1ALVA

Calcium bound domain vi of porcine calpain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALPAIN
publication title Crystal structure of calcium bound domain VI of calpain at 1.9 A resolution and its role in enzyme assembly, regulation, and inhibitor binding.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Calcium binding
total genus 57
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1alvA00
4MRXA 2E6WA 1TNPA 2A4JA 1UURA 2QACA 2KNEA 1CLMA 4ZCUA 4TNCA 1S6JA 3LCPC 1F8HA 1OE9B 1SY9A 1K96A 5K89A 1IJ5A 1QLSA 5CPVA 2JULA 1NX3A 1GGZA 2M9GA 2FCEA 2BBMA 4WRIA 2BCAA 1PSRA 1SW8A 4M2OA 4PCWA 1CKKA 4MZKA 2ZN8A 1IQ3A 1S5GZ 2CT9A 3CS1A 4YGDB 2HQWA 1BMOA 4HREE 1KWOB 5I2OA 1TNWA 1OMDA 2LVIA 2SCPA 3NSKA 1NX1A 3VRNA 2BCXA 2LUXA 1G33A 2BL0B 2I18A 1BR1B 1OMVA 1RROA 3ZWHA 1FI6A 1DJYA 1H4BA 2CCMA 4D1EA 2NCPA 1MR8A 4MRYA 4OVNF 1KFXS 4WQ2A 5AFPA 2LCPA 2EC6B 4AOMA 5PALA 1HQVA 1QIWA 3DVEA 1M31A 5HKWA 1SMGA 1TCOB 2KFGA 4CIDA 1SCMB 2WCBA 3GK2A 3LL8B 3WHTB 5KSZA 2LUCA 2I2RE 1RECA 4AQJA 1W7IB 3SG6A 1DT7B 1A03A 1NCXA 3AAKA 1U5IA 2F2OA 2K0JA 2M29A 1PVAA 1OQPA 1ZOTB 1BF5A 4GNKB 1M45A 2F3YA 1GJYA 1XYDA 1UP5A 1XFXO 2TN4A 4YI8A 1QTXA 4XYNA 1LA3A 3F45A 2ZNDA 1SR6C 1AJ5A 2F33A 2QPTA 1YVHA 4GFTA 5AERA 1AUIB 2E30A 1TNQA 2M0RA 1NYAA 3VRRA 5JJGA 5KTYA 3NXAA 2OTGC 4MN0A 3K21A 4JPZB 1F4QA 3PN7C 5B8IB 3PALA 3I5GB 1A2XA 2K61A 1F71A 4ORBB 1CDMA 1XVJA 2FJUB 1EXRA 1XA5A 3OB2B 5ER5A 1C7WA 1M46A 2L50A 2WNDA 1IGVA 2OS8B 3WHUB 2KSPA 5I2LA 1LINA 4OR9B 1DF0B 3CGAA 1BOCA 4DIRA 1XFUO 1DGVA 1SBJA 1XO5A 1Y1UA 1S5GY 2M1KB 2SASA 2Y4QA 3BXKA 2KGRA 5CSFA 1CMFA 2EHBA 3A4UB 1B8CA 3O78A 4NDDA 1JC2A 4FQOA 2PMYA 4DCKA 4ORAB 3BOWA 1CTRA 1BODA 1MWNA 1CDLA 2Q91A 3NSIA 1XFWO 2NXQA 1YURA 2BECA 3KF9A 1OMRA 2I94A 3IQOA 3TZ1A 4IL1A 2LLTA 2BE6A 1M63B 3TDUA 2PRUA 3O4YA 2KYFA 4GBAA 1EG4A 1F54A 5AXIA 1WY9A 1NIWA 5JOLA 5F6TA 1CM4A 1Y1XA 3LK0A 2LMVA 1A75B 4XJKA 2B1UA 1C07A 1G8IA 2Q4UA 1KK8B 2KBIA 1SPYA 2WC8A 2K8MB 3A8RA 1PK0D 1OOJA 4P2YB 4MVFA 3TUYC 1J7PA 1EH2A 1ALWA 2BCBA 2CXJA 4I5NB 3RLZA 2K7BA 1PALA 1CFPA 1CLBA 4MSPA 1N65A 1QJTA 1SNLA 1CFFA 1V1GA 2JXCA 3FWCA 1K90D 2MJWB 3JTDB 3OHMB 3TDIA 1J7OA 1MXLC 1QLKA 2JNXA 1WRKA 2PSRA 1H8BA 2O60A 1A29A 4M2PA 2LVVA 5CSJA 2KYCA 3CLNA 5CSNA 4PHKA 3VRPA 4CFQA 1RWYA 2JTZA 1UHNA 1UWOA 2JOJA 4CFRA 1NX2A 1SRAA 4NDBA 4JWQA 1AP4A 1B7TY 1FF1A 1WDCC 4F0ZB 2CNPA 2NZ0A 1DJWA 1ZFSA 1F4OA 3SIAA 4PALA 3FWBA 2HF5A 2KAVA 5HYDA 4QJ3B 1IKUA 3I5FB 4YGBB 2JU0A 1BLQA 1W7JB 1TIZA 1FW4A 1K93D 4L9MA 1S1EA 1UHIA 1KSOA 5CSIA 4JQ0D 4QJ4B 1KWOC 2LVJA 3KHEA 2MA2A 1J7RA 1CDPA 3EK8A 5HLVA 3NSLA 1Y0VH 2JRFA 4NQGA 2EGDA 2Y5IA 1AVSA 1D1OA 2LHIA 1UHHA 3EKHA 5HLOA 4UPGA 2BL0C 2PVBA 2KQYA 3SG4A 1JBAA 2ZFDA 3GK4X 2KGBC 5J3XA 3EVUA 2O5GA 1KSMA 5KU1A 2JT8A 2G2BA 4PHMA 1TRFA 2EC6C 2V53A 2ZRTA 4BY5A 1RTP1 4ORCB 2F3ZA 1NP8A 1SCMC 4OCIA 1SCVA 1IH0A 4I5KA 5HKYA 1FBVA 4I5LB 1HT9A 4A4BA 1AHRA 2LP3A 1KCYA 1YUSA 2BKHB 1N2DA 2KFFA 3DVKA 3M0WA 2NLNA 4U8DA 1SR6B 1YTZC 1OZOA 1QXPA 2MHHA 4GUKA 4N5XA 3RM1A 1PRWA 1L2OB 2LANA 2KFHA 3BUXB 3KEVA 1K95A 1B7TZ 2GV5A 3BUWB 4E68A 4R1EA 1CNPA 3TS5B 1F70A 1EG3A 1SK6D 1QVIZ 2JT0A 1TTXA 4PHJA 1RJVA 1WRZA 1ZMZA 3PATA 1DMOA 4QJ5B 2DOQA 3EK7A 1K2HA 1NX0A 1Y1AA 5GQQC 4MZJA 1JWDA 1MF8B 2K2AA 3HCMA 1ALVA 2K7CA 3AKBA 1DJXA 3O2PA 3DF0B 2BE4A 3BUNB 2LLSA 1KQMB 5D7FA 3EKJA 1CFCA 1IG5A 3D0YB 2G9BA 1CM1A 4PDZA 2M7NA 3DD4A 2PASA 3I5GC 1YUTA 4YRUA 4WQ3A 1BJFA 2AAOA 3OB1B 3OX6A 2K7OA 4PE1A 3SG5A 4DUQA 4Q04A 1SYMA 2KI4B 1M39A 3LK1A 1N0YA 1QV1A 3CR4X 3MSEB 1NWDA 2LVKA 2LC5A 3FIAA 1FPWA 2K7DA 4YGAA 3I5HC 1QIVA 2M7LA 4GAOA 1TNXA 1S26D 2KAYA 1YVLA 2ZRSA 3O6BA 1AK8A 3OX5A 1NPQA 1SL8A 3BOWB 1MUXA 1UHJA 2JQ6A 1K9PA 2ZN9A 3CZTX 3GK1A 3KO0A 4GPLB 1EJ3A 2KI6D 2LV7A 3PFVA 1JFKA 1C7VA 1R2UA 2MLEC 2I7AA 2NCOA 1DTLA 2HQ8A 2GGMA 3CR2A 4HRGA 2BBNA 4AQIA 1CMGA 1CB1A 2M8UA 1UHKA 2LLUA 4NDCA 2H61A 3I5IC 4A4CA 1A4PA 4YGCB 1FI5A 2L2EA 1NCYA 1QX5B 3ICBA 1NCZA 3JVTC 1ODBA 2JZIA 1JF2A 4HRHA 3E3RA 1BG1A 4ICBA 1CDNA 1DJIA 2AMIA 3SIBA 1XK4C 1B9AA 1YUUA 4CLNA 1ZUZA 3I5IB 1KK8C 1YRUB 4M2QA 1KQVA 1KFUL 2JTTA 4GGNA 1MHOA 1DVIA 3CR5X 1QX7A 4GGFC 1KK7Y 2LMTA 1GQMA 1S6IA 1XFVO 2ISDA 2LAPA 1B47A 1R6PA 1J1EA 2JT3A 2GGZA 2M97A 3DVMA 2JWWA 3FS7A 3JTDC 1XFYO 1K8UA 5I8NA 1B8RA 1J55A 2H61C 4PE0A 3VGOA 5BPJA 1QVIY 2WCEA 4DRWA 1OSAA 2KBMA 3PLFB 3EVVA 4CPVA 2HPSA 1S3PA 1WDCB 1QX2A 1QV0A 3WNXB 1NSHA 2JPTA 1YX7A 1YRTB 2Y1MA 4MBEA 1WLMA 1QASA 1G4YR 2KAXA 3IQQA 2L4HA 5TNCA 1JF0A 3PSRA 2L98A 3CTNA 5I2QA 4HSZA 1JSAA 2LM5A 2CBLA 2L0PA 4C0KA 3I5FC 1AJ4A 1LKJA 2BKIB 1TCFA 3IF7A 2PALA 1SL7A 3ZNIA 4ETOA 1JUOA 2KI6C 1LA0A 2MLFC 3WXAA 4N1GA 1BU3A 2F2PA 3QRXA 3VRQA 1IWQA 2LMUA 2M1UA 2LHLA 2COLB 3SG2A 2RGIA 2L5XB 2VRGA 5HKZA 1GGWA 1TOPA 2WORA 1U5IB 1DJZA 5AEQA 4OKHA 3SG3A 1QS7A 1WRLA 2FOTA 2KDHA 1EL4A 1KK7Z 1PVBA 2H2KA 2FCDA 5DKRA 2M49B 2MBXA 3NSOA 1RFJA 1YX8A 1B8LA 1VRKA 2WOSA 4PE7A 5FYXA 2IS9A 4MEWA 1IRJA 1CLLA 2JC2A 4YBHB 1DJGA 4DS7A 1Q80A 3DVJA 5DKQA 1MQ1A 2OTGB 1Y6WA 3C1VA 3PN7B 2MRDA 1L2OC 1K94A 3D10A 1SL9A 1F55A 1B1GA 3TS5C 1XFZO 1KFUS 2L51A 4ZCVA 3SJSA 2HETA 3LLEA 2LE9B 1CFDA 1B4CA 1K9KA 1MXEA 4P5OE 1YR5A 4YI9A 3DF0A 1K9UA 3D0YA 4PHNA 1KQMC 3PM8A 1V1FA 2M3WA 2OS8C 1DF0A 1KFXL 1S36A 3KPXA 1LVCD 1LXFC 2AUCA 2P6BB 3EK4A 4BY4A 1BT6A 2OPOA 2KOTA 2KQ6A 1J1DA 2R2IA 2KHNA 1DJHA 1SKTA 1UUSA 4MLWA 1QATA 3BQ3A 1E8AA 3VROA 3BUOB 2KI4C 3I5HB 1BR4B 4PE4A 3TDZA 1WLZA 1JFJA 1NUBA 1J7QA 2LP2A 4FTGA 1TN4A 3HX4A 2JXLA 2ZKMX 2L4IA 3SG7A 4USLA 5IBWA 3CWGA 3EVRA 3AAJA 5DKNA 2K2FA 1IJ6A 1IQ5A 2CTNA 4XJKB 5G08A 1X02A 4OV2A 1A75A 2LNKA 1XK4A 5D69A 5ER4X 4MZLA 2ZNEA 3TUYB 2MAZA 2WCFA 1DGUA 3BUMB 1PSBA 3JVTB 3GOFA 4GGFA 3H4SE 3BYAA 4I5JA 4C0JA 2D8NA 1S6CA 4N1FA 5AANA 1RK9A 1PULA 2F8PA 3OP0A 4YGEB 1L7ZA 4C0LA 3AKAA 1OZSA 2Y1NA 2JNFA 1ZACA
chains in the Genus database with same CATH superfamily
4MRXA 3D78A 2E6WA 1TNPA 2A4JA 1UURA 2QACA 2KNEA 1CLMA 4ZCUA 4TNCA 1S6JA 3LCPC 1F8HA 1OE9B 1SY9A 1K96A 3S0FA 2QEHA 1IJ5A 3VB1A 5K89A 1QLSA 5CPVA 2JULA 1NX3A 1GGZA 2M9GA 2FCEA 2BBMA 2PQLA 4WRIA 2BCAA 1PSRA 1SW8A 4M2OA 4PCWA 1CKKA 2WCJA 2ZN8A 4MZKA 1IQ3A 1S5GZ 2CT9A 3CS1A 4YGDB 2HQWA 1BMOA 1DQEA 2JPOA 4HREE 1KWOB 5I2OA 1TNWA 1OMDA 2LVIA 2SCPA 3NSKA 1NX1A 3VRNA 3OGNA 1W9ZA 2BCXA 4JKTA 2LUXA 1G33A 2BL0B 2I18A 1BR1B 1OMVA 1RROA 3B88A 3ZWHA 1DJYA 1FI6A 2CCMA 4D1EA 1H4BA 2NCPA 5HL1A 1MR8A 4MRYA 4OVNF 1KFXS 4WQ2A 5AFPA 2LCPA 2EC6B 4AOMA 5PALA 1HQVA 1QIWA 2GTEA 3DVEA 1M31A 5HKWA 1SMGA 1TCOB 2KFGA 2L2CA 1SCMB 2WCBA 3GK2A 3LL8B 3WHTB 4CIDA 5KSZA 2LUCA 2I2RE 2WCKA 1RECA 1TUJA 4AQJA 2KPHA 1W7IB 2K60A 3SG6A 1DT7B 1A03A 1NCXA 3AAKA 1U5IA 2F2OA 2K0JA 2M29A 1PVAA 3N7HA 1OQPA 1ZOTB 2QEVA 4GNKB 1BF5A 3D76A 1M45A 2F3YA 1GJYA 1XYDA 1UP5A 1XFXO 2TN4A 5BPJA 4YI8A 1QTXA 4XYNA 1LA3A 3F45A 2ZNDA 1SR6C 1AJ5A 2F33A 2QPTA 1Z2CB 1YVHA 4GFTA 5AERA 1AUIB 2E30A 1TNQA 2QDIA 2M0RA 1NYAA 3VRRA 3R72A 5JJGA 5KTYA 3NXAA 3UO9A 2OTGC 4MN0A 2WCHA 3K21A 4JPZB 1F4QA 3PN7C 5B8IB 3PALA 3I5GB 3CZ0A 1TUZA 3SS3A 1A2XA 2K61A 1F71A 4ORBB 1CDMA 3V2LA 1XVJA 2FJUB 4INWA 1EXRA 1XA5A 3OB2B 5ER5A 1C7WA 1M46A 2L50A 2WNDA 1IGVA 2OS8B 3WHUB 2KSPA 5I2LA 1LINA 4OR9B 1DF0B 3CGAA 1BOCA 4DIRA 1XFUO 1DGVA 1SBJA 1XO5A 1Y1UA 1S5GY 2M1KB 2SASA 2Y4QA 3BXKA 2KGRA 5CSFA 1CMFA 2EHBA 3A4UB 1B8CA 1T14A 3CABA 3O78A 4NDDA 3L4LA 1JC2A 2WCLA 4FQOA 2PMYA 4DCKA 4ORAB 3BOWA 1CTRA 1BODA 1MWNA 1CDLA 2Q91A 3NSIA 1XFWO 1XFRA 2NXQA 1YURA 2BECA 3KF9A 1OMRA 2I94A 3IQOA 3TZ1A 4IL1A 2LLTA 2BE6A 1M63B 3B7AA 3TDUA 2PRUA 3O4YA 2KYFA 4GBAA 1EG4A 1F54A 5AXIA 1WY9A 1NIWA 5JOLA 5F6TA 1CM4A 5FI7A 1Y1XA 3LK0A 2LMVA 3D73A 1A75B 4XJKA 2B1UA 1C07A 1G8IA 2Q4UA 1KK8B 2KBIA 1SPYA 2WC8A 2K8MB 3A8RA 1PK0D 1OOJA 4P2YB 4MVFA 3TUYC 1J7PA 1EH2A 1ALWA 2BCBA 2CXJA 4I5NB 3RLZA 2K7BA 1PALA 3BFBA 1CFPA 2FJYA 1CLBA 4MSPA 1N65A 1QJTA 1SNLA 1CFFA 1V1GA 2JXCA 3FWCA 1K90D 2MJWB 3JTDB 3OHMB 3TDIA 1J7OA 3BJHA 3DY9A 1MXLC 1QLKA 1IIOA 2JNXA 1WRKA 2PSRA 1H8BA 2O60A 1A29A 3PJIA 4M2PA 2LVVA 5CSJA 3NHIA 2KYCA 3CLNA 5CSNA 4PHKA 3VRPA 4CFQA 2PYQA 3OBVA 1RWYA 2JTZA 1UHNA 1UWOA 2JOJA 4CFRA 1NX2A 1SRAA 4NDBA 4JWQA 1AP4A 1B7TY 1FF1A 1WDCC 4F0ZB 2QEBA 2CNPA 2NZ0A 1DJWA 3B6XA 1ZFSA 1F4OA 3SIAA 4PALA 3FWBA 2HF5A 5EL2A 2KAVA 3L4AA 5HYDA 4QJ3B 1IKUA 3I5FB 4YGBB 2JU0A 1BLQA 1W7JB 1TIZA 1FW4A 2QEOA 1K93D 4L9MA 1S1EA 1UHIA 3S0DA 1KSOA 3B86A 4JQ0D 5CSIA 4QJ4B 1KWOC 2LVJA 3KHEA 2MA2A 1J7RA 1CDPA 3EK8A 5HLVA 3NSLA 4PT1A 1Y0VH 2JRFA 4NQGA 2EGDA 2Y5IA 1AVSA 1D1OA 2LHIA 1UHHA 2KLDA 3EKHA 3PM2A 5HLOA 4UPGA 2BL0C 2PVBA 2KQYA 3SG4A 1JBAA 2ZFDA 3GK4X 2KGBC 1DEKA 5J3XA 3EVUA 2O5GA 1KSMA 5KU1A 2JT8A 2G2BA 4PHMA 1TRFA 2EC6C 2V53A 2ZRTA 4BY5A 3B87A 1RTP1 1OOFA 4ORCB 2F3ZA 1NP8A 1SCMC 4OCIA 1SCVA 1IH0A 4I5KA 5HKYA 1FBVA 4I5LB 1HT9A 4A4BA 3S0EA 1AHRA 2ERBA 4FQTA 1OOHA 3DYEA 2LP3A 1KCYA 1YUSA 4KYNA 3S0GA 2BKHB 3L47A 1N2DA 2KFFA 3DVKA 2L5YA 2NLNA 3M0WA 1OOIX 4U8DA 1SR6B 1YTZC 1OZOA 1QXPA 2MHHA 4GUKA 4N5XA 3RM1A 1PRWA 1L2OB 2LANA 2KFHA 3BUXB 3KEVA 1K95A 1B7TZ 2GV5A 3BUWB 4E68A 4R1EA 1CNPA 3TS5B 1F70A 1EG3A 1SK6D 1QVIZ 2JT0A 1TTXA 4PHJA 1RJVA 1WRZA 1ZMZA 3PATA 1DMOA 4QJ5B 2DOQA 3EK7A 1K2HA 1NX0A 3DXLA 1Y1AA 4JD9A 4MZJA 5GQQC 3RZSA 1MF8B 2K2AA 1JWDA 3HCMA 1ALVA 2K7CA 3AKBA 1DJXA 3O2PA 3DF0B 2BE4A 3BUNB 2LLSA 1KQMB 5D7FA 3EKJA 1CFCA 1IG5A 3D0YB 2G9BA 1CM1A 3IVTA 4PDZA 2M7NA 3DD4A 2PASA 3I5GC 1YUTA 3D75A 4YRUA 4WQ3A 1BJFA 2AAOA 3OB1B 3OX6A 2K7OA 3CDNA 4PE1A 3SG5A 4DUQA 4Q04A 1SYMA 2KI4B 1M39A 3LK1A 1N0YA 1QV1A 3CR4X 3MSEB 1NWDA 2LVKA 2LC5A 3CYZA 3FIAA 1C3YA 4INXA 1FPWA 2K7DA 4YGAA 3I5HC 2P71A 1QIVA 2M7LA 3QMEA 4GAOA 1TNXA 1S26D 2KAYA 3BFAA 1YVLA 2ZRSA 3O6BA 1AK8A 3OX5A 1NPQA 1SL8A 3BOWB 1MUXA 1UHJA 2JQ6A 1K9PA 2ZN9A 3CZTX 3GK1A 3KO0A 4GPLB 1EJ3A 2KI6D 2LV7A 3PFVA 3D77A 1JFKA 1C7VA 1R2UA 2MLEC 5DICA 2I7AA 2NCOA 1DTLA 2HQ8A 2GGMA 3CR2A 1GM0A 4HRGA 2BBNA 4AQIA 1CMGA 1CB1A 2M8UA 1UHKA 2LLUA 4NDCA 2H61A 3I5IC 4A4CA 1A4PA 4YGCB 1FI5A 2L2EA 1NCYA 1QX5B 3ICBA 1NCZA 3JVTC 3Q8IA 1ODBA 1C3ZA 1JF2A 2JZIA 3E3RA 4HRHA 1BG1A 4ICBA 1CDNA 1DJIA 2AMIA 4IJ7A 3SIBA 1XK4C 1B9AA 1YUUA 4CLNA 1ZUZA 3I5IB 1KK8C 1YRUB 4M2QA 1KQVA 1KFUL 2JTTA 4GGNA 1MHOA 1DVIA 3CR5X 1QX7A 4GGFC 1KK7Y 2LMTA 1GQMA 1S6IA 1XFVO 2ISDA 2LAPA 1B47A 1R6PA 1J1EA 2JT3A 2GGZA 2M97A 3DVMA 2JWWA 1DC1A 3FS7A 3JTDC 1XFYO 1K8UA 5I8NA 1B8RA 1J55A 2H61C 4PE0A 3VGOA 1P28A 1QVIY 2WCEA 4DRWA 1OSAA 2KBMA 5I94A 3PLFB 3EVVA 4CPVA 2HPSA 1S3PA 1WDCB 3FE6A 1QX2A 1QV0A 3R1VA 1NSHA 3WNXB 2JPTA 1YX7A 1YRTB 2Y1MA 4MBEA 1WLMA 2BAPA 1QASA 2BNXA 1G4YR 2KAXA 3IQQA 2L4HA 5TNCA 1JF0A 2WCMA 3PSRA 2L98A 3CTNA 5I2QA 2H8VA 4HSZA 2LM5A 1JSAA 2CBLA 2L0PA 4OZDA 3I5FC 1AJ4A 1LKJA 2BKIB 1TCFA 3IF7A 4C0KA 2PALA 1SL7A 3ZNIA 4ETOA 1JUOA 2KI6C 1LA0A 1OOGA 2MLFC 3FE8A 3WXAA 4N1GA 1BU3A 2WC6A 2F2PA 3FE9A 3QRXA 3VRQA 3NGVA 1IWQA 2LMUA 2M1UA 2LHLA 2COLB 3SG2A 2RGIA 2L5XB 2VRGA 5HKZA 1GGWA 1TOPA 2WORA 1U5IB 1DJZA 5AEQA 2YGUA 4OKHA 3SG3A 1QS7A 1QWVA 1WRLA 2FOTA 2KDHA 3S0BA 3SS4A 1EL4A 1KK7Z 1PVBA 2H2KA 2FCDA 3CZ2A 5DKRA 2M49B 2MBXA 3NSOA 1RFJA 3DZTA 1YX8A 1B8LA 1VRKA 2WOSA 1SSEB 4PE7A 5FYXA 2IS9A 4MEWA 1IRJA 1CLLA 2P70A 2JC2A 4YBHB 3NHTA 1DJGA 4DS7A 1Q80A 3DVJA 5DKQA 1MQ1A 2OTGB 1Y6WA 3C1VA 1LS8A 1DELA 3SS5A 3PN7B 2MRDA 3UNWA 1L2OC 3R1OA 1K94A 1Z4HA 3D10A 1SL9A 3O4XA 3D74A 1F55A 1B1GA 3TS5C 1XFZO 1KFUS 2L51A 4ZCVA 3SJSA 2HETA 3LLEA 2LE9B 1CFDA 1B4CA 1K9KA 1MXEA 4P5OE 1YR5A 4YI9A 3DF0A 1K9UA 3D0YA 4PHNA 5D3OA 1KQMC 3PM8A 1V1FA 2M3WA 2OS8C 1DF0A 1KFXL 1S36A 3KPXA 2KLEA 1LVCD 1LXFC 2AUCA 2P6BB 3EK4A 4BY4A 1BT6A 2OPOA 2KOTA 2KQ6A 1J1DA 2R2IA 4F7FA 2KHNA 1DJHA 1SKTA 1UUSA 4MLWA 1QATA 3BQ3A 1E8AA 3VROA 3BUOB 3CZ1A 3EG5B 3S0AA 2KI4C 3I5HB 1BR4B 4PE4A 3TDZA 1WLZA 1JFJA 1NUBA 1J7QA 2LP2A 4FTGA 3BFHA 1TN4A 3HX4A 3R1PA 2JXLA 2ZKMX 2L4IA 3SG7A 4USLA 5IBWA 5FI6A 5FI2A 2WC5A 3CWGA 3EVRA 1ORGA 3AAJA 5DKNA 2K2FA 1IJ6A 1IQ5A 2CTNA 4XJKB 5G08A 1X02A 4OV2A 1A75A 2LNKA 1XK4A 5D69A 5ER4X 4MZLA 2ZNEA 3TUYB 2MAZA 2WCFA 1DGUA 1TWOA 3BUMB 1PSBA 3K1EA 3JVTB 3GOFA 4GGFA 3H4SE 3BYAA 4I5JA 4C0JA 2D8NA 1S6CA 4N1FA 1OW4A 5AANA 1RK9A 1PULA 2F8PA 3OP0A 4YGEB 1L7ZA 4C0LA 3AKAA 1OZSA 2Y1NA 2JNFA 1ZACA
chains in the Genus database with same CATH topology
4MRXA 2E6WA 1TNPA 2A4JA 1UURA 2QACA 2KNEA 1CLMA 4ZCUA 4TNCA 1S6JA 3LCPC 1F8HA 1OE9B 1SY9A 1K96A 5K89A 1IJ5A 1QLSA 5CPVA 2JULA 1NX3A 1GGZA 2M9GA 2FCEA 2BBMA 4WRIA 2BCAA 1PSRA 1SW8A 4M2OA 4PCWA 1CKKA 4MZKA 2ZN8A 1IQ3A 1S5GZ 2CT9A 3CS1A 4YGDB 2HQWA 1BMOA 4HREE 1KWOB 5I2OA 1TNWA 1OMDA 2LVIA 2SCPA 3NSKA 1NX1A 3VRNA 2BCXA 2LUXA 1G33A 2BL0B 2I18A 1BR1B 1OMVA 1RROA 3ZWHA 1FI6A 1DJYA 1H4BA 2CCMA 4D1EA 2NCPA 1MR8A 4MRYA 4OVNF 1KFXS 4WQ2A 5AFPA 2LCPA 2EC6B 4AOMA 5PALA 1HQVA 1QIWA 3DVEA 1M31A 5HKWA 1SMGA 1TCOB 2KFGA 4CIDA 1SCMB 2WCBA 3GK2A 3LL8B 3WHTB 5KSZA 2LUCA 2I2RE 1RECA 4AQJA 1W7IB 3SG6A 1DT7B 1A03A 1NCXA 3AAKA 1U5IA 2F2OA 2K0JA 2M29A 1PVAA 1OQPA 1ZOTB 1BF5A 4GNKB 1M45A 2F3YA 1GJYA 1XYDA 1UP5A 1XFXO 2TN4A 4YI8A 1QTXA 4XYNA 1LA3A 3F45A 2ZNDA 1SR6C 1AJ5A 2F33A 2QPTA 1YVHA 4GFTA 5AERA 1AUIB 2E30A 1TNQA 2M0RA 1NYAA 3VRRA 5JJGA 5KTYA 3NXAA 2OTGC 4MN0A 3K21A 4JPZB 1F4QA 3PN7C 5B8IB 3PALA 3I5GB 1A2XA 2K61A 1F71A 4ORBB 1CDMA 1XVJA 2FJUB 1EXRA 1XA5A 3OB2B 5ER5A 1C7WA 1M46A 2L50A 2WNDA 1IGVA 2OS8B 3WHUB 2KSPA 5I2LA 1LINA 4OR9B 1DF0B 3CGAA 1BOCA 4DIRA 1XFUO 1DGVA 1SBJA 1XO5A 1Y1UA 1S5GY 2M1KB 2SASA 2Y4QA 3BXKA 2KGRA 5CSFA 1CMFA 2EHBA 3A4UB 1B8CA 3O78A 4NDDA 1JC2A 4FQOA 2PMYA 4DCKA 4ORAB 3BOWA 1CTRA 1BODA 1MWNA 1CDLA 2Q91A 3NSIA 1XFWO 2NXQA 1YURA 2BECA 3KF9A 1OMRA 2I94A 3IQOA 3TZ1A 4IL1A 2LLTA 2BE6A 1M63B 3TDUA 2PRUA 3O4YA 2KYFA 4GBAA 1EG4A 1F54A 5AXIA 1WY9A 1NIWA 5JOLA 5F6TA 1CM4A 1Y1XA 3LK0A 2LMVA 1A75B 4XJKA 2B1UA 1C07A 1G8IA 2Q4UA 1KK8B 2KBIA 1SPYA 2WC8A 2K8MB 3A8RA 1PK0D 1OOJA 4P2YB 4MVFA 3TUYC 1J7PA 1EH2A 1ALWA 2BCBA 2CXJA 4I5NB 3RLZA 2K7BA 1PALA 1CFPA 1CLBA 4MSPA 1N65A 1QJTA 1SNLA 1CFFA 1V1GA 2JXCA 3FWCA 1K90D 2MJWB 3JTDB 3OHMB 3TDIA 1J7OA 1MXLC 1QLKA 2JNXA 1WRKA 2PSRA 1H8BA 2O60A 1A29A 4M2PA 2LVVA 5CSJA 2KYCA 3CLNA 5CSNA 4PHKA 3VRPA 4CFQA 1RWYA 2JTZA 1UHNA 1UWOA 2JOJA 4CFRA 1NX2A 1SRAA 4NDBA 4JWQA 1AP4A 1B7TY 1FF1A 1WDCC 4F0ZB 2CNPA 2NZ0A 1DJWA 1ZFSA 1F4OA 3SIAA 4PALA 3FWBA 2HF5A 2KAVA 5HYDA 4QJ3B 1IKUA 3I5FB 4YGBB 2JU0A 1BLQA 1W7JB 1TIZA 1FW4A 1K93D 4L9MA 1S1EA 1UHIA 1KSOA 5CSIA 4JQ0D 4QJ4B 1KWOC 2LVJA 3KHEA 2MA2A 1J7RA 1CDPA 3EK8A 5HLVA 3NSLA 1Y0VH 2JRFA 4NQGA 2EGDA 2Y5IA 1AVSA 1D1OA 2LHIA 1UHHA 3EKHA 5HLOA 4UPGA 2BL0C 2PVBA 2KQYA 3SG4A 1JBAA 2ZFDA 3GK4X 2KGBC 5J3XA 3EVUA 2O5GA 1KSMA 5KU1A 2JT8A 2G2BA 4PHMA 1TRFA 2EC6C 2V53A 2ZRTA 4BY5A 1RTP1 4ORCB 2F3ZA 1NP8A 1SCMC 4OCIA 1SCVA 1IH0A 4I5KA 5HKYA 1FBVA 4I5LB 1HT9A 4A4BA 1AHRA 2LP3A 1KCYA 1YUSA 2BKHB 1N2DA 2KFFA 3DVKA 3M0WA 2NLNA 4U8DA 1SR6B 1YTZC 1OZOA 1QXPA 2MHHA 4GUKA 4N5XA 3RM1A 1PRWA 1L2OB 2LANA 2KFHA 3BUXB 3KEVA 1K95A 1B7TZ 2GV5A 3BUWB 4E68A 4R1EA 1CNPA 3TS5B 1F70A 1EG3A 1SK6D 1QVIZ 2JT0A 1TTXA 4PHJA 1RJVA 1WRZA 1ZMZA 3PATA 1DMOA 4QJ5B 2DOQA 3EK7A 1K2HA 1NX0A 1Y1AA 5GQQC 4MZJA 1JWDA 1MF8B 2K2AA 3HCMA 1ALVA 2K7CA 3AKBA 1DJXA 3O2PA 3DF0B 2BE4A 3BUNB 2LLSA 1KQMB 5D7FA 3EKJA 1CFCA 1IG5A 3D0YB 2G9BA 1CM1A 4PDZA 2M7NA 3DD4A 2PASA 3I5GC 1YUTA 4YRUA 4WQ3A 1BJFA 2AAOA 3OB1B 3OX6A 2K7OA 4PE1A 3SG5A 4DUQA 4Q04A 1SYMA 2KI4B 1M39A 3LK1A 1N0YA 1QV1A 3CR4X 3MSEB 1NWDA 2LVKA 2LC5A 3FIAA 1FPWA 2K7DA 4YGAA 3I5HC 1QIVA 2M7LA 4GAOA 1TNXA 1S26D 2KAYA 1YVLA 2ZRSA 3O6BA 1AK8A 3OX5A 1NPQA 1SL8A 3BOWB 1MUXA 1UHJA 2JQ6A 1K9PA 2ZN9A 3CZTX 3GK1A 3KO0A 4GPLB 1EJ3A 2KI6D 2LV7A 3PFVA 1JFKA 1C7VA 1R2UA 2MLEC 2I7AA 2NCOA 1DTLA 2HQ8A 2GGMA 3CR2A 4HRGA 2BBNA 4AQIA 1CMGA 1CB1A 2M8UA 1UHKA 2LLUA 4NDCA 2H61A 3I5IC 4A4CA 1A4PA 4YGCB 1FI5A 2L2EA 1NCYA 1QX5B 3ICBA 1NCZA 3JVTC 1ODBA 2JZIA 1JF2A 4HRHA 3E3RA 1BG1A 4ICBA 1CDNA 1DJIA 2AMIA 3SIBA 1XK4C 1B9AA 1YUUA 4CLNA 1ZUZA 3I5IB 1KK8C 1YRUB 4M2QA 1KQVA 1KFUL 2JTTA 4GGNA 1MHOA 1DVIA 3CR5X 1QX7A 4GGFC 1KK7Y 2LMTA 1GQMA 1S6IA 1XFVO 2ISDA 2LAPA 1B47A 1R6PA 1J1EA 2JT3A 2GGZA 2M97A 3DVMA 2JWWA 3FS7A 3JTDC 1XFYO 1K8UA 5I8NA 1B8RA 1J55A 2H61C 4PE0A 3VGOA 5BPJA 1QVIY 2WCEA 4DRWA 1OSAA 2KBMA 3PLFB 3EVVA 4CPVA 2HPSA 1S3PA 1WDCB 1QX2A 1QV0A 3WNXB 1NSHA 2JPTA 1YX7A 1YRTB 2Y1MA 4MBEA 1WLMA 1QASA 1G4YR 2KAXA 3IQQA 2L4HA 5TNCA 1JF0A 3PSRA 2L98A 3CTNA 5I2QA 4HSZA 1JSAA 2LM5A 2CBLA 2L0PA 4C0KA 3I5FC 1AJ4A 1LKJA 2BKIB 1TCFA 3IF7A 2PALA 1SL7A 3ZNIA 4ETOA 1JUOA 2KI6C 1LA0A 2MLFC 3WXAA 4N1GA 1BU3A 2F2PA 3QRXA 3VRQA 1IWQA 2LMUA 2M1UA 2LHLA 2COLB 3SG2A 2RGIA 2L5XB 2VRGA 5HKZA 1GGWA 1TOPA 2WORA 1U5IB 1DJZA 5AEQA 4OKHA 3SG3A 1QS7A 1WRLA 2FOTA 2KDHA 1EL4A 1KK7Z 1PVBA 2H2KA 2FCDA 5DKRA 2M49B 2MBXA 3NSOA 1RFJA 1YX8A 1B8LA 1VRKA 2WOSA 4PE7A 5FYXA 2IS9A 4MEWA 1IRJA 1CLLA 2JC2A 4YBHB 1DJGA 4DS7A 1Q80A 3DVJA 5DKQA 1MQ1A 2OTGB 1Y6WA 3C1VA 3PN7B 2MRDA 1L2OC 1K94A 3D10A 1SL9A 1F55A 1B1GA 3TS5C 1XFZO 1KFUS 2L51A 4ZCVA 3SJSA 2HETA 3LLEA 2LE9B 1CFDA 1B4CA 1K9KA 1MXEA 4P5OE 1YR5A 4YI9A 3DF0A 1K9UA 3D0YA 4PHNA 1KQMC 3PM8A 1V1FA 2M3WA 2OS8C 1DF0A 1KFXL 1S36A 3KPXA 1LVCD 1LXFC 2AUCA 2P6BB 3EK4A 4BY4A 1BT6A 2OPOA 2KOTA 2KQ6A 1J1DA 2R2IA 2KHNA 1DJHA 1SKTA 1UUSA 4MLWA 1QATA 3BQ3A 1E8AA 3VROA 3BUOB 2KI4C 3I5HB 1BR4B 4PE4A 3TDZA 1WLZA 1JFJA 1NUBA 1J7QA 2LP2A 4FTGA 1TN4A 3HX4A 2JXLA 2ZKMX 2L4IA 3SG7A 4USLA 5IBWA 3CWGA 3EVRA 3AAJA 5DKNA 2K2FA 1IJ6A 1IQ5A 2CTNA 4XJKB 5G08A 1X02A 4OV2A 1A75A 2LNKA 1XK4A 5D69A 5ER4X 4MZLA 2ZNEA 3TUYB 2MAZA 2WCFA 1DGUA 3BUMB 1PSBA 3JVTB 3GOFA 4GGFA 3H4SE 3BYAA 4I5JA 4C0JA 2D8NA 1S6CA 4N1FA 5AANA 1RK9A 1PULA 2F8PA 3OP0A 4YGEB 1L7ZA 4C0LA 3AKAA 1OZSA 2Y1NA 2JNFA 1ZACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRX A;  2E6W A;  1TNP A;  2A4J A;  1UUR A;  2QAC A;  2KNE A;  1CLM A;  4ZCU A;  4TNC A;  1S6J A;  3LCP C;  1F8H A;  1OE9 B;  1SY9 A;  1K96 A;  5K89 A;  1IJ5 A;  1QLS A;  5CPV A;  2JUL A;  1NX3 A;  1GGZ A;  2M9G A;  2FCE A;  2BBM A;  4WRI A;  2BCA A;  1PSR A;  1SW8 A;  4M2O A;  4PCW A;  1CKK A;  4MZK A;  2ZN8 A;  1IQ3 A;  1S5G Z;  2CT9 A;  3CS1 A;  4YGD B;  2HQW A;  1BMO A;  4HRE E;  1KWO B;  5I2O A;  1TNW A;  1OMD A;  2LVI A;  2SCP A;  3NSK A;  1NX1 A;  3VRN A;  2BCX A;  2LUX A;  1G33 A;  2BL0 B;  2I18 A;  1BR1 B;  1OMV A;  1RRO A;  3ZWH A;  1FI6 A;  1DJY A;  1H4B A;  2CCM A;  4D1E A;  2NCP A;  1MR8 A;  4MRY A;  4OVN F;  1KFX S;  4WQ2 A;  5AFP A;  2LCP A;  2EC6 B;  4AOM A;  5PAL A;  1HQV A;  1QIW A;  3DVE A;  1M31 A;  5HKW A;  1SMG A;  1TCO B;  2KFG A;  4CID A;  1SCM B;  2WCB A;  3GK2 A;  3LL8 B;  3WHT B;  5KSZ A;  2LUC A;  2I2R E;  1REC A;  4AQJ A;  1W7I B;  3SG6 A;  1DT7 B;  1A03 A;  1NCX A;  3AAK A;  1U5I A;  2F2O A;  2K0J A;  2M29 A;  1PVA A;  1OQP A;  1ZOT B;  1BF5 A;  4GNK B;  1M45 A;  2F3Y A;  1GJY A;  1XYD A;  1UP5 A;  1XFX O;  2TN4 A;  4YI8 A;  1QTX A;  4XYN A;  1LA3 A;  3F45 A;  2ZND A;  1SR6 C;  1AJ5 A;  2F33 A;  2QPT A;  1YVH A;  4GFT A;  5AER A;  1AUI B;  2E30 A;  1TNQ A;  2M0R A;  1NYA A;  3VRR A;  5JJG A;  5KTY A;  3NXA A;  2OTG C;  4MN0 A;  3K21 A;  4JPZ B;  1F4Q A;  3PN7 C;  5B8I B;  3PAL A;  3I5G B;  1A2X A;  2K61 A;  1F71 A;  4ORB B;  1CDM A;  1XVJ A;  2FJU B;  1EXR A;  1XA5 A;  3OB2 B;  5ER5 A;  1C7W A;  1M46 A;  2L50 A;  2WND A;  1IGV A;  2OS8 B;  3WHU B;  2KSP A;  5I2L A;  1LIN A;  4OR9 B;  1DF0 B;  3CGA A;  1BOC A;  4DIR A;  1XFU O;  1DGV A;  1SBJ A;  1XO5 A;  1Y1U A;  1S5G Y;  2M1K B;  2SAS A;  2Y4Q A;  3BXK A;  2KGR A;  5CSF A;  1CMF A;  2EHB A;  3A4U B;  1B8C A;  3O78 A;  4NDD A;  1JC2 A;  4FQO A;  2PMY A;  4DCK A;  4ORA B;  3BOW A;  1CTR A;  1BOD A;  1MWN A;  1CDL A;  2Q91 A;  3NSI A;  1XFW O;  2NXQ A;  1YUR A;  2BEC A;  3KF9 A;  1OMR A;  2I94 A;  3IQO A;  3TZ1 A;  4IL1 A;  2LLT A;  2BE6 A;  1M63 B;  3TDU A;  2PRU A;  3O4Y A;  2KYF A;  4GBA A;  1EG4 A;  1F54 A;  5AXI A;  1WY9 A;  1NIW A;  5JOL A;  5F6T A;  1CM4 A;  1Y1X A;  3LK0 A;  2LMV A;  1A75 B;  4XJK A;  2B1U A;  1C07 A;  1G8I A;  2Q4U A;  1KK8 B;  2KBI A;  1SPY A;  2WC8 A;  2K8M B;  3A8R A;  1PK0 D;  1OOJ A;  4P2Y B;  4MVF A;  3TUY C;  1J7P A;  1EH2 A;  1ALW A;  2BCB A;  2CXJ A;  4I5N B;  3RLZ A;  2K7B A;  1PAL A;  1CFP A;  1CLB A;  4MSP A;  1N65 A;  1QJT A;  1SNL A;  1CFF A;  1V1G A;  2JXC A;  3FWC A;  1K90 D;  2MJW B;  3JTD B;  3OHM B;  3TDI A;  1J7O A;  1MXL C;  1QLK A;  2JNX A;  1WRK A;  2PSR A;  1H8B A;  2O60 A;  1A29 A;  4M2P A;  2LVV A;  5CSJ A;  2KYC A;  3CLN A;  5CSN A;  4PHK A;  3VRP A;  4CFQ A;  1RWY A;  2JTZ A;  1UHN A;  1UWO A;  2JOJ A;  4CFR A;  1NX2 A;  1SRA A;  4NDB A;  4JWQ A;  1AP4 A;  1B7T Y;  1FF1 A;  1WDC C;  4F0Z B;  2CNP A;  2NZ0 A;  1DJW A;  1ZFS A;  1F4O A;  3SIA A;  4PAL A;  3FWB A;  2HF5 A;  2KAV A;  5HYD A;  4QJ3 B;  1IKU A;  3I5F B;  4YGB B;  2JU0 A;  1BLQ A;  1W7J B;  1TIZ A;  1FW4 A;  1K93 D;  4L9M A;  1S1E A;  1UHI A;  1KSO A;  5CSI A;  4JQ0 D;  4QJ4 B;  1KWO C;  2LVJ A;  3KHE A;  2MA2 A;  1J7R A;  1CDP A;  3EK8 A;  5HLV A;  3NSL A;  1Y0V H;  2JRF A;  4NQG A;  2EGD A;  2Y5I A;  1AVS A;  1D1O A;  2LHI A;  1UHH A;  3EKH A;  5HLO A;  4UPG A;  2BL0 C;  2PVB A;  2KQY A;  3SG4 A;  1JBA A;  2ZFD A;  3GK4 X;  2KGB C;  5J3X A;  3EVU A;  2O5G A;  1KSM A;  5KU1 A;  2JT8 A;  2G2B A;  4PHM A;  1TRF A;  2EC6 C;  2V53 A;  2ZRT A;  4BY5 A;  1RTP 1;  4ORC B;  2F3Z A;  1NP8 A;  1SCM C;  4OCI A;  1SCV A;  1IH0 A;  4I5K A;  5HKY A;  1FBV A;  4I5L B;  1HT9 A;  4A4B A;  1AHR A;  2LP3 A;  1KCY A;  1YUS A;  2BKH B;  1N2D A;  2KFF A;  3DVK A;  3M0W A;  2NLN A;  4U8D A;  1SR6 B;  1YTZ C;  1OZO A;  1QXP A;  2MHH A;  4GUK A;  4N5X A;  3RM1 A;  1PRW A;  1L2O B;  2LAN A;  2KFH A;  3BUX B;  3KEV A;  1K95 A;  1B7T Z;  2GV5 A;  3BUW B;  4E68 A;  4R1E A;  1CNP A;  3TS5 B;  1F70 A;  1EG3 A;  1SK6 D;  1QVI Z;  2JT0 A;  1TTX A;  4PHJ A;  1RJV A;  1WRZ A;  1ZMZ A;  3PAT A;  1DMO A;  4QJ5 B;  2DOQ A;  3EK7 A;  1K2H A;  1NX0 A;  1Y1A A;  5GQQ C;  4MZJ A;  1JWD A;  1MF8 B;  2K2A A;  3HCM A;  1ALV A;  2K7C A;  3AKB A;  1DJX A;  3O2P A;  3DF0 B;  2BE4 A;  3BUN B;  2LLS A;  1KQM B;  5D7F A;  3EKJ A;  1CFC A;  1IG5 A;  3D0Y B;  2G9B A;  1CM1 A;  4PDZ A;  2M7N A;  3DD4 A;  2PAS A;  3I5G C;  1YUT A;  4YRU A;  4WQ3 A;  1BJF A;  2AAO A;  3OB1 B;  3OX6 A;  2K7O A;  4PE1 A;  3SG5 A;  4DUQ A;  4Q04 A;  1SYM A;  2KI4 B;  1M39 A;  3LK1 A;  1N0Y A;  1QV1 A;  3CR4 X;  3MSE B;  1NWD A;  2LVK A;  2LC5 A;  3FIA A;  1FPW A;  2K7D A;  4YGA A;  3I5H C;  1QIV A;  2M7L A;  4GAO A;  1TNX A;  1S26 D;  2KAY A;  1YVL A;  2ZRS A;  3O6B A;  1AK8 A;  3OX5 A;  1NPQ A;  1SL8 A;  3BOW B;  1MUX A;  1UHJ A;  2JQ6 A;  1K9P A;  2ZN9 A;  3CZT X;  3GK1 A;  3KO0 A;  4GPL B;  1EJ3 A;  2KI6 D;  2LV7 A;  3PFV A;  1JFK A;  1C7V A;  1R2U A;  2MLE C;  2I7A A;  2NCO A;  1DTL A;  2HQ8 A;  2GGM A;  3CR2 A;  4HRG A;  2BBN A;  4AQI A;  1CMG A;  1CB1 A;  2M8U A;  1UHK A;  2LLU A;  4NDC A;  2H61 A;  3I5I C;  4A4C A;  1A4P A;  4YGC B;  1FI5 A;  2L2E A;  1NCY A;  1QX5 B;  3ICB A;  1NCZ A;  3JVT C;  1ODB A;  2JZI A;  1JF2 A;  4HRH A;  3E3R A;  1BG1 A;  4ICB A;  1CDN A;  1DJI A;  2AMI A;  3SIB A;  1XK4 C;  1B9A A;  1YUU A;  4CLN A;  1ZUZ A;  3I5I B;  1KK8 C;  1YRU B;  4M2Q A;  1KQV A;  1KFU L;  2JTT A;  4GGN A;  1MHO A;  1DVI A;  3CR5 X;  1QX7 A;  4GGF C;  1KK7 Y;  2LMT A;  1GQM A;  1S6I A;  1XFV O;  2ISD A;  2LAP A;  1B47 A;  1R6P A;  1J1E A;  2JT3 A;  2GGZ A;  2M97 A;  3DVM A;  2JWW A;  3FS7 A;  3JTD C;  1XFY O;  1K8U A;  5I8N A;  1B8R A;  1J55 A;  2H61 C;  4PE0 A;  3VGO A;  5BPJ A;  1QVI Y;  2WCE A;  4DRW A;  1OSA A;  2KBM A;  3PLF B;  3EVV A;  4CPV A;  2HPS A;  1S3P A;  1WDC B;  1QX2 A;  1QV0 A;  3WNX B;  1NSH A;  2JPT A;  1YX7 A;  1YRT B;  2Y1M A;  4MBE A;  1WLM A;  1QAS A;  1G4Y R;  2KAX A;  3IQQ A;  2L4H A;  5TNC A;  1JF0 A;  3PSR A;  2L98 A;  3CTN A;  5I2Q A;  4HSZ A;  1JSA A;  2LM5 A;  2CBL A;  2L0P A;  4C0K A;  3I5F C;  1AJ4 A;  1LKJ A;  2BKI B;  1TCF A;  3IF7 A;  2PAL A;  1SL7 A;  3ZNI A;  4ETO A;  1JUO A;  2KI6 C;  1LA0 A;  2MLF C;  3WXA A;  4N1G A;  1BU3 A;  2F2P A;  3QRX A;  3VRQ A;  1IWQ A;  2LMU A;  2M1U A;  2LHL A;  2COL B;  3SG2 A;  2RGI A;  2L5X B;  2VRG A;  5HKZ A;  1GGW A;  1TOP A;  2WOR A;  1U5I B;  1DJZ A;  5AEQ A;  4OKH A;  3SG3 A;  1QS7 A;  1WRL A;  2FOT A;  2KDH A;  1EL4 A;  1KK7 Z;  1PVB A;  2H2K A;  2FCD A;  5DKR A;  2M49 B;  2MBX A;  3NSO A;  1RFJ A;  1YX8 A;  1B8L A;  1VRK A;  2WOS A;  4PE7 A;  5FYX A;  2IS9 A;  4MEW A;  1IRJ A;  1CLL A;  2JC2 A;  4YBH B;  1DJG A;  4DS7 A;  1Q80 A;  3DVJ A;  5DKQ A;  1MQ1 A;  2OTG B;  1Y6W A;  3C1V A;  3PN7 B;  2MRD A;  1L2O C;  1K94 A;  3D10 A;  1SL9 A;  1F55 A;  1B1G A;  3TS5 C;  1XFZ O;  1KFU S;  2L51 A;  4ZCV A;  3SJS A;  2HET A;  3LLE A;  2LE9 B;  1CFD A;  1B4C A;  1K9K A;  1MXE A;  4P5O E;  1YR5 A;  4YI9 A;  3DF0 A;  1K9U A;  3D0Y A;  4PHN A;  1KQM C;  3PM8 A;  1V1F A;  2M3W A;  2OS8 C;  1DF0 A;  1KFX L;  1S36 A;  3KPX A;  1LVC D;  1LXF C;  2AUC A;  2P6B B;  3EK4 A;  4BY4 A;  1BT6 A;  2OPO A;  2KOT A;  2KQ6 A;  1J1D A;  2R2I A;  2KHN A;  1DJH A;  1SKT A;  1UUS A;  4MLW A;  1QAT A;  3BQ3 A;  1E8A A;  3VRO A;  3BUO B;  2KI4 C;  3I5H B;  1BR4 B;  4PE4 A;  3TDZ A;  1WLZ A;  1JFJ A;  1NUB A;  1J7Q A;  2LP2 A;  4FTG A;  1TN4 A;  3HX4 A;  2JXL A;  2ZKM X;  2L4I A;  3SG7 A;  4USL A;  5IBW A;  3CWG A;  3EVR A;  3AAJ A;  5DKN A;  2K2F A;  1IJ6 A;  1IQ5 A;  2CTN A;  4XJK B;  5G08 A;  1X02 A;  4OV2 A;  1A75 A;  2LNK A;  1XK4 A;  5D69 A;  5ER4 X;  4MZL A;  2ZNE A;  3TUY B;  2MAZ A;  2WCF A;  1DGU A;  3BUM B;  1PSB A;  3JVT B;  3GOF A;  4GGF A;  3H4S E;  3BYA A;  4I5J A;  4C0J A;  2D8N A;  1S6C A;  4N1F A;  5AAN A;  1RK9 A;  1PUL A;  2F8P A;  3OP0 A;  4YGE B;  1L7Z A;  4C0L A;  3AKA A;  1OZS A;  2Y1N A;  2JNF A;  1ZAC A; 
#chains in the Genus database with same CATH topology
 4MRX A;  3D78 A;  2E6W A;  1TNP A;  2A4J A;  1UUR A;  2QAC A;  2KNE A;  1CLM A;  4ZCU A;  4TNC A;  1S6J A;  3LCP C;  1F8H A;  1OE9 B;  1SY9 A;  1K96 A;  3S0F A;  2QEH A;  1IJ5 A;  3VB1 A;  5K89 A;  1QLS A;  5CPV A;  2JUL A;  1NX3 A;  1GGZ A;  2M9G A;  2FCE A;  2BBM A;  2PQL A;  4WRI A;  2BCA A;  1PSR A;  1SW8 A;  4M2O A;  4PCW A;  1CKK A;  2WCJ A;  2ZN8 A;  4MZK A;  1IQ3 A;  1S5G Z;  2CT9 A;  3CS1 A;  4YGD B;  2HQW A;  1BMO A;  1DQE A;  2JPO A;  4HRE E;  1KWO B;  5I2O A;  1TNW A;  1OMD A;  2LVI A;  2SCP A;  3NSK A;  1NX1 A;  3VRN A;  3OGN A;  1W9Z A;  2BCX A;  4JKT A;  2LUX A;  1G33 A;  2BL0 B;  2I18 A;  1BR1 B;  1OMV A;  1RRO A;  3B88 A;  3ZWH A;  1DJY A;  1FI6 A;  2CCM A;  4D1E A;  1H4B A;  2NCP A;  5HL1 A;  1MR8 A;  4MRY A;  4OVN F;  1KFX S;  4WQ2 A;  5AFP A;  2LCP A;  2EC6 B;  4AOM A;  5PAL A;  1HQV A;  1QIW A;  2GTE A;  3DVE A;  1M31 A;  5HKW A;  1SMG A;  1TCO B;  2KFG A;  2L2C A;  1SCM B;  2WCB A;  3GK2 A;  3LL8 B;  3WHT B;  4CID A;  5KSZ A;  2LUC A;  2I2R E;  2WCK A;  1REC A;  1TUJ A;  4AQJ A;  2KPH A;  1W7I B;  2K60 A;  3SG6 A;  1DT7 B;  1A03 A;  1NCX A;  3AAK A;  1U5I A;  2F2O A;  2K0J A;  2M29 A;  1PVA A;  3N7H A;  1OQP A;  1ZOT B;  2QEV A;  4GNK B;  1BF5 A;  3D76 A;  1M45 A;  2F3Y A;  1GJY A;  1XYD A;  1UP5 A;  1XFX O;  2TN4 A;  5BPJ A;  4YI8 A;  1QTX A;  4XYN A;  1LA3 A;  3F45 A;  2ZND A;  1SR6 C;  1AJ5 A;  2F33 A;  2QPT A;  1Z2C B;  1YVH A;  4GFT A;  5AER A;  1AUI B;  2E30 A;  1TNQ A;  2QDI A;  2M0R A;  1NYA A;  3VRR A;  3R72 A;  5JJG A;  5KTY A;  3NXA A;  3UO9 A;  2OTG C;  4MN0 A;  2WCH A;  3K21 A;  4JPZ B;  1F4Q A;  3PN7 C;  5B8I B;  3PAL A;  3I5G B;  3CZ0 A;  1TUZ A;  3SS3 A;  1A2X A;  2K61 A;  1F71 A;  4ORB B;  1CDM A;  3V2L A;  1XVJ A;  2FJU B;  4INW A;  1EXR A;  1XA5 A;  3OB2 B;  5ER5 A;  1C7W A;  1M46 A;  2L50 A;  2WND A;  1IGV A;  2OS8 B;  3WHU B;  2KSP A;  5I2L A;  1LIN A;  4OR9 B;  1DF0 B;  3CGA A;  1BOC A;  4DIR A;  1XFU O;  1DGV A;  1SBJ A;  1XO5 A;  1Y1U A;  1S5G Y;  2M1K B;  2SAS A;  2Y4Q A;  3BXK A;  2KGR A;  5CSF A;  1CMF A;  2EHB A;  3A4U B;  1B8C A;  1T14 A;  3CAB A;  3O78 A;  4NDD A;  3L4L A;  1JC2 A;  2WCL A;  4FQO A;  2PMY A;  4DCK A;  4ORA B;  3BOW A;  1CTR A;  1BOD A;  1MWN A;  1CDL A;  2Q91 A;  3NSI A;  1XFW O;  1XFR A;  2NXQ A;  1YUR A;  2BEC A;  3KF9 A;  1OMR A;  2I94 A;  3IQO A;  3TZ1 A;  4IL1 A;  2LLT A;  2BE6 A;  1M63 B;  3B7A A;  3TDU A;  2PRU A;  3O4Y A;  2KYF A;  4GBA A;  1EG4 A;  1F54 A;  5AXI A;  1WY9 A;  1NIW A;  5JOL A;  5F6T A;  1CM4 A;  5FI7 A;  1Y1X A;  3LK0 A;  2LMV A;  3D73 A;  1A75 B;  4XJK A;  2B1U A;  1C07 A;  1G8I A;  2Q4U A;  1KK8 B;  2KBI A;  1SPY A;  2WC8 A;  2K8M B;  3A8R A;  1PK0 D;  1OOJ A;  4P2Y B;  4MVF A;  3TUY C;  1J7P A;  1EH2 A;  1ALW A;  2BCB A;  2CXJ A;  4I5N B;  3RLZ A;  2K7B A;  1PAL A;  3BFB A;  1CFP A;  2FJY A;  1CLB A;  4MSP A;  1N65 A;  1QJT A;  1SNL A;  1CFF A;  1V1G A;  2JXC A;  3FWC A;  1K90 D;  2MJW B;  3JTD B;  3OHM B;  3TDI A;  1J7O A;  3BJH A;  3DY9 A;  1MXL C;  1QLK A;  1IIO A;  2JNX A;  1WRK A;  2PSR A;  1H8B A;  2O60 A;  1A29 A;  3PJI A;  4M2P A;  2LVV A;  5CSJ A;  3NHI A;  2KYC A;  3CLN A;  5CSN A;  4PHK A;  3VRP A;  4CFQ A;  2PYQ A;  3OBV A;  1RWY A;  2JTZ A;  1UHN A;  1UWO A;  2JOJ A;  4CFR A;  1NX2 A;  1SRA A;  4NDB A;  4JWQ A;  1AP4 A;  1B7T Y;  1FF1 A;  1WDC C;  4F0Z B;  2QEB A;  2CNP A;  2NZ0 A;  1DJW A;  3B6X A;  1ZFS A;  1F4O A;  3SIA A;  4PAL A;  3FWB A;  2HF5 A;  5EL2 A;  2KAV A;  3L4A A;  5HYD A;  4QJ3 B;  1IKU A;  3I5F B;  4YGB B;  2JU0 A;  1BLQ A;  1W7J B;  1TIZ A;  1FW4 A;  2QEO A;  1K93 D;  4L9M A;  1S1E A;  1UHI A;  3S0D A;  1KSO A;  3B86 A;  4JQ0 D;  5CSI A;  4QJ4 B;  1KWO C;  2LVJ A;  3KHE A;  2MA2 A;  1J7R A;  1CDP A;  3EK8 A;  5HLV A;  3NSL A;  4PT1 A;  1Y0V H;  2JRF A;  4NQG A;  2EGD A;  2Y5I A;  1AVS A;  1D1O A;  2LHI A;  1UHH A;  2KLD A;  3EKH A;  3PM2 A;  5HLO A;  4UPG A;  2BL0 C;  2PVB A;  2KQY A;  3SG4 A;  1JBA A;  2ZFD A;  3GK4 X;  2KGB C;  1DEK A;  5J3X A;  3EVU A;  2O5G A;  1KSM A;  5KU1 A;  2JT8 A;  2G2B A;  4PHM A;  1TRF A;  2EC6 C;  2V53 A;  2ZRT A;  4BY5 A;  3B87 A;  1RTP 1;  1OOF A;  4ORC B;  2F3Z A;  1NP8 A;  1SCM C;  4OCI A;  1SCV A;  1IH0 A;  4I5K A;  5HKY A;  1FBV A;  4I5L B;  1HT9 A;  4A4B A;  3S0E A;  1AHR A;  2ERB A;  4FQT A;  1OOH A;  3DYE A;  2LP3 A;  1KCY A;  1YUS A;  4KYN A;  3S0G A;  2BKH B;  3L47 A;  1N2D A;  2KFF A;  3DVK A;  2L5Y A;  2NLN A;  3M0W A;  1OOI X;  4U8D A;  1SR6 B;  1YTZ C;  1OZO A;  1QXP A;  2MHH A;  4GUK A;  4N5X A;  3RM1 A;  1PRW A;  1L2O B;  2LAN A;  2KFH A;  3BUX B;  3KEV A;  1K95 A;  1B7T Z;  2GV5 A;  3BUW B;  4E68 A;  4R1E A;  1CNP A;  3TS5 B;  1F70 A;  1EG3 A;  1SK6 D;  1QVI Z;  2JT0 A;  1TTX A;  4PHJ A;  1RJV A;  1WRZ A;  1ZMZ A;  3PAT A;  1DMO A;  4QJ5 B;  2DOQ A;  3EK7 A;  1K2H A;  1NX0 A;  3DXL A;  1Y1A A;  4JD9 A;  4MZJ A;  5GQQ C;  3RZS A;  1MF8 B;  2K2A A;  1JWD A;  3HCM A;  1ALV A;  2K7C A;  3AKB A;  1DJX A;  3O2P A;  3DF0 B;  2BE4 A;  3BUN B;  2LLS A;  1KQM B;  5D7F A;  3EKJ A;  1CFC A;  1IG5 A;  3D0Y B;  2G9B A;  1CM1 A;  3IVT A;  4PDZ A;  2M7N A;  3DD4 A;  2PAS A;  3I5G C;  1YUT A;  3D75 A;  4YRU A;  4WQ3 A;  1BJF A;  2AAO A;  3OB1 B;  3OX6 A;  2K7O A;  3CDN A;  4PE1 A;  3SG5 A;  4DUQ A;  4Q04 A;  1SYM A;  2KI4 B;  1M39 A;  3LK1 A;  1N0Y A;  1QV1 A;  3CR4 X;  3MSE B;  1NWD A;  2LVK A;  2LC5 A;  3CYZ A;  3FIA A;  1C3Y A;  4INX A;  1FPW A;  2K7D A;  4YGA A;  3I5H C;  2P71 A;  1QIV A;  2M7L A;  3QME A;  4GAO A;  1TNX A;  1S26 D;  2KAY A;  3BFA A;  1YVL A;  2ZRS A;  3O6B A;  1AK8 A;  3OX5 A;  1NPQ A;  1SL8 A;  3BOW B;  1MUX A;  1UHJ A;  2JQ6 A;  1K9P A;  2ZN9 A;  3CZT X;  3GK1 A;  3KO0 A;  4GPL B;  1EJ3 A;  2KI6 D;  2LV7 A;  3PFV A;  3D77 A;  1JFK A;  1C7V A;  1R2U A;  2MLE C;  5DIC A;  2I7A A;  2NCO A;  1DTL A;  2HQ8 A;  2GGM A;  3CR2 A;  1GM0 A;  4HRG A;  2BBN A;  4AQI A;  1CMG A;  1CB1 A;  2M8U A;  1UHK A;  2LLU A;  4NDC A;  2H61 A;  3I5I C;  4A4C A;  1A4P A;  4YGC B;  1FI5 A;  2L2E A;  1NCY A;  1QX5 B;  3ICB A;  1NCZ A;  3JVT C;  3Q8I A;  1ODB A;  1C3Z A;  1JF2 A;  2JZI A;  3E3R A;  4HRH A;  1BG1 A;  4ICB A;  1CDN A;  1DJI A;  2AMI A;  4IJ7 A;  3SIB A;  1XK4 C;  1B9A A;  1YUU A;  4CLN A;  1ZUZ A;  3I5I B;  1KK8 C;  1YRU B;  4M2Q A;  1KQV A;  1KFU L;  2JTT A;  4GGN A;  1MHO A;  1DVI A;  3CR5 X;  1QX7 A;  4GGF C;  1KK7 Y;  2LMT A;  1GQM A;  1S6I A;  1XFV O;  2ISD A;  2LAP A;  1B47 A;  1R6P A;  1J1E A;  2JT3 A;  2GGZ A;  2M97 A;  3DVM A;  2JWW A;  1DC1 A;  3FS7 A;  3JTD C;  1XFY O;  1K8U A;  5I8N A;  1B8R A;  1J55 A;  2H61 C;  4PE0 A;  3VGO A;  1P28 A;  1QVI Y;  2WCE A;  4DRW A;  1OSA A;  2KBM A;  5I94 A;  3PLF B;  3EVV A;  4CPV A;  2HPS A;  1S3P A;  1WDC B;  3FE6 A;  1QX2 A;  1QV0 A;  3R1V A;  1NSH A;  3WNX B;  2JPT A;  1YX7 A;  1YRT B;  2Y1M A;  4MBE A;  1WLM A;  2BAP A;  1QAS A;  2BNX A;  1G4Y R;  2KAX A;  3IQQ A;  2L4H A;  5TNC A;  1JF0 A;  2WCM A;  3PSR A;  2L98 A;  3CTN A;  5I2Q A;  2H8V A;  4HSZ A;  2LM5 A;  1JSA A;  2CBL A;  2L0P A;  4OZD A;  3I5F C;  1AJ4 A;  1LKJ A;  2BKI B;  1TCF A;  3IF7 A;  4C0K A;  2PAL A;  1SL7 A;  3ZNI A;  4ETO A;  1JUO A;  2KI6 C;  1LA0 A;  1OOG A;  2MLF C;  3FE8 A;  3WXA A;  4N1G A;  1BU3 A;  2WC6 A;  2F2P A;  3FE9 A;  3QRX A;  3VRQ A;  3NGV A;  1IWQ A;  2LMU A;  2M1U A;  2LHL A;  2COL B;  3SG2 A;  2RGI A;  2L5X B;  2VRG A;  5HKZ A;  1GGW A;  1TOP A;  2WOR A;  1U5I B;  1DJZ A;  5AEQ A;  2YGU A;  4OKH A;  3SG3 A;  1QS7 A;  1QWV A;  1WRL A;  2FOT A;  2KDH A;  3S0B A;  3SS4 A;  1EL4 A;  1KK7 Z;  1PVB A;  2H2K A;  2FCD A;  3CZ2 A;  5DKR A;  2M49 B;  2MBX A;  3NSO A;  1RFJ A;  3DZT A;  1YX8 A;  1B8L A;  1VRK A;  2WOS A;  1SSE B;  4PE7 A;  5FYX A;  2IS9 A;  4MEW A;  1IRJ A;  1CLL A;  2P70 A;  2JC2 A;  4YBH B;  3NHT A;  1DJG A;  4DS7 A;  1Q80 A;  3DVJ A;  5DKQ A;  1MQ1 A;  2OTG B;  1Y6W A;  3C1V A;  1LS8 A;  1DEL A;  3SS5 A;  3PN7 B;  2MRD A;  3UNW A;  1L2O C;  3R1O A;  1K94 A;  1Z4H A;  3D10 A;  1SL9 A;  3O4X A;  3D74 A;  1F55 A;  1B1G A;  3TS5 C;  1XFZ O;  1KFU S;  2L51 A;  4ZCV A;  3SJS A;  2HET A;  3LLE A;  2LE9 B;  1CFD A;  1B4C A;  1K9K A;  1MXE A;  4P5O E;  1YR5 A;  4YI9 A;  3DF0 A;  1K9U A;  3D0Y A;  4PHN A;  5D3O A;  1KQM C;  3PM8 A;  1V1F A;  2M3W A;  2OS8 C;  1DF0 A;  1KFX L;  1S36 A;  3KPX A;  2KLE A;  1LVC D;  1LXF C;  2AUC A;  2P6B B;  3EK4 A;  4BY4 A;  1BT6 A;  2OPO A;  2KOT A;  2KQ6 A;  1J1D A;  2R2I A;  4F7F A;  2KHN A;  1DJH A;  1SKT A;  1UUS A;  4MLW A;  1QAT A;  3BQ3 A;  1E8A A;  3VRO A;  3BUO B;  3CZ1 A;  3EG5 B;  3S0A A;  2KI4 C;  3I5H B;  1BR4 B;  4PE4 A;  3TDZ A;  1WLZ A;  1JFJ A;  1NUB A;  1J7Q A;  2LP2 A;  4FTG A;  3BFH A;  1TN4 A;  3HX4 A;  3R1P A;  2JXL A;  2ZKM X;  2L4I A;  3SG7 A;  4USL A;  5IBW A;  5FI6 A;  5FI2 A;  2WC5 A;  3CWG A;  3EVR A;  1ORG A;  3AAJ A;  5DKN A;  2K2F A;  1IJ6 A;  1IQ5 A;  2CTN A;  4XJK B;  5G08 A;  1X02 A;  4OV2 A;  1A75 A;  2LNK A;  1XK4 A;  5D69 A;  5ER4 X;  4MZL A;  2ZNE A;  3TUY B;  2MAZ A;  2WCF A;  1DGU A;  1TWO A;  3BUM B;  1PSB A;  3K1E A;  3JVT B;  3GOF A;  4GGF A;  3H4S E;  3BYA A;  4I5J A;  4C0J A;  2D8N A;  1S6C A;  4N1F A;  1OW4 A;  5AAN A;  1RK9 A;  1PUL A;  2F8P A;  3OP0 A;  4YGE B;  1L7Z A;  4C0L A;  3AKA A;  1OZS A;  2Y1N A;  2JNF A;  1ZAC A; 
#chains in the Genus database with same CATH homology
 4MRX A;  2E6W A;  1TNP A;  2A4J A;  1UUR A;  2QAC A;  2KNE A;  1CLM A;  4ZCU A;  4TNC A;  1S6J A;  3LCP C;  1F8H A;  1OE9 B;  1SY9 A;  1K96 A;  5K89 A;  1IJ5 A;  1QLS A;  5CPV A;  2JUL A;  1NX3 A;  1GGZ A;  2M9G A;  2FCE A;  2BBM A;  4WRI A;  2BCA A;  1PSR A;  1SW8 A;  4M2O A;  4PCW A;  1CKK A;  4MZK A;  2ZN8 A;  1IQ3 A;  1S5G Z;  2CT9 A;  3CS1 A;  4YGD B;  2HQW A;  1BMO A;  4HRE E;  1KWO B;  5I2O A;  1TNW A;  1OMD A;  2LVI A;  2SCP A;  3NSK A;  1NX1 A;  3VRN A;  2BCX A;  2LUX A;  1G33 A;  2BL0 B;  2I18 A;  1BR1 B;  1OMV A;  1RRO A;  3ZWH A;  1FI6 A;  1DJY A;  1H4B A;  2CCM A;  4D1E A;  2NCP A;  1MR8 A;  4MRY A;  4OVN F;  1KFX S;  4WQ2 A;  5AFP A;  2LCP A;  2EC6 B;  4AOM A;  5PAL A;  1HQV A;  1QIW A;  3DVE A;  1M31 A;  5HKW A;  1SMG A;  1TCO B;  2KFG A;  4CID A;  1SCM B;  2WCB A;  3GK2 A;  3LL8 B;  3WHT B;  5KSZ A;  2LUC A;  2I2R E;  1REC A;  4AQJ A;  1W7I B;  3SG6 A;  1DT7 B;  1A03 A;  1NCX A;  3AAK A;  1U5I A;  2F2O A;  2K0J A;  2M29 A;  1PVA A;  1OQP A;  1ZOT B;  1BF5 A;  4GNK B;  1M45 A;  2F3Y A;  1GJY A;  1XYD A;  1UP5 A;  1XFX O;  2TN4 A;  4YI8 A;  1QTX A;  4XYN A;  1LA3 A;  3F45 A;  2ZND A;  1SR6 C;  1AJ5 A;  2F33 A;  2QPT A;  1YVH A;  4GFT A;  5AER A;  1AUI B;  2E30 A;  1TNQ A;  2M0R A;  1NYA A;  3VRR A;  5JJG A;  5KTY A;  3NXA A;  2OTG C;  4MN0 A;  3K21 A;  4JPZ B;  1F4Q A;  3PN7 C;  5B8I B;  3PAL A;  3I5G B;  1A2X A;  2K61 A;  1F71 A;  4ORB B;  1CDM A;  1XVJ A;  2FJU B;  1EXR A;  1XA5 A;  3OB2 B;  5ER5 A;  1C7W A;  1M46 A;  2L50 A;  2WND A;  1IGV A;  2OS8 B;  3WHU B;  2KSP A;  5I2L A;  1LIN A;  4OR9 B;  1DF0 B;  3CGA A;  1BOC A;  4DIR A;  1XFU O;  1DGV A;  1SBJ A;  1XO5 A;  1Y1U A;  1S5G Y;  2M1K B;  2SAS A;  2Y4Q A;  3BXK A;  2KGR A;  5CSF A;  1CMF A;  2EHB A;  3A4U B;  1B8C A;  3O78 A;  4NDD A;  1JC2 A;  4FQO A;  2PMY A;  4DCK A;  4ORA B;  3BOW A;  1CTR A;  1BOD A;  1MWN A;  1CDL A;  2Q91 A;  3NSI A;  1XFW O;  2NXQ A;  1YUR A;  2BEC A;  3KF9 A;  1OMR A;  2I94 A;  3IQO A;  3TZ1 A;  4IL1 A;  2LLT A;  2BE6 A;  1M63 B;  3TDU A;  2PRU A;  3O4Y A;  2KYF A;  4GBA A;  1EG4 A;  1F54 A;  5AXI A;  1WY9 A;  1NIW A;  5JOL A;  5F6T A;  1CM4 A;  1Y1X A;  3LK0 A;  2LMV A;  1A75 B;  4XJK A;  2B1U A;  1C07 A;  1G8I A;  2Q4U A;  1KK8 B;  2KBI A;  1SPY A;  2WC8 A;  2K8M B;  3A8R A;  1PK0 D;  1OOJ A;  4P2Y B;  4MVF A;  3TUY C;  1J7P A;  1EH2 A;  1ALW A;  2BCB A;  2CXJ A;  4I5N B;  3RLZ A;  2K7B A;  1PAL A;  1CFP A;  1CLB A;  4MSP A;  1N65 A;  1QJT A;  1SNL A;  1CFF A;  1V1G A;  2JXC A;  3FWC A;  1K90 D;  2MJW B;  3JTD B;  3OHM B;  3TDI A;  1J7O A;  1MXL C;  1QLK A;  2JNX A;  1WRK A;  2PSR A;  1H8B A;  2O60 A;  1A29 A;  4M2P A;  2LVV A;  5CSJ A;  2KYC A;  3CLN A;  5CSN A;  4PHK A;  3VRP A;  4CFQ A;  1RWY A;  2JTZ A;  1UHN A;  1UWO A;  2JOJ A;  4CFR A;  1NX2 A;  1SRA A;  4NDB A;  4JWQ A;  1AP4 A;  1B7T Y;  1FF1 A;  1WDC C;  4F0Z B;  2CNP A;  2NZ0 A;  1DJW A;  1ZFS A;  1F4O A;  3SIA A;  4PAL A;  3FWB A;  2HF5 A;  2KAV A;  5HYD A;  4QJ3 B;  1IKU A;  3I5F B;  4YGB B;  2JU0 A;  1BLQ A;  1W7J B;  1TIZ A;  1FW4 A;  1K93 D;  4L9M A;  1S1E A;  1UHI A;  1KSO A;  5CSI A;  4JQ0 D;  4QJ4 B;  1KWO C;  2LVJ A;  3KHE A;  2MA2 A;  1J7R A;  1CDP A;  3EK8 A;  5HLV A;  3NSL A;  1Y0V H;  2JRF A;  4NQG A;  2EGD A;  2Y5I A;  1AVS A;  1D1O A;  2LHI A;  1UHH A;  3EKH A;  5HLO A;  4UPG A;  2BL0 C;  2PVB A;  2KQY A;  3SG4 A;  1JBA A;  2ZFD A;  3GK4 X;  2KGB C;  5J3X A;  3EVU A;  2O5G A;  1KSM A;  5KU1 A;  2JT8 A;  2G2B A;  4PHM A;  1TRF A;  2EC6 C;  2V53 A;  2ZRT A;  4BY5 A;  1RTP 1;  4ORC B;  2F3Z A;  1NP8 A;  1SCM C;  4OCI A;  1SCV A;  1IH0 A;  4I5K A;  5HKY A;  1FBV A;  4I5L B;  1HT9 A;  4A4B A;  1AHR A;  2LP3 A;  1KCY A;  1YUS A;  2BKH B;  1N2D A;  2KFF A;  3DVK A;  3M0W A;  2NLN A;  4U8D A;  1SR6 B;  1YTZ C;  1OZO A;  1QXP A;  2MHH A;  4GUK A;  4N5X A;  3RM1 A;  1PRW A;  1L2O B;  2LAN A;  2KFH A;  3BUX B;  3KEV A;  1K95 A;  1B7T Z;  2GV5 A;  3BUW B;  4E68 A;  4R1E A;  1CNP A;  3TS5 B;  1F70 A;  1EG3 A;  1SK6 D;  1QVI Z;  2JT0 A;  1TTX A;  4PHJ A;  1RJV A;  1WRZ A;  1ZMZ A;  3PAT A;  1DMO A;  4QJ5 B;  2DOQ A;  3EK7 A;  1K2H A;  1NX0 A;  1Y1A A;  5GQQ C;  4MZJ A;  1JWD A;  1MF8 B;  2K2A A;  3HCM A;  1ALV A;  2K7C A;  3AKB A;  1DJX A;  3O2P A;  3DF0 B;  2BE4 A;  3BUN B;  2LLS A;  1KQM B;  5D7F A;  3EKJ A;  1CFC A;  1IG5 A;  3D0Y B;  2G9B A;  1CM1 A;  4PDZ A;  2M7N A;  3DD4 A;  2PAS A;  3I5G C;  1YUT A;  4YRU A;  4WQ3 A;  1BJF A;  2AAO A;  3OB1 B;  3OX6 A;  2K7O A;  4PE1 A;  3SG5 A;  4DUQ A;  4Q04 A;  1SYM A;  2KI4 B;  1M39 A;  3LK1 A;  1N0Y A;  1QV1 A;  3CR4 X;  3MSE B;  1NWD A;  2LVK A;  2LC5 A;  3FIA A;  1FPW A;  2K7D A;  4YGA A;  3I5H C;  1QIV A;  2M7L A;  4GAO A;  1TNX A;  1S26 D;  2KAY A;  1YVL A;  2ZRS A;  3O6B A;  1AK8 A;  3OX5 A;  1NPQ A;  1SL8 A;  3BOW B;  1MUX A;  1UHJ A;  2JQ6 A;  1K9P A;  2ZN9 A;  3CZT X;  3GK1 A;  3KO0 A;  4GPL B;  1EJ3 A;  2KI6 D;  2LV7 A;  3PFV A;  1JFK A;  1C7V A;  1R2U A;  2MLE C;  2I7A A;  2NCO A;  1DTL A;  2HQ8 A;  2GGM A;  3CR2 A;  4HRG A;  2BBN A;  4AQI A;  1CMG A;  1CB1 A;  2M8U A;  1UHK A;  2LLU A;  4NDC A;  2H61 A;  3I5I C;  4A4C A;  1A4P A;  4YGC B;  1FI5 A;  2L2E A;  1NCY A;  1QX5 B;  3ICB A;  1NCZ A;  3JVT C;  1ODB A;  2JZI A;  1JF2 A;  4HRH A;  3E3R A;  1BG1 A;  4ICB A;  1CDN A;  1DJI A;  2AMI A;  3SIB A;  1XK4 C;  1B9A A;  1YUU A;  4CLN A;  1ZUZ A;  3I5I B;  1KK8 C;  1YRU B;  4M2Q A;  1KQV A;  1KFU L;  2JTT A;  4GGN A;  1MHO A;  1DVI A;  3CR5 X;  1QX7 A;  4GGF C;  1KK7 Y;  2LMT A;  1GQM A;  1S6I A;  1XFV O;  2ISD A;  2LAP A;  1B47 A;  1R6P A;  1J1E A;  2JT3 A;  2GGZ A;  2M97 A;  3DVM A;  2JWW A;  3FS7 A;  3JTD C;  1XFY O;  1K8U A;  5I8N A;  1B8R A;  1J55 A;  2H61 C;  4PE0 A;  3VGO A;  5BPJ A;  1QVI Y;  2WCE A;  4DRW A;  1OSA A;  2KBM A;  3PLF B;  3EVV A;  4CPV A;  2HPS A;  1S3P A;  1WDC B;  1QX2 A;  1QV0 A;  3WNX B;  1NSH A;  2JPT A;  1YX7 A;  1YRT B;  2Y1M A;  4MBE A;  1WLM A;  1QAS A;  1G4Y R;  2KAX A;  3IQQ A;  2L4H A;  5TNC A;  1JF0 A;  3PSR A;  2L98 A;  3CTN A;  5I2Q A;  4HSZ A;  1JSA A;  2LM5 A;  2CBL A;  2L0P A;  4C0K A;  3I5F C;  1AJ4 A;  1LKJ A;  2BKI B;  1TCF A;  3IF7 A;  2PAL A;  1SL7 A;  3ZNI A;  4ETO A;  1JUO A;  2KI6 C;  1LA0 A;  2MLF C;  3WXA A;  4N1G A;  1BU3 A;  2F2P A;  3QRX A;  3VRQ A;  1IWQ A;  2LMU A;  2M1U A;  2LHL A;  2COL B;  3SG2 A;  2RGI A;  2L5X B;  2VRG A;  5HKZ A;  1GGW A;  1TOP A;  2WOR A;  1U5I B;  1DJZ A;  5AEQ A;  4OKH A;  3SG3 A;  1QS7 A;  1WRL A;  2FOT A;  2KDH A;  1EL4 A;  1KK7 Z;  1PVB A;  2H2K A;  2FCD A;  5DKR A;  2M49 B;  2MBX A;  3NSO A;  1RFJ A;  1YX8 A;  1B8L A;  1VRK A;  2WOS A;  4PE7 A;  5FYX A;  2IS9 A;  4MEW A;  1IRJ A;  1CLL A;  2JC2 A;  4YBH B;  1DJG A;  4DS7 A;  1Q80 A;  3DVJ A;  5DKQ A;  1MQ1 A;  2OTG B;  1Y6W A;  3C1V A;  3PN7 B;  2MRD A;  1L2O C;  1K94 A;  3D10 A;  1SL9 A;  1F55 A;  1B1G A;  3TS5 C;  1XFZ O;  1KFU S;  2L51 A;  4ZCV A;  3SJS A;  2HET A;  3LLE A;  2LE9 B;  1CFD A;  1B4C A;  1K9K A;  1MXE A;  4P5O E;  1YR5 A;  4YI9 A;  3DF0 A;  1K9U A;  3D0Y A;  4PHN A;  1KQM C;  3PM8 A;  1V1F A;  2M3W A;  2OS8 C;  1DF0 A;  1KFX L;  1S36 A;  3KPX A;  1LVC D;  1LXF C;  2AUC A;  2P6B B;  3EK4 A;  4BY4 A;  1BT6 A;  2OPO A;  2KOT A;  2KQ6 A;  1J1D A;  2R2I A;  2KHN A;  1DJH A;  1SKT A;  1UUS A;  4MLW A;  1QAT A;  3BQ3 A;  1E8A A;  3VRO A;  3BUO B;  2KI4 C;  3I5H B;  1BR4 B;  4PE4 A;  3TDZ A;  1WLZ A;  1JFJ A;  1NUB A;  1J7Q A;  2LP2 A;  4FTG A;  1TN4 A;  3HX4 A;  2JXL A;  2ZKM X;  2L4I A;  3SG7 A;  4USL A;  5IBW A;  3CWG A;  3EVR A;  3AAJ A;  5DKN A;  2K2F A;  1IJ6 A;  1IQ5 A;  2CTN A;  4XJK B;  5G08 A;  1X02 A;  4OV2 A;  1A75 A;  2LNK A;  1XK4 A;  5D69 A;  5ER4 X;  4MZL A;  2ZNE A;  3TUY B;  2MAZ A;  2WCF A;  1DGU A;  3BUM B;  1PSB A;  3JVT B;  3GOF A;  4GGF A;  3H4S E;  3BYA A;  4I5J A;  4C0J A;  2D8N A;  1S6C A;  4N1F A;  5AAN A;  1RK9 A;  1PUL A;  2F8P A;  3OP0 A;  4YGE B;  1L7Z A;  4C0L A;  3AKA A;  1OZS A;  2Y1N A;  2JNF A;  1ZAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...