PHK A;  1CTR A;  4CPV A;  2M9G A;  2KSP A;  2LMV A;  3GK4 X;  3LLE A;  5CSF A;  1KQM C;  4DUQ A;  3KHE A;  5JOL A;  2L98 A;  5BPJ A;  1SCV A;  1DF0 A;  5KTY A;  1HQV A;  1PRW A;  4C0J A;  2LUC A;  1FBV A;  3FWC A;  1BOC A;  4HRE E;  2QAC A;  2JT0 A;  4JQ0 D;  5K89 A;  2L0P A;  2LVJ A;  2BL0 B;  1L7Z A;  4YBH B;  1CMF A;  1S6J A;  2KQY A;  3NSK A;  1WLZ A;  3KF9 A;  4PHN A;  1JBA A;  1FI5 A;  1NP8 A;  4OCI A;  2IS9 A;  4WQ2 A;  2GGZ A;  3EK7 A;  1S3P A;  2QPT A;  2F3Z A;  1QX5 B;  1TCF A;  1YTZ C;  2L4H A;  2I2R E;  2BL0 C;  1RFJ A;  1C7V A;  2KI6 D;  1REC A;  5J3X A;  4YGD B;  1N65 A;  1SW8 A;  2KFF A;  2MHH A;  3KPX A;  4I5L B;  3BXK A;  1NX0 A;  2ZN9 A;  4PCW A;  5DKN A;  4N5X A;  1AP4 A;  1XK4 A;  2CTN A;  3DVK A;  4C0K A;  2LE9 B;  1IKU A;  4ORB B;  2BKH B;  2O60 A;  5HKZ A;  1DMO A;  2LUX A;  1DJI A;  1NSH A;  2BCB A;  1DF0 B;  5I2O A;  2KBM A;  2GV5 A;  3I5I B;  2I94 A;  4ICB A;  1IRJ A;  3WNX B;  1KFU S;  3NSO A;  4HRH A;  2JXL A;  2BBM A;  1V1F A;  1B7T Y;  1IQ5 A;  3CTN A;  1SK6 D;  2KYC A;  3PFV A;  1DJG A;  1JF2 A;  1NCY A;  5DKQ A;  3I5G B;  1S6C A;  3AKB A;  4DRW A;  3I5I C;  3OB1 B;  4OV2 A;  1QIW A;  2K7D A;  1S36 A;  4I5K A;  4GAO A;  1U5I A;  1DVI A;  1S5G Z;  2M8U A;  1H4B A;  3I5G C;  3PLF B;  3PN7 B;  2H2K A;  1CKK A;  4N1G A;  1PK0 D;  1V1G A;  2LV7 A;  1XFY O;  3TDZ A;  3SIA A;  2M97 A;  4CFQ A;  2COL B;  5AXI A;  3SJS A;  1PSR A;  2DOQ A;  1CLM A;  5ER4 X;  5HKY A;  5JJG A;  1SYM A;  3PN7 C;  3BUO B;  4Q04 A;  4CID A;  1B8C A;  1YUR A;  1KQV A;  4XJK A;  1NIW A;  4YGB B;  1J7O A;  1JC2 A;  1AHR A;  2MJW B;  1M39 A;  1MWN A;  2M7N A;  3BQ3 A;  1CM4 A;  1EL4 A;  4AOM A;  2KAX A;  1K9U A;  1KK8 B;  5PAL A;  1J7P A;  4YRU A;  2KAY A;  1DJW A;  1QAT A;  1S1E A;  3ZNI A;  1B4C A;  4GNK B;  1SNL A;  1WLM A;  3SG5 A;  1U5I B;  3OX6 A;  3IF7 A;  1KFX L;  2NLN A;  4PE1 A;  2K8M B;  4HRG A;  3RLZ A;  1QX7 A;  1UHN A;  1K8U A;  5B8I B;  1KK8 C;  3O2P A;  1IJ5 A;  1SMG A;  3O78 A;  1DJY A;  1RRO A;  1K93 D;  4DIR A;  1W7I B;  5CSI A;  1K9K A;  5HLV A;  1AVS A;  2D8N A;  2MRD A;  3BUW B;  2K2F A;  1OMV A;  1NPQ A;  2LC5 A;  1IH0 A;  5AEQ A;  2M7L A;  1CLB A;  1SBJ A;  1NX3 A;  1DJZ A;  2CBL A;  2JXC A;  2KI6 C;  2LM5 A;  3TZ1 A;  4QJ3 B;  2ISD A;  3RM1 A;  1Y1U A;  4XJK B;  2LLU A;  3LK1 A;  2JU0 A;  1MXE A;  2HQ8 A;  2JUL A;  3D0Y A;  4FQO A;  4USL A;  1HT9 A;  2LP2 A;  2Q4U A;  4ETO A;  2JT3 A;  3H4S E;  2OPO A;  1B8R A;  1VRK A;  4PHJ A;  1XFU O;  2LCP A;  2ZFD A;  4NDC A;  3VRR A;  1KK7 Y;  3SG7 A;  4XYN A;  2GGM A;  1A03 A;  3OX5 A;  2KDH A;  3E3R A;  3CR2 A;  4AQJ A;  2K7B A;  2JZI A;  4C0L A;  2KHN A;  4GBA A;  2LAP A;  2B1U A;  4AQI A;  1UP5 A;  2L4I A;  1MXL C;  2BE4 A;  1QV0 A;  2PMY A;  3KO0 A;  4D1E A;  1A29 A;  1QLS A;  2JOJ A;  2I7A A;  5CPV A;  1FW4 A;  1WRL A;  4MRY A;  1ALV A;  2HPS A;  2TN4 A;  2SAS A;  1MHO A;  5ER5 A;  4MSP A;  1KCY A;  3D0Y B;  1SL8 A;  1KWO B;  3JVT B;  3NXA A;  1LA0 A;  1CFP A;  2KFG A;  2CT9 A;  4ORC B;  1A75 B;  1WRZ A;  4PE0 A;  3CR4 X;  3I5F B;  2AAO A;  3A4U B;  2OTG B;  1DJX A;  5IBW A;  5I8N A;  4BY4 A;  5D69 A;  1CM1 A;  2WOR A;  1KWO C;  3JVT C;  1LKJ A;  5F6T A;  5G08 A;  1SRA A;  2BE6 A;  1UUR A;  4YGC B;  1MR8 A;  3WXA A;  1DTL A;  2FOT A;  2M29 A;  4GGN A;  1TRF A;  2RGI A;  3I5F C;  1JWD A;  2OTG C;  1B47 A;  2Y1N A;  4U8D A;  4GPL B;  2ZKM X;  2M49 B;  1GGW A;  2I18 A;  1SL9 A;  1G8I A;  3FS7 A;  1YUU A;  4M2P A;  3EK8 A;  2KQ6 A;  5D7F A;  1JF0 A;  1NX1 A;  3EK4 A;  3OP0 A;  4ORA B;  1IJ6 A;  4MN0 A;  2CCM A;  1ZFS A;  1QVI Y;  4GGF A;  4I5N B;  3VRO A;  2FJU B;  2BBN A;  1X02 A;  3TUY B;  1BF5 A;  1AK8 A;  1CDM A;  1CNP A;  4MEW A;  4MZL A;  3SG3 A;  1H8B A;  1KSM A;  1Y6W A;  2F33 A;  4MZK A;  4I5J A;  1NX2 A;  3GK1 A;  1JUO A;  2LHL A;  2BCX A;  2O5G A;  1KSO A;  1PSB A;  1Y1A A;  1ALW A;  1J1E A;  3TUY C;  1SPY A;  2LP3 A;  2EHB A;  1FI6 A;  1UHK A;  2JWW A;  3LK0 A;  4GUK A;  3CS1 A;  1ZAC A;  2MBX A;  1C07 A;  4OR9 B;  2WCB A;  4UPG A;  1XK4 C;  1FF1 A;  3VRN A;  1QLK A;  2K7O A;  3TS5 B;  1XVJ A;  5DKR A;  2ZRT A;  1J55 A;  5AER A;  4YI9 A;  3BOW A;  3DF0 A;  3EVU A;  1F70 A;  2Q91 A;  1M45 A;  1RJV A;  3CLN A;  3HCM A;  1YRT B;  4CLN A;  2KNE A;  1BMO A;  1LIN A;  4OKH A;  1F4Q A;  2LLT A;  3TS5 C;  1NYA A;  1F55 A;  1XA5 A;  1PVB A;  1MF8 B;  1TCO B;  1YX8 A;  3K21 A;  1EG4 A;  2F3Y A;  2F8P A;  2P6B B;  1ZOT B;  1TNQ A;  5AAN A;  5CSN A;  1F71 A;  1YUS A;  4YGE B;  1CDL A;  1OE9 B;  1N2D A;  4GGF C;  3CGA A;  1YX7 A;  1XYD A;  4FTG A;  1CFD A;  5CSJ A;  1F54 A;  1QS7 A;  3PAT A;  2WND A;  5I2L A;  3JTD B;  1TNW A;  2M0R A;  1CDP A;  2CXJ A;  2WOS A;  1M63 B;  4NDB A;  4WRI A;  4DS7 A;  2NCO A;  1E8A A;  1R2U A;  2WC8 A;  4MBE A;  1JSA A;  3A8R A;  2NXQ A;  1DJH A;  2L2E A;  2KGR A;  1ZMZ A;  2EGD A;  1GGZ A;  2A4J A;  3JTD C;  1CFC A;  1G4Y R;  2L51 A;  3SG2 A;  1AJ5 A;  1K9P A;  4MZJ A;  3AAK A;  3LL8 B;  5KU1 A;  2LVK A;  3EVV A;  1EG3 A;  1R6P A;  2BKI B;  2Y5I A;  1ZUZ A;  3SIB A;  2MLF C;  1J7Q A;  2PAL A;  1XFV O;  2V53 A;  4JPZ B;  1GJY A;  1EXR A;  2ZND A;  2WCE A;  4GFT A;  2G9B A;  1MQ1 A;  3VRP A;  4MVF A;  2JNX A;  1NCX A;  2L5X B;  1CFF A;  2E30 A;  2LAN A;  1CMG A;  1UHH A;  4P2Y B;  3VGO A;  5HLO A;  2PRU A;  1BR4 B;  1M46 A;  1Q80 A;  1ODB A;  1W7J B;  2FCD A;  3GOF A;  4PDZ A;  5KSZ A;  1BG1 A;  1JFJ A;  1OZS A;  1F8H A;  2LNK A;  3MSE B;  1D1O A;  1DGV A;  2JTT A;  1TOP A;  3C1V A;  4DCK A;  1DGU A;  1OSA A;  1K95 A;  1C7W A;  1BLQ A;  1QX2 A;  1UWO A;  3OHM B;  4CFR A;  1TTX A;  3PSR A;  1JFK A;  2NCP A;  4HSZ A;  2K2A A;  1SR6 B;  2LVV A;  3I5H B;  3BYA A;  1XFX O;  1K94 A;  1XO5 A;  4A4B A;  2H61 A;  1XFW O;  1PAL A;  3ZWH A;  2LMU A;  2BCA A;  2KI4 B;  3KEV A;  1FPW A;  2SCP A;  1Y1X A;  1BR1 B;  2M1U A;  2JQ6 A;  1CB1 A;  1SR6 C;  2LMT A;  2ZRS A;  3I5H C;  3NSL A;  2CNP A;  1SCM B;  3BUN B;  1YRU B;  5FYX A;  2F2P A;  5TNC A;  2M1K B;  3CR5 X;  2HET A;  1WDC B;  1QAS A;  2KYF A;  2MLE C;  4YGA A;  3WHT B;  3EVR A;  2KI4 C;  1CLL A;  1J7R A;  1BJF A;  1SKT A;  2HQW A;  3DD4 A;  1SY9 A;  4L9M A;  1TNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...