1F55A

Solution structure of the calcium bound n-terminal domain of yeast calmodulin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN
publication title Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f55A00
2LUCA 1QASA 4GUKA 5I8NA 1S6CA 5FYXA 4MN0A 2KAVA 3D10A 2FOTA 2KOTA 3LLEA 1WDCB 2GV5A 1DGVA 5CSNA 1KSOA 5CSFA 3ICBA 4PE7A 4L9MA 4N1GA 2MBXA 2BE6A 2KAYA 2JC2A 4A4BA 4QJ4B 1SR6C 4N5XA 1XFZO 3TDIA 1MR8A 4PDZA 3JTDC 1BG1A 2PASA 4GAOA 2L2EA 4GGFA 1G33A 2FCEA 1BU3A 2G2BA 2LCPA 2WORA 1B4CA 1PVAA 1BMOA 3TUYC 1MQ1A 1NYAA 3HX4A 1TTXA 1F4OA 2NCPA 3C1VA 3OX6A 3TZ1A 1CFFA 2I7AA 2CXJA 1KWOB 3PN7C 1JC2A 3M0WA 1MUXA 2KBMA 5HKZA 4PHKA 1A75B 4C0KA 4YGCB 2KYFA 4M2OA 3AAKA 3FIAA 2PALA 1KK8B 1RTP1 2M49B 1GJYA 4YGDB 1KSMA 4GGFC 4ORBB 2Q91A 2HPSA 1Y6WA 1NX2A 1YUTA 3K21A 2WCBA 4M2QA 3WNXB 1JWDA 1SNLA 1J1DA 1FPWA 1WLMA 4I5KA 1B1GA 1N0YA 4XYNA 1DJXA 1OZOA 3GK1A 4TNCA 1SCVA 1XFWO 5KU1A 2MJWB 4MRYA 5BPJA 2P6BB 5ER4X 1KK7Y 1XK4C 1FI5A 5I2QA 3SG6A 4DS7A 1EG3A 2LLSA 1BF5A 2QACA 4OVNF 1BT6A 5D69A 2L5XB 2KGRA 4C0LA 4A4CA 1EJ3A 2JNFA 5DKNA 1WDCC 1BLQA 1NUBA 1IWQA 1PRWA 1SYMA 3NSOA 1KQMB 1SW8A 1ZUZA 2K0JA 2LE9B 4JPZB 4Q04A 1C7VA 4GGNA 2L4HA 1B47A 4WQ3A 4YI8A 2BBMA 5DKRA 4ICBA 1K9UA 2NLNA 4ZCUA 1SL8A 2KI6D 1B7TZ 4I5LB 1ZFSA 3OP0A 3DF0B 2KSPA 1AJ4A 4I5NB 1NPQA 2KI4B 1PALA 1PSBA 2RGIA 3VRRA 2MLEC 1SL9A 1UHJA 1K95A 2BL0B 1J7RA 3D0YB 4XJKB 1CMGA 1CM1A 1KWOC 1RJVA 3JVTB 1DJIA 4D1EA 1M39A 4M2PA 1RWYA 3PM8A 1A2XA 1S5GY 1ZMZA 5KSZA 2WCEA 1KK8C 2LMUA 1PK0D 2LP2A 1E8AA 5HKYA 1YTZC 4PE4A 3QRXA 1CFCA 2LUXA 1CM4A 2M9GA 2GGMA 1OOJA 1OE9B 1CB1A 2MHHA 1JFKA 2K7BA 3WHUB 3CLNA 1K9PA 1UWOA 3EK4A 4N1FA 2Q4UA 4QJ3B 1QJTA 1TIZA 2JOJA 1R6PA 4UPGA 1Q80A 1NCZA 2CT9A 4MZKA 2BCXA 2V53A 4OCIA 4PHNA 2F2OA 2H2KA 4GPLB 2KGBC 5G08A 1MF8B 1XFVO 1QVIY 1S36A 1SBJA 2M7LA 2HQ8A 3GOFA 1XFYO 4PE0A 2CNPA 1IRJA 3DF0A 1TOPA 3VGOA 2K61A 3CGAA 1NX3A 3PALA 4JQ0D 1XFUO 1G8IA 2K7DA 1KQMC 3D0YA 4XJKA 2KBIA 2L51A 4GFTA 2BECA 4NQGA 1CLBA 2ZNDA 1QV0A 3FWBA 1YVHA 2QPTA 4P2YB 4YGBB 3VRNA 1DJZA 1EL4A 4PHMA 1JSAA 2BKIB 5J3XA 2LHLA 1GGZA 2KI4C 2JU0A 3A4UB 1GQMA 1J7PA 1Y1UA 2BL0C 3PFVA 1TCOB 4DRWA 4F0ZB 1LKJA 1JBAA 1JF0A 3JVTC 5AXIA 1JF2A 3CR5X 5DKQA 1J1EA 3CR2A 1KCYA 2OTGB 1DJGA 1YVLA 1MHOA 2WC8A 3TDUA 1ODBA 2F8PA 2M97A 2IS9A 2KI6C 1B8CA 4OV2A 1LA3A 2Y5IA 1B8RA 1NP8A 2M1KB 4E68A 5D7FA 1TNQA 1F4QA 3RLZA 3TS5B 2BBNA 2AAOA 1PSRA 2O60A 4YI9A 2JZIA 2PVBA 2ZKMX 3FWCA 1A29A 1RK9A 4AQIA 1N2DA 1NSHA 3HCMA 1WRZA 2M7NA 3GK2A 3LCPC 1SCMB 1NIWA 1QXPA 1U5IA 2M8UA 2EC6B 1S6IA 1L2OB 2B1UA 1S3PA 2JNXA 3BOWB 1EH2A 4ETOA 1K93D 3WHTB 3OB1B 1TRFA 2JRFA 1YR5A 2E6WA 2M0RA 1AP4A 1QS7A 2JXCA 4DCKA 1XVJA 3I5FB 1K94A 2WNDA 5CSJA 4GBAA 2M1UA 1OZSA 4ZCVA 1QATA 2LNKA 1W7JB 5AEQA 4HRHA 2EGDA 4DIRA 1IJ6A 1JUOA 4MLWA 5IBWA 1C07A 1YUUA 2OTGC 1FI6A 1X02A 1OSAA 4NDCA 2TN4A 1QIWA 1OMRA 2JT8A 4PHJA 1MWNA 1CLLA 1UHIA 4MRXA 3FS7A 2PRUA 4FQOA 1PVBA 1LINA 2L0PA 3OB2B 2LMVA 5HKWA 2K2FA 2BE4A 3KHEA 3TS5C 1QX5B 2JTZA 2LVIA 3I5HB 2KFGA 2K7OA 2LMTA 2MAZA 3BOWA 1YX8A 1DGUA 1SL7A 4YRUA 1RECA 1UUSA 1B7TY 2AUCA 1CDPA 5AANA 1L7ZA 1UHNA 1FBVA 5HLOA 1YRTB 1TNXA 1EXRA 1F54A 1SCMC 1WRKA 3OX5A 4ORCB 2EC6C 1UHKA 1L2OC 2ZN9A 1AUIB 4IL1A 2BKHB 3EK8A 2KYCA 3OHMB 1C7WA 3KF9A 4CIDA 2WOSA 1DJYA 4AQJA 1CDMA 3O2PA 2LC5A 3F45A 3I5FC 1Y0VH 5JJGA 1V1GA 1J7QA 1XO5A 1IQ5A 1R2UA 2M29A 2CTNA 1XFXO 3IF7A 1MXEA 2F2PA 4WQ2A 1IJ5A 1EG4A 3O78A 2K2AA 1B9AA 3BYAA 2LHIA 3EVVA 1M63B 1DJWA 1WRLA 1DTLA 3GK4X 1XA5A 3AKAA 5JOLA 1FF1A 5KTYA 3SG3A 2MRDA 3DD4A 1RFJA 1DMOA 1F8HA 5CSIA 1IH0A 1UURA 2L98A 2KNEA 3I5HC 3CZTX 1U5IB 3WXAA 3ZWHA 1KFUL 2JWWA 1QV1A 1QLSA 1D1OA 1OMVA 1AK8A 1XYDA 5F6TA 3SIBA 1KFUS 1S26D 1QIVA 3MSEB 3BUNB 4YBHB 5PALA 1J7OA 2I2RE 1H8BA 4HSZA 5CPVA 1CKKA 2M3WA 2ZNEA 2OS8C 5HLVA 5AFPA 2FJUB 1NX0A 4MSPA 4NDDA 2KFHA 1K90D 2ZFDA 1YX7A 1PULA 1M45A 2LM5A 1ZOTB 2NZ0A 2EHBA 1TNPA 2G9BA 2PSRA 2A4JA 3EKJA 3ZNIA 1KFXL 4MZLA 3IQOA 4HRGA 2LANA 2Y1NA 2L50A 3BXKA 2F33A 1F55A 2KHNA 1KFXS 1CDLA 4HREE 2LLTA 1RROA 3TDZA 2I18A 2L4IA 3SG4A 1BR4B 4GNKB 3PSRA 4BY4A 1OMDA 1W7IB 3NSLA 4C0JA 1CFDA 2BCAA 1YRUB 2SASA 3CWGA 1DVIA 1A4PA 1UP5A 3KO0A 1FW4A 1NWDA 3LK1A 2LVJA 1CNPA 1DJHA 5B8IB 1S1EA 1TN4A 4YGAA 3I5GB 1BODA 1NCYA 2I94A 2K8MB 3PATA 1K96A 5I2OA 2HQWA 1F70A 1QTXA 1XK4A 1YURA 2O5GA 1NX1A 5ER5A 2KFFA 4MZJA 2H61A 3CR4X 1KK7Z 4PALA 2JT0A 4USLA 2NXQA 3SJSA 2ZN8A 1CDNA 2LV7A 4NDBA 1F71A 5I2LA 2ISDA 3I5IB 3VRQA 3AAJA 4CFQA 1WLZA 3AKBA 4YGEB 1BR1B 3KPXA 4PCWA 2PMYA 4CFRA 1ALWA 2KAXA 2SCPA 2JT3A 2Y1MA 5K89A 1OQPA 2H61C 3CS1A 1SRAA 4JWQA 2MA2A 3NXAA 3VRPA 1ALVA 1QX2A 2JXLA 2KDHA 2ZRSA 2Y4QA 3BQ3A 4MEWA 3SG5A 2HETA 3EVUA 4QJ5B 1IQ3A 2JQ6A 3SG7A 5HYDA 1JFJA 1CFPA 2E30A 4I5JA 4ORAB 5TNCA 2HF5A 2LAPA 1SK6D 3LK0A 1IKUA 4DUQA 1AJ5A 4OKHA 1K9KA 1A75A 1BOCA 1SKTA 1HQVA 1GGWA 2F3ZA 1CMFA 1LVCD 2OS8B 3EVRA 3SG2A 1S5GZ 1B8LA 1BJFA 1DF0B 1HT9A 2JULA 3DVMA 3H4SE 1V1FA 1LXFC 1SPYA 3I5GC 3O6BA 4WRIA 1AHRA 4OR9B 4BY5A 1TCFA 3DVJA 1K2HA 4U8DA 1J55A 2BCBA 3A8RA 2VRGA 3SIAA 2LVKA 3BUMB 4FTGA 3BUXB 3BUOB 2LP3A 3EKHA 1LA0A 1NCXA 1WY9A 5AERA 1KQVA 1SR6B 2CCMA 2COLB 2R2IA 1CLMA 1SMGA 1YUSA 1M31A 2WCFA 3DVEA 3RM1A 1S6JA 4CLNA 1MXLC 2DOQA 2K7CA 3JTDB 2LLUA 3I5IC 1QLKA 1QVIZ 1G4YR 2KQYA 4R1EA 4PE1A 3DVKA 1M46A 3TUYB 1VRKA 2FCDA 2ZRTA 1Y1AA 3O4YA 1A03A 1N65A 1TNWA 1Y1XA 3PN7B 1AVSA 3E3RA 2D8NA 4MBEA 1ZACA 2OPOA 1K8UA 1IGVA 1DF0A 2MLFC 3CTNA 3KEVA 2CBLA 2AMIA 3NSKA 3NSIA 4AOMA 2JPTA 1H4BA 1QX7A 2GGZA 4MVFA 1CTRA 2F3YA 3IQQA 2NCOA 3EK7A 3BUWB 3VROA 1UHHA 1IG5A 2JTTA 1DT7B 3LL8B 2LVVA 1SY9A 5GQQC 4P5OE 2KQ6A 4CPVA 3PLFB
chains in the Genus database with same CATH superfamily
2LUCA 1QASA 4GUKA 5I8NA 1S6CA 3R1VA 5FYXA 4MN0A 2KAVA 3D10A 3CZ1A 2FOTA 2KOTA 3LLEA 1WDCB 2GV5A 1DGVA 5CSNA 2QDIA 1KSOA 5CSFA 3D74A 3ICBA 4PE7A 4L9MA 4N1GA 2MBXA 2BE6A 2KAYA 2JC2A 4A4BA 4QJ4B 1SR6C 4N5XA 1XFZO 3R72A 4OZDA 3TDIA 1MR8A 2P70A 4IJ7A 4PDZA 3JTDC 1BG1A 2PASA 4GAOA 2L2EA 2PQLA 1G33A 2FCEA 1BU3A 2G2BA 2LCPA 2WORA 4GGFA 1B4CA 1PVAA 1BMOA 3TUYC 1MQ1A 1NYAA 3HX4A 1TTXA 1F4OA 2NCPA 3B88A 3C1VA 3OX6A 3TZ1A 2QEBA 1CFFA 2I7AA 2CXJA 1KWOB 3PN7C 1JC2A 3M0WA 1MUXA 2KBMA 5HKZA 4PHKA 1A75B 4C0KA 4YGCB 2KYFA 4M2OA 3AAKA 3FIAA 5FI2A 2PALA 1KK8B 1RTP1 2M49B 1GJYA 4YGDB 1KSMA 4GGFC 1C3YA 4ORBB 2Q91A 2HPSA 3D75A 1Y6WA 1NX2A 1YUTA 3K21A 2WCBA 4M2QA 3WNXB 3CYZA 1JWDA 1SNLA 1J1DA 1FPWA 1WLMA 4I5KA 1B1GA 1N0YA 4XYNA 1DJXA 1OZOA 3GK1A 4TNCA 1SCVA 1XFWO 5KU1A 2MJWB 4MRYA 3SS3A 5BPJA 2P6BB 5ER4X 1KK7Y 1XK4C 1FI5A 5I2QA 3SG6A 4DS7A 1EG3A 2LLSA 3BFAA 2PYQA 1BF5A 2QACA 4OVNF 1BT6A 1QWVA 2L5XB 5D69A 2KGRA 4C0LA 4A4CA 1DC1A 1EJ3A 2JNFA 1XFRA 5DKNA 1WDCC 1BLQA 1NUBA 1IWQA 1PRWA 1SYMA 3NSOA 1KQMB 1SW8A 1ZUZA 2K0JA 2LE9B 1OOFA 3CABA 4JPZB 4GGNA 4Q04A 2L4HA 1IIOA 1B47A 4WQ3A 4YI8A 2BBMA 5DKRA 4ICBA 1K9UA 2NLNA 3L47A 4ZCUA 1SL8A 2KI6D 1B7TZ 4I5LB 1ZFSA 3OP0A 3DF0B 2KSPA 1AJ4A 2L5YA 1NPQA 4I5NB 2KI4B 1PALA 1PSBA 2KPHA 2RGIA 1W9ZA 3VRRA 2FJYA 2MLEC 1SL9A 1UHJA 3R1PA 1K95A 2BL0B 1J7RA 3D0YB 4XJKB 1CMGA 1CM1A 1KWOC 1RJVA 3JVTB 3CDNA 1DJIA 4D1EA 1M39A 4M2PA 1RWYA 3PM8A 1A2XA 1S5GY 1ZMZA 5KSZA 2WCEA 1KK8C 2LMUA 3FE6A 1PK0D 2LP2A 1E8AA 5HKYA 3D73A 1YTZC 4PE4A 3QRXA 1CFCA 2LUXA 1CM4A 2M9GA 2WCHA 2GGMA 1OOJA 1OE9B 1CB1A 2MHHA 1JFKA 2K7BA 3WHUB 3CLNA 1K9PA 1UWOA 3EK4A 4N1FA 2Q4UA 4QJ3B 1QJTA 3S0BA 1TIZA 2JOJA 1R6PA 4UPGA 1Q80A 1NCZA 2CT9A 4MZKA 2BCXA 2V53A 4OCIA 4PHNA 2F2OA 2H2KA 3OBVA 4GPLB 2KGBC 5G08A 1MF8B 1XFVO 1QVIY 1S36A 1SBJA 2M7LA 2HQ8A 3GOFA 1XFYO 4JD9A 4PE0A 2CNPA 3B87A 1IRJA 3DF0A 1TOPA 3VGOA 2K61A 3CGAA 1NX3A 3PALA 4JQ0D 1XFUO 1G8IA 2K7DA 1KQMC 2WC6A 3D0YA 4XJKA 5I94A 2KBIA 3PM2A 2L51A 4GFTA 2KLDA 2BECA 4NQGA 1CLBA 2ZNDA 1QV0A 3FWBA 1YVHA 2QPTA 4P2YB 1OW4A 4YGBB 3VRNA 1DJZA 1EL4A 4PHMA 1JSAA 2BKIB 5J3XA 2LHLA 1GGZA 2BNXA 2KI4C 2JU0A 5DICA 3A4UB 1GQMA 1J7PA 1Y1UA 4KYNA 2BL0C 3PFVA 1TCOB 4DRWA 4F0ZB 1LKJA 1JBAA 1JF0A 3JVTC 5AXIA 1JF2A 3CR5X 5DKQA 3SS5A 1J1EA 3CR2A 1KCYA 2QEOA 2OTGB 3IVTA 1DJGA 1YVLA 1MHOA 2WC8A 3TDUA 3QMEA 1ODBA 2F8PA 2M97A 2IS9A 3DZTA 2KI6C 1B8CA 4OV2A 1LA3A 2Y5IA 1B8RA 1NP8A 2M1KB 4E68A 5D7FA 1TNQA 1F4QA 1OOIX 3RLZA 3TS5B 2BBNA 2AAOA 1PSRA 2O60A 4YI9A 2JZIA 2PVBA 2ZKMX 3FWCA 1A29A 1RK9A 4AQIA 1N2DA 1NSHA 1P28A 2L2CA 3HCMA 1WRZA 2M7NA 3GK2A 3LCPC 1SCMB 2QEVA 1NIWA 1QXPA 1U5IA 2M8UA 2EC6B 1S6IA 1L2OB 2B1UA 1S3PA 2JNXA 3UNWA 3BOWB 1EH2A 3L4AA 4ETOA 1K93D 3WHTB 3OB1B 1TRFA 3O4XA 2JRFA 1YR5A 2E6WA 2M0RA 1AP4A 3N7HA 1QS7A 2JXCA 4DCKA 1XVJA 3I5FB 1K94A 3PJIA 2WNDA 5CSJA 4GBAA 2M1UA 1OZSA 4ZCVA 1QATA 2LNKA 4FQTA 1W7JB 5AEQA 4HRHA 2EGDA 1OOGA 4DIRA 1IJ6A 1JUOA 4MLWA 5IBWA 1C07A 1YUUA 2OTGC 1FI6A 1X02A 1OSAA 4NDCA 2TN4A 1QIWA 2BAPA 1OMRA 2JT8A 4PHJA 1MWNA 1CLLA 1UHIA 4MRXA 3D77A 3L4LA 3FS7A 2K60A 1ORGA 2PRUA 4FQOA 1PVBA 1LINA 2L0PA 3OB2B 2LMVA 5HKWA 2K2FA 3S0EA 2BE4A 3KHEA 3S0DA 3TS5C 1QX5B 5EL2A 2JTZA 2LVIA 3I5HB 2KFGA 2K7OA 2LMTA 2MAZA 3BOWA 1YX8A 1DGUA 3S0AA 1SL7A 4YRUA 3BFBA 1RECA 1UUSA 1B7TY 2AUCA 1CDPA 5AANA 3S0FA 3NGVA 1L7ZA 1UHNA 1FBVA 5HLOA 1YRTB 1TNXA 1C7VA 1EXRA 1F54A 1C3ZA 1SCMC 1WRKA 3OX5A 4ORCB 3V2LA 2EC6C 1UHKA 1L2OC 2ZN9A 1AUIB 1OOHA 4IL1A 2BKHB 3EK8A 2KYCA 3OHMB 1C7WA 3KF9A 4CIDA 3K1EA 2WOSA 1DJYA 4AQJA 1CDMA 3O2PA 2WCMA 2LC5A 3F45A 3I5FC 1Y0VH 5JJGA 1V1GA 1Z4HA 1J7QA 1XO5A 1IQ5A 3Q8IA 3FE8A 1R2UA 1SSEB 2M29A 3UO9A 3DY9A 1GM0A 1DELA 3SS4A 2CTNA 1XFXO 3IF7A 1MXEA 2F2PA 2WCJA 4WQ2A 1IJ5A 1EG4A 3D76A 3O78A 2K2AA 1B9AA 3BYAA 2LHIA 3EVVA 2KLEA 1M63B 1DJWA 1WRLA 1DTLA 3GK4X 1XA5A 3AKAA 5JOLA 1FF1A 5KTYA 3SG3A 2MRDA 3DD4A 1RFJA 1DMOA 1F8HA 5CSIA 1IH0A 1UURA 2L98A 2KNEA 3I5HC 3CZTX 4F7FA 1U5IB 1Z2CB 2H8VA 3WXAA 3ZWHA 1KFUL 2JWWA 1QV1A 1QLSA 1D1OA 1OMVA 1AK8A 1XYDA 4INXA 5F6TA 3SIBA 1KFUS 1S26D 1QIVA 3MSEB 3BUNB 4YBHB 5PALA 2WCLA 2I2RE 3OGNA 1J7OA 1H8BA 4HSZA 5CPVA 1CKKA 2M3WA 2ZNEA 2OS8C 5HLVA 4PT1A 1DEKA 5AFPA 2FJUB 1NX0A 4MSPA 4NDDA 2KFHA 1K90D 2ERBA 1LS8A 1YX7A 2ZFDA 3DXLA 2WC5A 1PULA 1M45A 2LM5A 1ZOTB 2NZ0A 2EHBA 1TNPA 2G9BA 2PSRA 2A4JA 3EKJA 3R1OA 3NHTA 3ZNIA 1KFXL 4MZLA 3IQOA 4JKTA 4HRGA 2LANA 2Y1NA 3B7AA 1TUJA 2L50A 3BXKA 2F33A 1F55A 2KHNA 1KFXS 4INWA 1CDLA 4HREE 2LLTA 1RROA 3TDZA 2I18A 2L4IA 5FI6A 3SG4A 1BR4B 4GNKB 3PSRA 4BY4A 1OMDA 1W7IB 3NSLA 4C0JA 1CFDA 1TWOA 2BCAA 3B86A 1YRUB 2SASA 3CWGA 1DVIA 1A4PA 1UP5A 3KO0A 1FW4A 1NWDA 3D78A 2LVJA 3LK1A 3VB1A 1DJHA 5B8IB 1CNPA 1S1EA 1TN4A 3NHIA 4YGAA 3I5GB 1TUZA 1BODA 1NCYA 3B6XA 2I94A 2QEHA 2K8MB 3PATA 1K96A 5I2OA 1DQEA 2HQWA 1QTXA 1F70A 1XK4A 1YURA 2O5GA 1NX1A 5ER5A 2KFFA 4MZJA 2H61A 3CR4X 1KK7Z 4PALA 2JT0A 2WCKA 4USLA 3DYEA 2NXQA 3SJSA 2ZN8A 1CDNA 2LV7A 4NDBA 1F71A 5I2LA 2ISDA 3I5IB 3VRQA 3AAJA 4CFQA 1WLZA 3AKBA 4YGEB 1BR1B 3KPXA 3CZ2A 4PCWA 2PMYA 4CFRA 1ALWA 2KAXA 2SCPA 2JT3A 2Y1MA 5HL1A 5K89A 1OQPA 2H61C 3CS1A 1SRAA 4JWQA 2MA2A 3NXAA 3VRPA 1ALVA 1QX2A 2JXLA 2KDHA 2ZRSA 2Y4QA 3BQ3A 4MEWA 3SG5A 2HETA 3EVUA 4QJ5B 1IQ3A 2JQ6A 3SG7A 5HYDA 1JFJA 2GTEA 2YGUA 1CFPA 2E30A 3FE9A 4I5JA 4ORAB 5TNCA 3EG5B 2HF5A 2LAPA 1SK6D 3LK0A 1IKUA 4DUQA 1AJ5A 4OKHA 1K9KA 1A75A 5D3OA 5FI7A 1BOCA 1SKTA 1HQVA 1GGWA 2F3ZA 1CMFA 1LVCD 2OS8B 3EVRA 3SG2A 1S5GZ 1B8LA 1BJFA 1DF0B 1HT9A 2JULA 3DVMA 3H4SE 1V1FA 1LXFC 1SPYA 1T14A 3I5GC 3O6BA 4WRIA 1AHRA 4OR9B 4BY5A 1TCFA 3DVJA 1K2HA 4U8DA 1J55A 2BCBA 3A8RA 2VRGA 3SIAA 2LVKA 3BUMB 4FTGA 3BUXB 3BUOB 2LP3A 3EKHA 1LA0A 1NCXA 1WY9A 5AERA 3BJHA 1KQVA 3RZSA 1SR6B 2CCMA 2COLB 2R2IA 1CLMA 1SMGA 1YUSA 1M31A 2WCFA 3DVEA 3RM1A 1S6JA 4CLNA 1MXLC 2DOQA 2K7CA 3JTDB 2LLUA 3I5IC 1QLKA 1QVIZ 1G4YR 2KQYA 4R1EA 4PE1A 3DVKA 1M46A 3TUYB 1VRKA 2FCDA 2ZRTA 1Y1AA 3O4YA 1A03A 1N65A 1TNWA 1Y1XA 3PN7B 1AVSA 2P71A 3E3RA 2D8NA 4MBEA 1ZACA 2OPOA 1K8UA 1IGVA 1DF0A 2MLFC 3CTNA 3KEVA 2CBLA 2AMIA 3NSKA 3NSIA 4AOMA 2JPTA 1H4BA 1QX7A 2GGZA 4MVFA 1CTRA 2F3YA 3CZ0A 3IQQA 2NCOA 3EK7A 3BUWB 3VROA 1UHHA 1IG5A 2JTTA 1DT7B 3LL8B 2LVVA 1SY9A 3BFHA 5GQQC 4P5OE 2KQ6A 2JPOA 3S0GA 4CPVA 3PLFB
chains in the Genus database with same CATH topology
2LUCA 1QASA 4GUKA 5I8NA 1S6CA 5FYXA 4MN0A 2KAVA 3D10A 2FOTA 2KOTA 3LLEA 1WDCB 2GV5A 1DGVA 5CSNA 1KSOA 5CSFA 3ICBA 4PE7A 4L9MA 4N1GA 2MBXA 2BE6A 2KAYA 2JC2A 4A4BA 4QJ4B 1SR6C 4N5XA 1XFZO 3TDIA 1MR8A 4PDZA 3JTDC 1BG1A 2PASA 4GAOA 2L2EA 4GGFA 1G33A 2FCEA 1BU3A 2G2BA 2LCPA 2WORA 1B4CA 1PVAA 1BMOA 3TUYC 1MQ1A 1NYAA 3HX4A 1TTXA 1F4OA 2NCPA 3C1VA 3OX6A 3TZ1A 1CFFA 2I7AA 2CXJA 1KWOB 3PN7C 1JC2A 3M0WA 1MUXA 2KBMA 5HKZA 4PHKA 1A75B 4C0KA 4YGCB 2KYFA 4M2OA 3AAKA 3FIAA 2PALA 1KK8B 1RTP1 2M49B 1GJYA 4YGDB 1KSMA 4GGFC 4ORBB 2Q91A 2HPSA 1Y6WA 1NX2A 1YUTA 3K21A 2WCBA 4M2QA 3WNXB 1JWDA 1SNLA 1J1DA 1FPWA 1WLMA 4I5KA 1B1GA 1N0YA 4XYNA 1DJXA 1OZOA 3GK1A 4TNCA 1SCVA 1XFWO 5KU1A 2MJWB 4MRYA 5BPJA 2P6BB 5ER4X 1KK7Y 1XK4C 1FI5A 5I2QA 3SG6A 4DS7A 1EG3A 2LLSA 1BF5A 2QACA 4OVNF 1BT6A 5D69A 2L5XB 2KGRA 4C0LA 4A4CA 1EJ3A 2JNFA 5DKNA 1WDCC 1BLQA 1NUBA 1IWQA 1PRWA 1SYMA 3NSOA 1KQMB 1SW8A 1ZUZA 2K0JA 2LE9B 4JPZB 4Q04A 1C7VA 4GGNA 2L4HA 1B47A 4WQ3A 4YI8A 2BBMA 5DKRA 4ICBA 1K9UA 2NLNA 4ZCUA 1SL8A 2KI6D 1B7TZ 4I5LB 1ZFSA 3OP0A 3DF0B 2KSPA 1AJ4A 4I5NB 1NPQA 2KI4B 1PALA 1PSBA 2RGIA 3VRRA 2MLEC 1SL9A 1UHJA 1K95A 2BL0B 1J7RA 3D0YB 4XJKB 1CMGA 1CM1A 1KWOC 1RJVA 3JVTB 1DJIA 4D1EA 1M39A 4M2PA 1RWYA 3PM8A 1A2XA 1S5GY 1ZMZA 5KSZA 2WCEA 1KK8C 2LMUA 1PK0D 2LP2A 1E8AA 5HKYA 1YTZC 4PE4A 3QRXA 1CFCA 2LUXA 1CM4A 2M9GA 2GGMA 1OOJA 1OE9B 1CB1A 2MHHA 1JFKA 2K7BA 3WHUB 3CLNA 1K9PA 1UWOA 3EK4A 4N1FA 2Q4UA 4QJ3B 1QJTA 1TIZA 2JOJA 1R6PA 4UPGA 1Q80A 1NCZA 2CT9A 4MZKA 2BCXA 2V53A 4OCIA 4PHNA 2F2OA 2H2KA 4GPLB 2KGBC 5G08A 1MF8B 1XFVO 1QVIY 1S36A 1SBJA 2M7LA 2HQ8A 3GOFA 1XFYO 4PE0A 2CNPA 1IRJA 3DF0A 1TOPA 3VGOA 2K61A 3CGAA 1NX3A 3PALA 4JQ0D 1XFUO 1G8IA 2K7DA 1KQMC 3D0YA 4XJKA 2KBIA 2L51A 4GFTA 2BECA 4NQGA 1CLBA 2ZNDA 1QV0A 3FWBA 1YVHA 2QPTA 4P2YB 4YGBB 3VRNA 1DJZA 1EL4A 4PHMA 1JSAA 2BKIB 5J3XA 2LHLA 1GGZA 2KI4C 2JU0A 3A4UB 1GQMA 1J7PA 1Y1UA 2BL0C 3PFVA 1TCOB 4DRWA 4F0ZB 1LKJA 1JBAA 1JF0A 3JVTC 5AXIA 1JF2A 3CR5X 5DKQA 1J1EA 3CR2A 1KCYA 2OTGB 1DJGA 1YVLA 1MHOA 2WC8A 3TDUA 1ODBA 2F8PA 2M97A 2IS9A 2KI6C 1B8CA 4OV2A 1LA3A 2Y5IA 1B8RA 1NP8A 2M1KB 4E68A 5D7FA 1TNQA 1F4QA 3RLZA 3TS5B 2BBNA 2AAOA 1PSRA 2O60A 4YI9A 2JZIA 2PVBA 2ZKMX 3FWCA 1A29A 1RK9A 4AQIA 1N2DA 1NSHA 3HCMA 1WRZA 2M7NA 3GK2A 3LCPC 1SCMB 1NIWA 1QXPA 1U5IA 2M8UA 2EC6B 1S6IA 1L2OB 2B1UA 1S3PA 2JNXA 3BOWB 1EH2A 4ETOA 1K93D 3WHTB 3OB1B 1TRFA 2JRFA 1YR5A 2E6WA 2M0RA 1AP4A 1QS7A 2JXCA 4DCKA 1XVJA 3I5FB 1K94A 2WNDA 5CSJA 4GBAA 2M1UA 1OZSA 4ZCVA 1QATA 2LNKA 1W7JB 5AEQA 4HRHA 2EGDA 4DIRA 1IJ6A 1JUOA 4MLWA 5IBWA 1C07A 1YUUA 2OTGC 1FI6A 1X02A 1OSAA 4NDCA 2TN4A 1QIWA 1OMRA 2JT8A 4PHJA 1MWNA 1CLLA 1UHIA 4MRXA 3FS7A 2PRUA 4FQOA 1PVBA 1LINA 2L0PA 3OB2B 2LMVA 5HKWA 2K2FA 2BE4A 3KHEA 3TS5C 1QX5B 2JTZA 2LVIA 3I5HB 2KFGA 2K7OA 2LMTA 2MAZA 3BOWA 1YX8A 1DGUA 1SL7A 4YRUA 1RECA 1UUSA 1B7TY 2AUCA 1CDPA 5AANA 1L7ZA 1UHNA 1FBVA 5HLOA 1YRTB 1TNXA 1EXRA 1F54A 1SCMC 1WRKA 3OX5A 4ORCB 2EC6C 1UHKA 1L2OC 2ZN9A 1AUIB 4IL1A 2BKHB 3EK8A 2KYCA 3OHMB 1C7WA 3KF9A 4CIDA 2WOSA 1DJYA 4AQJA 1CDMA 3O2PA 2LC5A 3F45A 3I5FC 1Y0VH 5JJGA 1V1GA 1J7QA 1XO5A 1IQ5A 1R2UA 2M29A 2CTNA 1XFXO 3IF7A 1MXEA 2F2PA 4WQ2A 1IJ5A 1EG4A 3O78A 2K2AA 1B9AA 3BYAA 2LHIA 3EVVA 1M63B 1DJWA 1WRLA 1DTLA 3GK4X 1XA5A 3AKAA 5JOLA 1FF1A 5KTYA 3SG3A 2MRDA 3DD4A 1RFJA 1DMOA 1F8HA 5CSIA 1IH0A 1UURA 2L98A 2KNEA 3I5HC 3CZTX 1U5IB 3WXAA 3ZWHA 1KFUL 2JWWA 1QV1A 1QLSA 1D1OA 1OMVA 1AK8A 1XYDA 5F6TA 3SIBA 1KFUS 1S26D 1QIVA 3MSEB 3BUNB 4YBHB 5PALA 1J7OA 2I2RE 1H8BA 4HSZA 5CPVA 1CKKA 2M3WA 2ZNEA 2OS8C 5HLVA 5AFPA 2FJUB 1NX0A 4MSPA 4NDDA 2KFHA 1K90D 2ZFDA 1YX7A 1PULA 1M45A 2LM5A 1ZOTB 2NZ0A 2EHBA 1TNPA 2G9BA 2PSRA 2A4JA 3EKJA 3ZNIA 1KFXL 4MZLA 3IQOA 4HRGA 2LANA 2Y1NA 2L50A 3BXKA 2F33A 1F55A 2KHNA 1KFXS 1CDLA 4HREE 2LLTA 1RROA 3TDZA 2I18A 2L4IA 3SG4A 1BR4B 4GNKB 3PSRA 4BY4A 1OMDA 1W7IB 3NSLA 4C0JA 1CFDA 2BCAA 1YRUB 2SASA 3CWGA 1DVIA 1A4PA 1UP5A 3KO0A 1FW4A 1NWDA 3LK1A 2LVJA 1CNPA 1DJHA 5B8IB 1S1EA 1TN4A 4YGAA 3I5GB 1BODA 1NCYA 2I94A 2K8MB 3PATA 1K96A 5I2OA 2HQWA 1F70A 1QTXA 1XK4A 1YURA 2O5GA 1NX1A 5ER5A 2KFFA 4MZJA 2H61A 3CR4X 1KK7Z 4PALA 2JT0A 4USLA 2NXQA 3SJSA 2ZN8A 1CDNA 2LV7A 4NDBA 1F71A 5I2LA 2ISDA 3I5IB 3VRQA 3AAJA 4CFQA 1WLZA 3AKBA 4YGEB 1BR1B 3KPXA 4PCWA 2PMYA 4CFRA 1ALWA 2KAXA 2SCPA 2JT3A 2Y1MA 5K89A 1OQPA 2H61C 3CS1A 1SRAA 4JWQA 2MA2A 3NXAA 3VRPA 1ALVA 1QX2A 2JXLA 2KDHA 2ZRSA 2Y4QA 3BQ3A 4MEWA 3SG5A 2HETA 3EVUA 4QJ5B 1IQ3A 2JQ6A 3SG7A 5HYDA 1JFJA 1CFPA 2E30A 4I5JA 4ORAB 5TNCA 2HF5A 2LAPA 1SK6D 3LK0A 1IKUA 4DUQA 1AJ5A 4OKHA 1K9KA 1A75A 1BOCA 1SKTA 1HQVA 1GGWA 2F3ZA 1CMFA 1LVCD 2OS8B 3EVRA 3SG2A 1S5GZ 1B8LA 1BJFA 1DF0B 1HT9A 2JULA 3DVMA 3H4SE 1V1FA 1LXFC 1SPYA 3I5GC 3O6BA 4WRIA 1AHRA 4OR9B 4BY5A 1TCFA 3DVJA 1K2HA 4U8DA 1J55A 2BCBA 3A8RA 2VRGA 3SIAA 2LVKA 3BUMB 4FTGA 3BUXB 3BUOB 2LP3A 3EKHA 1LA0A 1NCXA 1WY9A 5AERA 1KQVA 1SR6B 2CCMA 2COLB 2R2IA 1CLMA 1SMGA 1YUSA 1M31A 2WCFA 3DVEA 3RM1A 1S6JA 4CLNA 1MXLC 2DOQA 2K7CA 3JTDB 2LLUA 3I5IC 1QLKA 1QVIZ 1G4YR 2KQYA 4R1EA 4PE1A 3DVKA 1M46A 3TUYB 1VRKA 2FCDA 2ZRTA 1Y1AA 3O4YA 1A03A 1N65A 1TNWA 1Y1XA 3PN7B 1AVSA 3E3RA 2D8NA 4MBEA 1ZACA 2OPOA 1K8UA 1IGVA 1DF0A 2MLFC 3CTNA 3KEVA 2CBLA 2AMIA 3NSKA 3NSIA 4AOMA 2JPTA 1H4BA 1QX7A 2GGZA 4MVFA 1CTRA 2F3YA 3IQQA 2NCOA 3EK7A 3BUWB 3VROA 1UHHA 1IG5A 2JTTA 1DT7B 3LL8B 2LVVA 1SY9A 5GQQC 4P5OE 2KQ6A 4CPVA 3PLFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUC A;  1QAS A;  4GUK A;  5I8N A;  1S6C A;  5FYX A;  4MN0 A;  2KAV A;  3D10 A;  2FOT A;  2KOT A;  3LLE A;  1WDC B;  2GV5 A;  1DGV A;  5CSN A;  1KSO A;  5CSF A;  3ICB A;  4PE7 A;  4L9M A;  4N1G A;  2MBX A;  2BE6 A;  2KAY A;  2JC2 A;  4A4B A;  4QJ4 B;  1SR6 C;  4N5X A;  1XFZ O;  3TDI A;  1MR8 A;  4PDZ A;  3JTD C;  1BG1 A;  2PAS A;  4GAO A;  2L2E A;  4GGF A;  1G33 A;  2FCE A;  1BU3 A;  2G2B A;  2LCP A;  2WOR A;  1B4C A;  1PVA A;  1BMO A;  3TUY C;  1MQ1 A;  1NYA A;  3HX4 A;  1TTX A;  1F4O A;  2NCP A;  3C1V A;  3OX6 A;  3TZ1 A;  1CFF A;  2I7A A;  2CXJ A;  1KWO B;  3PN7 C;  1JC2 A;  3M0W A;  1MUX A;  2KBM A;  5HKZ A;  4PHK A;  1A75 B;  4C0K A;  4YGC B;  2KYF A;  4M2O A;  3AAK A;  3FIA A;  2PAL A;  1KK8 B;  1RTP 1;  2M49 B;  1GJY A;  4YGD B;  1KSM A;  4GGF C;  4ORB B;  2Q91 A;  2HPS A;  1Y6W A;  1NX2 A;  1YUT A;  3K21 A;  2WCB A;  4M2Q A;  3WNX B;  1JWD A;  1SNL A;  1J1D A;  1FPW A;  1WLM A;  4I5K A;  1B1G A;  1N0Y A;  4XYN A;  1DJX A;  1OZO A;  3GK1 A;  4TNC A;  1SCV A;  1XFW O;  5KU1 A;  2MJW B;  4MRY A;  5BPJ A;  2P6B B;  5ER4 X;  1KK7 Y;  1XK4 C;  1FI5 A;  5I2Q A;  3SG6 A;  4DS7 A;  1EG3 A;  2LLS A;  1BF5 A;  2QAC A;  4OVN F;  1BT6 A;  5D69 A;  2L5X B;  2KGR A;  4C0L A;  4A4C A;  1EJ3 A;  2JNF A;  5DKN A;  1WDC C;  1BLQ A;  1NUB A;  1IWQ A;  1PRW A;  1SYM A;  3NSO A;  1KQM B;  1SW8 A;  1ZUZ A;  2K0J A;  2LE9 B;  4JPZ B;  4Q04 A;  1C7V A;  4GGN A;  2L4H A;  1B47 A;  4WQ3 A;  4YI8 A;  2BBM A;  5DKR A;  4ICB A;  1K9U A;  2NLN A;  4ZCU A;  1SL8 A;  2KI6 D;  1B7T Z;  4I5L B;  1ZFS A;  3OP0 A;  3DF0 B;  2KSP A;  1AJ4 A;  4I5N B;  1NPQ A;  2KI4 B;  1PAL A;  1PSB A;  2RGI A;  3VRR A;  2MLE C;  1SL9 A;  1UHJ A;  1K95 A;  2BL0 B;  1J7R A;  3D0Y B;  4XJK B;  1CMG A;  1CM1 A;  1KWO C;  1RJV A;  3JVT B;  1DJI A;  4D1E A;  1M39 A;  4M2P A;  1RWY A;  3PM8 A;  1A2X A;  1S5G Y;  1ZMZ A;  5KSZ A;  2WCE A;  1KK8 C;  2LMU A;  1PK0 D;  2LP2 A;  1E8A A;  5HKY A;  1YTZ C;  4PE4 A;  3QRX A;  1CFC A;  2LUX A;  1CM4 A;  2M9G A;  2GGM A;  1OOJ A;  1OE9 B;  1CB1 A;  2MHH A;  1JFK A;  2K7B A;  3WHU B;  3CLN A;  1K9P A;  1UWO A;  3EK4 A;  4N1F A;  2Q4U A;  4QJ3 B;  1QJT A;  1TIZ A;  2JOJ A;  1R6P A;  4UPG A;  1Q80 A;  1NCZ A;  2CT9 A;  4MZK A;  2BCX A;  2V53 A;  4OCI A;  4PHN A;  2F2O A;  2H2K A;  4GPL B;  2KGB C;  5G08 A;  1MF8 B;  1XFV O;  1QVI Y;  1S36 A;  1SBJ A;  2M7L A;  2HQ8 A;  3GOF A;  1XFY O;  4PE0 A;  2CNP A;  1IRJ A;  3DF0 A;  1TOP A;  3VGO A;  2K61 A;  3CGA A;  1NX3 A;  3PAL A;  4JQ0 D;  1XFU O;  1G8I A;  2K7D A;  1KQM C;  3D0Y A;  4XJK A;  2KBI A;  2L51 A;  4GFT A;  2BEC A;  4NQG A;  1CLB A;  2ZND A;  1QV0 A;  3FWB A;  1YVH A;  2QPT A;  4P2Y B;  4YGB B;  3VRN A;  1DJZ A;  1EL4 A;  4PHM A;  1JSA A;  2BKI B;  5J3X A;  2LHL A;  1GGZ A;  2KI4 C;  2JU0 A;  3A4U B;  1GQM A;  1J7P A;  1Y1U A;  2BL0 C;  3PFV A;  1TCO B;  4DRW A;  4F0Z B;  1LKJ A;  1JBA A;  1JF0 A;  3JVT C;  5AXI A;  1JF2 A;  3CR5 X;  5DKQ A;  1J1E A;  3CR2 A;  1KCY A;  2OTG B;  1DJG A;  1YVL A;  1MHO A;  2WC8 A;  3TDU A;  1ODB A;  2F8P A;  2M97 A;  2IS9 A;  2KI6 C;  1B8C A;  4OV2 A;  1LA3 A;  2Y5I A;  1B8R A;  1NP8 A;  2M1K B;  4E68 A;  5D7F A;  1TNQ A;  1F4Q A;  3RLZ A;  3TS5 B;  2BBN A;  2AAO A;  1PSR A;  2O60 A;  4YI9 A;  2JZI A;  2PVB A;  2ZKM X;  3FWC A;  1A29 A;  1RK9 A;  4AQI A;  1N2D A;  1NSH A;  3HCM A;  1WRZ A;  2M7N A;  3GK2 A;  3LCP C;  1SCM B;  1NIW A;  1QXP A;  1U5I A;  2M8U A;  2EC6 B;  1S6I A;  1L2O B;  2B1U A;  1S3P A;  2JNX A;  3BOW B;  1EH2 A;  4ETO A;  1K93 D;  3WHT B;  3OB1 B;  1TRF A;  2JRF A;  1YR5 A;  2E6W A;  2M0R A;  1AP4 A;  1QS7 A;  2JXC A;  4DCK A;  1XVJ A;  3I5F B;  1K94 A;  2WND A;  5CSJ A;  4GBA A;  2M1U A;  1OZS A;  4ZCV A;  1QAT A;  2LNK A;  1W7J B;  5AEQ A;  4HRH A;  2EGD A;  4DIR A;  1IJ6 A;  1JUO A;  4MLW A;  5IBW A;  1C07 A;  1YUU A;  2OTG C;  1FI6 A;  1X02 A;  1OSA A;  4NDC A;  2TN4 A;  1QIW A;  1OMR A;  2JT8 A;  4PHJ A;  1MWN A;  1CLL A;  1UHI A;  4MRX A;  3FS7 A;  2PRU A;  4FQO A;  1PVB A;  1LIN A;  2L0P A;  3OB2 B;  2LMV A;  5HKW A;  2K2F A;  2BE4 A;  3KHE A;  3TS5 C;  1QX5 B;  2JTZ A;  2LVI A;  3I5H B;  2KFG A;  2K7O A;  2LMT A;  2MAZ A;  3BOW A;  1YX8 A;  1DGU A;  1SL7 A;  4YRU A;  1REC A;  1UUS A;  1B7T Y;  2AUC A;  1CDP A;  5AAN A;  1L7Z A;  1UHN A;  1FBV A;  5HLO A;  1YRT B;  1TNX A;  1EXR A;  1F54 A;  1SCM C;  1WRK A;  3OX5 A;  4ORC B;  2EC6 C;  1UHK A;  1L2O C;  2ZN9 A;  1AUI B;  4IL1 A;  2BKH B;  3EK8 A;  2KYC A;  3OHM B;  1C7W A;  3KF9 A;  4CID A;  2WOS A;  1DJY A;  4AQJ A;  1CDM A;  3O2P A;  2LC5 A;  3F45 A;  3I5F C;  1Y0V H;  5JJG A;  1V1G A;  1J7Q A;  1XO5 A;  1IQ5 A;  1R2U A;  2M29 A;  2CTN A;  1XFX O;  3IF7 A;  1MXE A;  2F2P A;  4WQ2 A;  1IJ5 A;  1EG4 A;  3O78 A;  2K2A A;  1B9A A;  3BYA A;  2LHI A;  3EVV A;  1M63 B;  1DJW A;  1WRL A;  1DTL A;  3GK4 X;  1XA5 A;  3AKA A;  5JOL A;  1FF1 A;  5KTY A;  3SG3 A;  2MRD A;  3DD4 A;  1RFJ A;  1DMO A;  1F8H A;  5CSI A;  1IH0 A;  1UUR A;  2L98 A;  2KNE A;  3I5H C;  3CZT X;  1U5I B;  3WXA A;  3ZWH A;  1KFU L;  2JWW A;  1QV1 A;  1QLS A;  1D1O A;  1OMV A;  1AK8 A;  1XYD A;  5F6T A;  3SIB A;  1KFU S;  1S26 D;  1QIV A;  3MSE B;  3BUN B;  4YBH B;  5PAL A;  1J7O A;  2I2R E;  1H8B A;  4HSZ A;  5CPV A;  1CKK A;  2M3W A;  2ZNE A;  2OS8 C;  5HLV A;  5AFP A;  2FJU B;  1NX0 A;  4MSP A;  4NDD A;  2KFH A;  1K90 D;  2ZFD A;  1YX7 A;  1PUL A;  1M45 A;  2LM5 A;  1ZOT B;  2NZ0 A;  2EHB A;  1TNP A;  2G9B A;  2PSR A;  2A4J A;  3EKJ A;  3ZNI A;  1KFX L;  4MZL A;  3IQO A;  4HRG A;  2LAN A;  2Y1N A;  2L50 A;  3BXK A;  2F33 A;  1F55 A;  2KHN A;  1KFX S;  1CDL A;  4HRE E;  2LLT A;  1RRO A;  3TDZ A;  2I18 A;  2L4I A;  3SG4 A;  1BR4 B;  4GNK B;  3PSR A;  4BY4 A;  1OMD A;  1W7I B;  3NSL A;  4C0J A;  1CFD A;  2BCA A;  1YRU B;  2SAS A;  3CWG A;  1DVI A;  1A4P A;  1UP5 A;  3KO0 A;  1FW4 A;  1NWD A;  3LK1 A;  2LVJ A;  1CNP A;  1DJH A;  5B8I B;  1S1E A;  1TN4 A;  4YGA A;  3I5G B;  1BOD A;  1NCY A;  2I94 A;  2K8M B;  3PAT A;  1K96 A;  5I2O A;  2HQW A;  1F70 A;  1QTX A;  1XK4 A;  1YUR A;  2O5G A;  1NX1 A;  5ER5 A;  2KFF A;  4MZJ A;  2H61 A;  3CR4 X;  1KK7 Z;  4PAL A;  2JT0 A;  4USL A;  2NXQ A;  3SJS A;  2ZN8 A;  1CDN A;  2LV7 A;  4NDB A;  1F71 A;  5I2L A;  2ISD A;  3I5I B;  3VRQ A;  3AAJ A;  4CFQ A;  1WLZ A;  3AKB A;  4YGE B;  1BR1 B;  3KPX A;  4PCW A;  2PMY A;  4CFR A;  1ALW A;  2KAX A;  2SCP A;  2JT3 A;  2Y1M A;  5K89 A;  1OQP A;  2H61 C;  3CS1 A;  1SRA A;  4JWQ A;  2MA2 A;  3NXA A;  3VRP A;  1ALV A;  1QX2 A;  2JXL A;  2KDH A;  2ZRS A;  2Y4Q A;  3BQ3 A;  4MEW A;  3SG5 A;  2HET A;  3EVU A;  4QJ5 B;  1IQ3 A;  2JQ6 A;  3SG7 A;  5HYD A;  1JFJ A;  1CFP A;  2E30 A;  4I5J A;  4ORA B;  5TNC A;  2HF5 A;  2LAP A;  1SK6 D;  3LK0 A;  1IKU A;  4DUQ A;  1AJ5 A;  4OKH A;  1K9K A;  1A75 A;  1BOC A;  1SKT A;  1HQV A;  1GGW A;  2F3Z A;  1CMF A;  1LVC D;  2OS8 B;  3EVR A;  3SG2 A;  1S5G Z;  1B8L A;  1BJF A;  1DF0 B;  1HT9 A;  2JUL A;  3DVM A;  3H4S E;  1V1F A;  1LXF C;  1SPY A;  3I5G C;  3O6B A;  4WRI A;  1AHR A;  4OR9 B;  4BY5 A;  1TCF A;  3DVJ A;  1K2H A;  4U8D A;  1J55 A;  2BCB A;  3A8R A;  2VRG A;  3SIA A;  2LVK A;  3BUM B;  4FTG A;  3BUX B;  3BUO B;  2LP3 A;  3EKH A;  1LA0 A;  1NCX A;  1WY9 A;  5AER A;  1KQV A;  1SR6 B;  2CCM A;  2COL B;  2R2I A;  1CLM A;  1SMG A;  1YUS A;  1M31 A;  2WCF A;  3DVE A;  3RM1 A;  1S6J A;  4CLN A;  1MXL C;  2DOQ A;  2K7C A;  3JTD B;  2LLU A;  3I5I C;  1QLK A;  1QVI Z;  1G4Y R;  2KQY A;  4R1E A;  4PE1 A;  3DVK A;  1M46 A;  3TUY B;  1VRK A;  2FCD A;  2ZRT A;  1Y1A A;  3O4Y A;  1A03 A;  1N65 A;  1TNW A;  1Y1X A;  3PN7 B;  1AVS A;  3E3R A;  2D8N A;  4MBE A;  1ZAC A;  2OPO A;  1K8U A;  1IGV A;  1DF0 A;  2MLF C;  3CTN A;  3KEV A;  2CBL A;  2AMI A;  3NSK A;  3NSI A;  4AOM A;  2JPT A;  1H4B A;  1QX7 A;  2GGZ A;  4MVF A;  1CTR A;  2F3Y A;  3IQQ A;  2NCO A;  3EK7 A;  3BUW B;  3VRO A;  1UHH A;  1IG5 A;  2JTT A;  1DT7 B;  3LL8 B;  2LVV A;  1SY9 A;  5GQQ C;  4P5O E;  2KQ6 A;  4CPV A;  3PLF B; 
#chains in the Genus database with same CATH topology
 2LUC A;  1QAS A;  4GUK A;  5I8N A;  1S6C A;  3R1V A;  5FYX A;  4MN0 A;  2KAV A;  3D10 A;  3CZ1 A;  2FOT A;  2KOT A;  3LLE A;  1WDC B;  2GV5 A;  1DGV A;  5CSN A;  2QDI A;  1KSO A;  5CSF A;  3D74 A;  3ICB A;  4PE7 A;  4L9M A;  4N1G A;  2MBX A;  2BE6 A;  2KAY A;  2JC2 A;  4A4B A;  4QJ4 B;  1SR6 C;  4N5X A;  1XFZ O;  3R72 A;  4OZD A;  3TDI A;  1MR8 A;  2P70 A;  4IJ7 A;  4PDZ A;  3JTD C;  1BG1 A;  2PAS A;  4GAO A;  2L2E A;  2PQL A;  1G33 A;  2FCE A;  1BU3 A;  2G2B A;  2LCP A;  2WOR A;  4GGF A;  1B4C A;  1PVA A;  1BMO A;  3TUY C;  1MQ1 A;  1NYA A;  3HX4 A;  1TTX A;  1F4O A;  2NCP A;  3B88 A;  3C1V A;  3OX6 A;  3TZ1 A;  2QEB A;  1CFF A;  2I7A A;  2CXJ A;  1KWO B;  3PN7 C;  1JC2 A;  3M0W A;  1MUX A;  2KBM A;  5HKZ A;  4PHK A;  1A75 B;  4C0K A;  4YGC B;  2KYF A;  4M2O A;  3AAK A;  3FIA A;  5FI2 A;  2PAL A;  1KK8 B;  1RTP 1;  2M49 B;  1GJY A;  4YGD B;  1KSM A;  4GGF C;  1C3Y A;  4ORB B;  2Q91 A;  2HPS A;  3D75 A;  1Y6W A;  1NX2 A;  1YUT A;  3K21 A;  2WCB A;  4M2Q A;  3WNX B;  3CYZ A;  1JWD A;  1SNL A;  1J1D A;  1FPW A;  1WLM A;  4I5K A;  1B1G A;  1N0Y A;  4XYN A;  1DJX A;  1OZO A;  3GK1 A;  4TNC A;  1SCV A;  1XFW O;  5KU1 A;  2MJW B;  4MRY A;  3SS3 A;  5BPJ A;  2P6B B;  5ER4 X;  1KK7 Y;  1XK4 C;  1FI5 A;  5I2Q A;  3SG6 A;  4DS7 A;  1EG3 A;  2LLS A;  3BFA A;  2PYQ A;  1BF5 A;  2QAC A;  4OVN F;  1BT6 A;  1QWV A;  2L5X B;  5D69 A;  2KGR A;  4C0L A;  4A4C A;  1DC1 A;  1EJ3 A;  2JNF A;  1XFR A;  5DKN A;  1WDC C;  1BLQ A;  1NUB A;  1IWQ A;  1PRW A;  1SYM A;  3NSO A;  1KQM B;  1SW8 A;  1ZUZ A;  2K0J A;  2LE9 B;  1OOF A;  3CAB A;  4JPZ B;  4GGN A;  4Q04 A;  2L4H A;  1IIO A;  1B47 A;  4WQ3 A;  4YI8 A;  2BBM A;  5DKR A;  4ICB A;  1K9U A;  2NLN A;  3L47 A;  4ZCU A;  1SL8 A;  2KI6 D;  1B7T Z;  4I5L B;  1ZFS A;  3OP0 A;  3DF0 B;  2KSP A;  1AJ4 A;  2L5Y A;  1NPQ A;  4I5N B;  2KI4 B;  1PAL A;  1PSB A;  2KPH A;  2RGI A;  1W9Z A;  3VRR A;  2FJY A;  2MLE C;  1SL9 A;  1UHJ A;  3R1P A;  1K95 A;  2BL0 B;  1J7R A;  3D0Y B;  4XJK B;  1CMG A;  1CM1 A;  1KWO C;  1RJV A;  3JVT B;  3CDN A;  1DJI A;  4D1E A;  1M39 A;  4M2P A;  1RWY A;  3PM8 A;  1A2X A;  1S5G Y;  1ZMZ A;  5KSZ A;  2WCE A;  1KK8 C;  2LMU A;  3FE6 A;  1PK0 D;  2LP2 A;  1E8A A;  5HKY A;  3D73 A;  1YTZ C;  4PE4 A;  3QRX A;  1CFC A;  2LUX A;  1CM4 A;  2M9G A;  2WCH A;  2GGM A;  1OOJ A;  1OE9 B;  1CB1 A;  2MHH A;  1JFK A;  2K7B A;  3WHU B;  3CLN A;  1K9P A;  1UWO A;  3EK4 A;  4N1F A;  2Q4U A;  4QJ3 B;  1QJT A;  3S0B A;  1TIZ A;  2JOJ A;  1R6P A;  4UPG A;  1Q80 A;  1NCZ A;  2CT9 A;  4MZK A;  2BCX A;  2V53 A;  4OCI A;  4PHN A;  2F2O A;  2H2K A;  3OBV A;  4GPL B;  2KGB C;  5G08 A;  1MF8 B;  1XFV O;  1QVI Y;  1S36 A;  1SBJ A;  2M7L A;  2HQ8 A;  3GOF A;  1XFY O;  4JD9 A;  4PE0 A;  2CNP A;  3B87 A;  1IRJ A;  3DF0 A;  1TOP A;  3VGO A;  2K61 A;  3CGA A;  1NX3 A;  3PAL A;  4JQ0 D;  1XFU O;  1G8I A;  2K7D A;  1KQM C;  2WC6 A;  3D0Y A;  4XJK A;  5I94 A;  2KBI A;  3PM2 A;  2L51 A;  4GFT A;  2KLD A;  2BEC A;  4NQG A;  1CLB A;  2ZND A;  1QV0 A;  3FWB A;  1YVH A;  2QPT A;  4P2Y B;  1OW4 A;  4YGB B;  3VRN A;  1DJZ A;  1EL4 A;  4PHM A;  1JSA A;  2BKI B;  5J3X A;  2LHL A;  1GGZ A;  2BNX A;  2KI4 C;  2JU0 A;  5DIC A;  3A4U B;  1GQM A;  1J7P A;  1Y1U A;  4KYN A;  2BL0 C;  3PFV A;  1TCO B;  4DRW A;  4F0Z B;  1LKJ A;  1JBA A;  1JF0 A;  3JVT C;  5AXI A;  1JF2 A;  3CR5 X;  5DKQ A;  3SS5 A;  1J1E A;  3CR2 A;  1KCY A;  2QEO A;  2OTG B;  3IVT A;  1DJG A;  1YVL A;  1MHO A;  2WC8 A;  3TDU A;  3QME A;  1ODB A;  2F8P A;  2M97 A;  2IS9 A;  3DZT A;  2KI6 C;  1B8C A;  4OV2 A;  1LA3 A;  2Y5I A;  1B8R A;  1NP8 A;  2M1K B;  4E68 A;  5D7F A;  1TNQ A;  1F4Q A;  1OOI X;  3RLZ A;  3TS5 B;  2BBN A;  2AAO A;  1PSR A;  2O60 A;  4YI9 A;  2JZI A;  2PVB A;  2ZKM X;  3FWC A;  1A29 A;  1RK9 A;  4AQI A;  1N2D A;  1NSH A;  1P28 A;  2L2C A;  3HCM A;  1WRZ A;  2M7N A;  3GK2 A;  3LCP C;  1SCM B;  2QEV A;  1NIW A;  1QXP A;  1U5I A;  2M8U A;  2EC6 B;  1S6I A;  1L2O B;  2B1U A;  1S3P A;  2JNX A;  3UNW A;  3BOW B;  1EH2 A;  3L4A A;  4ETO A;  1K93 D;  3WHT B;  3OB1 B;  1TRF A;  3O4X A;  2JRF A;  1YR5 A;  2E6W A;  2M0R A;  1AP4 A;  3N7H A;  1QS7 A;  2JXC A;  4DCK A;  1XVJ A;  3I5F B;  1K94 A;  3PJI A;  2WND A;  5CSJ A;  4GBA A;  2M1U A;  1OZS A;  4ZCV A;  1QAT A;  2LNK A;  4FQT A;  1W7J B;  5AEQ A;  4HRH A;  2EGD A;  1OOG A;  4DIR A;  1IJ6 A;  1JUO A;  4MLW A;  5IBW A;  1C07 A;  1YUU A;  2OTG C;  1FI6 A;  1X02 A;  1OSA A;  4NDC A;  2TN4 A;  1QIW A;  2BAP A;  1OMR A;  2JT8 A;  4PHJ A;  1MWN A;  1CLL A;  1UHI A;  4MRX A;  3D77 A;  3L4L A;  3FS7 A;  2K60 A;  1ORG A;  2PRU A;  4FQO A;  1PVB A;  1LIN A;  2L0P A;  3OB2 B;  2LMV A;  5HKW A;  2K2F A;  3S0E A;  2BE4 A;  3KHE A;  3S0D A;  3TS5 C;  1QX5 B;  5EL2 A;  2JTZ A;  2LVI A;  3I5H B;  2KFG A;  2K7O A;  2LMT A;  2MAZ A;  3BOW A;  1YX8 A;  1DGU A;  3S0A A;  1SL7 A;  4YRU A;  3BFB A;  1REC A;  1UUS A;  1B7T Y;  2AUC A;  1CDP A;  5AAN A;  3S0F A;  3NGV A;  1L7Z A;  1UHN A;  1FBV A;  5HLO A;  1YRT B;  1TNX A;  1C7V A;  1EXR A;  1F54 A;  1C3Z A;  1SCM C;  1WRK A;  3OX5 A;  4ORC B;  3V2L A;  2EC6 C;  1UHK A;  1L2O C;  2ZN9 A;  1AUI B;  1OOH A;  4IL1 A;  2BKH B;  3EK8 A;  2KYC A;  3OHM B;  1C7W A;  3KF9 A;  4CID A;  3K1E A;  2WOS A;  1DJY A;  4AQJ A;  1CDM A;  3O2P A;  2WCM A;  2LC5 A;  3F45 A;  3I5F C;  1Y0V H;  5JJG A;  1V1G A;  1Z4H A;  1J7Q A;  1XO5 A;  1IQ5 A;  3Q8I A;  3FE8 A;  1R2U A;  1SSE B;  2M29 A;  3UO9 A;  3DY9 A;  1GM0 A;  1DEL A;  3SS4 A;  2CTN A;  1XFX O;  3IF7 A;  1MXE A;  2F2P A;  2WCJ A;  4WQ2 A;  1IJ5 A;  1EG4 A;  3D76 A;  3O78 A;  2K2A A;  1B9A A;  3BYA A;  2LHI A;  3EVV A;  2KLE A;  1M63 B;  1DJW A;  1WRL A;  1DTL A;  3GK4 X;  1XA5 A;  3AKA A;  5JOL A;  1FF1 A;  5KTY A;  3SG3 A;  2MRD A;  3DD4 A;  1RFJ A;  1DMO A;  1F8H A;  5CSI A;  1IH0 A;  1UUR A;  2L98 A;  2KNE A;  3I5H C;  3CZT X;  4F7F A;  1U5I B;  1Z2C B;  2H8V A;  3WXA A;  3ZWH A;  1KFU L;  2JWW A;  1QV1 A;  1QLS A;  1D1O A;  1OMV A;  1AK8 A;  1XYD A;  4INX A;  5F6T A;  3SIB A;  1KFU S;  1S26 D;  1QIV A;  3MSE B;  3BUN B;  4YBH B;  5PAL A;  2WCL A;  2I2R E;  3OGN A;  1J7O A;  1H8B A;  4HSZ A;  5CPV A;  1CKK A;  2M3W A;  2ZNE A;  2OS8 C;  5HLV A;  4PT1 A;  1DEK A;  5AFP A;  2FJU B;  1NX0 A;  4MSP A;  4NDD A;  2KFH A;  1K90 D;  2ERB A;  1LS8 A;  1YX7 A;  2ZFD A;  3DXL A;  2WC5 A;  1PUL A;  1M45 A;  2LM5 A;  1ZOT B;  2NZ0 A;  2EHB A;  1TNP A;  2G9B A;  2PSR A;  2A4J A;  3EKJ A;  3R1O A;  3NHT A;  3ZNI A;  1KFX L;  4MZL A;  3IQO A;  4JKT A;  4HRG A;  2LAN A;  2Y1N A;  3B7A A;  1TUJ A;  2L50 A;  3BXK A;  2F33 A;  1F55 A;  2KHN A;  1KFX S;  4INW A;  1CDL A;  4HRE E;  2LLT A;  1RRO A;  3TDZ A;  2I18 A;  2L4I A;  5FI6 A;  3SG4 A;  1BR4 B;  4GNK B;  3PSR A;  4BY4 A;  1OMD A;  1W7I B;  3NSL A;  4C0J A;  1CFD A;  1TWO A;  2BCA A;  3B86 A;  1YRU B;  2SAS A;  3CWG A;  1DVI A;  1A4P A;  1UP5 A;  3KO0 A;  1FW4 A;  1NWD A;  3D78 A;  2LVJ A;  3LK1 A;  3VB1 A;  1DJH A;  5B8I B;  1CNP A;  1S1E A;  1TN4 A;  3NHI A;  4YGA A;  3I5G B;  1TUZ A;  1BOD A;  1NCY A;  3B6X A;  2I94 A;  2QEH A;  2K8M B;  3PAT A;  1K96 A;  5I2O A;  1DQE A;  2HQW A;  1QTX A;  1F70 A;  1XK4 A;  1YUR A;  2O5G A;  1NX1 A;  5ER5 A;  2KFF A;  4MZJ A;  2H61 A;  3CR4 X;  1KK7 Z;  4PAL A;  2JT0 A;  2WCK A;  4USL A;  3DYE A;  2NXQ A;  3SJS A;  2ZN8 A;  1CDN A;  2LV7 A;  4NDB A;  1F71 A;  5I2L A;  2ISD A;  3I5I B;  3VRQ A;  3AAJ A;  4CFQ A;  1WLZ A;  3AKB A;  4YGE B;  1BR1 B;  3KPX A;  3CZ2 A;  4PCW A;  2PMY A;  4CFR A;  1ALW A;  2KAX A;  2SCP A;  2JT3 A;  2Y1M A;  5HL1 A;  5K89 A;  1OQP A;  2H61 C;  3CS1 A;  1SRA A;  4JWQ A;  2MA2 A;  3NXA A;  3VRP A;  1ALV A;  1QX2 A;  2JXL A;  2KDH A;  2ZRS A;  2Y4Q A;  3BQ3 A;  4MEW A;  3SG5 A;  2HET A;  3EVU A;  4QJ5 B;  1IQ3 A;  2JQ6 A;  3SG7 A;  5HYD A;  1JFJ A;  2GTE A;  2YGU A;  1CFP A;  2E30 A;  3FE9 A;  4I5J A;  4ORA B;  5TNC A;  3EG5 B;  2HF5 A;  2LAP A;  1SK6 D;  3LK0 A;  1IKU A;  4DUQ A;  1AJ5 A;  4OKH A;  1K9K A;  1A75 A;  5D3O A;  5FI7 A;  1BOC A;  1SKT A;  1HQV A;  1GGW A;  2F3Z A;  1CMF A;  1LVC D;  2OS8 B;  3EVR A;  3SG2 A;  1S5G Z;  1B8L A;  1BJF A;  1DF0 B;  1HT9 A;  2JUL A;  3DVM A;  3H4S E;  1V1F A;  1LXF C;  1SPY A;  1T14 A;  3I5G C;  3O6B A;  4WRI A;  1AHR A;  4OR9 B;  4BY5 A;  1TCF A;  3DVJ A;  1K2H A;  4U8D A;  1J55 A;  2BCB A;  3A8R A;  2VRG A;  3SIA A;  2LVK A;  3BUM B;  4FTG A;  3BUX B;  3BUO B;  2LP3 A;  3EKH A;  1LA0 A;  1NCX A;  1WY9 A;  5AER A;  3BJH A;  1KQV A;  3RZS A;  1SR6 B;  2CCM A;  2COL B;  2R2I A;  1CLM A;  1SMG A;  1YUS A;  1M31 A;  2WCF A;  3DVE A;  3RM1 A;  1S6J A;  4CLN A;  1MXL C;  2DOQ A;  2K7C A;  3JTD B;  2LLU A;  3I5I C;  1QLK A;  1QVI Z;  1G4Y R;  2KQY A;  4R1E A;  4PE1 A;  3DVK A;  1M46 A;  3TUY B;  1VRK A;  2FCD A;  2ZRT A;  1Y1A A;  3O4Y A;  1A03 A;  1N65 A;  1TNW A;  1Y1X A;  3PN7 B;  1AVS A;  2P71 A;  3E3R A;  2D8N A;  4MBE A;  1ZAC A;  2OPO A;  1K8U A;  1IGV A;  1DF0 A;  2MLF C;  3CTN A;  3KEV A;  2CBL A;  2AMI A;  3NSK A;  3NSI A;  4AOM A;  2JPT A;  1H4B A;  1QX7 A;  2GGZ A;  4MVF A;  1CTR A;  2F3Y A;  3CZ0 A;  3IQQ A;  2NCO A;  3EK7 A;  3BUW B;  3VRO A;  1UHH A;  1IG5 A;  2JTT A;  1DT7 B;  3LL8 B;  2LVV A;  1SY9 A;  3BFH A;  5GQQ C;  4P5O E;  2KQ6 A;  2JPO A;  3S0G A;  4CPV A;  3PLF B; 
#chains in the Genus database with same CATH homology
 2LUC A;  1QAS A;  4GUK A;  5I8N A;  1S6C A;  5FYX A;  4MN0 A;  2KAV A;  3D10 A;  2FOT A;  2KOT A;  3LLE A;  1WDC B;  2GV5 A;  1DGV A;  5CSN A;  1KSO A;  5CSF A;  3ICB A;  4PE7 A;  4L9M A;  4N1G A;  2MBX A;  2BE6 A;  2KAY A;  2JC2 A;  4A4B A;  4QJ4 B;  1SR6 C;  4N5X A;  1XFZ O;  3TDI A;  1MR8 A;  4PDZ A;  3JTD C;  1BG1 A;  2PAS A;  4GAO A;  2L2E A;  4GGF A;  1G33 A;  2FCE A;  1BU3 A;  2G2B A;  2LCP A;  2WOR A;  1B4C A;  1PVA A;  1BMO A;  3TUY C;  1MQ1 A;  1NYA A;  3HX4 A;  1TTX A;  1F4O A;  2NCP A;  3C1V A;  3OX6 A;  3TZ1 A;  1CFF A;  2I7A A;  2CXJ A;  1KWO B;  3PN7 C;  1JC2 A;  3M0W A;  1MUX A;  2KBM A;  5HKZ A;  4PHK A;  1A75 B;  4C0K A;  4YGC B;  2KYF A;  4M2O A;  3AAK A;  3FIA A;  2PAL A;  1KK8 B;  1RTP 1;  2M49 B;  1GJY A;  4YGD B;  1KSM A;  4GGF C;  4ORB B;  2Q91 A;  2HPS A;  1Y6W A;  1NX2 A;  1YUT A;  3K21 A;  2WCB A;  4M2Q A;  3WNX B;  1JWD A;  1SNL A;  1J1D A;  1FPW A;  1WLM A;  4I5K A;  1B1G A;  1N0Y A;  4XYN A;  1DJX A;  1OZO A;  3GK1 A;  4TNC A;  1SCV A;  1XFW O;  5KU1 A;  2MJW B;  4MRY A;  5BPJ A;  2P6B B;  5ER4 X;  1KK7 Y;  1XK4 C;  1FI5 A;  5I2Q A;  3SG6 A;  4DS7 A;  1EG3 A;  2LLS A;  1BF5 A;  2QAC A;  4OVN F;  1BT6 A;  5D69 A;  2L5X B;  2KGR A;  4C0L A;  4A4C A;  1EJ3 A;  2JNF A;  5DKN A;  1WDC C;  1BLQ A;  1NUB A;  1IWQ A;  1PRW A;  1SYM A;  3NSO A;  1KQM B;  1SW8 A;  1ZUZ A;  2K0J A;  2LE9 B;  4JPZ B;  4Q04 A;  1C7V A;  4GGN A;  2L4H A;  1B47 A;  4WQ3 A;  4YI8 A;  2BBM A;  5DKR A;  4ICB A;  1K9U A;  2NLN A;  4ZCU A;  1SL8 A;  2KI6 D;  1B7T Z;  4I5L B;  1ZFS A;  3OP0 A;  3DF0 B;  2KSP A;  1AJ4 A;  4I5N B;  1NPQ A;  2KI4 B;  1PAL A;  1PSB A;  2RGI A;  3VRR A;  2MLE C;  1SL9 A;  1UHJ A;  1K95 A;  2BL0 B;  1J7R A;  3D0Y B;  4XJK B;  1CMG A;  1CM1 A;  1KWO C;  1RJV A;  3JVT B;  1DJI A;  4D1E A;  1M39 A;  4M2P A;  1RWY A;  3PM8 A;  1A2X A;  1S5G Y;  1ZMZ A;  5KSZ A;  2WCE A;  1KK8 C;  2LMU A;  1PK0 D;  2LP2 A;  1E8A A;  5HKY A;  1YTZ C;  4PE4 A;  3QRX A;  1CFC A;  2LUX A;  1CM4 A;  2M9G A;  2GGM A;  1OOJ A;  1OE9 B;  1CB1 A;  2MHH A;  1JFK A;  2K7B A;  3WHU B;  3CLN A;  1K9P A;  1UWO A;  3EK4 A;  4N1F A;  2Q4U A;  4QJ3 B;  1QJT A;  1TIZ A;  2JOJ A;  1R6P A;  4UPG A;  1Q80 A;  1NCZ A;  2CT9 A;  4MZK A;  2BCX A;  2V53 A;  4OCI A;  4PHN A;  2F2O A;  2H2K A;  4GPL B;  2KGB C;  5G08 A;  1MF8 B;  1XFV O;  1QVI Y;  1S36 A;  1SBJ A;  2M7L A;  2HQ8 A;  3GOF A;  1XFY O;  4PE0 A;  2CNP A;  1IRJ A;  3DF0 A;  1TOP A;  3VGO A;  2K61 A;  3CGA A;  1NX3 A;  3PAL A;  4JQ0 D;  1XFU O;  1G8I A;  2K7D A;  1KQM C;  3D0Y A;  4XJK A;  2KBI A;  2L51 A;  4GFT A;  2BEC A;  4NQG A;  1CLB A;  2ZND A;  1QV0 A;  3FWB A;  1YVH A;  2QPT A;  4P2Y B;  4YGB B;  3VRN A;  1DJZ A;  1EL4 A;  4PHM A;  1JSA A;  2BKI B;  5J3X A;  2LHL A;  1GGZ A;  2KI4 C;  2JU0 A;  3A4U B;  1GQM A;  1J7P A;  1Y1U A;  2BL0 C;  3PFV A;  1TCO B;  4DRW A;  4F0Z B;  1LKJ A;  1JBA A;  1JF0 A;  3JVT C;  5AXI A;  1JF2 A;  3CR5 X;  5DKQ A;  1J1E A;  3CR2 A;  1KCY A;  2OTG B;  1DJG A;  1YVL A;  1MHO A;  2WC8 A;  3TDU A;  1ODB A;  2F8P A;  2M97 A;  2IS9 A;  2KI6 C;  1B8C A;  4OV2 A;  1LA3 A;  2Y5I A;  1B8R A;  1NP8 A;  2M1K B;  4E68 A;  5D7F A;  1TNQ A;  1F4Q A;  3RLZ A;  3TS5 B;  2BBN A;  2AAO A;  1PSR A;  2O60 A;  4YI9 A;  2JZI A;  2PVB A;  2ZKM X;  3FWC A;  1A29 A;  1RK9 A;  4AQI A;  1N2D A;  1NSH A;  3HCM A;  1WRZ A;  2M7N A;  3GK2 A;  3LCP C;  1SCM B;  1NIW A;  1QXP A;  1U5I A;  2M8U A;  2EC6 B;  1S6I A;  1L2O B;  2B1U A;  1S3P A;  2JNX A;  3BOW B;  1EH2 A;  4ETO A;  1K93 D;  3WHT B;  3OB1 B;  1TRF A;  2JRF A;  1YR5 A;  2E6W A;  2M0R A;  1AP4 A;  1QS7 A;  2JXC A;  4DCK A;  1XVJ A;  3I5F B;  1K94 A;  2WND A;  5CSJ A;  4GBA A;  2M1U A;  1OZS A;  4ZCV A;  1QAT A;  2LNK A;  1W7J B;  5AEQ A;  4HRH A;  2EGD A;  4DIR A;  1IJ6 A;  1JUO A;  4MLW A;  5IBW A;  1C07 A;  1YUU A;  2OTG C;  1FI6 A;  1X02 A;  1OSA A;  4NDC A;  2TN4 A;  1QIW A;  1OMR A;  2JT8 A;  4PHJ A;  1MWN A;  1CLL A;  1UHI A;  4MRX A;  3FS7 A;  2PRU A;  4FQO A;  1PVB A;  1LIN A;  2L0P A;  3OB2 B;  2LMV A;  5HKW A;  2K2F A;  2BE4 A;  3KHE A;  3TS5 C;  1QX5 B;  2JTZ A;  2LVI A;  3I5H B;  2KFG A;  2K7O A;  2LMT A;  2MAZ A;  3BOW A;  1YX8 A;  1DGU A;  1SL7 A;  4YRU A;  1REC A;  1UUS A;  1B7T Y;  2AUC A;  1CDP A;  5AAN A;  1L7Z A;  1UHN A;  1FBV A;  5HLO A;  1YRT B;  1TNX A;  1EXR A;  1F54 A;  1SCM C;  1WRK A;  3OX5 A;  4ORC B;  2EC6 C;  1UHK A;  1L2O C;  2ZN9 A;  1AUI B;  4IL1 A;  2BKH B;  3EK8 A;  2KYC A;  3OHM B;  1C7W A;  3KF9 A;  4CID A;  2WOS A;  1DJY A;  4AQJ A;  1CDM A;  3O2P A;  2LC5 A;  3F45 A;  3I5F C;  1Y0V H;  5JJG A;  1V1G A;  1J7Q A;  1XO5 A;  1IQ5 A;  1R2U A;  2M29 A;  2CTN A;  1XFX O;  3IF7 A;  1MXE A;  2F2P A;  4WQ2 A;  1IJ5 A;  1EG4 A;  3O78 A;  2K2A A;  1B9A A;  3BYA A;  2LHI A;  3EVV A;  1M63 B;  1DJW A;  1WRL A;  1DTL A;  3GK4 X;  1XA5 A;  3AKA A;  5JOL A;  1FF1 A;  5KTY A;  3SG3 A;  2MRD A;  3DD4 A;  1RFJ A;  1DMO A;  1F8H A;  5CSI A;  1IH0 A;  1UUR A;  2L98 A;  2KNE A;  3I5H C;  3CZT X;  1U5I B;  3WXA A;  3ZWH A;  1KFU L;  2JWW A;  1QV1 A;  1QLS A;  1D1O A;  1OMV A;  1AK8 A;  1XYD A;  5F6T A;  3SIB A;  1KFU S;  1S26 D;  1QIV A;  3MSE B;  3BUN B;  4YBH B;  5PAL A;  1J7O A;  2I2R E;  1H8B A;  4HSZ A;  5CPV A;  1CKK A;  2M3W A;  2ZNE A;  2OS8 C;  5HLV A;  5AFP A;  2FJU B;  1NX0 A;  4MSP A;  4NDD A;  2KFH A;  1K90 D;  2ZFD A;  1YX7 A;  1PUL A;  1M45 A;  2LM5 A;  1ZOT B;  2NZ0 A;  2EHB A;  1TNP A;  2G9B A;  2PSR A;  2A4J A;  3EKJ A;  3ZNI A;  1KFX L;  4MZL A;  3IQO A;  4HRG A;  2LAN A;  2Y1N A;  2L50 A;  3BXK A;  2F33 A;  1F55 A;  2KHN A;  1KFX S;  1CDL A;  4HRE E;  2LLT A;  1RRO A;  3TDZ A;  2I18 A;  2L4I A;  3SG4 A;  1BR4 B;  4GNK B;  3PSR A;  4BY4 A;  1OMD A;  1W7I B;  3NSL A;  4C0J A;  1CFD A;  2BCA A;  1YRU B;  2SAS A;  3CWG A;  1DVI A;  1A4P A;  1UP5 A;  3KO0 A;  1FW4 A;  1NWD A;  3LK1 A;  2LVJ A;  1CNP A;  1DJH A;  5B8I B;  1S1E A;  1TN4 A;  4YGA A;  3I5G B;  1BOD A;  1NCY A;  2I94 A;  2K8M B;  3PAT A;  1K96 A;  5I2O A;  2HQW A;  1F70 A;  1QTX A;  1XK4 A;  1YUR A;  2O5G A;  1NX1 A;  5ER5 A;  2KFF A;  4MZJ A;  2H61 A;  3CR4 X;  1KK7 Z;  4PAL A;  2JT0 A;  4USL A;  2NXQ A;  3SJS A;  2ZN8 A;  1CDN A;  2LV7 A;  4NDB A;  1F71 A;  5I2L A;  2ISD A;  3I5I B;  3VRQ A;  3AAJ A;  4CFQ A;  1WLZ A;  3AKB A;  4YGE B;  1BR1 B;  3KPX A;  4PCW A;  2PMY A;  4CFR A;  1ALW A;  2KAX A;  2SCP A;  2JT3 A;  2Y1M A;  5K89 A;  1OQP A;  2H61 C;  3CS1 A;  1SRA A;  4JWQ A;  2MA2 A;  3NXA A;  3VRP A;  1ALV A;  1QX2 A;  2JXL A;  2KDH A;  2ZRS A;  2Y4Q A;  3BQ3 A;  4MEW A;  3SG5 A;  2HET A;  3EVU A;  4QJ5 B;  1IQ3 A;  2JQ6 A;  3SG7 A;  5HYD A;  1JFJ A;  1CFP A;  2E30 A;  4I5J A;  4ORA B;  5TNC A;  2HF5 A;  2LAP A;  1SK6 D;  3LK0 A;  1IKU A;  4DUQ A;  1AJ5 A;  4OKH A;  1K9K A;  1A75 A;  1BOC A;  1SKT A;  1HQV A;  1GGW A;  2F3Z A;  1CMF A;  1LVC D;  2OS8 B;  3EVR A;  3SG2 A;  1S5G Z;  1B8L A;  1BJF A;  1DF0 B;  1HT9 A;  2JUL A;  3DVM A;  3H4S E;  1V1F A;  1LXF C;  1SPY A;  3I5G C;  3O6B A;  4WRI A;  1AHR A;  4OR9 B;  4BY5 A;  1TCF A;  3DVJ A;  1K2H A;  4U8D A;  1J55 A;  2BCB A;  3A8R A;  2VRG A;  3SIA A;  2LVK A;  3BUM B;  4FTG A;  3BUX B;  3BUO B;  2LP3 A;  3EKH A;  1LA0 A;  1NCX A;  1WY9 A;  5AER A;  1KQV A;  1SR6 B;  2CCM A;  2COL B;  2R2I A;  1CLM A;  1SMG A;  1YUS A;  1M31 A;  2WCF A;  3DVE A;  3RM1 A;  1S6J A;  4CLN A;  1MXL C;  2DOQ A;  2K7C A;  3JTD B;  2LLU A;  3I5I C;  1QLK A;  1QVI Z;  1G4Y R;  2KQY A;  4R1E A;  4PE1 A;  3DVK A;  1M46 A;  3TUY B;  1VRK A;  2FCD A;  2ZRT A;  1Y1A A;  3O4Y A;  1A03 A;  1N65 A;  1TNW A;  1Y1X A;  3PN7 B;  1AVS A;  3E3R A;  2D8N A;  4MBE A;  1ZAC A;  2OPO A;  1K8U A;  1IGV A;  1DF0 A;  2MLF C;  3CTN A;  3KEV A;  2CBL A;  2AMI A;  3NSK A;  3NSI A;  4AOM A;  2JPT A;  1H4B A;  1QX7 A;  2GGZ A;  4MVF A;  1CTR A;  2F3Y A;  3IQQ A;  2NCO A;  3EK7 A;  3BUW B;  3VRO A;  1UHH A;  1IG5 A;  2JTT A;  1DT7 B;  3LL8 B;  2LVV A;  1SY9 A;  5GQQ C;  4P5O E;  2KQ6 A;  4CPV A;  3PLF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...