5I2OA

Structure of ef-hand containing protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
102
Chain Sequence
FNPYTEFKEFSRKQIKDMEKMFKQYDDGFIDLMALKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EF-hand domain-containing protein D2
publication title Structural implications of Ca(2+)-dependent actin-bundling function of human EFhd2/Swiprosin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 102
sequence length 105
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5i2oA00
1YR5A 3A8RA 2PSRA 1K93D 3OP0A 5IBWA 1FI5A 1PSRA 1L2OC 2K7BA 1K95A 3SG6A 2HETA 4PHKA 4ORCB 2JNFA 3O4YA 1BLQA 1YRTB 1QVIZ 1OMVA 4CPVA 1F4QA 2G2BA 2ZNEA 4MVFA 4M2QA 4MRXA 1XVJA 1RFJA 2JXLA 3I5IC 3F45A 2FOTA 1XA5A 2Y5IA 4DUQA 3PATA 1CFFA 1TRFA 1OZSA 3I5HC 2R2IA 4AQJA 2KQ6A 2KYFA 2PRUA 2WC8A 1CLLA 2LNKA 3TDIA 2CNPA 2H61C 3O2PA 4MSPA 3RLZA 3PN7B 4I5NB 3LLEA 1G8IA 2L51A 3OB1B 1QV0A 1KFUL 5CSFA 1HT9A 1DTLA 2K8MB 3EKHA 5HLVA 1MXLC 4YGCB 1D1OA 1SK6D 4MEWA 2KAYA 1YX8A 1PSBA 2LMVA 3CTNA 3KHEA 3FS7A 2BCBA 4ZCVA 4C0LA 1NX0A 2H61A 2K61A 2EC6C 2B1UA 1UHIA 5AERA 2OS8C 2M3WA 2JNXA 4QJ4B 2Y1MA 2KOTA 2OPOA 1UHNA 3SG2A 5AEQA 3CR2A 1E8AA 1WRKA 2OTGB 3LCPC 2BCAA 3D0YB 1CLBA 2JU0A 2KFFA 1YTZC 4YGEB 3FWCA 4JWQA 2LUCA 3EK7A 2K7CA 2KI4C 1CDMA 3SG4A 1LINA 1K9PA 2KSPA 1JF2A 1G4YR 3I5HB 1DJIA 1SKTA 3C1VA 1DGUA 2LVVA 3IQQA 2BBNA 4GGFA 4ICBA 3TDUA 1JC2A 1DGVA 1SNLA 4P2YB 5ER4X 3VGOA 1SL8A 1TNXA 1M46A 1Y1UA 3TUYC 1QX5B 4YRUA 2LLUA 2SCPA 2F3YA 1MR8A 1Y1XA 2LP3A 1WDCB 1BMOA 4U8DA 2LLTA 3KPXA 3VRQA 5HLOA 1ODBA 2K7OA 1IJ5A 2L50A 3I5GB 1CM1A 4HRGA 1MXEA 1ZOTB 4OR9B 1KSMA 1A03A 4XJKA 2EC6B 1VRKA 1S3PA 2ZKMX 2L4IA 3ICBA 1CFPA 1BR1B 1UP5A 1J7OA 2JT0A 2NXQA 4FQOA 1EG3A 2K2AA 3PSRA 1YUTA 4FTGA 3TS5B 1BOCA 1B8RA 4Q04A 2BBMA 1K90D 1KWOB 4QJ5B 4PE1A 1V1GA 3VRRA 3HCMA 1DF0A 1TCOB 2KFGA 2M49B 3AAJA 2KBMA 1FW4A 2KI4B 1A2XA 1DJZA 1S5GY 2AAOA 3BYAA 1OSAA 4A4CA 2LHLA 5HKWA 3ZWHA 2F3ZA 3EVVA 1TNQA 2KDHA 5I2OA 3AKAA 1MQ1A 5DKQA 1EH2A 1K9KA 4NDDA 1AJ4A 1B4CA 3A4UB 3LL8B 1EXRA 1RROA 1DT7B 2LAPA 1PVBA 1EL4A 1IGVA 4PE7A 1AHRA 5I2LA 2M1KB 1TNWA 1SMGA 3FIAA 3DVEA 1QX2A 2FCDA 1SY9A 2Q91A 4PHNA 1Y0VH 2KYCA 1Q80A 2KI6D 4NQGA 1CLMA 5J3XA 1CKKA 1KFUS 1YURA 3KEVA 2LCPA 2EHBA 1JSAA 2M0RA 4DS7A 2I7AA 2IS9A 1OQPA 1KFXS 1PRWA 2CBLA 2M97A 2NZ0A 1WLZA 2QACA 3EVUA 1ZUZA 4ZCUA 1AJ5A 1LKJA 2BL0C 1AP4A 2M1UA 2A4JA 1PULA 4ORBB 2GGZA 3BUOB 1QLSA 1QTXA 2JTTA 1KK8C 1H4BA 1XFWO 1S36A 4GGNA 2WCEA 3HX4A 1A75A 1SYMA 4YI8A 3OHMB 2GV5A 1NCXA 2LMUA 3ZNIA 2FJUB 4PE4A 1SCVA 4ETOA 1QASA 1LVCD 2JZIA 1CB1A 4R1EA 2ZNDA 3O78A 2LUXA 2M7LA 2BE6A 1BG1A 2KGBC 3JTDB 3CR5X 2MLFC 1SCMB 1RK9A 1S6IA 2H2KA 1CDNA 2BKHB 3CZTX 3IQOA 3NSLA 4MN0A 1OMDA 3CWGA 3PFVA 4MBEA 2KGRA 1KFXL 1B9AA 5HKYA 5I8NA 3BQ3A 1F70A 2E6WA 1CDLA 5AFPA 3EK4A 1L2OB 1B7TZ 2E30A 2BL0B 4OVNF 1JFJA 1SBJA 4GGFC 1NCZA 1GGWA 3BOWA 2MA2A 1K94A 4TNCA 5K89A 2ISDA 2CT9A 3I5IB 2G9BA 5AXIA 1UUSA 3TZ1A 1NX1A 2LVIA 1DJYA 5DKNA 2HPSA 1MF8B 3BUXB 3BUNB 1OOJA 1AUIB 1QATA 1XFZO 1A4PA 1XFVO 2MHHA 1CFCA 5BPJA 1F71A 1IH0A 1QX7A 1FBVA 1RECA 1M45A 2CTNA 2JT8A 4MZKA 1J1EA 4PALA 1K9UA 4DRWA 3K21A 1S6JA 1WRZA 3H4SE 4I5JA 5HKZA 3VRNA 1ZMZA 1IWQA 1PK0D 2BECA 2JXCA 3JVTC 2MRDA 4N1GA 3SIAA 1SL9A 2L98A 5CSNA 4I5KA 5D7FA 3RM1A 3OX5A 1QIVA 4AQIA 2P6BB 1CFDA 2M29A 1OMRA 1ALWA 4QJ3B 2DOQA 3SG5A 1X02A 1QIWA 5B8IB 1TIZA 4CIDA 2JT3A 1QJTA 2NCOA 1NYAA 1K96A 2OS8B 3QRXA 1W7IB 1GQMA 4PCWA 3DF0A 1GJYA 2KAXA 3EK8A 4CFQA 1YUSA 3PM8A 4YGDB 4IL1A 2O60A 4YGAA 5KTYA 2I2RE 1BODA 1C7VA 4P5OE 1CNPA 1Y1AA 1B47A 2WORA 5JOLA 1U5IA 1DJGA 1NWDA 1MHOA 3SG7A 1R2UA 2JRFA 1V1FA 3CLNA 1F55A 1G33A 2K7DA 1Y6WA 3AKBA 2LMTA 1CMGA 2JTZA 1CDPA 5DKRA 1TN4A 4N5XA 1BU3A 1CTRA 2O5GA 4XJKB 3MSEB 1PVAA 1S1EA 4GPLB 4PHJA 2MBXA 2JC2A 5CSJA 1KSOA 3GK2A 4WQ2A 1BF5A 1NIWA 1NSHA 3TUYB 3JVTB 2CCMA 1J55A 2PVBA 3BUMB 1SR6C 2I18A 3GK1A 5FYXA 3DVJA 4C0KA 1QXPA 1ZFSA 2MJWB 1M39A 3WNXB 2LV7A 4BY4A 5GQQC 3DD4A 4OCIA 1DF0B 3SJSA 2MLEC 4PHMA 5KSZA 1AK8A 1R6PA 2JWWA 2QPTA 2KBIA 1HQVA 2I94A 3VROA 3BXKA 1IQ5A 1TTXA 4GNKB 3WXAA 2GGMA 1TNPA 2JPTA 2L4HA 5HYDA 4GUKA 2LM5A 3PN7C 1J7QA 4ORAB 1SL7A 4MLWA 1OE9B 2SASA 1CM4A 3I5FC 4CLNA 3NSOA 1TCFA 5G08A 3PALA 1NP8A 2AMIA 2NLNA 1BT6A 3DVMA 2PASA 2WCFA 1H8BA 1LXFC 2KI6C 2HQWA 2KHNA 4OV2A 1MWNA 1SR6B 1TOPA 2EGDA 1NX3A 2L5XB 3O6BA 4A4BA 3NSKA 1F8HA 2K0JA 1UWOA 2HF5A 1XK4C 3KO0A 1F4OA 2OTGC 3KF9A 1J1DA 1RJVA 4GBAA 3LK0A 1DJWA 3WHTB 1A75B 1IJ6A 2ZFDA 3LK1A 4YGBB 2K2FA 1IG5A 2Y1NA 3AAKA 3WHUB 2F33A 1JUOA 5AANA 1KQVA 3BUWB 1S26D 2F2OA 3CGAA 4M2PA 1S5GZ 1QS7A 1XK4A 1CMFA 3VRPA 3D0YA 4XYNA 1KK8B 1YVLA 1IKUA 2ZRSA 1RTP1 2F8PA 1WDCC 3EKJA 3I5FB 1LA3A 1OZOA 3D10A 1UHKA 1KK7Y 1NPQA 3SG3A 4DCKA 2LLSA 3I5GC 3IF7A 1N0YA 2KNEA 1BR4B 2LANA 1QV1A 4NDCA 1B8CA 2LP2A 1AVSA 2HQ8A 2PALA 3NSIA 4M2OA 4HREE 1C7WA 2D8NA 2TN4A 5D69A 1JWDA 4NDBA 3TS5C 2PMYA 1LA0A 1N65A 1KWOC 3FWBA 2BCXA 1DJHA 1IRJA 3BOWB 1FF1A 3NXAA 5ER5A 3TDZA 4N1FA 1UHHA 2JQ6A 2LVKA 4YI9A 1W7JB 1UHJA 2BKIB 2RGIA 4USLA 1WLMA 1FPWA 2M8UA 2L0PA 1F54A 4PE0A 2LC5A 1QVIY 4YBHB 4DIRA 1SPYA 2CXJA 1BJFA 3GOFA 1C07A 4E68A 3CR4X 1N2DA 1JF0A 4HSZA 1EG4A 4MZJA 2VRGA 2MAZA 4GFTA 2KAVA 1XFUO 1DVIA 2WCBA 1XYDA 3OB2B 4UPGA 3M0WA 4WQ3A 1FI6A 5TNCA 1EJ3A 1QLKA 2LVJA 5CSIA 2Q4UA 2WOSA 3OX6A 5F6TA 4HRHA 1B1GA 4JPZB 1XO5A 1SW8A 2ZN8A 2LE9B 1WY9A 1KQMC 1B8LA 5PALA 2KFHA 3DVKA 4L9MA 4F0ZB 2V53A 1S6CA 1XFYO 1JBAA 4OKHA 2KQYA 3DF0B 4MZLA 2WNDA 1MUXA 4CFRA 1NUBA 3SIBA 3E3RA 2F2PA 4MRYA 4WRIA 1U5IB 2NCPA 1KCYA 2BE4A 1B7TY 2ZRTA 1ZACA 1K8UA 3EVRA 2AUCA 1YVHA 2COLB 3CS1A 1J7RA 1L7ZA 1M63B 4BY5A 1M31A 1GGZA 4C0JA 5I2QA 1A29A 1NX2A 3PLFB 5JJGA 1IQ3A 2M9GA 4PDZA 1KK7Z 4AOMA 1XFXO 2Y4QA 2LHIA 1SRAA 3JTDC 1RWYA 4D1EA 1NCYA 1DJXA 1SCMC 2JULA 4JQ0D 3GK4X 2ZN9A 1K2HA 5CPVA 1JFKA 2L2EA 4I5LB 1PALA 1J7PA 1DMOA 1WRLA 4GAOA 1YX7A 1YRUB 2FCEA 1ALVA 1KQMB 1YUUA 2M7NA 5KU1A 2JOJA 1UURA
chains in the Genus database with same CATH superfamily
1YR5A 3A8RA 4IJ7A 2PSRA 1K93D 3OP0A 5IBWA 1FI5A 1PSRA 1L2OC 2K7BA 1K95A 3SG6A 2HETA 4INXA 4PHKA 4ORCB 2JNFA 3D75A 3O4YA 1BLQA 1YRTB 1QVIZ 1OMVA 4CPVA 1F4QA 2G2BA 2ZNEA 4MVFA 3VB1A 4M2QA 4MRXA 1XVJA 1RFJA 2JXLA 3I5IC 3F45A 2FOTA 1XA5A 2Y5IA 4DUQA 1SSEB 3PATA 1CFFA 1TRFA 1OZSA 3I5HC 2R2IA 4JKTA 4AQJA 2KQ6A 2KYFA 2PRUA 2WC8A 1CLLA 2LNKA 3TDIA 2CNPA 2H61C 3O2PA 4MSPA 3RLZA 3PN7B 4I5NB 3LLEA 1G8IA 2L51A 3OB1B 1OOIX 1QV0A 1KFUL 5CSFA 2WCJA 1HT9A 1DTLA 2K8MB 3EKHA 5HLVA 1MXLC 4YGCB 1D1OA 1SK6D 1TWOA 4MEWA 2KAYA 1YX8A 1PSBA 2LMVA 3NGVA 3R72A 3CTNA 3KHEA 3FS7A 2BCBA 4ZCVA 4C0LA 1NX0A 2H61A 2K61A 2EC6C 2B1UA 3EG5B 1UHIA 5AERA 2OS8C 2M3WA 1C3YA 2JNXA 4QJ4B 3B6XA 3FE6A 3R1VA 2Y1MA 2KOTA 2L2CA 2JPOA 2OPOA 1UHNA 3SG2A 5AEQA 3CR2A 1E8AA 1WRKA 2OTGB 3LCPC 2BCAA 3D0YB 1CLBA 2JU0A 2KFFA 1YTZC 4YGEB 3FWCA 4JWQA 2LUCA 3EK7A 2K7CA 2KI4C 1CDMA 3L47A 3SG4A 1LINA 1K9PA 2KSPA 3N7HA 1JF2A 1G4YR 1P28A 1DJIA 3B87A 1SKTA 3C1VA 3I5HB 1DGUA 2LVVA 3B7AA 3IQQA 2BBNA 4GGFA 4ICBA 3TDUA 1JC2A 1IIOA 1DGVA 1SNLA 4P2YB 3CABA 5ER4X 3VGOA 1SL8A 1TNXA 2QEBA 1M46A 1Y1UA 1TUZA 3CZ0A 3TUYC 1QX5B 4YRUA 2LLUA 2SCPA 2F3YA 1MR8A 1Y1XA 2LP3A 4JD9A 1WDCB 3CDNA 1BMOA 4U8DA 2LLTA 3KPXA 3Q8IA 3VRQA 5HLOA 1ODBA 2K7OA 1IJ5A 2L50A 3I5GB 1CM1A 3D77A 4HRGA 3BFBA 1MXEA 1ZOTB 4OR9B 1KSMA 2ERBA 4XJKA 1A03A 2EC6B 1VRKA 1S3PA 2ZKMX 2L4IA 3ICBA 1CFPA 1BR1B 1UP5A 1J7OA 2JT0A 2NXQA 4FQOA 1EG3A 2K2AA 3PSRA 1YUTA 4FTGA 3TS5B 1BOCA 1B8RA 4Q04A 2BBMA 1K90D 1KWOB 4QJ5B 4PE1A 1V1GA 3VRRA 3HCMA 1DF0A 1GM0A 1DEKA 1TCOB 2KFGA 2M49B 3AAJA 2KBMA 1FW4A 2KI4B 1A2XA 1DJZA 1S5GY 2AAOA 3BYAA 1OSAA 4A4CA 2LHLA 3FE8A 5HKWA 3ZWHA 4OZDA 2F3ZA 3EVVA 1TNQA 1W9ZA 2KDHA 5I2OA 3AKAA 1MQ1A 5DKQA 1EH2A 1K9KA 4NDDA 1AJ4A 1B4CA 3A4UB 3LL8B 1EXRA 1RROA 1DT7B 2LAPA 1PVBA 1EL4A 1IGVA 4PE7A 1AHRA 5I2LA 2M1KB 1TNWA 4PT1A 1SMGA 3DXLA 1XFRA 3DVEA 1QX2A 3FIAA 5I94A 2FCDA 1SY9A 2Q91A 4PHNA 1Y0VH 3V2LA 2KYCA 1Q80A 2KI6D 3S0EA 1DELA 4NQGA 2K60A 1CLMA 5J3XA 1CKKA 1KFUS 1YURA 3KEVA 2LCPA 2EHBA 1JSAA 3S0BA 2M0RA 4DS7A 3UNWA 2I7AA 2IS9A 3CZ2A 1OQPA 1KFXS 1PRWA 2CBLA 2M97A 2NZ0A 1WLZA 2QACA 3EVUA 1ZUZA 3NHIA 1AJ5A 1LKJA 2BL0C 1AP4A 2M1UA 3O4XA 2A4JA 1PULA 3NHTA 4ORBB 2GGZA 3BUOB 1QLSA 1QTXA 2JTTA 1KK8C 1H4BA 1XFWO 1S36A 4GGNA 2WCEA 3HX4A 1A75A 1SYMA 4YI8A 2BAPA 2GV5A 3OHMB 1NCXA 1T14A 2LMUA 3ZNIA 2FJUB 4PE4A 1SCVA 4ETOA 1QASA 1LVCD 2JZIA 3L4LA 1CB1A 4R1EA 2ZNDA 3DYEA 3O78A 2LUXA 2M7LA 2BE6A 1BG1A 2KGBC 3JTDB 3CR5X 5EL2A 2MLFC 1SCMB 1RK9A 1TUJA 1S6IA 2H2KA 2BNXA 1CDNA 2BKHB 3CZTX 1ORGA 3IQOA 3NSLA 4MN0A 1OMDA 3CWGA 3PFVA 4MBEA 1OW4A 2KGRA 1KFXL 2WC6A 1B9AA 5HKYA 5I8NA 3BQ3A 1F70A 2E6WA 2KLDA 1CDLA 5AFPA 3EK4A 1L2OB 1B7TZ 2E30A 2BL0B 3IVTA 4OVNF 1JFJA 1SBJA 4GGFC 1NCZA 3D73A 3BOWA 1GGWA 2MA2A 1K94A 4TNCA 5K89A 2ISDA 2CT9A 1QWVA 2G9BA 3I5IB 1UUSA 5AXIA 3TZ1A 1NX1A 2LVIA 1DJYA 5DKNA 2HPSA 1MF8B 3BUXB 3BUNB 3K1EA 1OOJA 3OBVA 1AUIB 1QATA 1XFZO 1A4PA 1XFVO 2MHHA 1CFCA 5BPJA 1F71A 1IH0A 1QX7A 1FBVA 1RECA 1LS8A 1M45A 2CTNA 2JT8A 3D78A 4MZKA 1J1EA 4PALA 1K9UA 4DRWA 3K21A 1S6JA 1WRZA 3H4SE 4I5JA 5HKZA 3VRNA 1ZMZA 1IWQA 1PK0D 2BECA 2JXCA 3JVTC 2MRDA 4N1GA 3SIAA 1SL9A 3S0AA 2L98A 5CSNA 4I5KA 5D7FA 3RM1A 3OX5A 1QIVA 4AQIA 2P6BB 1CFDA 2M29A 3D74A 1OMRA 1ALWA 4QJ3B 2DOQA 2WCKA 3SG5A 1X02A 1QIWA 5B8IB 1TIZA 3R1PA 4CIDA 2JT3A 1QJTA 2NCOA 1NYAA 1K96A 2OS8B 3QRXA 1W7IB 1GQMA 4PCWA 3DF0A 1GJYA 2KAXA 3EK8A 4ZCUA 4CFQA 1YUSA 3PM8A 4YGDB 2KLEA 2O60A 4IL1A 4YGAA 2I2RE 5KTYA 1BODA 4P5OE 1C7VA 1CNPA 1Y1AA 1B47A 2WORA 5JOLA 1U5IA 1DJGA 1NWDA 1MHOA 3SG7A 1R2UA 2JRFA 1V1FA 3CLNA 1F55A 3BJHA 1G33A 3B86A 2K7DA 1Y6WA 3AKBA 2LMTA 1CMGA 2JTZA 1CDPA 5DKRA 1TN4A 2L5YA 4N5XA 2PYQA 1BU3A 1CTRA 2O5GA 4XJKB 3MSEB 5D3OA 1PVAA 1S1EA 4GPLB 4PHJA 2MBXA 2JC2A 5CSJA 1KSOA 3GK2A 4WQ2A 5HL1A 1BF5A 1NIWA 1NSHA 2KPHA 1C3ZA 3TUYB 3JVTB 2CCMA 1J55A 2PVBA 3BUMB 1SR6C 2I18A 3GK1A 5FYXA 3DVJA 3CYZA 4C0KA 1QXPA 1ZFSA 2MJWB 1M39A 3WNXB 2LV7A 4BY4A 5GQQC 3DD4A 4OCIA 1DF0B 3SJSA 2MLEC 4PHMA 5KSZA 1AK8A 1R6PA 2JWWA 2WCLA 2QPTA 2KBIA 1HQVA 2I94A 2QEHA 3VROA 2H8VA 3BXKA 1IQ5A 1TTXA 4GNKB 3WXAA 2GGMA 1TNPA 2JPTA 2L4HA 5HYDA 4GUKA 1Z4HA 2LM5A 3PN7C 2P70A 1J7QA 4ORAB 1SL7A 4MLWA 1OE9B 2SASA 1CM4A 3I5FC 4CLNA 3NSOA 1TCFA 5G08A 3PALA 2GTEA 1NP8A 3FE9A 2AMIA 2NLNA 1BT6A 3DVMA 2PASA 3PM2A 2WCFA 1H8BA 1LXFC 2KI6C 2HQWA 2KHNA 4OV2A 3S0FA 1MWNA 1SR6B 1TOPA 2EGDA 1NX3A 2L5XB 3BFAA 3O6BA 4A4BA 3NSKA 1F8HA 2K0JA 1UWOA 2HF5A 1XK4C 3KO0A 1F4OA 2OTGC 3KF9A 1J1DA 1RJVA 4GBAA 3LK0A 1DJWA 3WHTB 4KYNA 1A75B 1IJ6A 2ZFDA 3LK1A 4YGBB 2K2FA 1IG5A 2Y1NA 3AAKA 3WHUB 2QDIA 2F33A 1JUOA 5AANA 1KQVA 3BUWB 1S26D 2F2OA 3CGAA 4M2PA 1S5GZ 1Z2CB 1QS7A 1XK4A 1CMFA 3VRPA 3D0YA 4XYNA 1KK8B 1YVLA 1IKUA 2ZRSA 1RTP1 2F8PA 1WDCC 3EKJA 3I5FB 1LA3A 1OZOA 3D10A 1UHKA 1KK7Y 1NPQA 3SG3A 4DCKA 2LLSA 3I5GC 3IF7A 4FQTA 1N0YA 3SS5A 2KNEA 2P71A 1BR4B 2LANA 1QV1A 4NDCA 3OGNA 1B8CA 2LP2A 1AVSA 2HQ8A 2PALA 3NSIA 4M2OA 4HREE 1C7WA 2D8NA 2TN4A 2WCHA 3B88A 5D69A 4NDBA 3TS5C 2PMYA 1LA0A 1OOFA 2WCMA 1N65A 2WC5A 1KWOC 3FWBA 5FI6A 2BCXA 1DJHA 2FJYA 1IRJA 3BOWB 1FF1A 3NXAA 5ER5A 3TDZA 4N1FA 1UHHA 2JQ6A 2LVKA 4YI9A 1W7JB 1UHJA 2BKIB 2RGIA 4USLA 1WLMA 1FPWA 2M8UA 2L0PA 1F54A 4PE0A 2LC5A 1QVIY 3BFHA 4YBHB 4DIRA 1SPYA 2CXJA 1BJFA 2PQLA 3L4AA 3GOFA 1C07A 4E68A 3RZSA 3CR4X 1N2DA 1JF0A 4HSZA 1EG4A 3DZTA 4MZJA 2VRGA 2MAZA 4GFTA 2KAVA 3CZ1A 1XFUO 1DVIA 2WCBA 1XYDA 3OB2B 3S0GA 3M0WA 4WQ3A 4UPGA 1FI6A 5TNCA 1EJ3A 1QLKA 2LVJA 2QEVA 5CSIA 2Q4UA 2WOSA 5DICA 3OX6A 5F6TA 4HRHA 1B1GA 4JPZB 3SS3A 1XO5A 1SW8A 2ZN8A 1OOGA 2LE9B 1WY9A 1KQMC 1B8LA 5PALA 2KFHA 3R1OA 3DVKA 4L9MA 4F0ZB 2V53A 2YGUA 1S6CA 1XFYO 1JBAA 4OKHA 2KQYA 3SS4A 3DF0B 4MZLA 2WNDA 3UO9A 1MUXA 3D76A 1NUBA 3SIBA 3E3RA 4CFRA 2F2PA 4MRYA 4WRIA 1U5IB 2NCPA 3S0DA 1KCYA 2BE4A 1B7TY 2ZRTA 1ZACA 1K8UA 3EVRA 2AUCA 1YVHA 2QEOA 2COLB 1DC1A 3CS1A 1OOHA 1J7RA 1L7ZA 1M63B 4BY5A 1M31A 4INWA 1GGZA 4C0JA 5I2QA 1A29A 1NX2A 3PLFB 5JJGA 1IQ3A 1JWDA 2M9GA 4PDZA 1DQEA 3PJIA 1KK7Z 4AOMA 1XFXO 2Y4QA 2LHIA 1SRAA 3JTDC 1RWYA 4D1EA 1NCYA 1DJXA 1SCMC 2JULA 3QMEA 4JQ0D 3GK4X 2ZN9A 1K2HA 5CPVA 1JFKA 2L2EA 5FI2A 4I5LB 1PALA 1J7PA 1DMOA 1WRLA 4F7FA 4GAOA 1YX7A 1YRUB 2FCEA 5FI7A 3DY9A 1ALVA 1KQMB 1YUUA 2M7NA 5KU1A 2JOJA 1UURA
chains in the Genus database with same CATH topology
1YR5A 3A8RA 2PSRA 1K93D 3OP0A 5IBWA 1FI5A 1PSRA 1L2OC 2K7BA 1K95A 3SG6A 2HETA 4PHKA 4ORCB 2JNFA 3O4YA 1BLQA 1YRTB 1QVIZ 1OMVA 4CPVA 1F4QA 2G2BA 2ZNEA 4MVFA 4M2QA 4MRXA 1XVJA 1RFJA 2JXLA 3I5IC 3F45A 2FOTA 1XA5A 2Y5IA 4DUQA 3PATA 1CFFA 1TRFA 1OZSA 3I5HC 2R2IA 4AQJA 2KQ6A 2KYFA 2PRUA 2WC8A 1CLLA 2LNKA 3TDIA 2CNPA 2H61C 3O2PA 4MSPA 3RLZA 3PN7B 4I5NB 3LLEA 1G8IA 2L51A 3OB1B 1QV0A 1KFUL 5CSFA 1HT9A 1DTLA 2K8MB 3EKHA 5HLVA 1MXLC 4YGCB 1D1OA 1SK6D 4MEWA 2KAYA 1YX8A 1PSBA 2LMVA 3CTNA 3KHEA 3FS7A 2BCBA 4ZCVA 4C0LA 1NX0A 2H61A 2K61A 2EC6C 2B1UA 1UHIA 5AERA 2OS8C 2M3WA 2JNXA 4QJ4B 2Y1MA 2KOTA 2OPOA 1UHNA 3SG2A 5AEQA 3CR2A 1E8AA 1WRKA 2OTGB 3LCPC 2BCAA 3D0YB 1CLBA 2JU0A 2KFFA 1YTZC 4YGEB 3FWCA 4JWQA 2LUCA 3EK7A 2K7CA 2KI4C 1CDMA 3SG4A 1LINA 1K9PA 2KSPA 1JF2A 1G4YR 3I5HB 1DJIA 1SKTA 3C1VA 1DGUA 2LVVA 3IQQA 2BBNA 4GGFA 4ICBA 3TDUA 1JC2A 1DGVA 1SNLA 4P2YB 5ER4X 3VGOA 1SL8A 1TNXA 1M46A 1Y1UA 3TUYC 1QX5B 4YRUA 2LLUA 2SCPA 2F3YA 1MR8A 1Y1XA 2LP3A 1WDCB 1BMOA 4U8DA 2LLTA 3KPXA 3VRQA 5HLOA 1ODBA 2K7OA 1IJ5A 2L50A 3I5GB 1CM1A 4HRGA 1MXEA 1ZOTB 4OR9B 1KSMA 1A03A 4XJKA 2EC6B 1VRKA 1S3PA 2ZKMX 2L4IA 3ICBA 1CFPA 1BR1B 1UP5A 1J7OA 2JT0A 2NXQA 4FQOA 1EG3A 2K2AA 3PSRA 1YUTA 4FTGA 3TS5B 1BOCA 1B8RA 4Q04A 2BBMA 1K90D 1KWOB 4QJ5B 4PE1A 1V1GA 3VRRA 3HCMA 1DF0A 1TCOB 2KFGA 2M49B 3AAJA 2KBMA 1FW4A 2KI4B 1A2XA 1DJZA 1S5GY 2AAOA 3BYAA 1OSAA 4A4CA 2LHLA 5HKWA 3ZWHA 2F3ZA 3EVVA 1TNQA 2KDHA 5I2OA 3AKAA 1MQ1A 5DKQA 1EH2A 1K9KA 4NDDA 1AJ4A 1B4CA 3A4UB 3LL8B 1EXRA 1RROA 1DT7B 2LAPA 1PVBA 1EL4A 1IGVA 4PE7A 1AHRA 5I2LA 2M1KB 1TNWA 1SMGA 3FIAA 3DVEA 1QX2A 2FCDA 1SY9A 2Q91A 4PHNA 1Y0VH 2KYCA 1Q80A 2KI6D 4NQGA 1CLMA 5J3XA 1CKKA 1KFUS 1YURA 3KEVA 2LCPA 2EHBA 1JSAA 2M0RA 4DS7A 2I7AA 2IS9A 1OQPA 1KFXS 1PRWA 2CBLA 2M97A 2NZ0A 1WLZA 2QACA 3EVUA 1ZUZA 4ZCUA 1AJ5A 1LKJA 2BL0C 1AP4A 2M1UA 2A4JA 1PULA 4ORBB 2GGZA 3BUOB 1QLSA 1QTXA 2JTTA 1KK8C 1H4BA 1XFWO 1S36A 4GGNA 2WCEA 3HX4A 1A75A 1SYMA 4YI8A 3OHMB 2GV5A 1NCXA 2LMUA 3ZNIA 2FJUB 4PE4A 1SCVA 4ETOA 1QASA 1LVCD 2JZIA 1CB1A 4R1EA 2ZNDA 3O78A 2LUXA 2M7LA 2BE6A 1BG1A 2KGBC 3JTDB 3CR5X 2MLFC 1SCMB 1RK9A 1S6IA 2H2KA 1CDNA 2BKHB 3CZTX 3IQOA 3NSLA 4MN0A 1OMDA 3CWGA 3PFVA 4MBEA 2KGRA 1KFXL 1B9AA 5HKYA 5I8NA 3BQ3A 1F70A 2E6WA 1CDLA 5AFPA 3EK4A 1L2OB 1B7TZ 2E30A 2BL0B 4OVNF 1JFJA 1SBJA 4GGFC 1NCZA 1GGWA 3BOWA 2MA2A 1K94A 4TNCA 5K89A 2ISDA 2CT9A 3I5IB 2G9BA 5AXIA 1UUSA 3TZ1A 1NX1A 2LVIA 1DJYA 5DKNA 2HPSA 1MF8B 3BUXB 3BUNB 1OOJA 1AUIB 1QATA 1XFZO 1A4PA 1XFVO 2MHHA 1CFCA 5BPJA 1F71A 1IH0A 1QX7A 1FBVA 1RECA 1M45A 2CTNA 2JT8A 4MZKA 1J1EA 4PALA 1K9UA 4DRWA 3K21A 1S6JA 1WRZA 3H4SE 4I5JA 5HKZA 3VRNA 1ZMZA 1IWQA 1PK0D 2BECA 2JXCA 3JVTC 2MRDA 4N1GA 3SIAA 1SL9A 2L98A 5CSNA 4I5KA 5D7FA 3RM1A 3OX5A 1QIVA 4AQIA 2P6BB 1CFDA 2M29A 1OMRA 1ALWA 4QJ3B 2DOQA 3SG5A 1X02A 1QIWA 5B8IB 1TIZA 4CIDA 2JT3A 1QJTA 2NCOA 1NYAA 1K96A 2OS8B 3QRXA 1W7IB 1GQMA 4PCWA 3DF0A 1GJYA 2KAXA 3EK8A 4CFQA 1YUSA 3PM8A 4YGDB 4IL1A 2O60A 4YGAA 5KTYA 2I2RE 1BODA 1C7VA 4P5OE 1CNPA 1Y1AA 1B47A 2WORA 5JOLA 1U5IA 1DJGA 1NWDA 1MHOA 3SG7A 1R2UA 2JRFA 1V1FA 3CLNA 1F55A 1G33A 2K7DA 1Y6WA 3AKBA 2LMTA 1CMGA 2JTZA 1CDPA 5DKRA 1TN4A 4N5XA 1BU3A 1CTRA 2O5GA 4XJKB 3MSEB 1PVAA 1S1EA 4GPLB 4PHJA 2MBXA 2JC2A 5CSJA 1KSOA 3GK2A 4WQ2A 1BF5A 1NIWA 1NSHA 3TUYB 3JVTB 2CCMA 1J55A 2PVBA 3BUMB 1SR6C 2I18A 3GK1A 5FYXA 3DVJA 4C0KA 1QXPA 1ZFSA 2MJWB 1M39A 3WNXB 2LV7A 4BY4A 5GQQC 3DD4A 4OCIA 1DF0B 3SJSA 2MLEC 4PHMA 5KSZA 1AK8A 1R6PA 2JWWA 2QPTA 2KBIA 1HQVA 2I94A 3VROA 3BXKA 1IQ5A 1TTXA 4GNKB 3WXAA 2GGMA 1TNPA 2JPTA 2L4HA 5HYDA 4GUKA 2LM5A 3PN7C 1J7QA 4ORAB 1SL7A 4MLWA 1OE9B 2SASA 1CM4A 3I5FC 4CLNA 3NSOA 1TCFA 5G08A 3PALA 1NP8A 2AMIA 2NLNA 1BT6A 3DVMA 2PASA 2WCFA 1H8BA 1LXFC 2KI6C 2HQWA 2KHNA 4OV2A 1MWNA 1SR6B 1TOPA 2EGDA 1NX3A 2L5XB 3O6BA 4A4BA 3NSKA 1F8HA 2K0JA 1UWOA 2HF5A 1XK4C 3KO0A 1F4OA 2OTGC 3KF9A 1J1DA 1RJVA 4GBAA 3LK0A 1DJWA 3WHTB 1A75B 1IJ6A 2ZFDA 3LK1A 4YGBB 2K2FA 1IG5A 2Y1NA 3AAKA 3WHUB 2F33A 1JUOA 5AANA 1KQVA 3BUWB 1S26D 2F2OA 3CGAA 4M2PA 1S5GZ 1QS7A 1XK4A 1CMFA 3VRPA 3D0YA 4XYNA 1KK8B 1YVLA 1IKUA 2ZRSA 1RTP1 2F8PA 1WDCC 3EKJA 3I5FB 1LA3A 1OZOA 3D10A 1UHKA 1KK7Y 1NPQA 3SG3A 4DCKA 2LLSA 3I5GC 3IF7A 1N0YA 2KNEA 1BR4B 2LANA 1QV1A 4NDCA 1B8CA 2LP2A 1AVSA 2HQ8A 2PALA 3NSIA 4M2OA 4HREE 1C7WA 2D8NA 2TN4A 5D69A 1JWDA 4NDBA 3TS5C 2PMYA 1LA0A 1N65A 1KWOC 3FWBA 2BCXA 1DJHA 1IRJA 3BOWB 1FF1A 3NXAA 5ER5A 3TDZA 4N1FA 1UHHA 2JQ6A 2LVKA 4YI9A 1W7JB 1UHJA 2BKIB 2RGIA 4USLA 1WLMA 1FPWA 2M8UA 2L0PA 1F54A 4PE0A 2LC5A 1QVIY 4YBHB 4DIRA 1SPYA 2CXJA 1BJFA 3GOFA 1C07A 4E68A 3CR4X 1N2DA 1JF0A 4HSZA 1EG4A 4MZJA 2VRGA 2MAZA 4GFTA 2KAVA 1XFUO 1DVIA 2WCBA 1XYDA 3OB2B 4UPGA 3M0WA 4WQ3A 1FI6A 5TNCA 1EJ3A 1QLKA 2LVJA 5CSIA 2Q4UA 2WOSA 3OX6A 5F6TA 4HRHA 1B1GA 4JPZB 1XO5A 1SW8A 2ZN8A 2LE9B 1WY9A 1KQMC 1B8LA 5PALA 2KFHA 3DVKA 4L9MA 4F0ZB 2V53A 1S6CA 1XFYO 1JBAA 4OKHA 2KQYA 3DF0B 4MZLA 2WNDA 1MUXA 4CFRA 1NUBA 3SIBA 3E3RA 2F2PA 4MRYA 4WRIA 1U5IB 2NCPA 1KCYA 2BE4A 1B7TY 2ZRTA 1ZACA 1K8UA 3EVRA 2AUCA 1YVHA 2COLB 3CS1A 1J7RA 1L7ZA 1M63B 4BY5A 1M31A 1GGZA 4C0JA 5I2QA 1A29A 1NX2A 3PLFB 5JJGA 1IQ3A 2M9GA 4PDZA 1KK7Z 4AOMA 1XFXO 2Y4QA 2LHIA 1SRAA 3JTDC 1RWYA 4D1EA 1NCYA 1DJXA 1SCMC 2JULA 4JQ0D 3GK4X 2ZN9A 1K2HA 5CPVA 1JFKA 2L2EA 4I5LB 1PALA 1J7PA 1DMOA 1WRLA 4GAOA 1YX7A 1YRUB 2FCEA 1ALVA 1KQMB 1YUUA 2M7NA 5KU1A 2JOJA 1UURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YR5 A;  3A8R A;  2PSR A;  1K93 D;  3OP0 A;  5IBW A;  1FI5 A;  1PSR A;  1L2O C;  2K7B A;  1K95 A;  3SG6 A;  2HET A;  4PHK A;  4ORC B;  2JNF A;  3O4Y A;  1BLQ A;  1YRT B;  1QVI Z;  1OMV A;  4CPV A;  1F4Q A;  2G2B A;  2ZNE A;  4MVF A;  4M2Q A;  4MRX A;  1XVJ A;  1RFJ A;  2JXL A;  3I5I C;  3F45 A;  2FOT A;  1XA5 A;  2Y5I A;  4DUQ A;  3PAT A;  1CFF A;  1TRF A;  1OZS A;  3I5H C;  2R2I A;  4AQJ A;  2KQ6 A;  2KYF A;  2PRU A;  2WC8 A;  1CLL A;  2LNK A;  3TDI A;  2CNP A;  2H61 C;  3O2P A;  4MSP A;  3RLZ A;  3PN7 B;  4I5N B;  3LLE A;  1G8I A;  2L51 A;  3OB1 B;  1QV0 A;  1KFU L;  5CSF A;  1HT9 A;  1DTL A;  2K8M B;  3EKH A;  5HLV A;  1MXL C;  4YGC B;  1D1O A;  1SK6 D;  4MEW A;  2KAY A;  1YX8 A;  1PSB A;  2LMV A;  3CTN A;  3KHE A;  3FS7 A;  2BCB A;  4ZCV A;  4C0L A;  1NX0 A;  2H61 A;  2K61 A;  2EC6 C;  2B1U A;  1UHI A;  5AER A;  2OS8 C;  2M3W A;  2JNX A;  4QJ4 B;  2Y1M A;  2KOT A;  2OPO A;  1UHN A;  3SG2 A;  5AEQ A;  3CR2 A;  1E8A A;  1WRK A;  2OTG B;  3LCP C;  2BCA A;  3D0Y B;  1CLB A;  2JU0 A;  2KFF A;  1YTZ C;  4YGE B;  3FWC A;  4JWQ A;  2LUC A;  3EK7 A;  2K7C A;  2KI4 C;  1CDM A;  3SG4 A;  1LIN A;  1K9P A;  2KSP A;  1JF2 A;  1G4Y R;  3I5H B;  1DJI A;  1SKT A;  3C1V A;  1DGU A;  2LVV A;  3IQQ A;  2BBN A;  4GGF A;  4ICB A;  3TDU A;  1JC2 A;  1DGV A;  1SNL A;  4P2Y B;  5ER4 X;  3VGO A;  1SL8 A;  1TNX A;  1M46 A;  1Y1U A;  3TUY C;  1QX5 B;  4YRU A;  2LLU A;  2SCP A;  2F3Y A;  1MR8 A;  1Y1X A;  2LP3 A;  1WDC B;  1BMO A;  4U8D A;  2LLT A;  3KPX A;  3VRQ A;  5HLO A;  1ODB A;  2K7O A;  1IJ5 A;  2L50 A;  3I5G B;  1CM1 A;  4HRG A;  1MXE A;  1ZOT B;  4OR9 B;  1KSM A;  1A03 A;  4XJK A;  2EC6 B;  1VRK A;  1S3P A;  2ZKM X;  2L4I A;  3ICB A;  1CFP A;  1BR1 B;  1UP5 A;  1J7O A;  2JT0 A;  2NXQ A;  4FQO A;  1EG3 A;  2K2A A;  3PSR A;  1YUT A;  4FTG A;  3TS5 B;  1BOC A;  1B8R A;  4Q04 A;  2BBM A;  1K90 D;  1KWO B;  4QJ5 B;  4PE1 A;  1V1G A;  3VRR A;  3HCM A;  1DF0 A;  1TCO B;  2KFG A;  2M49 B;  3AAJ A;  2KBM A;  1FW4 A;  2KI4 B;  1A2X A;  1DJZ A;  1S5G Y;  2AAO A;  3BYA A;  1OSA A;  4A4C A;  2LHL A;  5HKW A;  3ZWH A;  2F3Z A;  3EVV A;  1TNQ A;  2KDH A;  5I2O A;  3AKA A;  1MQ1 A;  5DKQ A;  1EH2 A;  1K9K A;  4NDD A;  1AJ4 A;  1B4C A;  3A4U B;  3LL8 B;  1EXR A;  1RRO A;  1DT7 B;  2LAP A;  1PVB A;  1EL4 A;  1IGV A;  4PE7 A;  1AHR A;  5I2L A;  2M1K B;  1TNW A;  1SMG A;  3FIA A;  3DVE A;  1QX2 A;  2FCD A;  1SY9 A;  2Q91 A;  4PHN A;  1Y0V H;  2KYC A;  1Q80 A;  2KI6 D;  4NQG A;  1CLM A;  5J3X A;  1CKK A;  1KFU S;  1YUR A;  3KEV A;  2LCP A;  2EHB A;  1JSA A;  2M0R A;  4DS7 A;  2I7A A;  2IS9 A;  1OQP A;  1KFX S;  1PRW A;  2CBL A;  2M97 A;  2NZ0 A;  1WLZ A;  2QAC A;  3EVU A;  1ZUZ A;  4ZCU A;  1AJ5 A;  1LKJ A;  2BL0 C;  1AP4 A;  2M1U A;  2A4J A;  1PUL A;  4ORB B;  2GGZ A;  3BUO B;  1QLS A;  1QTX A;  2JTT A;  1KK8 C;  1H4B A;  1XFW O;  1S36 A;  4GGN A;  2WCE A;  3HX4 A;  1A75 A;  1SYM A;  4YI8 A;  3OHM B;  2GV5 A;  1NCX A;  2LMU A;  3ZNI A;  2FJU B;  4PE4 A;  1SCV A;  4ETO A;  1QAS A;  1LVC D;  2JZI A;  1CB1 A;  4R1E A;  2ZND A;  3O78 A;  2LUX A;  2M7L A;  2BE6 A;  1BG1 A;  2KGB C;  3JTD B;  3CR5 X;  2MLF C;  1SCM B;  1RK9 A;  1S6I A;  2H2K A;  1CDN A;  2BKH B;  3CZT X;  3IQO A;  3NSL A;  4MN0 A;  1OMD A;  3CWG A;  3PFV A;  4MBE A;  2KGR A;  1KFX L;  1B9A A;  5HKY A;  5I8N A;  3BQ3 A;  1F70 A;  2E6W A;  1CDL A;  5AFP A;  3EK4 A;  1L2O B;  1B7T Z;  2E30 A;  2BL0 B;  4OVN F;  1JFJ A;  1SBJ A;  4GGF C;  1NCZ A;  1GGW A;  3BOW A;  2MA2 A;  1K94 A;  4TNC A;  5K89 A;  2ISD A;  2CT9 A;  3I5I B;  2G9B A;  5AXI A;  1UUS A;  3TZ1 A;  1NX1 A;  2LVI A;  1DJY A;  5DKN A;  2HPS A;  1MF8 B;  3BUX B;  3BUN B;  1OOJ A;  1AUI B;  1QAT A;  1XFZ O;  1A4P A;  1XFV O;  2MHH A;  1CFC A;  5BPJ A;  1F71 A;  1IH0 A;  1QX7 A;  1FBV A;  1REC A;  1M45 A;  2CTN A;  2JT8 A;  4MZK A;  1J1E A;  4PAL A;  1K9U A;  4DRW A;  3K21 A;  1S6J A;  1WRZ A;  3H4S E;  4I5J A;  5HKZ A;  3VRN A;  1ZMZ A;  1IWQ A;  1PK0 D;  2BEC A;  2JXC A;  3JVT C;  2MRD A;  4N1G A;  3SIA A;  1SL9 A;  2L98 A;  5CSN A;  4I5K A;  5D7F A;  3RM1 A;  3OX5 A;  1QIV A;  4AQI A;  2P6B B;  1CFD A;  2M29 A;  1OMR A;  1ALW A;  4QJ3 B;  2DOQ A;  3SG5 A;  1X02 A;  1QIW A;  5B8I B;  1TIZ A;  4CID A;  2JT3 A;  1QJT A;  2NCO A;  1NYA A;  1K96 A;  2OS8 B;  3QRX A;  1W7I B;  1GQM A;  4PCW A;  3DF0 A;  1GJY A;  2KAX A;  3EK8 A;  4CFQ A;  1YUS A;  3PM8 A;  4YGD B;  4IL1 A;  2O60 A;  4YGA A;  5KTY A;  2I2R E;  1BOD A;  1C7V A;  4P5O E;  1CNP A;  1Y1A A;  1B47 A;  2WOR A;  5JOL A;  1U5I A;  1DJG A;  1NWD A;  1MHO A;  3SG7 A;  1R2U A;  2JRF A;  1V1F A;  3CLN A;  1F55 A;  1G33 A;  2K7D A;  1Y6W A;  3AKB A;  2LMT A;  1CMG A;  2JTZ A;  1CDP A;  5DKR A;  1TN4 A;  4N5X A;  1BU3 A;  1CTR A;  2O5G A;  4XJK B;  3MSE B;  1PVA A;  1S1E A;  4GPL B;  4PHJ A;  2MBX A;  2JC2 A;  5CSJ A;  1KSO A;  3GK2 A;  4WQ2 A;  1BF5 A;  1NIW A;  1NSH A;  3TUY B;  3JVT B;  2CCM A;  1J55 A;  2PVB A;  3BUM B;  1SR6 C;  2I18 A;  3GK1 A;  5FYX A;  3DVJ A;  4C0K A;  1QXP A;  1ZFS A;  2MJW B;  1M39 A;  3WNX B;  2LV7 A;  4BY4 A;  5GQQ C;  3DD4 A;  4OCI A;  1DF0 B;  3SJS A;  2MLE C;  4PHM A;  5KSZ A;  1AK8 A;  1R6P A;  2JWW A;  2QPT A;  2KBI A;  1HQV A;  2I94 A;  3VRO A;  3BXK A;  1IQ5 A;  1TTX A;  4GNK B;  3WXA A;  2GGM A;  1TNP A;  2JPT A;  2L4H A;  5HYD A;  4GUK A;  2LM5 A;  3PN7 C;  1J7Q A;  4ORA B;  1SL7 A;  4MLW A;  1OE9 B;  2SAS A;  1CM4 A;  3I5F C;  4CLN A;  3NSO A;  1TCF A;  5G08 A;  3PAL A;  1NP8 A;  2AMI A;  2NLN A;  1BT6 A;  3DVM A;  2PAS A;  2WCF A;  1H8B A;  1LXF C;  2KI6 C;  2HQW A;  2KHN A;  4OV2 A;  1MWN A;  1SR6 B;  1TOP A;  2EGD A;  1NX3 A;  2L5X B;  3O6B A;  4A4B A;  3NSK A;  1F8H A;  2K0J A;  1UWO A;  2HF5 A;  1XK4 C;  3KO0 A;  1F4O A;  2OTG C;  3KF9 A;  1J1D A;  1RJV A;  4GBA A;  3LK0 A;  1DJW A;  3WHT B;  1A75 B;  1IJ6 A;  2ZFD A;  3LK1 A;  4YGB B;  2K2F A;  1IG5 A;  2Y1N A;  3AAK A;  3WHU B;  2F33 A;  1JUO A;  5AAN A;  1KQV A;  3BUW B;  1S26 D;  2F2O A;  3CGA A;  4M2P A;  1S5G Z;  1QS7 A;  1XK4 A;  1CMF A;  3VRP A;  3D0Y A;  4XYN A;  1KK8 B;  1YVL A;  1IKU A;  2ZRS A;  1RTP 1;  2F8P A;  1WDC C;  3EKJ A;  3I5F B;  1LA3 A;  1OZO A;  3D10 A;  1UHK A;  1KK7 Y;  1NPQ A;  3SG3 A;  4DCK A;  2LLS A;  3I5G C;  3IF7 A;  1N0Y A;  2KNE A;  1BR4 B;  2LAN A;  1QV1 A;  4NDC A;  1B8C A;  2LP2 A;  1AVS A;  2HQ8 A;  2PAL A;  3NSI A;  4M2O A;  4HRE E;  1C7W A;  2D8N A;  2TN4 A;  5D69 A;  1JWD A;  4NDB A;  3TS5 C;  2PMY A;  1LA0 A;  1N65 A;  1KWO C;  3FWB A;  2BCX A;  1DJH A;  1IRJ A;  3BOW B;  1FF1 A;  3NXA A;  5ER5 A;  3TDZ A;  4N1F A;  1UHH A;  2JQ6 A;  2LVK A;  4YI9 A;  1W7J B;  1UHJ A;  2BKI B;  2RGI A;  4USL A;  1WLM A;  1FPW A;  2M8U A;  2L0P A;  1F54 A;  4PE0 A;  2LC5 A;  1QVI Y;  4YBH B;  4DIR A;  1SPY A;  2CXJ A;  1BJF A;  3GOF A;  1C07 A;  4E68 A;  3CR4 X;  1N2D A;  1JF0 A;  4HSZ A;  1EG4 A;  4MZJ A;  2VRG A;  2MAZ A;  4GFT A;  2KAV A;  1XFU O;  1DVI A;  2WCB A;  1XYD A;  3OB2 B;  4UPG A;  3M0W A;  4WQ3 A;  1FI6 A;  5TNC A;  1EJ3 A;  1QLK A;  2LVJ A;  5CSI A;  2Q4U A;  2WOS A;  3OX6 A;  5F6T A;  4HRH A;  1B1G A;  4JPZ B;  1XO5 A;  1SW8 A;  2ZN8 A;  2LE9 B;  1WY9 A;  1KQM C;  1B8L A;  5PAL A;  2KFH A;  3DVK A;  4L9M A;  4F0Z B;  2V53 A;  1S6C A;  1XFY O;  1JBA A;  4OKH A;  2KQY A;  3DF0 B;  4MZL A;  2WND A;  1MUX A;  4CFR A;  1NUB A;  3SIB A;  3E3R A;  2F2P A;  4MRY A;  4WRI A;  1U5I B;  2NCP A;  1KCY A;  2BE4 A;  1B7T Y;  2ZRT A;  1ZAC A;  1K8U A;  3EVR A;  2AUC A;  1YVH A;  2COL B;  3CS1 A;  1J7R A;  1L7Z A;  1M63 B;  4BY5 A;  1M31 A;  1GGZ A;  4C0J A;  5I2Q A;  1A29 A;  1NX2 A;  3PLF B;  5JJG A;  1IQ3 A;  2M9G A;  4PDZ A;  1KK7 Z;  4AOM A;  1XFX O;  2Y4Q A;  2LHI A;  1SRA A;  3JTD C;  1RWY A;  4D1E A;  1NCY A;  1DJX A;  1SCM C;  2JUL A;  4JQ0 D;  3GK4 X;  2ZN9 A;  1K2H A;  5CPV A;  1JFK A;  2L2E A;  4I5L B;  1PAL A;  1J7P A;  1DMO A;  1WRL A;  4GAO A;  1YX7 A;  1YRU B;  2FCE A;  1ALV A;  1KQM B;  1YUU A;  2M7N A;  5KU1 A;  2JOJ A;  1UUR A; 
#chains in the Genus database with same CATH topology
 1YR5 A;  3A8R A;  4IJ7 A;  2PSR A;  1K93 D;  3OP0 A;  5IBW A;  1FI5 A;  1PSR A;  1L2O C;  2K7B A;  1K95 A;  3SG6 A;  2HET A;  4INX A;  4PHK A;  4ORC B;  2JNF A;  3D75 A;  3O4Y A;  1BLQ A;  1YRT B;  1QVI Z;  1OMV A;  4CPV A;  1F4Q A;  2G2B A;  2ZNE A;  4MVF A;  3VB1 A;  4M2Q A;  4MRX A;  1XVJ A;  1RFJ A;  2JXL A;  3I5I C;  3F45 A;  2FOT A;  1XA5 A;  2Y5I A;  4DUQ A;  1SSE B;  3PAT A;  1CFF A;  1TRF A;  1OZS A;  3I5H C;  2R2I A;  4JKT A;  4AQJ A;  2KQ6 A;  2KYF A;  2PRU A;  2WC8 A;  1CLL A;  2LNK A;  3TDI A;  2CNP A;  2H61 C;  3O2P A;  4MSP A;  3RLZ A;  3PN7 B;  4I5N B;  3LLE A;  1G8I A;  2L51 A;  3OB1 B;  1OOI X;  1QV0 A;  1KFU L;  5CSF A;  2WCJ A;  1HT9 A;  1DTL A;  2K8M B;  3EKH A;  5HLV A;  1MXL C;  4YGC B;  1D1O A;  1SK6 D;  1TWO A;  4MEW A;  2KAY A;  1YX8 A;  1PSB A;  2LMV A;  3NGV A;  3R72 A;  3CTN A;  3KHE A;  3FS7 A;  2BCB A;  4ZCV A;  4C0L A;  1NX0 A;  2H61 A;  2K61 A;  2EC6 C;  2B1U A;  3EG5 B;  1UHI A;  5AER A;  2OS8 C;  2M3W A;  1C3Y A;  2JNX A;  4QJ4 B;  3B6X A;  3FE6 A;  3R1V A;  2Y1M A;  2KOT A;  2L2C A;  2JPO A;  2OPO A;  1UHN A;  3SG2 A;  5AEQ A;  3CR2 A;  1E8A A;  1WRK A;  2OTG B;  3LCP C;  2BCA A;  3D0Y B;  1CLB A;  2JU0 A;  2KFF A;  1YTZ C;  4YGE B;  3FWC A;  4JWQ A;  2LUC A;  3EK7 A;  2K7C A;  2KI4 C;  1CDM A;  3L47 A;  3SG4 A;  1LIN A;  1K9P A;  2KSP A;  3N7H A;  1JF2 A;  1G4Y R;  1P28 A;  1DJI A;  3B87 A;  1SKT A;  3C1V A;  3I5H B;  1DGU A;  2LVV A;  3B7A A;  3IQQ A;  2BBN A;  4GGF A;  4ICB A;  3TDU A;  1JC2 A;  1IIO A;  1DGV A;  1SNL A;  4P2Y B;  3CAB A;  5ER4 X;  3VGO A;  1SL8 A;  1TNX A;  2QEB A;  1M46 A;  1Y1U A;  1TUZ A;  3CZ0 A;  3TUY C;  1QX5 B;  4YRU A;  2LLU A;  2SCP A;  2F3Y A;  1MR8 A;  1Y1X A;  2LP3 A;  4JD9 A;  1WDC B;  3CDN A;  1BMO A;  4U8D A;  2LLT A;  3KPX A;  3Q8I A;  3VRQ A;  5HLO A;  1ODB A;  2K7O A;  1IJ5 A;  2L50 A;  3I5G B;  1CM1 A;  3D77 A;  4HRG A;  3BFB A;  1MXE A;  1ZOT B;  4OR9 B;  1KSM A;  2ERB A;  4XJK A;  1A03 A;  2EC6 B;  1VRK A;  1S3P A;  2ZKM X;  2L4I A;  3ICB A;  1CFP A;  1BR1 B;  1UP5 A;  1J7O A;  2JT0 A;  2NXQ A;  4FQO A;  1EG3 A;  2K2A A;  3PSR A;  1YUT A;  4FTG A;  3TS5 B;  1BOC A;  1B8R A;  4Q04 A;  2BBM A;  1K90 D;  1KWO B;  4QJ5 B;  4PE1 A;  1V1G A;  3VRR A;  3HCM A;  1DF0 A;  1GM0 A;  1DEK A;  1TCO B;  2KFG A;  2M49 B;  3AAJ A;  2KBM A;  1FW4 A;  2KI4 B;  1A2X A;  1DJZ A;  1S5G Y;  2AAO A;  3BYA A;  1OSA A;  4A4C A;  2LHL A;  3FE8 A;  5HKW A;  3ZWH A;  4OZD A;  2F3Z A;  3EVV A;  1TNQ A;  1W9Z A;  2KDH A;  5I2O A;  3AKA A;  1MQ1 A;  5DKQ A;  1EH2 A;  1K9K A;  4NDD A;  1AJ4 A;  1B4C A;  3A4U B;  3LL8 B;  1EXR A;  1RRO A;  1DT7 B;  2LAP A;  1PVB A;  1EL4 A;  1IGV A;  4PE7 A;  1AHR A;  5I2L A;  2M1K B;  1TNW A;  4PT1 A;  1SMG A;  3DXL A;  1XFR A;  3DVE A;  1QX2 A;  3FIA A;  5I94 A;  2FCD A;  1SY9 A;  2Q91 A;  4PHN A;  1Y0V H;  3V2L A;  2KYC A;  1Q80 A;  2KI6 D;  3S0E A;  1DEL A;  4NQG A;  2K60 A;  1CLM A;  5J3X A;  1CKK A;  1KFU S;  1YUR A;  3KEV A;  2LCP A;  2EHB A;  1JSA A;  3S0B A;  2M0R A;  4DS7 A;  3UNW A;  2I7A A;  2IS9 A;  3CZ2 A;  1OQP A;  1KFX S;  1PRW A;  2CBL A;  2M97 A;  2NZ0 A;  1WLZ A;  2QAC A;  3EVU A;  1ZUZ A;  3NHI A;  1AJ5 A;  1LKJ A;  2BL0 C;  1AP4 A;  2M1U A;  3O4X A;  2A4J A;  1PUL A;  3NHT A;  4ORB B;  2GGZ A;  3BUO B;  1QLS A;  1QTX A;  2JTT A;  1KK8 C;  1H4B A;  1XFW O;  1S36 A;  4GGN A;  2WCE A;  3HX4 A;  1A75 A;  1SYM A;  4YI8 A;  2BAP A;  2GV5 A;  3OHM B;  1NCX A;  1T14 A;  2LMU A;  3ZNI A;  2FJU B;  4PE4 A;  1SCV A;  4ETO A;  1QAS A;  1LVC D;  2JZI A;  3L4L A;  1CB1 A;  4R1E A;  2ZND A;  3DYE A;  3O78 A;  2LUX A;  2M7L A;  2BE6 A;  1BG1 A;  2KGB C;  3JTD B;  3CR5 X;  5EL2 A;  2MLF C;  1SCM B;  1RK9 A;  1TUJ A;  1S6I A;  2H2K A;  2BNX A;  1CDN A;  2BKH B;  3CZT X;  1ORG A;  3IQO A;  3NSL A;  4MN0 A;  1OMD A;  3CWG A;  3PFV A;  4MBE A;  1OW4 A;  2KGR A;  1KFX L;  2WC6 A;  1B9A A;  5HKY A;  5I8N A;  3BQ3 A;  1F70 A;  2E6W A;  2KLD A;  1CDL A;  5AFP A;  3EK4 A;  1L2O B;  1B7T Z;  2E30 A;  2BL0 B;  3IVT A;  4OVN F;  1JFJ A;  1SBJ A;  4GGF C;  1NCZ A;  3D73 A;  3BOW A;  1GGW A;  2MA2 A;  1K94 A;  4TNC A;  5K89 A;  2ISD A;  2CT9 A;  1QWV A;  2G9B A;  3I5I B;  1UUS A;  5AXI A;  3TZ1 A;  1NX1 A;  2LVI A;  1DJY A;  5DKN A;  2HPS A;  1MF8 B;  3BUX B;  3BUN B;  3K1E A;  1OOJ A;  3OBV A;  1AUI B;  1QAT A;  1XFZ O;  1A4P A;  1XFV O;  2MHH A;  1CFC A;  5BPJ A;  1F71 A;  1IH0 A;  1QX7 A;  1FBV A;  1REC A;  1LS8 A;  1M45 A;  2CTN A;  2JT8 A;  3D78 A;  4MZK A;  1J1E A;  4PAL A;  1K9U A;  4DRW A;  3K21 A;  1S6J A;  1WRZ A;  3H4S E;  4I5J A;  5HKZ A;  3VRN A;  1ZMZ A;  1IWQ A;  1PK0 D;  2BEC A;  2JXC A;  3JVT C;  2MRD A;  4N1G A;  3SIA A;  1SL9 A;  3S0A A;  2L98 A;  5CSN A;  4I5K A;  5D7F A;  3RM1 A;  3OX5 A;  1QIV A;  4AQI A;  2P6B B;  1CFD A;  2M29 A;  3D74 A;  1OMR A;  1ALW A;  4QJ3 B;  2DOQ A;  2WCK A;  3SG5 A;  1X02 A;  1QIW A;  5B8I B;  1TIZ A;  3R1P A;  4CID A;  2JT3 A;  1QJT A;  2NCO A;  1NYA A;  1K96 A;  2OS8 B;  3QRX A;  1W7I B;  1GQM A;  4PCW A;  3DF0 A;  1GJY A;  2KAX A;  3EK8 A;  4ZCU A;  4CFQ A;  1YUS A;  3PM8 A;  4YGD B;  2KLE A;  2O60 A;  4IL1 A;  4YGA A;  2I2R E;  5KTY A;  1BOD A;  4P5O E;  1C7V A;  1CNP A;  1Y1A A;  1B47 A;  2WOR A;  5JOL A;  1U5I A;  1DJG A;  1NWD A;  1MHO A;  3SG7 A;  1R2U A;  2JRF A;  1V1F A;  3CLN A;  1F55 A;  3BJH A;  1G33 A;  3B86 A;  2K7D A;  1Y6W A;  3AKB A;  2LMT A;  1CMG A;  2JTZ A;  1CDP A;  5DKR A;  1TN4 A;  2L5Y A;  4N5X A;  2PYQ A;  1BU3 A;  1CTR A;  2O5G A;  4XJK B;  3MSE B;  5D3O A;  1PVA A;  1S1E A;  4GPL B;  4PHJ A;  2MBX A;  2JC2 A;  5CSJ A;  1KSO A;  3GK2 A;  4WQ2 A;  5HL1 A;  1BF5 A;  1NIW A;  1NSH A;  2KPH A;  1C3Z A;  3TUY B;  3JVT B;  2CCM A;  1J55 A;  2PVB A;  3BUM B;  1SR6 C;  2I18 A;  3GK1 A;  5FYX A;  3DVJ A;  3CYZ A;  4C0K A;  1QXP A;  1ZFS A;  2MJW B;  1M39 A;  3WNX B;  2LV7 A;  4BY4 A;  5GQQ C;  3DD4 A;  4OCI A;  1DF0 B;  3SJS A;  2MLE C;  4PHM A;  5KSZ A;  1AK8 A;  1R6P A;  2JWW A;  2WCL A;  2QPT A;  2KBI A;  1HQV A;  2I94 A;  2QEH A;  3VRO A;  2H8V A;  3BXK A;  1IQ5 A;  1TTX A;  4GNK B;  3WXA A;  2GGM A;  1TNP A;  2JPT A;  2L4H A;  5HYD A;  4GUK A;  1Z4H A;  2LM5 A;  3PN7 C;  2P70 A;  1J7Q A;  4ORA B;  1SL7 A;  4MLW A;  1OE9 B;  2SAS A;  1CM4 A;  3I5F C;  4CLN A;  3NSO A;  1TCF A;  5G08 A;  3PAL A;  2GTE A;  1NP8 A;  3FE9 A;  2AMI A;  2NLN A;  1BT6 A;  3DVM A;  2PAS A;  3PM2 A;  2WCF A;  1H8B A;  1LXF C;  2KI6 C;  2HQW A;  2KHN A;  4OV2 A;  3S0F A;  1MWN A;  1SR6 B;  1TOP A;  2EGD A;  1NX3 A;  2L5X B;  3BFA A;  3O6B A;  4A4B A;  3NSK A;  1F8H A;  2K0J A;  1UWO A;  2HF5 A;  1XK4 C;  3KO0 A;  1F4O A;  2OTG C;  3KF9 A;  1J1D A;  1RJV A;  4GBA A;  3LK0 A;  1DJW A;  3WHT B;  4KYN A;  1A75 B;  1IJ6 A;  2ZFD A;  3LK1 A;  4YGB B;  2K2F A;  1IG5 A;  2Y1N A;  3AAK A;  3WHU B;  2QDI A;  2F33 A;  1JUO A;  5AAN A;  1KQV A;  3BUW B;  1S26 D;  2F2O A;  3CGA A;  4M2P A;  1S5G Z;  1Z2C B;  1QS7 A;  1XK4 A;  1CMF A;  3VRP A;  3D0Y A;  4XYN A;  1KK8 B;  1YVL A;  1IKU A;  2ZRS A;  1RTP 1;  2F8P A;  1WDC C;  3EKJ A;  3I5F B;  1LA3 A;  1OZO A;  3D10 A;  1UHK A;  1KK7 Y;  1NPQ A;  3SG3 A;  4DCK A;  2LLS A;  3I5G C;  3IF7 A;  4FQT A;  1N0Y A;  3SS5 A;  2KNE A;  2P71 A;  1BR4 B;  2LAN A;  1QV1 A;  4NDC A;  3OGN A;  1B8C A;  2LP2 A;  1AVS A;  2HQ8 A;  2PAL A;  3NSI A;  4M2O A;  4HRE E;  1C7W A;  2D8N A;  2TN4 A;  2WCH A;  3B88 A;  5D69 A;  4NDB A;  3TS5 C;  2PMY A;  1LA0 A;  1OOF A;  2WCM A;  1N65 A;  2WC5 A;  1KWO C;  3FWB A;  5FI6 A;  2BCX A;  1DJH A;  2FJY A;  1IRJ A;  3BOW B;  1FF1 A;  3NXA A;  5ER5 A;  3TDZ A;  4N1F A;  1UHH A;  2JQ6 A;  2LVK A;  4YI9 A;  1W7J B;  1UHJ A;  2BKI B;  2RGI A;  4USL A;  1WLM A;  1FPW A;  2M8U A;  2L0P A;  1F54 A;  4PE0 A;  2LC5 A;  1QVI Y;  3BFH A;  4YBH B;  4DIR A;  1SPY A;  2CXJ A;  1BJF A;  2PQL A;  3L4A A;  3GOF A;  1C07 A;  4E68 A;  3RZS A;  3CR4 X;  1N2D A;  1JF0 A;  4HSZ A;  1EG4 A;  3DZT A;  4MZJ A;  2VRG A;  2MAZ A;  4GFT A;  2KAV A;  3CZ1 A;  1XFU O;  1DVI A;  2WCB A;  1XYD A;  3OB2 B;  3S0G A;  3M0W A;  4WQ3 A;  4UPG A;  1FI6 A;  5TNC A;  1EJ3 A;  1QLK A;  2LVJ A;  2QEV A;  5CSI A;  2Q4U A;  2WOS A;  5DIC A;  3OX6 A;  5F6T A;  4HRH A;  1B1G A;  4JPZ B;  3SS3 A;  1XO5 A;  1SW8 A;  2ZN8 A;  1OOG A;  2LE9 B;  1WY9 A;  1KQM C;  1B8L A;  5PAL A;  2KFH A;  3R1O A;  3DVK A;  4L9M A;  4F0Z B;  2V53 A;  2YGU A;  1S6C A;  1XFY O;  1JBA A;  4OKH A;  2KQY A;  3SS4 A;  3DF0 B;  4MZL A;  2WND A;  3UO9 A;  1MUX A;  3D76 A;  1NUB A;  3SIB A;  3E3R A;  4CFR A;  2F2P A;  4MRY A;  4WRI A;  1U5I B;  2NCP A;  3S0D A;  1KCY A;  2BE4 A;  1B7T Y;  2ZRT A;  1ZAC A;  1K8U A;  3EVR A;  2AUC A;  1YVH A;  2QEO A;  2COL B;  1DC1 A;  3CS1 A;  1OOH A;  1J7R A;  1L7Z A;  1M63 B;  4BY5 A;  1M31 A;  4INW A;  1GGZ A;  4C0J A;  5I2Q A;  1A29 A;  1NX2 A;  3PLF B;  5JJG A;  1IQ3 A;  1JWD A;  2M9G A;  4PDZ A;  1DQE A;  3PJI A;  1KK7 Z;  4AOM A;  1XFX O;  2Y4Q A;  2LHI A;  1SRA A;  3JTD C;  1RWY A;  4D1E A;  1NCY A;  1DJX A;  1SCM C;  2JUL A;  3QME A;  4JQ0 D;  3GK4 X;  2ZN9 A;  1K2H A;  5CPV A;  1JFK A;  2L2E A;  5FI2 A;  4I5L B;  1PAL A;  1J7P A;  1DMO A;  1WRL A;  4F7F A;  4GAO A;  1YX7 A;  1YRU B;  2FCE A;  5FI7 A;  3DY9 A;  1ALV A;  1KQM B;  1YUU A;  2M7N A;  5KU1 A;  2JOJ A;  1UUR A; 
#chains in the Genus database with same CATH homology
 1YR5 A;  3A8R A;  2PSR A;  1K93 D;  3OP0 A;  5IBW A;  1FI5 A;  1PSR A;  1L2O C;  2K7B A;  1K95 A;  3SG6 A;  2HET A;  4PHK A;  4ORC B;  2JNF A;  3O4Y A;  1BLQ A;  1YRT B;  1QVI Z;  1OMV A;  4CPV A;  1F4Q A;  2G2B A;  2ZNE A;  4MVF A;  4M2Q A;  4MRX A;  1XVJ A;  1RFJ A;  2JXL A;  3I5I C;  3F45 A;  2FOT A;  1XA5 A;  2Y5I A;  4DUQ A;  3PAT A;  1CFF A;  1TRF A;  1OZS A;  3I5H C;  2R2I A;  4AQJ A;  2KQ6 A;  2KYF A;  2PRU A;  2WC8 A;  1CLL A;  2LNK A;  3TDI A;  2CNP A;  2H61 C;  3O2P A;  4MSP A;  3RLZ A;  3PN7 B;  4I5N B;  3LLE A;  1G8I A;  2L51 A;  3OB1 B;  1QV0 A;  1KFU L;  5CSF A;  1HT9 A;  1DTL A;  2K8M B;  3EKH A;  5HLV A;  1MXL C;  4YGC B;  1D1O A;  1SK6 D;  4MEW A;  2KAY A;  1YX8 A;  1PSB A;  2LMV A;  3CTN A;  3KHE A;  3FS7 A;  2BCB A;  4ZCV A;  4C0L A;  1NX0 A;  2H61 A;  2K61 A;  2EC6 C;  2B1U A;  1UHI A;  5AER A;  2OS8 C;  2M3W A;  2JNX A;  4QJ4 B;  2Y1M A;  2KOT A;  2OPO A;  1UHN A;  3SG2 A;  5AEQ A;  3CR2 A;  1E8A A;  1WRK A;  2OTG B;  3LCP C;  2BCA A;  3D0Y B;  1CLB A;  2JU0 A;  2KFF A;  1YTZ C;  4YGE B;  3FWC A;  4JWQ A;  2LUC A;  3EK7 A;  2K7C A;  2KI4 C;  1CDM A;  3SG4 A;  1LIN A;  1K9P A;  2KSP A;  1JF2 A;  1G4Y R;  3I5H B;  1DJI A;  1SKT A;  3C1V A;  1DGU A;  2LVV A;  3IQQ A;  2BBN A;  4GGF A;  4ICB A;  3TDU A;  1JC2 A;  1DGV A;  1SNL A;  4P2Y B;  5ER4 X;  3VGO A;  1SL8 A;  1TNX A;  1M46 A;  1Y1U A;  3TUY C;  1QX5 B;  4YRU A;  2LLU A;  2SCP A;  2F3Y A;  1MR8 A;  1Y1X A;  2LP3 A;  1WDC B;  1BMO A;  4U8D A;  2LLT A;  3KPX A;  3VRQ A;  5HLO A;  1ODB A;  2K7O A;  1IJ5 A;  2L50 A;  3I5G B;  1CM1 A;  4HRG A;  1MXE A;  1ZOT B;  4OR9 B;  1KSM A;  1A03 A;  4XJK A;  2EC6 B;  1VRK A;  1S3P A;  2ZKM X;  2L4I A;  3ICB A;  1CFP A;  1BR1 B;  1UP5 A;  1J7O A;  2JT0 A;  2NXQ A;  4FQO A;  1EG3 A;  2K2A A;  3PSR A;  1YUT A;  4FTG A;  3TS5 B;  1BOC A;  1B8R A;  4Q04 A;  2BBM A;  1K90 D;  1KWO B;  4QJ5 B;  4PE1 A;  1V1G A;  3VRR A;  3HCM A;  1DF0 A;  1TCO B;  2KFG A;  2M49 B;  3AAJ A;  2KBM A;  1FW4 A;  2KI4 B;  1A2X A;  1DJZ A;  1S5G Y;  2AAO A;  3BYA A;  1OSA A;  4A4C A;  2LHL A;  5HKW A;  3ZWH A;  2F3Z A;  3EVV A;  1TNQ A;  2KDH A;  5I2O A;  3AKA A;  1MQ1 A;  5DKQ A;  1EH2 A;  1K9K A;  4NDD A;  1AJ4 A;  1B4C A;  3A4U B;  3LL8 B;  1EXR A;  1RRO A;  1DT7 B;  2LAP A;  1PVB A;  1EL4 A;  1IGV A;  4PE7 A;  1AHR A;  5I2L A;  2M1K B;  1TNW A;  1SMG A;  3FIA A;  3DVE A;  1QX2 A;  2FCD A;  1SY9 A;  2Q91 A;  4PHN A;  1Y0V H;  2KYC A;  1Q80 A;  2KI6 D;  4NQG A;  1CLM A;  5J3X A;  1CKK A;  1KFU S;  1YUR A;  3KEV A;  2LCP A;  2EHB A;  1JSA A;  2M0R A;  4DS7 A;  2I7A A;  2IS9 A;  1OQP A;  1KFX S;  1PRW A;  2CBL A;  2M97 A;  2NZ0 A;  1WLZ A;  2QAC A;  3EVU A;  1ZUZ A;  4ZCU A;  1AJ5 A;  1LKJ A;  2BL0 C;  1AP4 A;  2M1U A;  2A4J A;  1PUL A;  4ORB B;  2GGZ A;  3BUO B;  1QLS A;  1QTX A;  2JTT A;  1KK8 C;  1H4B A;  1XFW O;  1S36 A;  4GGN A;  2WCE A;  3HX4 A;  1A75 A;  1SYM A;  4YI8 A;  3OHM B;  2GV5 A;  1NCX A;  2LMU A;  3ZNI A;  2FJU B;  4PE4 A;  1SCV A;  4ETO A;  1QAS A;  1LVC D;  2JZI A;  1CB1 A;  4R1E A;  2ZND A;  3O78 A;  2LUX A;  2M7L A;  2BE6 A;  1BG1 A;  2KGB C;  3JTD B;  3CR5 X;  2MLF C;  1SCM B;  1RK9 A;  1S6I A;  2H2K A;  1CDN A;  2BKH B;  3CZT X;  3IQO A;  3NSL A;  4MN0 A;  1OMD A;  3CWG A;  3PFV A;  4MBE A;  2KGR A;  1KFX L;  1B9A A;  5HKY A;  5I8N A;  3BQ3 A;  1F70 A;  2E6W A;  1CDL A;  5AFP A;  3EK4 A;  1L2O B;  1B7T Z;  2E30 A;  2BL0 B;  4OVN F;  1JFJ A;  1SBJ A;  4GGF C;  1NCZ A;  1GGW A;  3BOW A;  2MA2 A;  1K94 A;  4TNC A;  5K89 A;  2ISD A;  2CT9 A;  3I5I B;  2G9B A;  5AXI A;  1UUS A;  3TZ1 A;  1NX1 A;  2LVI A;  1DJY A;  5DKN A;  2HPS A;  1MF8 B;  3BUX B;  3BUN B;  1OOJ A;  1AUI B;  1QAT A;  1XFZ O;  1A4P A;  1XFV O;  2MHH A;  1CFC A;  5BPJ A;  1F71 A;  1IH0 A;  1QX7 A;  1FBV A;  1REC A;  1M45 A;  2CTN A;  2JT8 A;  4MZK A;  1J1E A;  4PAL A;  1K9U A;  4DRW A;  3K21 A;  1S6J A;  1WRZ A;  3H4S E;  4I5J A;  5HKZ A;  3VRN A;  1ZMZ A;  1IWQ A;  1PK0 D;  2BEC A;  2JXC A;  3JVT C;  2MRD A;  4N1G A;  3SIA A;  1SL9 A;  2L98 A;  5CSN A;  4I5K A;  5D7F A;  3RM1 A;  3OX5 A;  1QIV A;  4AQI A;  2P6B B;  1CFD A;  2M29 A;  1OMR A;  1ALW A;  4QJ3 B;  2DOQ A;  3SG5 A;  1X02 A;  1QIW A;  5B8I B;  1TIZ A;  4CID A;  2JT3 A;  1QJT A;  2NCO A;  1NYA A;  1K96 A;  2OS8 B;  3QRX A;  1W7I B;  1GQM A;  4PCW A;  3DF0 A;  1GJY A;  2KAX A;  3EK8 A;  4CFQ A;  1YUS A;  3PM8 A;  4YGD B;  4IL1 A;  2O60 A;  4YGA A;  5KTY A;  2I2R E;  1BOD A;  1C7V A;  4P5O E;  1CNP A;  1Y1A A;  1B47 A;  2WOR A;  5JOL A;  1U5I A;  1DJG A;  1NWD A;  1MHO A;  3SG7 A;  1R2U A;  2JRF A;  1V1F A;  3CLN A;  1F55 A;  1G33 A;  2K7D A;  1Y6W A;  3AKB A;  2LMT A;  1CMG A;  2JTZ A;  1CDP A;  5DKR A;  1TN4 A;  4N5X A;  1BU3 A;  1CTR A;  2O5G A;  4XJK B;  3MSE B;  1PVA A;  1S1E A;  4GPL B;  4PHJ A;  2MBX A;  2JC2 A;  5CSJ A;  1KSO A;  3GK2 A;  4WQ2 A;  1BF5 A;  1NIW A;  1NSH A;  3TUY B;  3JVT B;  2CCM A;  1J55 A;  2PVB A;  3BUM B;  1SR6 C;  2I18 A;  3GK1 A;  5FYX A;  3DVJ A;  4C0K A;  1QXP A;  1ZFS A;  2MJW B;  1M39 A;  3WNX B;  2LV7 A;  4BY4 A;  5GQQ C;  3DD4 A;  4OCI A;  1DF0 B;  3SJS A;  2MLE C;  4PHM A;  5KSZ A;  1AK8 A;  1R6P A;  2JWW A;  2QPT A;  2KBI A;  1HQV A;  2I94 A;  3VRO A;  3BXK A;  1IQ5 A;  1TTX A;  4GNK B;  3WXA A;  2GGM A;  1TNP A;  2JPT A;  2L4H A;  5HYD A;  4GUK A;  2LM5 A;  3PN7 C;  1J7Q A;  4ORA B;  1SL7 A;  4MLW A;  1OE9 B;  2SAS A;  1CM4 A;  3I5F C;  4CLN A;  3NSO A;  1TCF A;  5G08 A;  3PAL A;  1NP8 A;  2AMI A;  2NLN A;  1BT6 A;  3DVM A;  2PAS A;  2WCF A;  1H8B A;  1LXF C;  2KI6 C;  2HQW A;  2KHN A;  4OV2 A;  1MWN A;  1SR6 B;  1TOP A;  2EGD A;  1NX3 A;  2L5X B;  3O6B A;  4A4B A;  3NSK A;  1F8H A;  2K0J A;  1UWO A;  2HF5 A;  1XK4 C;  3KO0 A;  1F4O A;  2OTG C;  3KF9 A;  1J1D A;  1RJV A;  4GBA A;  3LK0 A;  1DJW A;  3WHT B;  1A75 B;  1IJ6 A;  2ZFD A;  3LK1 A;  4YGB B;  2K2F A;  1IG5 A;  2Y1N A;  3AAK A;  3WHU B;  2F33 A;  1JUO A;  5AAN A;  1KQV A;  3BUW B;  1S26 D;  2F2O A;  3CGA A;  4M2P A;  1S5G Z;  1QS7 A;  1XK4 A;  1CMF A;  3VRP A;  3D0Y A;  4XYN A;  1KK8 B;  1YVL A;  1IKU A;  2ZRS A;  1RTP 1;  2F8P A;  1WDC C;  3EKJ A;  3I5F B;  1LA3 A;  1OZO A;  3D10 A;  1UHK A;  1KK7 Y;  1NPQ A;  3SG3 A;  4DCK A;  2LLS A;  3I5G C;  3IF7 A;  1N0Y A;  2KNE A;  1BR4 B;  2LAN A;  1QV1 A;  4NDC A;  1B8C A;  2LP2 A;  1AVS A;  2HQ8 A;  2PAL A;  3NSI A;  4M2O A;  4HRE E;  1C7W A;  2D8N A;  2TN4 A;  5D69 A;  1JWD A;  4NDB A;  3TS5 C;  2PMY A;  1LA0 A;  1N65 A;  1KWO C;  3FWB A;  2BCX A;  1DJH A;  1IRJ A;  3BOW B;  1FF1 A;  3NXA A;  5ER5 A;  3TDZ A;  4N1F A;  1UHH A;  2JQ6 A;  2LVK A;  4YI9 A;  1W7J B;  1UHJ A;  2BKI B;  2RGI A;  4USL A;  1WLM A;  1FPW A;  2M8U A;  2L0P A;  1F54 A;  4PE0 A;  2LC5 A;  1QVI Y;  4YBH B;  4DIR A;  1SPY A;  2CXJ A;  1BJF A;  3GOF A;  1C07 A;  4E68 A;  3CR4 X;  1N2D A;  1JF0 A;  4HSZ A;  1EG4 A;  4MZJ A;  2VRG A;  2MAZ A;  4GFT A;  2KAV A;  1XFU O;  1DVI A;  2WCB A;  1XYD A;  3OB2 B;  4UPG A;  3M0W A;  4WQ3 A;  1FI6 A;  5TNC A;  1EJ3 A;  1QLK A;  2LVJ A;  5CSI A;  2Q4U A;  2WOS A;  3OX6 A;  5F6T A;  4HRH A;  1B1G A;  4JPZ B;  1XO5 A;  1SW8 A;  2ZN8 A;  2LE9 B;  1WY9 A;  1KQM C;  1B8L A;  5PAL A;  2KFH A;  3DVK A;  4L9M A;  4F0Z B;  2V53 A;  1S6C A;  1XFY O;  1JBA A;  4OKH A;  2KQY A;  3DF0 B;  4MZL A;  2WND A;  1MUX A;  4CFR A;  1NUB A;  3SIB A;  3E3R A;  2F2P A;  4MRY A;  4WRI A;  1U5I B;  2NCP A;  1KCY A;  2BE4 A;  1B7T Y;  2ZRT A;  1ZAC A;  1K8U A;  3EVR A;  2AUC A;  1YVH A;  2COL B;  3CS1 A;  1J7R A;  1L7Z A;  1M63 B;  4BY5 A;  1M31 A;  1GGZ A;  4C0J A;  5I2Q A;  1A29 A;  1NX2 A;  3PLF B;  5JJG A;  1IQ3 A;  2M9G A;  4PDZ A;  1KK7 Z;  4AOM A;  1XFX O;  2Y4Q A;  2LHI A;  1SRA A;  3JTD C;  1RWY A;  4D1E A;  1NCY A;  1DJX A;  1SCM C;  2JUL A;  4JQ0 D;  3GK4 X;  2ZN9 A;  1K2H A;  5CPV A;  1JFK A;  2L2E A;  4I5L B;  1PAL A;  1J7P A;  1DMO A;  1WRL A;  4GAO A;  1YX7 A;  1YRU B;  2FCE A;  1ALV A;  1KQM B;  1YUU A;  2M7N A;  5KU1 A;  2JOJ A;  1UUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...