1ALVA

Calcium bound domain vi of porcine calpain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
173
structure length
173
Chain Sequence
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALPAIN
publication title Crystal structure of calcium bound domain VI of calpain at 1.9 A resolution and its role in enzyme assembly, regulation, and inhibitor binding.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Calcium binding
total genus 57
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1alvA00
4WRIA 5AEQA 1J7QA 1KQMB 1CDLA 3PSRA 1TTXA 2M3WA 2WOSA 1QS7A 2OTGC 2KQ6A 4YBHB 1SKTA 4Q04A 4MEWA 1PALA 1KK7Y 2JC2A 1PULA 4I5LB 2F8PA 4YGCB 1F4OA 1M46A 1JBAA 1KWOC 3JVTB 5CPVA 3TDIA 4JPZB 5JOLA 4JQ0D 2LHLA 1QTXA 1KK7Z 3PALA 2PALA 1HT9A 2V53A 3DVEA 4PALA 1DJGA 1OZOA 1RROA 3D0YB 4DRWA 1CNPA 5CSNA 1PRWA 2ZKMX 5IBWA 2ISDA 1WLMA 1RTP1 4MRXA 2LLSA 1OE9B 3VRRA 1YUSA 3OX6A 3DF0B 4BY4A 3EVRA 1S5GY 1L7ZA 3CTNA 2LVVA 5CSIA 2GV5A 4C0LA 1QIVA 1SK6D 3KPXA 4CFRA 2LHIA 1DJHA 3M0WA 1XFWO 1QXPA 1SYMA 1S5GZ 3DVKA 2F3YA 3BOWB 4MN0A 4QJ4B 3VRQA 2Y4QA 1B8RA 1NX0A 5AANA 1A4PA 1TNQA 2L4HA 2L98A 2E30A 1V1FA 3BXKA 3CLNA 4XJKB 5D7FA 5I8NA 1OZSA 1YVLA 2HETA 2WNDA 2O60A 4MZJA 3SG3A 5I2OA 4PHMA 2PSRA 1QLSA 2HQWA 3VGOA 2CT9A 1UHNA 5GQQC 3WHUB 2PVBA 1K94A 2PRUA 1KFUL 2IS9A 2JULA 1B8LA 3I5GB 1NP8A 3AAKA 3BUXB 2L50A 3SG7A 3DVJA 1MWNA 3BUOB 3TZ1A 1J7PA 2ZFDA 3BYAA 2KAVA 3BQ3A 1F54A 4CPVA 2JQ6A 1SL7A 1RWYA 2G9BA 5HKYA 3GOFA 2KQYA 1CDMA 3I5HB 2KOTA 2I18A 1YVHA 2MLEC 1K2HA 3I5HC 1MXEA 1B9AA 2H61C 3RLZA 2BCXA 2MLFC 4DIRA 1B8CA 3IQQA 3DVMA 4IL1A 2WORA 1A03A 1GGWA 3A4UB 3H4SE 1TNXA 1S36A 1ALWA 5ER4X 1A75B 1QJTA 2L5XB 2M8UA 3OHMB 4I5KA 5BPJA 3ICBA 1S3PA 5I2LA 1S6CA 2KAXA 1N2DA 1S1EA 1VRKA 3EK4A 1LKJA 2KFHA 3FS7A 1KQVA 3JTDB 4OV2A 2LLUA 3TDUA 1OMDA 1F71A 1SL9A 4OKHA 1CM1A 2HPSA 1QV1A 2LMUA 4HRHA 1C7VA 1NIWA 1S26D 4MVFA 1WY9A 1KSMA 2NLNA 1DJYA 1EXRA 2I94A 1FI5A 4TNCA 1CLMA 1YRTB 2KI6C 1QLKA 2K2FA 4PHKA 5KU1A 1LA0A 4GGFA 1ZUZA 1CM4A 2NCPA 2LM5A 2CBLA 1YUUA 1WRKA 2NZ0A 5KTYA 1KSOA 2OPOA 4AQIA 1NX2A 4YI9A 2ZNDA 4YI8A 2MBXA 1F4QA 1UP5A 1IRJA 2M49B 3SG5A 4GUKA 5HYDA 4CFQA 4I5NB 2LAPA 4ETOA 2K2AA 2LP2A 1FW4A 1OOJA 4ORBB 4PE7A 2KSPA 2LLTA 1UURA 2G2BA 2OTGB 4CIDA 4YGEB 3SG6A 1DGUA 4WQ2A 1CDNA 4HRGA 1KWOB 4NQGA 2CXJA 2ZN8A 4DUQA 2M7NA 2ZN9A 2JT8A 1BODA 1NX1A 1TNPA 1U5IA 1UWOA 3OB2B 4QJ3B 3CZTX 1NWDA 2GGZA 3CGAA 3AKBA 1YRUB 3NSIA 1EJ3A 1RECA 2LNKA 1W7JB 2KDHA 2K7DA 2KI4C 1BG1A 2OS8C 3I5IB 1C7WA 3ZWHA 1CFCA 3EKHA 1CFFA 3LLEA 3I5IC 5PALA 1MUXA 1AUIB 4PHNA 2FJUB 4MRYA 1XFVO 1QASA 1IGVA 3SG4A 2KYCA 4HREE 3WXAA 3HCMA 4WQ3A 4AOMA 2PASA 2F2OA 3KHEA 3MSEB 1XFXO 4OR9B 4ZCUA 4AQJA 1QATA 1CMGA 2AAOA 3VROA 4MZLA 3WHTB 4C0JA 2KFGA 2B1UA 1N0YA 1QX7A 2JOJA 3PN7C 1JF2A 4GFTA 2K7BA 2QACA 1CTRA 2LC5A 1RK9A 4PCWA 3FWBA 1XYDA 2R2IA 1WRLA 2JPTA 3O78A 1UHIA 2LVJA 3EK8A 3ZNIA 2BCAA 3FIAA 2FCDA 3EK7A 2CTNA 2JU0A 2K8MB 1J7RA 2LE9B 2AUCA 1XO5A 2WCEA 3SIBA 1PK0D 2BL0B 4YRUA 1YUTA 1K9PA 2JWWA 1TN4A 1LA3A 1SNLA 2BL0C 2WC8A 3E3RA 1F70A 2NXQA 1DF0B 4GGFC 4JWQA 3KF9A 4GBAA 1TIZA 4MSPA 2JNXA 1L2OB 2H2KA 2L2EA 1LINA 4N1GA 4YGDB 4CLNA 5AFPA 1L2OC 3EVVA 3NSLA 2L0PA 4M2OA 3RM1A 4FTGA 1B4CA 1PSRA 3CR2A 1JUOA 1MHOA 2F3ZA 1Y1XA 1SCVA 4MLWA 1K9UA 1G8IA 2JXLA 1NYAA 2JZIA 2BKIB 1WLZA 1EG3A 1QV0A 1UHKA 1MF8B 5AXIA 1S6IA 3D0YA 4ZCVA 1SCMB 2K0JA 1U5IB 1D1OA 1SL8A 1SCMC 2HF5A 4DS7A 3DF0A 1BR4B 2JRFA 5DKQA 1KFUS 2BE6A 3D10A 4C0KA 1TOPA 3EKJA 1A2XA 1C07A 1DMOA 2EC6C 2KHNA 1Y6WA 2ZRTA 4PE0A 1KFXL 4QJ5B 2AMIA 3CWGA 2COLB 1F8HA 3BUNB 1B47A 1DJWA 5HLOA 3TUYB 3AKAA 3BOWA 2DOQA 3TUYC 1TCOB 2M9GA 3VRPA 1UHJA 2D8NA 3AAJA 3KO0A 4XYNA 2PMYA 5D69A 1KCYA 1HQVA 4XJKA 1K90D 1QX5B 5CSFA 1AJ5A 1CLLA 1YR5A 2O5GA 4HSZA 1SBJA 3TS5B 4M2QA 2MA2A 1DJXA 1M39A 3TS5C 1SRAA 2Y5IA 1BJFA 2M7LA 1M31A 2ZNEA 3O4YA 1ZMZA 4DCKA 1Q80A 2KGBC 3I5FB 3VRNA 4PE1A 3SIAA 2KBMA 2BECA 4OCIA 3I5FC 1Y1AA 1Y1UA 1R2UA 1UHHA 2KYFA 3LK0A 1F55A 1XFUO 4USLA 1SR6B 3PFVA 1A29A 1JFKA 2LVKA 1KK8C 4P2YB 1SR6C 5G08A 1MQ1A 3NSOA 1BMOA 1BOCA 1EG4A 1CFPA 1ODBA 1IJ6A 2KI4B 2GGMA 2OS8B 1J1EA 1V1GA 1OMVA 1JFJA 2E6WA 1GJYA 2SCPA 1NSHA 1YX8A 1DTLA 3GK1A 1G4YR 4YGAA 1A75A 1K95A 1R6PA 1KQMC 2L4IA 2MHHA 2WCFA 4I5JA 3TDZA 1RFJA 1EH2A 1G33A 2LMTA 5KSZA 1CMFA 4OVNF 1YTZC 4PE4A 1QX2A 2LUCA 4GNKB 5TNCA 1K8UA 2LMVA 2F2PA 1ZOTB 1AP4A 1K9KA 3JVTC 1UUSA 1OQPA 4R1EA 1JWDA 2L51A 2CNPA 2HQ8A 5F6TA 3PN7B 2WCBA 3IQOA 2JT3A 4GAOA 1X02A 1TRFA 2FOTA 5DKNA 2K7OA 2NCOA 3WNXB 1JC2A 1DGVA 2KFFA 2BBMA 4BY5A 1XVJA 1E8AA 1NPQA 2I7AA 4A4CA 3OX5A 1TCFA 3O6BA 3BUWB 5HKZA 2FCEA 1NX3A 1LVCD 2M1UA 4E68A 1SMGA 2VRGA 2JTTA 3PM8A 1BT6A 1SY9A 2P6BB 1NUBA 2EHBA 3SJSA 4P5OE 1AHRA 1Y0VH 2MRDA 1IWQA 3PATA 1XK4A 2KGRA 1WDCB 3LCPC 3OB1B 2M1KB 5CSJA 3BUMB 4GPLB 1WDCC 5JJGA 1FBVA 4N5XA 2LVIA 1H4BA 2BBNA 1B7TY 1M63B 3K21A 4L9MA 3A8RA 2K7CA 1BR1B 2KNEA 2TN4A 3SG2A 4UPGA 2JT0A 1PVBA 4MZKA 1IQ5A 3GK2A 2MJWB 3FWCA 1OMRA 1ZACA 1PSBA 1B7TZ 3GK4X 4YGBB 1H8BA 1JF0A 1J7OA 1B1GA 3I5GC 1XFYO 2M97A 1SW8A 5J3XA 1J55A 1DVIA 4F0ZB 1YX7A 1NCZA 2EGDA 2Q91A 1ZFSA 2BE4A 1FF1A 2CCMA 2Y1NA 4GGNA 5HKWA 4PHJA 2QPTA 2ZRSA 1MR8A 3LL8B 2JXCA 2KI6D 1XA5A 4M2PA 5B8IB 1IG5A 1K96A 2EC6B 1MXLC 3CS1A 1CB1A 1BF5A 2BCBA 3F45A 4U8DA 1ALVA 4PDZA 4ICBA 2MAZA 2LV7A 1DT7B 3PLFB 1FI6A 1BU3A 1GQMA 1CKKA 2F33A 1YURA 2Y1MA 1DJIA 1J1DA 1QVIY 3OP0A 1FPWA 3C1VA 3NXAA 2LUXA 2SASA 2RGIA 2M0RA 1IJ5A 2M29A 3CR5X 3O2PA 1M45A 4MBEA 1AJ4A 1QVIZ 1DJZA 3IF7A 4ORAB 1S6JA 2JNFA 4FQOA 5K89A 3JTDC 2LP3A 4NDBA 1GGZA 5AERA 1CDPA 4N1FA 4NDCA 1PVAA 2BKHB 1IKUA 1W7IB 1EL4A 2K61A 1LXFC 4D1EA 1SPYA 2LCPA 2Q4UA 1CLBA 1NCXA 2LANA 5FYXA 4NDDA 5HLVA 3DD4A 3CR4X 1XFZO 1AVSA 1OSAA 1DF0A 1NCYA 2A4JA 4A4BA 1RJVA 3EVUA 3LK1A 5I2QA 1AK8A 1N65A 1KK8B 1IQ3A 1BLQA 1QIWA 1JSAA 1WRZA 3KEVA 5DKRA 1IH0A 3HX4A 1K93D 1TNWA 2KAYA 3QRXA 2H61A 2KBIA 4ORCB 1CFDA 3NSKA 1KFXS 5ER5A 1XK4C 2I2RE 2JTZA
chains in the Genus database with same CATH superfamily
4WRIA 5AEQA 1J7QA 2L2CA 1KQMB 1CDLA 3PSRA 1TTXA 2M3WA 2WOSA 1QS7A 2OTGC 2KQ6A 4YBHB 1SKTA 4Q04A 4MEWA 1PALA 1KK7Y 1OOFA 1PULA 2JC2A 4I5LB 2F8PA 4YGCB 1F4OA 1M46A 1JBAA 1KWOC 3JVTB 5CPVA 3TDIA 4JPZB 5JOLA 4JQ0D 2LHLA 1QTXA 1KK7Z 3PALA 2PALA 2QEHA 1HT9A 2V53A 3DVEA 4PALA 1DJGA 1OZOA 1RROA 3D0YB 4DRWA 1CNPA 5CSNA 1PRWA 2ZKMX 3V2LA 5IBWA 2ISDA 1WLMA 1RTP1 4MRXA 2LLSA 1OE9B 3OGNA 1YUSA 3OX6A 3VRRA 3DF0B 4BY4A 3EVRA 1S5GY 1LS8A 1L7ZA 3SS3A 3CTNA 2LVVA 3CZ1A 5CSIA 2GV5A 4C0LA 1QIVA 1SK6D 2L5YA 3KPXA 4CFRA 2LHIA 1DJHA 2QEOA 3M0WA 1XFWO 1QXPA 1SYMA 1S5GZ 3BFAA 3DVKA 2F3YA 3BOWB 4MN0A 4QJ4B 3VRQA 2Y4QA 1B8RA 1NX0A 5AANA 1A4PA 1TNQA 2L4HA 2L98A 2E30A 1V1FA 3BXKA 3CLNA 3S0AA 4XJKB 5D7FA 5I8NA 2WC6A 1OZSA 1YVLA 2HETA 2WNDA 2O60A 4MZJA 3SG3A 3S0DA 5I2OA 3FE9A 4PHMA 2PSRA 1QLSA 2HQWA 3S0EA 2CT9A 3VGOA 3IVTA 1UHNA 5GQQC 3S0GA 4F7FA 3WHUB 2PVBA 1K94A 2PRUA 1KFUL 2IS9A 2JULA 1B8LA 3I5GB 1NP8A 3AAKA 3BUXB 2L50A 3SG7A 3DVJA 1MWNA 3BUOB 3TZ1A 1J7PA 2ZFDA 3BYAA 2KAVA 3BQ3A 1F54A 4CPVA 2JQ6A 1SL7A 1RWYA 2G9BA 5HKYA 3GOFA 2KQYA 1CDMA 3I5HB 2KOTA 2I18A 1YVHA 2MLEC 1K2HA 3I5HC 1MXEA 1B9AA 2ERBA 2H61C 2BCXA 2MLFC 3N7HA 1B8CA 3IQQA 3RLZA 3DVMA 4IL1A 2WORA 1A03A 1GGWA 3NHIA 3A4UB 3H4SE 1TNXA 5EL2A 1S36A 1ALWA 5ER4X 1A75B 1QJTA 2L5XB 2M8UA 3OHMB 4I5KA 5BPJA 3ICBA 1S3PA 5I2LA 3NGVA 1S6CA 2KAXA 1N2DA 1S1EA 1VRKA 3EK4A 1LKJA 2KFHA 3FS7A 1KQVA 3JTDB 4OV2A 2LLUA 3TDUA 1OMDA 1F71A 1SL9A 4OKHA 1CM1A 2HPSA 1QV1A 2LMUA 4HRHA 1C7VA 1NIWA 1S26D 4MVFA 1WY9A 1KSMA 2NLNA 1DJYA 1EXRA 2I94A 1FI5A 2QEVA 4TNCA 1CLMA 1YRTB 2KI6C 1QLKA 2K2FA 4PHKA 5KU1A 1LA0A 3VB1A 4GGFA 3B86A 1ZUZA 1CM4A 2NCPA 1QWVA 2LM5A 3UNWA 2CBLA 1YUUA 1WRKA 2NZ0A 5KTYA 1KSOA 2OPOA 4AQIA 1NX2A 4YI9A 2ZNDA 3R1VA 4YI8A 2MBXA 1F4QA 1UP5A 1IRJA 2M49B 3SG5A 4GUKA 5HYDA 4CFQA 4I5NB 2LAPA 4ETOA 2K2AA 2WCHA 2KPHA 2LP2A 3B6XA 1FW4A 1OOJA 4ORBB 4PE7A 3O4XA 2KSPA 3B88A 2LLTA 1UURA 2G2BA 2OTGB 3D76A 3QMEA 4CIDA 4YGEB 3SG6A 1DGUA 4WQ2A 1CDNA 4HRGA 1KWOB 4NQGA 2CXJA 2ZN8A 3L47A 2M7NA 4DUQA 2ZN9A 2JT8A 1BODA 1NX1A 1TNPA 1U5IA 1UWOA 3OB2B 4QJ3B 3CZTX 1NWDA 1GM0A 1OOIX 2GGZA 3CGAA 3AKBA 1YRUB 3NSIA 1EJ3A 1RECA 2LNKA 1W7JB 4FQTA 1DEKA 2K7DA 2KDHA 2KI4C 1BG1A 2OS8C 2BAPA 3I5IB 1C7WA 3ZWHA 5HL1A 3EKHA 1CFCA 1CFFA 3LLEA 3I5IC 5PALA 1P28A 1MUXA 2QDIA 1AUIB 4PHNA 2FJUB 4JKTA 4MRYA 1XFVO 1QASA 1IGVA 3SG4A 2KYCA 4HREE 3WXAA 1C3YA 3HCMA 4WQ3A 4AOMA 2PASA 2F2OA 2WCJA 3KHEA 1XFXO 3MSEB 4OR9B 4ZCUA 4AQJA 1QATA 1CMGA 2AAOA 3VROA 4MZLA 3WHTB 4C0JA 2KFGA 2B1UA 1N0YA 1QX7A 2JOJA 3CZ2A 1JF2A 1SSEB 2K7BA 3PN7C 4GFTA 2QACA 1CTRA 2LC5A 1RK9A 4PCWA 3FWBA 1XYDA 2R2IA 1WRLA 2JPTA 3O78A 1UHIA 2LVJA 3EK8A 3ZNIA 2BCAA 3FIAA 2FCDA 3R1PA 3EK7A 2CTNA 2JU0A 2K8MB 1J7RA 2LE9B 2AUCA 1XO5A 2WCEA 3SIBA 1PK0D 3L4AA 2BL0B 4YRUA 1YUTA 1K9PA 2JWWA 1TN4A 1LA3A 1SNLA 2BL0C 2WC8A 3E3RA 1F70A 2NXQA 1DF0B 5DICA 4GGFC 4JWQA 3KF9A 4GBAA 1TIZA 4MSPA 1ORGA 2JNXA 5FI6A 1L2OB 2H2KA 1DC1A 2L2EA 1LINA 4N1GA 4YGDB 4CLNA 5AFPA 1L2OC 3EVVA 3NSLA 2L0PA 4M2OA 3RM1A 4FTGA 1B4CA 1PSRA 3CR2A 1JUOA 1MHOA 2F3ZA 1Y1XA 2PQLA 1SCVA 4MLWA 1K9UA 1G8IA 2JXLA 1NYAA 2JZIA 2BKIB 1WLZA 1EG3A 1QV0A 1UHKA 1MF8B 2GTEA 3B7AA 5AXIA 1S6IA 2K60A 3D0YA 4ZCVA 1SCMB 2K0JA 1U5IB 1D1OA 1SL8A 3RZSA 1OOGA 1SCMC 2HF5A 3UO9A 4DS7A 3D77A 3D78A 3DF0A 1BR4B 2JRFA 5DKQA 1KFUS 2BE6A 3D10A 4C0KA 1TOPA 1TUJA 1A2XA 3EKJA 1C07A 1DMOA 2EC6C 2KHNA 1Y6WA 2ZRTA 3DXLA 4PE0A 2WCKA 3D74A 4JD9A 1KFXL 3PM2A 4QJ5B 2AMIA 3CWGA 2COLB 1F8HA 3BUNB 1B47A 1DJWA 5HLOA 3TUYB 4INXA 3AKAA 1Z4HA 3BOWA 2DOQA 3D75A 3TUYC 1TCOB 2M9GA 3VRPA 1UHJA 2D8NA 3AAJA 3L4LA 3KO0A 3DYEA 2PMYA 3R72A 4XYNA 5D69A 1HQVA 4XJKA 1K90D 1QX5B 5CSFA 1KCYA 1AJ5A 1CLLA 1YR5A 1IIOA 2O5GA 4HSZA 1SBJA 3TS5B 4M2QA 2MA2A 1DJXA 1T14A 1M39A 3TS5C 1SRAA 2Y5IA 1BJFA 2M7LA 2KLDA 2FJYA 1M31A 2ZNEA 3O4YA 3EG5B 1ZMZA 4DCKA 1Q80A 2KGBC 3I5FB 3BJHA 3VRNA 4PE1A 3SIAA 2KBMA 2BECA 4OCIA 3I5FC 1Y1AA 1Y1UA 1R2UA 1UHHA 2KYFA 3LK0A 1F55A 1XFUO 4USLA 1SR6B 3PFVA 1A29A 1JFKA 2LVKA 1KK8C 4P2YB 1SR6C 5G08A 2PYQA 1MQ1A 3NSOA 1BMOA 1BOCA 1EG4A 1CFPA 1ODBA 3CABA 1IJ6A 2KI4B 2GGMA 2OS8B 1J1EA 1V1GA 1OMVA 5FI7A 2KLEA 1JFJA 2E6WA 1GJYA 2SCPA 1NSHA 1YX8A 1DTLA 3GK1A 1G4YR 3D73A 1A75A 4YGAA 1K95A 1R6PA 1KQMC 2L4IA 2MHHA 2WCFA 4I5JA 3TDZA 1RFJA 1EH2A 1G33A 5FI2A 2LMTA 5KSZA 1CMFA 4OVNF 1YTZC 4PE4A 1QX2A 2LUCA 4GNKB 5TNCA 1K8UA 2LMVA 2F2PA 1ZOTB 1AP4A 1K9KA 3JVTC 1UUSA 1OQPA 4R1EA 1JWDA 2L51A 3FE8A 2CNPA 5I94A 2HQ8A 5F6TA 3PN7B 2WCBA 3IQOA 2JT3A 4GAOA 1X02A 1TRFA 2FOTA 5DKNA 2K7OA 2NCOA 3WNXB 1JC2A 1DGVA 2KFFA 2BBMA 4BY5A 1XVJA 1E8AA 1NPQA 2I7AA 4A4CA 3SS4A 1TWOA 1TCFA 3O6BA 3OX5A 3BUWB 5HKZA 5D3OA 2FCEA 1NX3A 1LVCD 2M1UA 4E68A 1SMGA 2VRGA 2JTTA 1C3ZA 1BT6A 1SY9A 3PM8A 1OW4A 2P6BB 1NUBA 2EHBA 3SJSA 4P5OE 1AHRA 1Y0VH 2MRDA 1IWQA 3PATA 1XK4A 2KGRA 1WDCB 2YGUA 3LCPC 2M1KB 3OB1B 5CSJA 3BUMB 1Z2CB 4GPLB 1WDCC 3DY9A 1FBVA 4N5XA 5JJGA 2LVIA 1H4BA 2BBNA 1B7TY 1M63B 2BNXA 3K21A 4L9MA 3A8RA 2P71A 2K7CA 1BR1B 2KNEA 2TN4A 3SG2A 4UPGA 1TUZA 2JT0A 1PVBA 4MZKA 1IQ5A 3GK2A 2MJWB 3FWCA 1OMRA 1ZACA 1DELA 1B7TZ 1PSBA 3GK4X 4YGBB 1H8BA 1JF0A 2P70A 1B1GA 1J7OA 3I5GC 1XFYO 3CDNA 2M97A 1SW8A 5J3XA 1J55A 1DVIA 4F0ZB 1YX7A 2WCMA 1NCZA 3PJIA 2EGDA 2Q91A 1ZFSA 2BE4A 1FF1A 2CCMA 2Y1NA 4GGNA 1W9ZA 5HKWA 2WCLA 2QPTA 4PHJA 2ZRSA 1MR8A 3LL8B 2JXCA 2KI6D 1XA5A 4M2PA 3S0BA 1IG5A 5B8IB 1K96A 2EC6B 1MXLC 3CS1A 1CB1A 3BFHA 1BF5A 2BCBA 3F45A 4U8DA 1ALVA 4PDZA 4ICBA 2MAZA 2LV7A 1DT7B 3PLFB 1FI6A 1BU3A 1GQMA 1CKKA 2F33A 3K1EA 3S0FA 1YURA 2Y1MA 1DJIA 1J1DA 4PT1A 1QVIY 3OP0A 3CYZA 3C1VA 1FPWA 3NXAA 2LUXA 1DQEA 2SASA 3B87A 2RGIA 2M0RA 1IJ5A 2M29A 3CR5X 3O2PA 1M45A 4MBEA 1AJ4A 1QVIZ 4IJ7A 1DJZA 3CZ0A 3DZTA 3IF7A 4ORAB 1S6JA 2JNFA 3NHTA 4FQOA 5K89A 3JTDC 2LP3A 4NDBA 1GGZA 4DIRA 5AERA 1CDPA 4N1FA 4NDCA 1PVAA 2BKHB 1IKUA 1W7IB 1EL4A 2K61A 2QEBA 1LXFC 3OBVA 4D1EA 1SPYA 2LCPA 2Q4UA 1XFRA 1CLBA 1NCXA 3BFBA 2LANA 5FYXA 4NDDA 4KYNA 3DD4A 3CR4X 5HLVA 1XFZO 1AVSA 1OSAA 1DF0A 1NCYA 2A4JA 3R1OA 1RJVA 3EVUA 3LK1A 4A4BA 5I2QA 1AK8A 1N65A 1KK8B 1IQ3A 1BLQA 1QIWA 1JSAA 1WRZA 3KEVA 5DKRA 2H8VA 1IH0A 3HX4A 1K93D 1TNWA 2KAYA 2WC5A 3QRXA 2H61A 2KBIA 4INWA 4ORCB 3Q8IA 1OOHA 2JPOA 1CFDA 3NSKA 4OZDA 3SS5A 3FE6A 1KFXS 5ER5A 1XK4C 2I2RE 2JTZA
chains in the Genus database with same CATH topology
4WRIA 5AEQA 1J7QA 1KQMB 1CDLA 3PSRA 1TTXA 2M3WA 2WOSA 1QS7A 2OTGC 2KQ6A 4YBHB 1SKTA 4Q04A 4MEWA 1PALA 1KK7Y 2JC2A 1PULA 4I5LB 2F8PA 4YGCB 1F4OA 1M46A 1JBAA 1KWOC 3JVTB 5CPVA 3TDIA 4JPZB 5JOLA 4JQ0D 2LHLA 1QTXA 1KK7Z 3PALA 2PALA 1HT9A 2V53A 3DVEA 4PALA 1DJGA 1OZOA 1RROA 3D0YB 4DRWA 1CNPA 5CSNA 1PRWA 2ZKMX 5IBWA 2ISDA 1WLMA 1RTP1 4MRXA 2LLSA 1OE9B 3VRRA 1YUSA 3OX6A 3DF0B 4BY4A 3EVRA 1S5GY 1L7ZA 3CTNA 2LVVA 5CSIA 2GV5A 4C0LA 1QIVA 1SK6D 3KPXA 4CFRA 2LHIA 1DJHA 3M0WA 1XFWO 1QXPA 1SYMA 1S5GZ 3DVKA 2F3YA 3BOWB 4MN0A 4QJ4B 3VRQA 2Y4QA 1B8RA 1NX0A 5AANA 1A4PA 1TNQA 2L4HA 2L98A 2E30A 1V1FA 3BXKA 3CLNA 4XJKB 5D7FA 5I8NA 1OZSA 1YVLA 2HETA 2WNDA 2O60A 4MZJA 3SG3A 5I2OA 4PHMA 2PSRA 1QLSA 2HQWA 3VGOA 2CT9A 1UHNA 5GQQC 3WHUB 2PVBA 1K94A 2PRUA 1KFUL 2IS9A 2JULA 1B8LA 3I5GB 1NP8A 3AAKA 3BUXB 2L50A 3SG7A 3DVJA 1MWNA 3BUOB 3TZ1A 1J7PA 2ZFDA 3BYAA 2KAVA 3BQ3A 1F54A 4CPVA 2JQ6A 1SL7A 1RWYA 2G9BA 5HKYA 3GOFA 2KQYA 1CDMA 3I5HB 2KOTA 2I18A 1YVHA 2MLEC 1K2HA 3I5HC 1MXEA 1B9AA 2H61C 3RLZA 2BCXA 2MLFC 4DIRA 1B8CA 3IQQA 3DVMA 4IL1A 2WORA 1A03A 1GGWA 3A4UB 3H4SE 1TNXA 1S36A 1ALWA 5ER4X 1A75B 1QJTA 2L5XB 2M8UA 3OHMB 4I5KA 5BPJA 3ICBA 1S3PA 5I2LA 1S6CA 2KAXA 1N2DA 1S1EA 1VRKA 3EK4A 1LKJA 2KFHA 3FS7A 1KQVA 3JTDB 4OV2A 2LLUA 3TDUA 1OMDA 1F71A 1SL9A 4OKHA 1CM1A 2HPSA 1QV1A 2LMUA 4HRHA 1C7VA 1NIWA 1S26D 4MVFA 1WY9A 1KSMA 2NLNA 1DJYA 1EXRA 2I94A 1FI5A 4TNCA 1CLMA 1YRTB 2KI6C 1QLKA 2K2FA 4PHKA 5KU1A 1LA0A 4GGFA 1ZUZA 1CM4A 2NCPA 2LM5A 2CBLA 1YUUA 1WRKA 2NZ0A 5KTYA 1KSOA 2OPOA 4AQIA 1NX2A 4YI9A 2ZNDA 4YI8A 2MBXA 1F4QA 1UP5A 1IRJA 2M49B 3SG5A 4GUKA 5HYDA 4CFQA 4I5NB 2LAPA 4ETOA 2K2AA 2LP2A 1FW4A 1OOJA 4ORBB 4PE7A 2KSPA 2LLTA 1UURA 2G2BA 2OTGB 4CIDA 4YGEB 3SG6A 1DGUA 4WQ2A 1CDNA 4HRGA 1KWOB 4NQGA 2CXJA 2ZN8A 4DUQA 2M7NA 2ZN9A 2JT8A 1BODA 1NX1A 1TNPA 1U5IA 1UWOA 3OB2B 4QJ3B 3CZTX 1NWDA 2GGZA 3CGAA 3AKBA 1YRUB 3NSIA 1EJ3A 1RECA 2LNKA 1W7JB 2KDHA 2K7DA 2KI4C 1BG1A 2OS8C 3I5IB 1C7WA 3ZWHA 1CFCA 3EKHA 1CFFA 3LLEA 3I5IC 5PALA 1MUXA 1AUIB 4PHNA 2FJUB 4MRYA 1XFVO 1QASA 1IGVA 3SG4A 2KYCA 4HREE 3WXAA 3HCMA 4WQ3A 4AOMA 2PASA 2F2OA 3KHEA 3MSEB 1XFXO 4OR9B 4ZCUA 4AQJA 1QATA 1CMGA 2AAOA 3VROA 4MZLA 3WHTB 4C0JA 2KFGA 2B1UA 1N0YA 1QX7A 2JOJA 3PN7C 1JF2A 4GFTA 2K7BA 2QACA 1CTRA 2LC5A 1RK9A 4PCWA 3FWBA 1XYDA 2R2IA 1WRLA 2JPTA 3O78A 1UHIA 2LVJA 3EK8A 3ZNIA 2BCAA 3FIAA 2FCDA 3EK7A 2CTNA 2JU0A 2K8MB 1J7RA 2LE9B 2AUCA 1XO5A 2WCEA 3SIBA 1PK0D 2BL0B 4YRUA 1YUTA 1K9PA 2JWWA 1TN4A 1LA3A 1SNLA 2BL0C 2WC8A 3E3RA 1F70A 2NXQA 1DF0B 4GGFC 4JWQA 3KF9A 4GBAA 1TIZA 4MSPA 2JNXA 1L2OB 2H2KA 2L2EA 1LINA 4N1GA 4YGDB 4CLNA 5AFPA 1L2OC 3EVVA 3NSLA 2L0PA 4M2OA 3RM1A 4FTGA 1B4CA 1PSRA 3CR2A 1JUOA 1MHOA 2F3ZA 1Y1XA 1SCVA 4MLWA 1K9UA 1G8IA 2JXLA 1NYAA 2JZIA 2BKIB 1WLZA 1EG3A 1QV0A 1UHKA 1MF8B 5AXIA 1S6IA 3D0YA 4ZCVA 1SCMB 2K0JA 1U5IB 1D1OA 1SL8A 1SCMC 2HF5A 4DS7A 3DF0A 1BR4B 2JRFA 5DKQA 1KFUS 2BE6A 3D10A 4C0KA 1TOPA 3EKJA 1A2XA 1C07A 1DMOA 2EC6C 2KHNA 1Y6WA 2ZRTA 4PE0A 1KFXL 4QJ5B 2AMIA 3CWGA 2COLB 1F8HA 3BUNB 1B47A 1DJWA 5HLOA 3TUYB 3AKAA 3BOWA 2DOQA 3TUYC 1TCOB 2M9GA 3VRPA 1UHJA 2D8NA 3AAJA 3KO0A 4XYNA 2PMYA 5D69A 1KCYA 1HQVA 4XJKA 1K90D 1QX5B 5CSFA 1AJ5A 1CLLA 1YR5A 2O5GA 4HSZA 1SBJA 3TS5B 4M2QA 2MA2A 1DJXA 1M39A 3TS5C 1SRAA 2Y5IA 1BJFA 2M7LA 1M31A 2ZNEA 3O4YA 1ZMZA 4DCKA 1Q80A 2KGBC 3I5FB 3VRNA 4PE1A 3SIAA 2KBMA 2BECA 4OCIA 3I5FC 1Y1AA 1Y1UA 1R2UA 1UHHA 2KYFA 3LK0A 1F55A 1XFUO 4USLA 1SR6B 3PFVA 1A29A 1JFKA 2LVKA 1KK8C 4P2YB 1SR6C 5G08A 1MQ1A 3NSOA 1BMOA 1BOCA 1EG4A 1CFPA 1ODBA 1IJ6A 2KI4B 2GGMA 2OS8B 1J1EA 1V1GA 1OMVA 1JFJA 2E6WA 1GJYA 2SCPA 1NSHA 1YX8A 1DTLA 3GK1A 1G4YR 4YGAA 1A75A 1K95A 1R6PA 1KQMC 2L4IA 2MHHA 2WCFA 4I5JA 3TDZA 1RFJA 1EH2A 1G33A 2LMTA 5KSZA 1CMFA 4OVNF 1YTZC 4PE4A 1QX2A 2LUCA 4GNKB 5TNCA 1K8UA 2LMVA 2F2PA 1ZOTB 1AP4A 1K9KA 3JVTC 1UUSA 1OQPA 4R1EA 1JWDA 2L51A 2CNPA 2HQ8A 5F6TA 3PN7B 2WCBA 3IQOA 2JT3A 4GAOA 1X02A 1TRFA 2FOTA 5DKNA 2K7OA 2NCOA 3WNXB 1JC2A 1DGVA 2KFFA 2BBMA 4BY5A 1XVJA 1E8AA 1NPQA 2I7AA 4A4CA 3OX5A 1TCFA 3O6BA 3BUWB 5HKZA 2FCEA 1NX3A 1LVCD 2M1UA 4E68A 1SMGA 2VRGA 2JTTA 3PM8A 1BT6A 1SY9A 2P6BB 1NUBA 2EHBA 3SJSA 4P5OE 1AHRA 1Y0VH 2MRDA 1IWQA 3PATA 1XK4A 2KGRA 1WDCB 3LCPC 3OB1B 2M1KB 5CSJA 3BUMB 4GPLB 1WDCC 5JJGA 1FBVA 4N5XA 2LVIA 1H4BA 2BBNA 1B7TY 1M63B 3K21A 4L9MA 3A8RA 2K7CA 1BR1B 2KNEA 2TN4A 3SG2A 4UPGA 2JT0A 1PVBA 4MZKA 1IQ5A 3GK2A 2MJWB 3FWCA 1OMRA 1ZACA 1PSBA 1B7TZ 3GK4X 4YGBB 1H8BA 1JF0A 1J7OA 1B1GA 3I5GC 1XFYO 2M97A 1SW8A 5J3XA 1J55A 1DVIA 4F0ZB 1YX7A 1NCZA 2EGDA 2Q91A 1ZFSA 2BE4A 1FF1A 2CCMA 2Y1NA 4GGNA 5HKWA 4PHJA 2QPTA 2ZRSA 1MR8A 3LL8B 2JXCA 2KI6D 1XA5A 4M2PA 5B8IB 1IG5A 1K96A 2EC6B 1MXLC 3CS1A 1CB1A 1BF5A 2BCBA 3F45A 4U8DA 1ALVA 4PDZA 4ICBA 2MAZA 2LV7A 1DT7B 3PLFB 1FI6A 1BU3A 1GQMA 1CKKA 2F33A 1YURA 2Y1MA 1DJIA 1J1DA 1QVIY 3OP0A 1FPWA 3C1VA 3NXAA 2LUXA 2SASA 2RGIA 2M0RA 1IJ5A 2M29A 3CR5X 3O2PA 1M45A 4MBEA 1AJ4A 1QVIZ 1DJZA 3IF7A 4ORAB 1S6JA 2JNFA 4FQOA 5K89A 3JTDC 2LP3A 4NDBA 1GGZA 5AERA 1CDPA 4N1FA 4NDCA 1PVAA 2BKHB 1IKUA 1W7IB 1EL4A 2K61A 1LXFC 4D1EA 1SPYA 2LCPA 2Q4UA 1CLBA 1NCXA 2LANA 5FYXA 4NDDA 5HLVA 3DD4A 3CR4X 1XFZO 1AVSA 1OSAA 1DF0A 1NCYA 2A4JA 4A4BA 1RJVA 3EVUA 3LK1A 5I2QA 1AK8A 1N65A 1KK8B 1IQ3A 1BLQA 1QIWA 1JSAA 1WRZA 3KEVA 5DKRA 1IH0A 3HX4A 1K93D 1TNWA 2KAYA 3QRXA 2H61A 2KBIA 4ORCB 1CFDA 3NSKA 1KFXS 5ER5A 1XK4C 2I2RE 2JTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WRI A;  5AEQ A;  1J7Q A;  1KQM B;  1CDL A;  3PSR A;  1TTX A;  2M3W A;  2WOS A;  1QS7 A;  2OTG C;  2KQ6 A;  4YBH B;  1SKT A;  4Q04 A;  4MEW A;  1PAL A;  1KK7 Y;  2JC2 A;  1PUL A;  4I5L B;  2F8P A;  4YGC B;  1F4O A;  1M46 A;  1JBA A;  1KWO C;  3JVT B;  5CPV A;  3TDI A;  4JPZ B;  5JOL A;  4JQ0 D;  2LHL A;  1QTX A;  1KK7 Z;  3PAL A;  2PAL A;  1HT9 A;  2V53 A;  3DVE A;  4PAL A;  1DJG A;  1OZO A;  1RRO A;  3D0Y B;  4DRW A;  1CNP A;  5CSN A;  1PRW A;  2ZKM X;  5IBW A;  2ISD A;  1WLM A;  1RTP 1;  4MRX A;  2LLS A;  1OE9 B;  3VRR A;  1YUS A;  3OX6 A;  3DF0 B;  4BY4 A;  3EVR A;  1S5G Y;  1L7Z A;  3CTN A;  2LVV A;  5CSI A;  2GV5 A;  4C0L A;  1QIV A;  1SK6 D;  3KPX A;  4CFR A;  2LHI A;  1DJH A;  3M0W A;  1XFW O;  1QXP A;  1SYM A;  1S5G Z;  3DVK A;  2F3Y A;  3BOW B;  4MN0 A;  4QJ4 B;  3VRQ A;  2Y4Q A;  1B8R A;  1NX0 A;  5AAN A;  1A4P A;  1TNQ A;  2L4H A;  2L98 A;  2E30 A;  1V1F A;  3BXK A;  3CLN A;  4XJK B;  5D7F A;  5I8N A;  1OZS A;  1YVL A;  2HET A;  2WND A;  2O60 A;  4MZJ A;  3SG3 A;  5I2O A;  4PHM A;  2PSR A;  1QLS A;  2HQW A;  3VGO A;  2CT9 A;  1UHN A;  5GQQ C;  3WHU B;  2PVB A;  1K94 A;  2PRU A;  1KFU L;  2IS9 A;  2JUL A;  1B8L A;  3I5G B;  1NP8 A;  3AAK A;  3BUX B;  2L50 A;  3SG7 A;  3DVJ A;  1MWN A;  3BUO B;  3TZ1 A;  1J7P A;  2ZFD A;  3BYA A;  2KAV A;  3BQ3 A;  1F54 A;  4CPV A;  2JQ6 A;  1SL7 A;  1RWY A;  2G9B A;  5HKY A;  3GOF A;  2KQY A;  1CDM A;  3I5H B;  2KOT A;  2I18 A;  1YVH A;  2MLE C;  1K2H A;  3I5H C;  1MXE A;  1B9A A;  2H61 C;  3RLZ A;  2BCX A;  2MLF C;  4DIR A;  1B8C A;  3IQQ A;  3DVM A;  4IL1 A;  2WOR A;  1A03 A;  1GGW A;  3A4U B;  3H4S E;  1TNX A;  1S36 A;  1ALW A;  5ER4 X;  1A75 B;  1QJT A;  2L5X B;  2M8U A;  3OHM B;  4I5K A;  5BPJ A;  3ICB A;  1S3P A;  5I2L A;  1S6C A;  2KAX A;  1N2D A;  1S1E A;  1VRK A;  3EK4 A;  1LKJ A;  2KFH A;  3FS7 A;  1KQV A;  3JTD B;  4OV2 A;  2LLU A;  3TDU A;  1OMD A;  1F71 A;  1SL9 A;  4OKH A;  1CM1 A;  2HPS A;  1QV1 A;  2LMU A;  4HRH A;  1C7V A;  1NIW A;  1S26 D;  4MVF A;  1WY9 A;  1KSM A;  2NLN A;  1DJY A;  1EXR A;  2I94 A;  1FI5 A;  4TNC A;  1CLM A;  1YRT B;  2KI6 C;  1QLK A;  2K2F A;  4PHK A;  5KU1 A;  1LA0 A;  4GGF A;  1ZUZ A;  1CM4 A;  2NCP A;  2LM5 A;  2CBL A;  1YUU A;  1WRK A;  2NZ0 A;  5KTY A;  1KSO A;  2OPO A;  4AQI A;  1NX2 A;  4YI9 A;  2ZND A;  4YI8 A;  2MBX A;  1F4Q A;  1UP5 A;  1IRJ A;  2M49 B;  3SG5 A;  4GUK A;  5HYD A;  4CFQ A;  4I5N B;  2LAP A;  4ETO A;  2K2A A;  2LP2 A;  1FW4 A;  1OOJ A;  4ORB B;  4PE7 A;  2KSP A;  2LLT A;  1UUR A;  2G2B A;  2OTG B;  4CID A;  4YGE B;  3SG6 A;  1DGU A;  4WQ2 A;  1CDN A;  4HRG A;  1KWO B;  4NQG A;  2CXJ A;  2ZN8 A;  4DUQ A;  2M7N A;  2ZN9 A;  2JT8 A;  1BOD A;  1NX1 A;  1TNP A;  1U5I A;  1UWO A;  3OB2 B;  4QJ3 B;  3CZT X;  1NWD A;  2GGZ A;  3CGA A;  3AKB A;  1YRU B;  3NSI A;  1EJ3 A;  1REC A;  2LNK A;  1W7J B;  2KDH A;  2K7D A;  2KI4 C;  1BG1 A;  2OS8 C;  3I5I B;  1C7W A;  3ZWH A;  1CFC A;  3EKH A;  1CFF A;  3LLE A;  3I5I C;  5PAL A;  1MUX A;  1AUI B;  4PHN A;  2FJU B;  4MRY A;  1XFV O;  1QAS A;  1IGV A;  3SG4 A;  2KYC A;  4HRE E;  3WXA A;  3HCM A;  4WQ3 A;  4AOM A;  2PAS A;  2F2O A;  3KHE A;  3MSE B;  1XFX O;  4OR9 B;  4ZCU A;  4AQJ A;  1QAT A;  1CMG A;  2AAO A;  3VRO A;  4MZL A;  3WHT B;  4C0J A;  2KFG A;  2B1U A;  1N0Y A;  1QX7 A;  2JOJ A;  3PN7 C;  1JF2 A;  4GFT A;  2K7B A;  2QAC A;  1CTR A;  2LC5 A;  1RK9 A;  4PCW A;  3FWB A;  1XYD A;  2R2I A;  1WRL A;  2JPT A;  3O78 A;  1UHI A;  2LVJ A;  3EK8 A;  3ZNI A;  2BCA A;  3FIA A;  2FCD A;  3EK7 A;  2CTN A;  2JU0 A;  2K8M B;  1J7R A;  2LE9 B;  2AUC A;  1XO5 A;  2WCE A;  3SIB A;  1PK0 D;  2BL0 B;  4YRU A;  1YUT A;  1K9P A;  2JWW A;  1TN4 A;  1LA3 A;  1SNL A;  2BL0 C;  2WC8 A;  3E3R A;  1F70 A;  2NXQ A;  1DF0 B;  4GGF C;  4JWQ A;  3KF9 A;  4GBA A;  1TIZ A;  4MSP A;  2JNX A;  1L2O B;  2H2K A;  2L2E A;  1LIN A;  4N1G A;  4YGD B;  4CLN A;  5AFP A;  1L2O C;  3EVV A;  3NSL A;  2L0P A;  4M2O A;  3RM1 A;  4FTG A;  1B4C A;  1PSR A;  3CR2 A;  1JUO A;  1MHO A;  2F3Z A;  1Y1X A;  1SCV A;  4MLW A;  1K9U A;  1G8I A;  2JXL A;  1NYA A;  2JZI A;  2BKI B;  1WLZ A;  1EG3 A;  1QV0 A;  1UHK A;  1MF8 B;  5AXI A;  1S6I A;  3D0Y A;  4ZCV A;  1SCM B;  2K0J A;  1U5I B;  1D1O A;  1SL8 A;  1SCM C;  2HF5 A;  4DS7 A;  3DF0 A;  1BR4 B;  2JRF A;  5DKQ A;  1KFU S;  2BE6 A;  3D10 A;  4C0K A;  1TOP A;  3EKJ A;  1A2X A;  1C07 A;  1DMO A;  2EC6 C;  2KHN A;  1Y6W A;  2ZRT A;  4PE0 A;  1KFX L;  4QJ5 B;  2AMI A;  3CWG A;  2COL B;  1F8H A;  3BUN B;  1B47 A;  1DJW A;  5HLO A;  3TUY B;  3AKA A;  3BOW A;  2DOQ A;  3TUY C;  1TCO B;  2M9G A;  3VRP A;  1UHJ A;  2D8N A;  3AAJ A;  3KO0 A;  4XYN A;  2PMY A;  5D69 A;  1KCY A;  1HQV A;  4XJK A;  1K90 D;  1QX5 B;  5CSF A;  1AJ5 A;  1CLL A;  1YR5 A;  2O5G A;  4HSZ A;  1SBJ A;  3TS5 B;  4M2Q A;  2MA2 A;  1DJX A;  1M39 A;  3TS5 C;  1SRA A;  2Y5I A;  1BJF A;  2M7L A;  1M31 A;  2ZNE A;  3O4Y A;  1ZMZ A;  4DCK A;  1Q80 A;  2KGB C;  3I5F B;  3VRN A;  4PE1 A;  3SIA A;  2KBM A;  2BEC A;  4OCI A;  3I5F C;  1Y1A A;  1Y1U A;  1R2U A;  1UHH A;  2KYF A;  3LK0 A;  1F55 A;  1XFU O;  4USL A;  1SR6 B;  3PFV A;  1A29 A;  1JFK A;  2LVK A;  1KK8 C;  4P2Y B;  1SR6 C;  5G08 A;  1MQ1 A;  3NSO A;  1BMO A;  1BOC A;  1EG4 A;  1CFP A;  1ODB A;  1IJ6 A;  2KI4 B;  2GGM A;  2OS8 B;  1J1E A;  1V1G A;  1OMV A;  1JFJ A;  2E6W A;  1GJY A;  2SCP A;  1NSH A;  1YX8 A;  1DTL A;  3GK1 A;  1G4Y R;  4YGA A;  1A75 A;  1K95 A;  1R6P A;  1KQM C;  2L4I A;  2MHH A;  2WCF A;  4I5J A;  3TDZ A;  1RFJ A;  1EH2 A;  1G33 A;  2LMT A;  5KSZ A;  1CMF A;  4OVN F;  1YTZ C;  4PE4 A;  1QX2 A;  2LUC A;  4GNK B;  5TNC A;  1K8U A;  2LMV A;  2F2P A;  1ZOT B;  1AP4 A;  1K9K A;  3JVT C;  1UUS A;  1OQP A;  4R1E A;  1JWD A;  2L51 A;  2CNP A;  2HQ8 A;  5F6T A;  3PN7 B;  2WCB A;  3IQO A;  2JT3 A;  4GAO A;  1X02 A;  1TRF A;  2FOT A;  5DKN A;  2K7O A;  2NCO A;  3WNX B;  1JC2 A;  1DGV A;  2KFF A;  2BBM A;  4BY5 A;  1XVJ A;  1E8A A;  1NPQ A;  2I7A A;  4A4C A;  3OX5 A;  1TCF A;  3O6B A;  3BUW B;  5HKZ A;  2FCE A;  1NX3 A;  1LVC D;  2M1U A;  4E68 A;  1SMG A;  2VRG A;  2JTT A;  3PM8 A;  1BT6 A;  1SY9 A;  2P6B B;  1NUB A;  2EHB A;  3SJS A;  4P5O E;  1AHR A;  1Y0V H;  2MRD A;  1IWQ A;  3PAT A;  1XK4 A;  2KGR A;  1WDC B;  3LCP C;  3OB1 B;  2M1K B;  5CSJ A;  3BUM B;  4GPL B;  1WDC C;  5JJG A;  1FBV A;  4N5X A;  2LVI A;  1H4B A;  2BBN A;  1B7T Y;  1M63 B;  3K21 A;  4L9M A;  3A8R A;  2K7C A;  1BR1 B;  2KNE A;  2TN4 A;  3SG2 A;  4UPG A;  2JT0 A;  1PVB A;  4MZK A;  1IQ5 A;  3GK2 A;  2MJW B;  3FWC A;  1OMR A;  1ZAC A;  1PSB A;  1B7T Z;  3GK4 X;  4YGB B;  1H8B A;  1JF0 A;  1J7O A;  1B1G A;  3I5G C;  1XFY O;  2M97 A;  1SW8 A;  5J3X A;  1J55 A;  1DVI A;  4F0Z B;  1YX7 A;  1NCZ A;  2EGD A;  2Q91 A;  1ZFS A;  2BE4 A;  1FF1 A;  2CCM A;  2Y1N A;  4GGN A;  5HKW A;  4PHJ A;  2QPT A;  2ZRS A;  1MR8 A;  3LL8 B;  2JXC A;  2KI6 D;  1XA5 A;  4M2P A;  5B8I B;  1IG5 A;  1K96 A;  2EC6 B;  1MXL C;  3CS1 A;  1CB1 A;  1BF5 A;  2BCB A;  3F45 A;  4U8D A;  1ALV A;  4PDZ A;  4ICB A;  2MAZ A;  2LV7 A;  1DT7 B;  3PLF B;  1FI6 A;  1BU3 A;  1GQM A;  1CKK A;  2F33 A;  1YUR A;  2Y1M A;  1DJI A;  1J1D A;  1QVI Y;  3OP0 A;  1FPW A;  3C1V A;  3NXA A;  2LUX A;  2SAS A;  2RGI A;  2M0R A;  1IJ5 A;  2M29 A;  3CR5 X;  3O2P A;  1M45 A;  4MBE A;  1AJ4 A;  1QVI Z;  1DJZ A;  3IF7 A;  4ORA B;  1S6J A;  2JNF A;  4FQO A;  5K89 A;  3JTD C;  2LP3 A;  4NDB A;  1GGZ A;  5AER A;  1CDP A;  4N1F A;  4NDC A;  1PVA A;  2BKH B;  1IKU A;  1W7I B;  1EL4 A;  2K61 A;  1LXF C;  4D1E A;  1SPY A;  2LCP A;  2Q4U A;  1CLB A;  1NCX A;  2LAN A;  5FYX A;  4NDD A;  5HLV A;  3DD4 A;  3CR4 X;  1XFZ O;  1AVS A;  1OSA A;  1DF0 A;  1NCY A;  2A4J A;  4A4B A;  1RJV A;  3EVU A;  3LK1 A;  5I2Q A;  1AK8 A;  1N65 A;  1KK8 B;  1IQ3 A;  1BLQ A;  1QIW A;  1JSA A;  1WRZ A;  3KEV A;  5DKR A;  1IH0 A;  3HX4 A;  1K93 D;  1TNW A;  2KAY A;  3QRX A;  2H61 A;  2KBI A;  4ORC B;  1CFD A;  3NSK A;  1KFX S;  5ER5 A;  1XK4 C;  2I2R E;  2JTZ A; 
#chains in the Genus database with same CATH topology
 4WRI A;  5AEQ A;  1J7Q A;  2L2C A;  1KQM B;  1CDL A;  3PSR A;  1TTX A;  2M3W A;  2WOS A;  1QS7 A;  2OTG C;  2KQ6 A;  4YBH B;  1SKT A;  4Q04 A;  4MEW A;  1PAL A;  1KK7 Y;  1OOF A;  1PUL A;  2JC2 A;  4I5L B;  2F8P A;  4YGC B;  1F4O A;  1M46 A;  1JBA A;  1KWO C;  3JVT B;  5CPV A;  3TDI A;  4JPZ B;  5JOL A;  4JQ0 D;  2LHL A;  1QTX A;  1KK7 Z;  3PAL A;  2PAL A;  2QEH A;  1HT9 A;  2V53 A;  3DVE A;  4PAL A;  1DJG A;  1OZO A;  1RRO A;  3D0Y B;  4DRW A;  1CNP A;  5CSN A;  1PRW A;  2ZKM X;  3V2L A;  5IBW A;  2ISD A;  1WLM A;  1RTP 1;  4MRX A;  2LLS A;  1OE9 B;  3OGN A;  1YUS A;  3OX6 A;  3VRR A;  3DF0 B;  4BY4 A;  3EVR A;  1S5G Y;  1LS8 A;  1L7Z A;  3SS3 A;  3CTN A;  2LVV A;  3CZ1 A;  5CSI A;  2GV5 A;  4C0L A;  1QIV A;  1SK6 D;  2L5Y A;  3KPX A;  4CFR A;  2LHI A;  1DJH A;  2QEO A;  3M0W A;  1XFW O;  1QXP A;  1SYM A;  1S5G Z;  3BFA A;  3DVK A;  2F3Y A;  3BOW B;  4MN0 A;  4QJ4 B;  3VRQ A;  2Y4Q A;  1B8R A;  1NX0 A;  5AAN A;  1A4P A;  1TNQ A;  2L4H A;  2L98 A;  2E30 A;  1V1F A;  3BXK A;  3CLN A;  3S0A A;  4XJK B;  5D7F A;  5I8N A;  2WC6 A;  1OZS A;  1YVL A;  2HET A;  2WND A;  2O60 A;  4MZJ A;  3SG3 A;  3S0D A;  5I2O A;  3FE9 A;  4PHM A;  2PSR A;  1QLS A;  2HQW A;  3S0E A;  2CT9 A;  3VGO A;  3IVT A;  1UHN A;  5GQQ C;  3S0G A;  4F7F A;  3WHU B;  2PVB A;  1K94 A;  2PRU A;  1KFU L;  2IS9 A;  2JUL A;  1B8L A;  3I5G B;  1NP8 A;  3AAK A;  3BUX B;  2L50 A;  3SG7 A;  3DVJ A;  1MWN A;  3BUO B;  3TZ1 A;  1J7P A;  2ZFD A;  3BYA A;  2KAV A;  3BQ3 A;  1F54 A;  4CPV A;  2JQ6 A;  1SL7 A;  1RWY A;  2G9B A;  5HKY A;  3GOF A;  2KQY A;  1CDM A;  3I5H B;  2KOT A;  2I18 A;  1YVH A;  2MLE C;  1K2H A;  3I5H C;  1MXE A;  1B9A A;  2ERB A;  2H61 C;  2BCX A;  2MLF C;  3N7H A;  1B8C A;  3IQQ A;  3RLZ A;  3DVM A;  4IL1 A;  2WOR A;  1A03 A;  1GGW A;  3NHI A;  3A4U B;  3H4S E;  1TNX A;  5EL2 A;  1S36 A;  1ALW A;  5ER4 X;  1A75 B;  1QJT A;  2L5X B;  2M8U A;  3OHM B;  4I5K A;  5BPJ A;  3ICB A;  1S3P A;  5I2L A;  3NGV A;  1S6C A;  2KAX A;  1N2D A;  1S1E A;  1VRK A;  3EK4 A;  1LKJ A;  2KFH A;  3FS7 A;  1KQV A;  3JTD B;  4OV2 A;  2LLU A;  3TDU A;  1OMD A;  1F71 A;  1SL9 A;  4OKH A;  1CM1 A;  2HPS A;  1QV1 A;  2LMU A;  4HRH A;  1C7V A;  1NIW A;  1S26 D;  4MVF A;  1WY9 A;  1KSM A;  2NLN A;  1DJY A;  1EXR A;  2I94 A;  1FI5 A;  2QEV A;  4TNC A;  1CLM A;  1YRT B;  2KI6 C;  1QLK A;  2K2F A;  4PHK A;  5KU1 A;  1LA0 A;  3VB1 A;  4GGF A;  3B86 A;  1ZUZ A;  1CM4 A;  2NCP A;  1QWV A;  2LM5 A;  3UNW A;  2CBL A;  1YUU A;  1WRK A;  2NZ0 A;  5KTY A;  1KSO A;  2OPO A;  4AQI A;  1NX2 A;  4YI9 A;  2ZND A;  3R1V A;  4YI8 A;  2MBX A;  1F4Q A;  1UP5 A;  1IRJ A;  2M49 B;  3SG5 A;  4GUK A;  5HYD A;  4CFQ A;  4I5N B;  2LAP A;  4ETO A;  2K2A A;  2WCH A;  2KPH A;  2LP2 A;  3B6X A;  1FW4 A;  1OOJ A;  4ORB B;  4PE7 A;  3O4X A;  2KSP A;  3B88 A;  2LLT A;  1UUR A;  2G2B A;  2OTG B;  3D76 A;  3QME A;  4CID A;  4YGE B;  3SG6 A;  1DGU A;  4WQ2 A;  1CDN A;  4HRG A;  1KWO B;  4NQG A;  2CXJ A;  2ZN8 A;  3L47 A;  2M7N A;  4DUQ A;  2ZN9 A;  2JT8 A;  1BOD A;  1NX1 A;  1TNP A;  1U5I A;  1UWO A;  3OB2 B;  4QJ3 B;  3CZT X;  1NWD A;  1GM0 A;  1OOI X;  2GGZ A;  3CGA A;  3AKB A;  1YRU B;  3NSI A;  1EJ3 A;  1REC A;  2LNK A;  1W7J B;  4FQT A;  1DEK A;  2K7D A;  2KDH A;  2KI4 C;  1BG1 A;  2OS8 C;  2BAP A;  3I5I B;  1C7W A;  3ZWH A;  5HL1 A;  3EKH A;  1CFC A;  1CFF A;  3LLE A;  3I5I C;  5PAL A;  1P28 A;  1MUX A;  2QDI A;  1AUI B;  4PHN A;  2FJU B;  4JKT A;  4MRY A;  1XFV O;  1QAS A;  1IGV A;  3SG4 A;  2KYC A;  4HRE E;  3WXA A;  1C3Y A;  3HCM A;  4WQ3 A;  4AOM A;  2PAS A;  2F2O A;  2WCJ A;  3KHE A;  1XFX O;  3MSE B;  4OR9 B;  4ZCU A;  4AQJ A;  1QAT A;  1CMG A;  2AAO A;  3VRO A;  4MZL A;  3WHT B;  4C0J A;  2KFG A;  2B1U A;  1N0Y A;  1QX7 A;  2JOJ A;  3CZ2 A;  1JF2 A;  1SSE B;  2K7B A;  3PN7 C;  4GFT A;  2QAC A;  1CTR A;  2LC5 A;  1RK9 A;  4PCW A;  3FWB A;  1XYD A;  2R2I A;  1WRL A;  2JPT A;  3O78 A;  1UHI A;  2LVJ A;  3EK8 A;  3ZNI A;  2BCA A;  3FIA A;  2FCD A;  3R1P A;  3EK7 A;  2CTN A;  2JU0 A;  2K8M B;  1J7R A;  2LE9 B;  2AUC A;  1XO5 A;  2WCE A;  3SIB A;  1PK0 D;  3L4A A;  2BL0 B;  4YRU A;  1YUT A;  1K9P A;  2JWW A;  1TN4 A;  1LA3 A;  1SNL A;  2BL0 C;  2WC8 A;  3E3R A;  1F70 A;  2NXQ A;  1DF0 B;  5DIC A;  4GGF C;  4JWQ A;  3KF9 A;  4GBA A;  1TIZ A;  4MSP A;  1ORG A;  2JNX A;  5FI6 A;  1L2O B;  2H2K A;  1DC1 A;  2L2E A;  1LIN A;  4N1G A;  4YGD B;  4CLN A;  5AFP A;  1L2O C;  3EVV A;  3NSL A;  2L0P A;  4M2O A;  3RM1 A;  4FTG A;  1B4C A;  1PSR A;  3CR2 A;  1JUO A;  1MHO A;  2F3Z A;  1Y1X A;  2PQL A;  1SCV A;  4MLW A;  1K9U A;  1G8I A;  2JXL A;  1NYA A;  2JZI A;  2BKI B;  1WLZ A;  1EG3 A;  1QV0 A;  1UHK A;  1MF8 B;  2GTE A;  3B7A A;  5AXI A;  1S6I A;  2K60 A;  3D0Y A;  4ZCV A;  1SCM B;  2K0J A;  1U5I B;  1D1O A;  1SL8 A;  3RZS A;  1OOG A;  1SCM C;  2HF5 A;  3UO9 A;  4DS7 A;  3D77 A;  3D78 A;  3DF0 A;  1BR4 B;  2JRF A;  5DKQ A;  1KFU S;  2BE6 A;  3D10 A;  4C0K A;  1TOP A;  1TUJ A;  1A2X A;  3EKJ A;  1C07 A;  1DMO A;  2EC6 C;  2KHN A;  1Y6W A;  2ZRT A;  3DXL A;  4PE0 A;  2WCK A;  3D74 A;  4JD9 A;  1KFX L;  3PM2 A;  4QJ5 B;  2AMI A;  3CWG A;  2COL B;  1F8H A;  3BUN B;  1B47 A;  1DJW A;  5HLO A;  3TUY B;  4INX A;  3AKA A;  1Z4H A;  3BOW A;  2DOQ A;  3D75 A;  3TUY C;  1TCO B;  2M9G A;  3VRP A;  1UHJ A;  2D8N A;  3AAJ A;  3L4L A;  3KO0 A;  3DYE A;  2PMY A;  3R72 A;  4XYN A;  5D69 A;  1HQV A;  4XJK A;  1K90 D;  1QX5 B;  5CSF A;  1KCY A;  1AJ5 A;  1CLL A;  1YR5 A;  1IIO A;  2O5G A;  4HSZ A;  1SBJ A;  3TS5 B;  4M2Q A;  2MA2 A;  1DJX A;  1T14 A;  1M39 A;  3TS5 C;  1SRA A;  2Y5I A;  1BJF A;  2M7L A;  2KLD A;  2FJY A;  1M31 A;  2ZNE A;  3O4Y A;  3EG5 B;  1ZMZ A;  4DCK A;  1Q80 A;  2KGB C;  3I5F B;  3BJH A;  3VRN A;  4PE1 A;  3SIA A;  2KBM A;  2BEC A;  4OCI A;  3I5F C;  1Y1A A;  1Y1U A;  1R2U A;  1UHH A;  2KYF A;  3LK0 A;  1F55 A;  1XFU O;  4USL A;  1SR6 B;  3PFV A;  1A29 A;  1JFK A;  2LVK A;  1KK8 C;  4P2Y B;  1SR6 C;  5G08 A;  2PYQ A;  1MQ1 A;  3NSO A;  1BMO A;  1BOC A;  1EG4 A;  1CFP A;  1ODB A;  3CAB A;  1IJ6 A;  2KI4 B;  2GGM A;  2OS8 B;  1J1E A;  1V1G A;  1OMV A;  5FI7 A;  2KLE A;  1JFJ A;  2E6W A;  1GJY A;  2SCP A;  1NSH A;  1YX8 A;  1DTL A;  3GK1 A;  1G4Y R;  3D73 A;  1A75 A;  4YGA A;  1K95 A;  1R6P A;  1KQM C;  2L4I A;  2MHH A;  2WCF A;  4I5J A;  3TDZ A;  1RFJ A;  1EH2 A;  1G33 A;  5FI2 A;  2LMT A;  5KSZ A;  1CMF A;  4OVN F;  1YTZ C;  4PE4 A;  1QX2 A;  2LUC A;  4GNK B;  5TNC A;  1K8U A;  2LMV A;  2F2P A;  1ZOT B;  1AP4 A;  1K9K A;  3JVT C;  1UUS A;  1OQP A;  4R1E A;  1JWD A;  2L51 A;  3FE8 A;  2CNP A;  5I94 A;  2HQ8 A;  5F6T A;  3PN7 B;  2WCB A;  3IQO A;  2JT3 A;  4GAO A;  1X02 A;  1TRF A;  2FOT A;  5DKN A;  2K7O A;  2NCO A;  3WNX B;  1JC2 A;  1DGV A;  2KFF A;  2BBM A;  4BY5 A;  1XVJ A;  1E8A A;  1NPQ A;  2I7A A;  4A4C A;  3SS4 A;  1TWO A;  1TCF A;  3O6B A;  3OX5 A;  3BUW B;  5HKZ A;  5D3O A;  2FCE A;  1NX3 A;  1LVC D;  2M1U A;  4E68 A;  1SMG A;  2VRG A;  2JTT A;  1C3Z A;  1BT6 A;  1SY9 A;  3PM8 A;  1OW4 A;  2P6B B;  1NUB A;  2EHB A;  3SJS A;  4P5O E;  1AHR A;  1Y0V H;  2MRD A;  1IWQ A;  3PAT A;  1XK4 A;  2KGR A;  1WDC B;  2YGU A;  3LCP C;  2M1K B;  3OB1 B;  5CSJ A;  3BUM B;  1Z2C B;  4GPL B;  1WDC C;  3DY9 A;  1FBV A;  4N5X A;  5JJG A;  2LVI A;  1H4B A;  2BBN A;  1B7T Y;  1M63 B;  2BNX A;  3K21 A;  4L9M A;  3A8R A;  2P71 A;  2K7C A;  1BR1 B;  2KNE A;  2TN4 A;  3SG2 A;  4UPG A;  1TUZ A;  2JT0 A;  1PVB A;  4MZK A;  1IQ5 A;  3GK2 A;  2MJW B;  3FWC A;  1OMR A;  1ZAC A;  1DEL A;  1B7T Z;  1PSB A;  3GK4 X;  4YGB B;  1H8B A;  1JF0 A;  2P70 A;  1B1G A;  1J7O A;  3I5G C;  1XFY O;  3CDN A;  2M97 A;  1SW8 A;  5J3X A;  1J55 A;  1DVI A;  4F0Z B;  1YX7 A;  2WCM A;  1NCZ A;  3PJI A;  2EGD A;  2Q91 A;  1ZFS A;  2BE4 A;  1FF1 A;  2CCM A;  2Y1N A;  4GGN A;  1W9Z A;  5HKW A;  2WCL A;  2QPT A;  4PHJ A;  2ZRS A;  1MR8 A;  3LL8 B;  2JXC A;  2KI6 D;  1XA5 A;  4M2P A;  3S0B A;  1IG5 A;  5B8I B;  1K96 A;  2EC6 B;  1MXL C;  3CS1 A;  1CB1 A;  3BFH A;  1BF5 A;  2BCB A;  3F45 A;  4U8D A;  1ALV A;  4PDZ A;  4ICB A;  2MAZ A;  2LV7 A;  1DT7 B;  3PLF B;  1FI6 A;  1BU3 A;  1GQM A;  1CKK A;  2F33 A;  3K1E A;  3S0F A;  1YUR A;  2Y1M A;  1DJI A;  1J1D A;  4PT1 A;  1QVI Y;  3OP0 A;  3CYZ A;  3C1V A;  1FPW A;  3NXA A;  2LUX A;  1DQE A;  2SAS A;  3B87 A;  2RGI A;  2M0R A;  1IJ5 A;  2M29 A;  3CR5 X;  3O2P A;  1M45 A;  4MBE A;  1AJ4 A;  1QVI Z;  4IJ7 A;  1DJZ A;  3CZ0 A;  3DZT A;  3IF7 A;  4ORA B;  1S6J A;  2JNF A;  3NHT A;  4FQO A;  5K89 A;  3JTD C;  2LP3 A;  4NDB A;  1GGZ A;  4DIR A;  5AER A;  1CDP A;  4N1F A;  4NDC A;  1PVA A;  2BKH B;  1IKU A;  1W7I B;  1EL4 A;  2K61 A;  2QEB A;  1LXF C;  3OBV A;  4D1E A;  1SPY A;  2LCP A;  2Q4U A;  1XFR A;  1CLB A;  1NCX A;  3BFB A;  2LAN A;  5FYX A;  4NDD A;  4KYN A;  3DD4 A;  3CR4 X;  5HLV A;  1XFZ O;  1AVS A;  1OSA A;  1DF0 A;  1NCY A;  2A4J A;  3R1O A;  1RJV A;  3EVU A;  3LK1 A;  4A4B A;  5I2Q A;  1AK8 A;  1N65 A;  1KK8 B;  1IQ3 A;  1BLQ A;  1QIW A;  1JSA A;  1WRZ A;  3KEV A;  5DKR A;  2H8V A;  1IH0 A;  3HX4 A;  1K93 D;  1TNW A;  2KAY A;  2WC5 A;  3QRX A;  2H61 A;  2KBI A;  4INW A;  4ORC B;  3Q8I A;  1OOH A;  2JPO A;  1CFD A;  3NSK A;  4OZD A;  3SS5 A;  3FE6 A;  1KFX S;  5ER5 A;  1XK4 C;  2I2R E;  2JTZ A; 
#chains in the Genus database with same CATH homology
 4WRI A;  5AEQ A;  1J7Q A;  1KQM B;  1CDL A;  3PSR A;  1TTX A;  2M3W A;  2WOS A;  1QS7 A;  2OTG C;  2KQ6 A;  4YBH B;  1SKT A;  4Q04 A;  4MEW A;  1PAL A;  1KK7 Y;  2JC2 A;  1PUL A;  4I5L B;  2F8P A;  4YGC B;  1F4O A;  1M46 A;  1JBA A;  1KWO C;  3JVT B;  5CPV A;  3TDI A;  4JPZ B;  5JOL A;  4JQ0 D;  2LHL A;  1QTX A;  1KK7 Z;  3PAL A;  2PAL A;  1HT9 A;  2V53 A;  3DVE A;  4PAL A;  1DJG A;  1OZO A;  1RRO A;  3D0Y B;  4DRW A;  1CNP A;  5CSN A;  1PRW A;  2ZKM X;  5IBW A;  2ISD A;  1WLM A;  1RTP 1;  4MRX A;  2LLS A;  1OE9 B;  3VRR A;  1YUS A;  3OX6 A;  3DF0 B;  4BY4 A;  3EVR A;  1S5G Y;  1L7Z A;  3CTN A;  2LVV A;  5CSI A;  2GV5 A;  4C0L A;  1QIV A;  1SK6 D;  3KPX A;  4CFR A;  2LHI A;  1DJH A;  3M0W A;  1XFW O;  1QXP A;  1SYM A;  1S5G Z;  3DVK A;  2F3Y A;  3BOW B;  4MN0 A;  4QJ4 B;  3VRQ A;  2Y4Q A;  1B8R A;  1NX0 A;  5AAN A;  1A4P A;  1TNQ A;  2L4H A;  2L98 A;  2E30 A;  1V1F A;  3BXK A;  3CLN A;  4XJK B;  5D7F A;  5I8N A;  1OZS A;  1YVL A;  2HET A;  2WND A;  2O60 A;  4MZJ A;  3SG3 A;  5I2O A;  4PHM A;  2PSR A;  1QLS A;  2HQW A;  3VGO A;  2CT9 A;  1UHN A;  5GQQ C;  3WHU B;  2PVB A;  1K94 A;  2PRU A;  1KFU L;  2IS9 A;  2JUL A;  1B8L A;  3I5G B;  1NP8 A;  3AAK A;  3BUX B;  2L50 A;  3SG7 A;  3DVJ A;  1MWN A;  3BUO B;  3TZ1 A;  1J7P A;  2ZFD A;  3BYA A;  2KAV A;  3BQ3 A;  1F54 A;  4CPV A;  2JQ6 A;  1SL7 A;  1RWY A;  2G9B A;  5HKY A;  3GOF A;  2KQY A;  1CDM A;  3I5H B;  2KOT A;  2I18 A;  1YVH A;  2MLE C;  1K2H A;  3I5H C;  1MXE A;  1B9A A;  2H61 C;  3RLZ A;  2BCX A;  2MLF C;  4DIR A;  1B8C A;  3IQQ A;  3DVM A;  4IL1 A;  2WOR A;  1A03 A;  1GGW A;  3A4U B;  3H4S E;  1TNX A;  1S36 A;  1ALW A;  5ER4 X;  1A75 B;  1QJT A;  2L5X B;  2M8U A;  3OHM B;  4I5K A;  5BPJ A;  3ICB A;  1S3P A;  5I2L A;  1S6C A;  2KAX A;  1N2D A;  1S1E A;  1VRK A;  3EK4 A;  1LKJ A;  2KFH A;  3FS7 A;  1KQV A;  3JTD B;  4OV2 A;  2LLU A;  3TDU A;  1OMD A;  1F71 A;  1SL9 A;  4OKH A;  1CM1 A;  2HPS A;  1QV1 A;  2LMU A;  4HRH A;  1C7V A;  1NIW A;  1S26 D;  4MVF A;  1WY9 A;  1KSM A;  2NLN A;  1DJY A;  1EXR A;  2I94 A;  1FI5 A;  4TNC A;  1CLM A;  1YRT B;  2KI6 C;  1QLK A;  2K2F A;  4PHK A;  5KU1 A;  1LA0 A;  4GGF A;  1ZUZ A;  1CM4 A;  2NCP A;  2LM5 A;  2CBL A;  1YUU A;  1WRK A;  2NZ0 A;  5KTY A;  1KSO A;  2OPO A;  4AQI A;  1NX2 A;  4YI9 A;  2ZND A;  4YI8 A;  2MBX A;  1F4Q A;  1UP5 A;  1IRJ A;  2M49 B;  3SG5 A;  4GUK A;  5HYD A;  4CFQ A;  4I5N B;  2LAP A;  4ETO A;  2K2A A;  2LP2 A;  1FW4 A;  1OOJ A;  4ORB B;  4PE7 A;  2KSP A;  2LLT A;  1UUR A;  2G2B A;  2OTG B;  4CID A;  4YGE B;  3SG6 A;  1DGU A;  4WQ2 A;  1CDN A;  4HRG A;  1KWO B;  4NQG A;  2CXJ A;  2ZN8 A;  4DUQ A;  2M7N A;  2ZN9 A;  2JT8 A;  1BOD A;  1NX1 A;  1TNP A;  1U5I A;  1UWO A;  3OB2 B;  4QJ3 B;  3CZT X;  1NWD A;  2GGZ A;  3CGA A;  3AKB A;  1YRU B;  3NSI A;  1EJ3 A;  1REC A;  2LNK A;  1W7J B;  2KDH A;  2K7D A;  2KI4 C;  1BG1 A;  2OS8 C;  3I5I B;  1C7W A;  3ZWH A;  1CFC A;  3EKH A;  1CFF A;  3LLE A;  3I5I C;  5PAL A;  1MUX A;  1AUI B;  4PHN A;  2FJU B;  4MRY A;  1XFV O;  1QAS A;  1IGV A;  3SG4 A;  2KYC A;  4HRE E;  3WXA A;  3HCM A;  4WQ3 A;  4AOM A;  2PAS A;  2F2O A;  3KHE A;  3MSE B;  1XFX O;  4OR9 B;  4ZCU A;  4AQJ A;  1QAT A;  1CMG A;  2AAO A;  3VRO A;  4MZL A;  3WHT B;  4C0J A;  2KFG A;  2B1U A;  1N0Y A;  1QX7 A;  2JOJ A;  3PN7 C;  1JF2 A;  4GFT A;  2K7B A;  2QAC A;  1CTR A;  2LC5 A;  1RK9 A;  4PCW A;  3FWB A;  1XYD A;  2R2I A;  1WRL A;  2JPT A;  3O78 A;  1UHI A;  2LVJ A;  3EK8 A;  3ZNI A;  2BCA A;  3FIA A;  2FCD A;  3EK7 A;  2CTN A;  2JU0 A;  2K8M B;  1J7R A;  2LE9 B;  2AUC A;  1XO5 A;  2WCE A;  3SIB A;  1PK0 D;  2BL0 B;  4YRU A;  1YUT A;  1K9P A;  2JWW A;  1TN4 A;  1LA3 A;  1SNL A;  2BL0 C;  2WC8 A;  3E3R A;  1F70 A;  2NXQ A;  1DF0 B;  4GGF C;  4JWQ A;  3KF9 A;  4GBA A;  1TIZ A;  4MSP A;  2JNX A;  1L2O B;  2H2K A;  2L2E A;  1LIN A;  4N1G A;  4YGD B;  4CLN A;  5AFP A;  1L2O C;  3EVV A;  3NSL A;  2L0P A;  4M2O A;  3RM1 A;  4FTG A;  1B4C A;  1PSR A;  3CR2 A;  1JUO A;  1MHO A;  2F3Z A;  1Y1X A;  1SCV A;  4MLW A;  1K9U A;  1G8I A;  2JXL A;  1NYA A;  2JZI A;  2BKI B;  1WLZ A;  1EG3 A;  1QV0 A;  1UHK A;  1MF8 B;  5AXI A;  1S6I A;  3D0Y A;  4ZCV A;  1SCM B;  2K0J A;  1U5I B;  1D1O A;  1SL8 A;  1SCM C;  2HF5 A;  4DS7 A;  3DF0 A;  1BR4 B;  2JRF A;  5DKQ A;  1KFU S;  2BE6 A;  3D10 A;  4C0K A;  1TOP A;  3EKJ A;  1A2X A;  1C07 A;  1DMO A;  2EC6 C;  2KHN A;  1Y6W A;  2ZRT A;  4PE0 A;  1KFX L;  4QJ5 B;  2AMI A;  3CWG A;  2COL B;  1F8H A;  3BUN B;  1B47 A;  1DJW A;  5HLO A;  3TUY B;  3AKA A;  3BOW A;  2DOQ A;  3TUY C;  1TCO B;  2M9G A;  3VRP A;  1UHJ A;  2D8N A;  3AAJ A;  3KO0 A;  4XYN A;  2PMY A;  5D69 A;  1KCY A;  1HQV A;  4XJK A;  1K90 D;  1QX5 B;  5CSF A;  1AJ5 A;  1CLL A;  1YR5 A;  2O5G A;  4HSZ A;  1SBJ A;  3TS5 B;  4M2Q A;  2MA2 A;  1DJX A;  1M39 A;  3TS5 C;  1SRA A;  2Y5I A;  1BJF A;  2M7L A;  1M31 A;  2ZNE A;  3O4Y A;  1ZMZ A;  4DCK A;  1Q80 A;  2KGB C;  3I5F B;  3VRN A;  4PE1 A;  3SIA A;  2KBM A;  2BEC A;  4OCI A;  3I5F C;  1Y1A A;  1Y1U A;  1R2U A;  1UHH A;  2KYF A;  3LK0 A;  1F55 A;  1XFU O;  4USL A;  1SR6 B;  3PFV A;  1A29 A;  1JFK A;  2LVK A;  1KK8 C;  4P2Y B;  1SR6 C;  5G08 A;  1MQ1 A;  3NSO A;  1BMO A;  1BOC A;  1EG4 A;  1CFP A;  1ODB A;  1IJ6 A;  2KI4 B;  2GGM A;  2OS8 B;  1J1E A;  1V1G A;  1OMV A;  1JFJ A;  2E6W A;  1GJY A;  2SCP A;  1NSH A;  1YX8 A;  1DTL A;  3GK1 A;  1G4Y R;  4YGA A;  1A75 A;  1K95 A;  1R6P A;  1KQM C;  2L4I A;  2MHH A;  2WCF A;  4I5J A;  3TDZ A;  1RFJ A;  1EH2 A;  1G33 A;  2LMT A;  5KSZ A;  1CMF A;  4OVN F;  1YTZ C;  4PE4 A;  1QX2 A;  2LUC A;  4GNK B;  5TNC A;  1K8U A;  2LMV A;  2F2P A;  1ZOT B;  1AP4 A;  1K9K A;  3JVT C;  1UUS A;  1OQP A;  4R1E A;  1JWD A;  2L51 A;  2CNP A;  2HQ8 A;  5F6T A;  3PN7 B;  2WCB A;  3IQO A;  2JT3 A;  4GAO A;  1X02 A;  1TRF A;  2FOT A;  5DKN A;  2K7O A;  2NCO A;  3WNX B;  1JC2 A;  1DGV A;  2KFF A;  2BBM A;  4BY5 A;  1XVJ A;  1E8A A;  1NPQ A;  2I7A A;  4A4C A;  3OX5 A;  1TCF A;  3O6B A;  3BUW B;  5HKZ A;  2FCE A;  1NX3 A;  1LVC D;  2M1U A;  4E68 A;  1SMG A;  2VRG A;  2JTT A;  3PM8 A;  1BT6 A;  1SY9 A;  2P6B B;  1NUB A;  2EHB A;  3SJS A;  4P5O E;  1AHR A;  1Y0V H;  2MRD A;  1IWQ A;  3PAT A;  1XK4 A;  2KGR A;  1WDC B;  3LCP C;  3OB1 B;  2M1K B;  5CSJ A;  3BUM B;  4GPL B;  1WDC C;  5JJG A;  1FBV A;  4N5X A;  2LVI A;  1H4B A;  2BBN A;  1B7T Y;  1M63 B;  3K21 A;  4L9M A;  3A8R A;  2K7C A;  1BR1 B;  2KNE A;  2TN4 A;  3SG2 A;  4UPG A;  2JT0 A;  1PVB A;  4MZK A;  1IQ5 A;  3GK2 A;  2MJW B;  3FWC A;  1OMR A;  1ZAC A;  1PSB A;  1B7T Z;  3GK4 X;  4YGB B;  1H8B A;  1JF0 A;  1J7O A;  1B1G A;  3I5G C;  1XFY O;  2M97 A;  1SW8 A;  5J3X A;  1J55 A;  1DVI A;  4F0Z B;  1YX7 A;  1NCZ A;  2EGD A;  2Q91 A;  1ZFS A;  2BE4 A;  1FF1 A;  2CCM A;  2Y1N A;  4GGN A;  5HKW A;  4PHJ A;  2QPT A;  2ZRS A;  1MR8 A;  3LL8 B;  2JXC A;  2KI6 D;  1XA5 A;  4M2P A;  5B8I B;  1IG5 A;  1K96 A;  2EC6 B;  1MXL C;  3CS1 A;  1CB1 A;  1BF5 A;  2BCB A;  3F45 A;  4U8D A;  1ALV A;  4PDZ A;  4ICB A;  2MAZ A;  2LV7 A;  1DT7 B;  3PLF B;  1FI6 A;  1BU3 A;  1GQM A;  1CKK A;  2F33 A;  1YUR A;  2Y1M A;  1DJI A;  1J1D A;  1QVI Y;  3OP0 A;  1FPW A;  3C1V A;  3NXA A;  2LUX A;  2SAS A;  2RGI A;  2M0R A;  1IJ5 A;  2M29 A;  3CR5 X;  3O2P A;  1M45 A;  4MBE A;  1AJ4 A;  1QVI Z;  1DJZ A;  3IF7 A;  4ORA B;  1S6J A;  2JNF A;  4FQO A;  5K89 A;  3JTD C;  2LP3 A;  4NDB A;  1GGZ A;  5AER A;  1CDP A;  4N1F A;  4NDC A;  1PVA A;  2BKH B;  1IKU A;  1W7I B;  1EL4 A;  2K61 A;  1LXF C;  4D1E A;  1SPY A;  2LCP A;  2Q4U A;  1CLB A;  1NCX A;  2LAN A;  5FYX A;  4NDD A;  5HLV A;  3DD4 A;  3CR4 X;  1XFZ O;  1AVS A;  1OSA A;  1DF0 A;  1NCY A;  2A4J A;  4A4B A;  1RJV A;  3EVU A;  3LK1 A;  5I2Q A;  1AK8 A;  1N65 A;  1KK8 B;  1IQ3 A;  1BLQ A;  1QIW A;  1JSA A;  1WRZ A;  3KEV A;  5DKR A;  1IH0 A;  3HX4 A;  1K93 D;  1TNW A;  2KAY A;  3QRX A;  2H61 A;  2KBI A;  4ORC B;  1CFD A;  3NSK A;  1KFX S;  5ER5 A;  1XK4 C;  2I2R E;  2JTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...