5I2OA

Structure of ef-hand containing protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
102
Chain Sequence
FNPYTEFKEFSRKQIKDMEKMFKQYDDGFIDLMALKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords EF-hand domain-containing protein D2
publication title Structural implications of Ca(2+)-dependent actin-bundling function of human EFhd2/Swiprosin-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 102
sequence length 105
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5i2oA00
3HX4A 4MZJA 2F33A 2OS8B 3SG4A 1KFUS 2F2PA 4F0ZB 1OMDA 3GK2A 4PCWA 3ZNIA 2JT0A 2PASA 3DVKA 2JTZA 1FBVA 2L51A 2LANA 1EL4A 1NX2A 1OSAA 3FS7A 1R2UA 3OX5A 3SG5A 3JTDB 4NDBA 1BR4B 1DGVA 2K2AA 3JVTC 3H4SE 2NCOA 3KF9A 3O78A 4CFQA 2NZ0A 1SL9A 1KSOA 3HCMA 4MVFA 1CKKA 1OMVA 1IH0A 2BE6A 2JZIA 3O6BA 4JQ0D 4MRXA 4N1GA 4DS7A 1B4CA 2EHBA 2GGMA 1XA5A 3PSRA 1EG3A 1NX1A 1QV0A 3BUWB 2V53A 2EGDA 1YVHA 3PN7B 2IS9A 1CNPA 4UPGA 2FJUB 1C7VA 1J7QA 4OCIA 2M9GA 4XJKA 2ISDA 4HREE 4MZLA 4U8DA 4GGFC 1QIVA 2JWWA 3PFVA 2AUCA 2LNKA 2ZRSA 2LVKA 2L98A 1NX3A 2KI6C 5IBWA 1W7JB 1GJYA 1XVJA 2A4JA 2CTNA 3KEVA 1GGZA 2AAOA 1Y1UA 1YRTB 3LL8B 4GGNA 5HKYA 3EK4A 4HRGA 1U5IB 1B7TZ 1DF0B 3PALA 2G2BA 1NIWA 4PE4A 2JXCA 1SYMA 1KFXS 1MXLC 3VGOA 1A75B 5F6TA 1EG4A 3I5HC 1XO5A 3WNXB 4NQGA 1CDNA 1B7TY 1R6PA 4USLA 3NXAA 4YGBB 4P2YB 1SR6C 2ZNDA 3PATA 5HYDA 1ZUZA 3GK4X 1QVIZ 5I8NA 3OP0A 4L9MA 1KK7Z 2LE9B 3IQQA 1OOJA 4PE1A 1FW4A 2PALA 1K9KA 4GPLB 3BUXB 1B47A 2KAYA 4AQJA 1QVIY 4C0KA 1UUSA 1JFKA 1KK7Y 2PSRA 2BKHB 1RFJA 1TNPA 1LINA 1XFXO 2ZN9A 3D0YB 2GGZA 2JT3A 3NSLA 5FYXA 5G08A 1QS7A 1KCYA 5J3XA 1QXPA 2SASA 5DKQA 2Q91A 2JOJA 2LV7A 1J7OA 5JOLA 2HQ8A 3A8RA 2LVJA 1OZSA 2KBMA 4WQ3A 3I5FC 3TS5C 1AVSA 1L2OC 3BYAA 3WHTB 4JWQA 2KFFA 1G33A 1TRFA 3EKJA 3SJSA 3I5IC 1M46A 1MR8A 5ER4X 1IJ5A 2OTGC 1KQMC 1V1GA 2KHNA 2K7OA 3QRXA 4YRUA 3SIBA 1YTZC 2KSPA 5GQQC 2JT8A 2EC6B 5I2LA 1J7RA 1F4OA 2H2KA 3MSEB 2M7LA 1N0YA 1U5IA 3WXAA 1SW8A 3GOFA 1XFUO 1C07A 4WRIA 4A4CA 3TUYB 1H8BA 2HETA 2KQ6A 4PE0A 2BBMA 1S5GZ 5K89A 2LP2A 3DD4A 3LCPC 1QLKA 4C0JA 3I5GB 1YUUA 2CNPA 1WRLA 2NCPA 1SCVA 2LMVA 3NSIA 4BY4A 1IRJA 2MBXA 3KO0A 1K94A 4PHNA 1JC2A 1MWNA 1S5GY 2SCPA 2LAPA 1LA0A 2BKIB 2K2FA 2O60A 1QX7A 2KGRA 1UHHA 3BOWA 1BT6A 4PALA 1X02A 3D0YA 3FIAA 1PVAA 1VRKA 2BL0C 1J55A 1ZOTB 1MXEA 2COLB 1MQ1A 2AMIA 2JULA 2PRUA 3BQ3A 3C1VA 2BCXA 2M49B 3RLZA 2Y5IA 2OS8C 1BR1B 4QJ3B 2F8PA 1TIZA 2KDHA 2LHLA 2M7NA 4OR9B 5CSNA 3WHUB 1PK0D 2Y4QA 3AKAA 4I5KA 3VROA 1BF5A 1K95A 1PVBA 1RWYA 3FWCA 2NXQA 2K61A 3LK0A 4OV2A 3VRQA 3K21A 1UWOA 2KI4C 1XFVO 2H61A 4ICBA 1FI6A 3DVEA 1S6JA 1YVLA 1NPQA 1DJIA 4ETOA 1MHOA 2LHIA 1CFFA 4YGDB 1DGUA 5D7FA 1SPYA 1DTLA 1F8HA 1PSRA 1PULA 1TOPA 1WLMA 4GNKB 4NDCA 4PHJA 1OE9B 3ZWHA 4GUKA 1E8AA 2JQ6A 4YGCB 1WY9A 2MLFC 3PN7C 1Y0VH 4ZCVA 1JF2A 2K7BA 4XYNA 1XFZO 5CSFA 3TDIA 4GFTA 3EVUA 3IF7A 1JFJA 2FCEA 3PM8A 1S6CA 1IQ3A 1C7WA 3KPXA 2L5XB 3DF0B 2D8NA 1S6IA 2Y1NA 5CPVA 2PMYA 1TCOB 1FPWA 3EK7A 1EH2A 2M29A 3ICBA 1LVCD 3CR5X 5HKZA 1F55A 4N1FA 4QJ4B 2M1UA 1RJVA 2NLNA 1YUSA 4HSZA 3BUMB 2L50A 1CB1A 4AOMA 4AQIA 4YI8A 1AUIB 3TDZA 2E30A 1LXFC 2WOSA 1G4YR 1MF8B 2MHHA 1N65A 1AP4A 3EVRA 1SK6D 4I5LB 1A2XA 4CFRA 1SRAA 2LP3A 2L4IA 4E68A 1SCMC 1NYAA 2M1KB 1J1DA 2I7AA 2ZFDA 2Q4UA 3EK8A 1BJFA 2BBNA 4N5XA 2JXLA 5AERA 1AJ4A 2QPTA 4ORBB 1MUXA 4MEWA 1UHJA 5PALA 1K9PA 1CDLA 2LVVA 1JBAA 4OKHA 1CMFA 1NCZA 2WC8A 3TDUA 1QX2A 1QATA 1ZFSA 1F70A 1HT9A 2K7CA 2K0JA 2I94A 2KGBC 1CFCA 1TTXA 1KK8B 1WLZA 2WCEA 1F71A 2JU0A 3RM1A 4ZCUA 1DJGA 2H61C 5KTYA 1IKUA 2ZN8A 1NSHA 3I5FB 1BMOA 2CXJA 2BCAA 2KFHA 3EKHA 1ODBA 1S1EA 4YBHB 1A29A 2O5GA 1BU3A 1V1FA 4M2PA 1WDCC 2KFGA 3VRPA 1M63B 2JC2A 3DF0A 1M39A 2MRDA 2OTGB 1KQMB 1DF0A 2HQWA 1F4QA 1CFPA 1XFWO 3OB2B 1CTRA 4P5OE 5D69A 2LMTA 3AAKA 1F54A 3AAJA 4MBEA 1A75A 4PE7A 1JSAA 1K96A 5I2OA 5HLVA 3O2PA 1CM4A 2BECA 1NP8A 1QIWA 3TUYC 1RROA 2KAXA 3CTNA 1KWOC 2LCPA 3IQOA 1IWQA 1TNWA 3KHEA 2KBIA 3CS1A 1RK9A 1XK4A 4BY5A 4MLWA 2KYCA 3FWBA 4PHKA 1XYDA 5DKRA 2WORA 1UURA 4MSPA 4I5JA 1QLSA 2M8UA 4C0LA 2TN4A 4D1EA 1K2HA 1CDPA 1S26D 3OHMB 1ALVA 1K93D 2K8MB 2LLTA 1TCFA 1GQMA 2KYFA 3LLEA 4YGAA 4CLNA 1CLLA 1UHNA 2FCDA 3EVVA 3GK1A 2LVIA 1LKJA 3OX6A 4FQOA 5JJGA 5BPJA 1QTXA 2LUXA 1YX7A 2WCFA 1IQ5A 3JTDC 4OVNF 1NWDA 2KQYA 3PLFB 1WRKA 4WQ2A 2F3YA 3SIAA 1ALWA 1NCYA 3SG7A 2QACA 4DUQA 1QX5B 1YURA 1TNXA 2GV5A 2P6BB 1DMOA 2KI4B 3JVTB 1EJ3A 2RGIA 1NX0A 3O4YA 1OZOA 5HLOA 4ORAB 1B8CA 1DJYA 1G8IA 1N2DA 1NCXA 1W7IB 2DOQA 2LC5A 1J7PA 4Q04A 3CR4X 1B8RA 1CFDA 1TNQA 1B8LA 1A4PA 1SMGA 3DVMA 1SBJA 4IL1A 1A03A 1K9UA 1DJWA 3M0WA 2L0PA 1B9AA 4PHMA 1BOCA 2ZKMX 2FOTA 1CLBA 1XFYO 3CGAA 2L2EA 2ZNEA 1DVIA 1KFXL 2CT9A 2R2IA 5AEQA 1Q80A 2MLEC 1JUOA 2Y1MA 1UHKA 2CBLA 1AK8A 1EXRA 1OQPA 3LK1A 4DCKA 4M2OA 1J1EA 2MA2A 2HPSA 1BODA 1L7ZA 3A4UB 4M2QA 1BG1A 3I5HB 1BLQA 5KU1A 1FF1A 1PALA 1HQVA 1SL8A 1AJ5A 1YUTA 2L4HA 3BXKA 4FTGA 1SR6B 2E6WA 5CSJA 1WRZA 3F45A 1D1OA 3BUNB 1XK4C 1M31A 2M3WA 2I18A 3NSOA 2KNEA 2VRGA 2WNDA 2LUCA 4MZKA 1CMGA 1FI5A 1KQVA 4TNCA 1SKTA 1QASA 1UHIA 1IG5A 1DJZA 4DRWA 2F3ZA 2KOTA 1SCMB 1K90D 2OPOA 5CSIA 1PSBA 2MJWB 3CZTX 4MRYA 1K8UA 1UP5A 4CIDA 3BOWB 1QV1A 3NSKA 2JRFA 1ZMZA 1LA3A 4JPZB 3TS5B 1CDMA 1PRWA 1KK8C 1L2OB 2ZRTA 5DKNA 3AKBA 4PDZA 3OB1B 2M97A 3DVJA 3SG2A 3BUOB 3I5IB 2LLUA 5KSZA 1ZACA 4CPVA 3TZ1A 1S3PA 1IJ6A 1Y1XA 3VRNA 1SY9A 2I2RE 1RTP1 3CLNA 1M45A 2EC6C 2BCBA 2PVBA 5B8IB 2F2OA 2KAVA 2LLSA 4GGFA 3VRRA 1GGWA 2LM5A 5AXIA 2K7DA 1TN4A 3SG3A 5AFPA 2JTTA 1H4BA 2CCMA 2JNFA 4GBAA 4ORCB 2JNXA 5ER5A 1DJXA 3SG6A 1JF0A 1WDCB 1KSMA 1SL7A 1NUBA 1S36A 1SNLA 3E3RA 1IGVA 2BE4A 1OMRA 3CWGA 3CR2A 4XJKB 2LMUA 3I5GC 5HKWA 4A4BA 1YR5A 1RECA 4HRHA 1AHRA 1DJHA 4GAOA 5TNCA 4MN0A 1Y6WA 2HF5A 4I5NB 4DIRA 1YRUB 5I2QA 4YI9A 1KWOB 2KI6D 1KFUL 4YGEB 4NDDA 1DT7B 2MAZA 4R1EA 5AANA 1YX8A 2JPTA 1QJTA 1JWDA 3D10A 2WCBA 1CM1A 2B1UA 2BL0B 2G9BA 1Y1AA 4QJ5B 1CLMA 1B1GA 2M0RA
chains in the Genus database with same CATH superfamily
3HX4A 4MZJA 3UO9A 2F33A 2OS8B 3SG4A 3FE6A 1KFUS 2F2PA 4F0ZB 1OMDA 3GK2A 3D73A 4PCWA 3D76A 3ZNIA 2JT0A 2PASA 3DVKA 2JTZA 1FBVA 2L51A 2LANA 1EL4A 1NX2A 1OSAA 3CDNA 2QDIA 1R2UA 3FS7A 2BNXA 3OX5A 1W9ZA 3SG5A 3JTDB 4NDBA 1BR4B 1DGVA 2K2AA 3JVTC 3H4SE 2NCOA 3KF9A 3DXLA 1LS8A 3O78A 4CFQA 2NZ0A 1SL9A 1KSOA 3HCMA 4MVFA 1CKKA 1OMVA 1IH0A 2BE6A 2JZIA 3O6BA 4JQ0D 4MRXA 4N1GA 4DS7A 1B4CA 2EHBA 2GGMA 1XA5A 3PSRA 1EG3A 1NX1A 1QV0A 3BUWB 2V53A 2EGDA 3DYEA 1YVHA 4JD9A 3PN7B 2IS9A 1CNPA 4UPGA 2FJUB 1C7VA 1J7QA 4OCIA 2M9GA 4XJKA 2ISDA 4HREE 4MZLA 4U8DA 3CYZA 4GGFC 1QIVA 2JWWA 2K60A 3PFVA 2AUCA 2L2CA 2LNKA 2ZRSA 2LVKA 2L98A 3UNWA 1NX3A 2KI6C 5IBWA 1W7JB 1GJYA 1XVJA 2A4JA 2CTNA 3KEVA 1GGZA 2AAOA 3NHTA 1Y1UA 1YRTB 3LL8B 4GGNA 5HKYA 3EK4A 5FI7A 4HRGA 1U5IB 1B7TZ 1DF0B 2WCLA 3PALA 2G2BA 1NIWA 4PE4A 2JXCA 1SYMA 1KFXS 1MXLC 3VGOA 1A75B 5F6TA 1EG4A 3I5HC 1XO5A 3WNXB 4NQGA 1CDNA 1B7TY 1R6PA 2YGUA 4USLA 3NXAA 3DZTA 4YGBB 4P2YB 1SR6C 2QEOA 2ZNDA 3PATA 5HYDA 1ZUZA 3GK4X 1QVIZ 5I8NA 3OP0A 4L9MA 1KK7Z 2LE9B 3IQQA 1OOJA 4PE1A 1FW4A 1P28A 2GTEA 2PALA 1K9KA 4GPLB 2ERBA 3BUXB 1B47A 2KAYA 3R1VA 5FI2A 3B86A 4AQJA 1QVIY 4C0KA 1UUSA 1JFKA 1KK7Y 2PSRA 1XFXO 1RFJA 1TNPA 1LINA 2BKHB 2KLEA 2ZN9A 2GGZA 2JT3A 3NSLA 5FYXA 5G08A 2JPOA 1QS7A 1KCYA 5J3XA 1DC1A 1QXPA 2SASA 3V2LA 5DKQA 3CZ1A 2Q91A 2JOJA 2LV7A 1J7OA 5JOLA 2HQ8A 2H8VA 2LVJA 3A8RA 1OZSA 3VB1A 2KBMA 4WQ3A 1T14A 3I5FC 3TS5C 1AVSA 3D0YB 1L2OC 3BYAA 3WHTB 3K1EA 4JWQA 2KFFA 1G33A 1TRFA 3EKJA 3SJSA 3I5IC 1M46A 3NHIA 1MR8A 4F7FA 5ER4X 1IJ5A 2OTGC 1OOFA 1KQMC 1V1GA 2KHNA 2K7OA 3QRXA 4YRUA 3SIBA 1YTZC 2KSPA 3S0FA 2L5YA 5GQQC 2JT8A 2EC6B 2QEVA 3L47A 5I2LA 1J7RA 1F4OA 2H2KA 3MSEB 2M7LA 1DEKA 1N0YA 1U5IA 3WXAA 1SW8A 3GOFA 1XFUO 1C07A 4WRIA 4A4CA 3TUYB 1H8BA 2HETA 2KQ6A 4INXA 4PE0A 2BBMA 1S5GZ 5K89A 2LP2A 3DD4A 3LCPC 1QLKA 4C0JA 2P70A 3I5GB 1YUUA 2CNPA 1WRLA 2NCPA 1SCVA 2LMVA 3NSIA 4BY4A 1IRJA 2MBXA 3KO0A 1K94A 4PHNA 1JC2A 1MWNA 1S5GY 2SCPA 2LAPA 1LA0A 3DY9A 2BKIB 2K2FA 2O60A 1QX7A 2KGRA 1UHHA 2WCMA 3BOWA 1BT6A 3IVTA 4PALA 1X02A 3D0YA 3FIAA 1PVAA 2WCJA 1VRKA 2BL0C 1J55A 4IJ7A 1ZOTB 1MXEA 2COLB 1MQ1A 2AMIA 2JULA 2PRUA 3BQ3A 3C1VA 2BCXA 2M49B 3RLZA 3R72A 2Y5IA 3SS3A 2OS8C 3EG5B 1BR1B 4QJ3B 2F8PA 1TIZA 2KDHA 2LHLA 2M7NA 4OR9B 5CSNA 3WHUB 1PK0D 2Y4QA 3AKAA 3NGVA 4I5KA 3VROA 1BF5A 1K95A 1PVBA 1RWYA 3FWCA 2NXQA 2K61A 3LK0A 4OV2A 3VRQA 3K21A 1UWOA 2KI4C 3S0GA 1XFVO 2H61A 3CZ2A 4ICBA 1FI6A 3DVEA 1S6JA 1YVLA 1NPQA 1DJIA 4ETOA 1MHOA 2LHIA 1CFFA 4YGDB 1DGUA 2BAPA 5D7FA 1SPYA 1DTLA 1F8HA 1PSRA 1PULA 1TOPA 1OOGA 1WLMA 4GNKB 4NDCA 4PHJA 1DQEA 1OE9B 3ZWHA 4GUKA 3L4LA 1E8AA 2JQ6A 3D78A 2WCKA 4YGCB 1WY9A 2MLFC 3CZ0A 3PN7C 1Y0VH 4ZCVA 1JF2A 2K7BA 4XYNA 1XFZO 5CSFA 3TDIA 4GFTA 1SSEB 3EVUA 3BJHA 3IF7A 1JFJA 2FCEA 3PM8A 1S6CA 1IQ3A 1C7WA 3KPXA 2L5XB 3DF0B 2D8NA 3R1OA 1S6IA 2Y1NA 5CPVA 2PMYA 1TCOB 1FPWA 3EK7A 1EH2A 2M29A 3ICBA 1LVCD 3S0AA 3CR5X 5HKZA 1F55A 4N1FA 4QJ4B 2M1UA 1RJVA 2NLNA 3SS4A 1YUSA 4HSZA 3BUMB 2L50A 1CB1A 4AOMA 4AQIA 4YI8A 1AUIB 3TDZA 2E30A 5D3OA 1LXFC 2WOSA 1G4YR 1MF8B 2MHHA 1N65A 1AP4A 3EVRA 1SK6D 3B7AA 2WC6A 1A2XA 4I5LB 1SRAA 4CFRA 2LP3A 2L4IA 3Q8IA 1SCMC 3RZSA 4E68A 1NYAA 2KLDA 1J1DA 2M1KB 2I7AA 2ZFDA 2Q4UA 3OBVA 3EK8A 1BJFA 2BBNA 4N5XA 2JXLA 5AERA 1AJ4A 2QPTA 4ORBB 1MUXA 4MEWA 1UHJA 2QEBA 5PALA 1K9PA 3D77A 1CDLA 2LVVA 1JBAA 1DELA 4OKHA 1CMFA 1NCZA 2KPHA 2WC8A 3TDUA 1QX2A 1QATA 1GM0A 1ZFSA 1F70A 1HT9A 2K7CA 3B87A 2K0JA 2I94A 2KGBC 1CFCA 1TTXA 1KK8B 1WLZA 3S0BA 3D75A 2WCEA 1F71A 2JU0A 3RM1A 4ZCUA 1DJGA 2H61C 5KTYA 1IKUA 2ZN8A 1NSHA 3I5FB 1BMOA 2CXJA 2BCAA 2KFHA 3EKHA 1ODBA 1S1EA 4YBHB 1A29A 2QEHA 2O5GA 1BU3A 1V1FA 4M2PA 1WDCC 2KFGA 3VRPA 1M63B 2JC2A 3DF0A 1M39A 2MRDA 2OTGB 3PJIA 1KQMB 1DF0A 2HQWA 1F4QA 4INWA 1XFWO 3OB2B 1CTRA 4P5OE 5D69A 1CFPA 2LMTA 3AAKA 5HL1A 1F54A 3AAJA 4MBEA 1A75A 4PE7A 5FI6A 1JSAA 4FQTA 1K96A 5I2OA 5HLVA 3O2PA 1CM4A 2BECA 1NP8A 1QIWA 3TUYC 1RROA 3PM2A 2KAXA 3CTNA 1KWOC 2LCPA 1TUZA 3IQOA 1IWQA 1TNWA 3KHEA 2KBIA 2WC5A 3CS1A 1RK9A 1XK4A 3BFBA 4BY5A 4MLWA 2KYCA 3FWBA 4PHKA 1XYDA 5DKRA 2WORA 1UURA 2FJYA 4I5JA 4MSPA 1QLSA 1OW4A 2M8UA 4C0LA 2TN4A 4D1EA 1K2HA 1CDPA 1S26D 3OHMB 1ALVA 1K93D 2K8MB 2LLTA 1TCFA 1GQMA 2KYFA 3FE8A 3LLEA 4YGAA 4CLNA 1CLLA 1UHNA 2FCDA 4KYNA 3EVVA 3GK1A 1C3ZA 2LVIA 1LKJA 3OX6A 4FQOA 5JJGA 5BPJA 1QTXA 2LUXA 1YX7A 2WCFA 1IQ5A 3JTDC 4OVNF 1NWDA 2KQYA 3PLFB 1WRKA 4JKTA 2F3YA 4WQ2A 3SIAA 1ALWA 1NCYA 3SG7A 2QACA 4DUQA 1Z4HA 1QX5B 1YURA 1TNXA 2GV5A 2P6BB 3D74A 1DMOA 2KI4B 3JVTB 1EJ3A 3N7HA 2RGIA 1NX0A 3O4YA 1OZOA 5HLOA 4ORAB 1B8CA 3S0DA 1DJYA 1G8IA 1N2DA 1NCXA 1W7IB 2DOQA 2LC5A 1J7PA 1XFRA 1OOIX 4Q04A 3CR4X 3L4AA 1B8RA 1CFDA 1TNQA 1B8LA 1A4PA 1SMGA 3DVMA 1SBJA 4IL1A 1A03A 1K9UA 1DJWA 3M0WA 2L0PA 2PQLA 1B9AA 4PHMA 1BOCA 3BFAA 2ZKMX 2FOTA 1CLBA 1XFYO 3B6XA 3CGAA 2L2EA 2ZNEA 1DVIA 1KFXL 2CT9A 2R2IA 5AEQA 1Q80A 2MLEC 1JUOA 2Y1MA 1UHKA 2CBLA 1AK8A 1EXRA 1OQPA 3LK1A 4DCKA 4M2OA 1J1EA 2MA2A 2HPSA 1BODA 1L7ZA 3A4UB 4M2QA 1BG1A 3I5HB 4PT1A 1BLQA 5KU1A 1FF1A 1PALA 1HQVA 1SL8A 1AJ5A 1YUTA 2L4HA 3BXKA 4FTGA 1SR6B 2E6WA 5CSJA 1WRZA 1QWVA 3F45A 3BUNB 1XK4C 3R1PA 1D1OA 1M31A 2M3WA 2I18A 3NSOA 2KNEA 2VRGA 2WNDA 2LUCA 4MZKA 1CMGA 3CABA 1FI5A 1KQVA 4TNCA 1SKTA 1QASA 1UHIA 1IG5A 1DJZA 2P71A 4DRWA 2F3ZA 2KOTA 1SCMB 1K90D 2OPOA 5CSIA 1IIOA 1PSBA 3QMEA 2MJWB 3CZTX 4MRYA 1K8UA 1UP5A 4CIDA 3BOWB 1QV1A 3NSKA 2JRFA 1ZMZA 1LA3A 4JPZB 3TS5B 1CDMA 1PRWA 1KK8C 1L2OB 2ZRTA 5DKNA 3AKBA 4PDZA 3OB1B 2M97A 3B88A 3DVJA 3SG2A 3BUOB 3I5IB 2LLUA 1Z2CB 5KSZA 1ZACA 4CPVA 3TZ1A 1S3PA 1IJ6A 1Y1XA 3VRNA 1SY9A 2I2RE 1RTP1 3CLNA 1M45A 2EC6C 2BCBA 2PVBA 5DICA 1TUJA 5B8IB 2F2OA 2KAVA 4OZDA 2LLSA 4GGFA 3VRRA 1GGWA 2LM5A 3S0EA 5AXIA 2K7DA 1TN4A 1TWOA 3O4XA 3SG3A 2JTTA 5AFPA 2WCHA 1H4BA 2CCMA 2JNFA 4GBAA 4ORCB 2JNXA 5ER5A 1DJXA 3SG6A 1JF0A 1WDCB 1KSMA 1SL7A 1NUBA 1S36A 1SNLA 3E3RA 1IGVA 5EL2A 2BE4A 1C3YA 1OMRA 3CWGA 3CR2A 4XJKB 2LMUA 3I5GC 5HKWA 4A4BA 1YR5A 1RECA 4HRHA 3FE9A 1AHRA 1DJHA 4GAOA 5TNCA 3SS5A 4MN0A 1Y6WA 2HF5A 4I5NB 5I94A 4DIRA 1YRUB 5I2QA 4YI9A 2PYQA 1ORGA 1KWOB 2KI6D 1KFUL 4YGEB 4NDDA 1DT7B 2MAZA 4R1EA 5AANA 1YX8A 3BFHA 2JPTA 1QJTA 1JWDA 3D10A 2WCBA 1CM1A 2B1UA 2BL0B 2G9BA 3OGNA 1Y1AA 4QJ5B 1CLMA 1B1GA 1OOHA 2M0RA
chains in the Genus database with same CATH topology
3HX4A 4MZJA 2F33A 2OS8B 3SG4A 1KFUS 2F2PA 4F0ZB 1OMDA 3GK2A 4PCWA 3ZNIA 2JT0A 2PASA 3DVKA 2JTZA 1FBVA 2L51A 2LANA 1EL4A 1NX2A 1OSAA 3FS7A 1R2UA 3OX5A 3SG5A 3JTDB 4NDBA 1BR4B 1DGVA 2K2AA 3JVTC 3H4SE 2NCOA 3KF9A 3O78A 4CFQA 2NZ0A 1SL9A 1KSOA 3HCMA 4MVFA 1CKKA 1OMVA 1IH0A 2BE6A 2JZIA 3O6BA 4JQ0D 4MRXA 4N1GA 4DS7A 1B4CA 2EHBA 2GGMA 1XA5A 3PSRA 1EG3A 1NX1A 1QV0A 3BUWB 2V53A 2EGDA 1YVHA 3PN7B 2IS9A 1CNPA 4UPGA 2FJUB 1C7VA 1J7QA 4OCIA 2M9GA 4XJKA 2ISDA 4HREE 4MZLA 4U8DA 4GGFC 1QIVA 2JWWA 3PFVA 2AUCA 2LNKA 2ZRSA 2LVKA 2L98A 1NX3A 2KI6C 5IBWA 1W7JB 1GJYA 1XVJA 2A4JA 2CTNA 3KEVA 1GGZA 2AAOA 1Y1UA 1YRTB 3LL8B 4GGNA 5HKYA 3EK4A 4HRGA 1U5IB 1B7TZ 1DF0B 3PALA 2G2BA 1NIWA 4PE4A 2JXCA 1SYMA 1KFXS 1MXLC 3VGOA 1A75B 5F6TA 1EG4A 3I5HC 1XO5A 3WNXB 4NQGA 1CDNA 1B7TY 1R6PA 4USLA 3NXAA 4YGBB 4P2YB 1SR6C 2ZNDA 3PATA 5HYDA 1ZUZA 3GK4X 1QVIZ 5I8NA 3OP0A 4L9MA 1KK7Z 2LE9B 3IQQA 1OOJA 4PE1A 1FW4A 2PALA 1K9KA 4GPLB 3BUXB 1B47A 2KAYA 4AQJA 1QVIY 4C0KA 1UUSA 1JFKA 1KK7Y 2PSRA 2BKHB 1RFJA 1TNPA 1LINA 1XFXO 2ZN9A 3D0YB 2GGZA 2JT3A 3NSLA 5FYXA 5G08A 1QS7A 1KCYA 5J3XA 1QXPA 2SASA 5DKQA 2Q91A 2JOJA 2LV7A 1J7OA 5JOLA 2HQ8A 3A8RA 2LVJA 1OZSA 2KBMA 4WQ3A 3I5FC 3TS5C 1AVSA 1L2OC 3BYAA 3WHTB 4JWQA 2KFFA 1G33A 1TRFA 3EKJA 3SJSA 3I5IC 1M46A 1MR8A 5ER4X 1IJ5A 2OTGC 1KQMC 1V1GA 2KHNA 2K7OA 3QRXA 4YRUA 3SIBA 1YTZC 2KSPA 5GQQC 2JT8A 2EC6B 5I2LA 1J7RA 1F4OA 2H2KA 3MSEB 2M7LA 1N0YA 1U5IA 3WXAA 1SW8A 3GOFA 1XFUO 1C07A 4WRIA 4A4CA 3TUYB 1H8BA 2HETA 2KQ6A 4PE0A 2BBMA 1S5GZ 5K89A 2LP2A 3DD4A 3LCPC 1QLKA 4C0JA 3I5GB 1YUUA 2CNPA 1WRLA 2NCPA 1SCVA 2LMVA 3NSIA 4BY4A 1IRJA 2MBXA 3KO0A 1K94A 4PHNA 1JC2A 1MWNA 1S5GY 2SCPA 2LAPA 1LA0A 2BKIB 2K2FA 2O60A 1QX7A 2KGRA 1UHHA 3BOWA 1BT6A 4PALA 1X02A 3D0YA 3FIAA 1PVAA 1VRKA 2BL0C 1J55A 1ZOTB 1MXEA 2COLB 1MQ1A 2AMIA 2JULA 2PRUA 3BQ3A 3C1VA 2BCXA 2M49B 3RLZA 2Y5IA 2OS8C 1BR1B 4QJ3B 2F8PA 1TIZA 2KDHA 2LHLA 2M7NA 4OR9B 5CSNA 3WHUB 1PK0D 2Y4QA 3AKAA 4I5KA 3VROA 1BF5A 1K95A 1PVBA 1RWYA 3FWCA 2NXQA 2K61A 3LK0A 4OV2A 3VRQA 3K21A 1UWOA 2KI4C 1XFVO 2H61A 4ICBA 1FI6A 3DVEA 1S6JA 1YVLA 1NPQA 1DJIA 4ETOA 1MHOA 2LHIA 1CFFA 4YGDB 1DGUA 5D7FA 1SPYA 1DTLA 1F8HA 1PSRA 1PULA 1TOPA 1WLMA 4GNKB 4NDCA 4PHJA 1OE9B 3ZWHA 4GUKA 1E8AA 2JQ6A 4YGCB 1WY9A 2MLFC 3PN7C 1Y0VH 4ZCVA 1JF2A 2K7BA 4XYNA 1XFZO 5CSFA 3TDIA 4GFTA 3EVUA 3IF7A 1JFJA 2FCEA 3PM8A 1S6CA 1IQ3A 1C7WA 3KPXA 2L5XB 3DF0B 2D8NA 1S6IA 2Y1NA 5CPVA 2PMYA 1TCOB 1FPWA 3EK7A 1EH2A 2M29A 3ICBA 1LVCD 3CR5X 5HKZA 1F55A 4N1FA 4QJ4B 2M1UA 1RJVA 2NLNA 1YUSA 4HSZA 3BUMB 2L50A 1CB1A 4AOMA 4AQIA 4YI8A 1AUIB 3TDZA 2E30A 1LXFC 2WOSA 1G4YR 1MF8B 2MHHA 1N65A 1AP4A 3EVRA 1SK6D 4I5LB 1A2XA 4CFRA 1SRAA 2LP3A 2L4IA 4E68A 1SCMC 1NYAA 2M1KB 1J1DA 2I7AA 2ZFDA 2Q4UA 3EK8A 1BJFA 2BBNA 4N5XA 2JXLA 5AERA 1AJ4A 2QPTA 4ORBB 1MUXA 4MEWA 1UHJA 5PALA 1K9PA 1CDLA 2LVVA 1JBAA 4OKHA 1CMFA 1NCZA 2WC8A 3TDUA 1QX2A 1QATA 1ZFSA 1F70A 1HT9A 2K7CA 2K0JA 2I94A 2KGBC 1CFCA 1TTXA 1KK8B 1WLZA 2WCEA 1F71A 2JU0A 3RM1A 4ZCUA 1DJGA 2H61C 5KTYA 1IKUA 2ZN8A 1NSHA 3I5FB 1BMOA 2CXJA 2BCAA 2KFHA 3EKHA 1ODBA 1S1EA 4YBHB 1A29A 2O5GA 1BU3A 1V1FA 4M2PA 1WDCC 2KFGA 3VRPA 1M63B 2JC2A 3DF0A 1M39A 2MRDA 2OTGB 1KQMB 1DF0A 2HQWA 1F4QA 1CFPA 1XFWO 3OB2B 1CTRA 4P5OE 5D69A 2LMTA 3AAKA 1F54A 3AAJA 4MBEA 1A75A 4PE7A 1JSAA 1K96A 5I2OA 5HLVA 3O2PA 1CM4A 2BECA 1NP8A 1QIWA 3TUYC 1RROA 2KAXA 3CTNA 1KWOC 2LCPA 3IQOA 1IWQA 1TNWA 3KHEA 2KBIA 3CS1A 1RK9A 1XK4A 4BY5A 4MLWA 2KYCA 3FWBA 4PHKA 1XYDA 5DKRA 2WORA 1UURA 4MSPA 4I5JA 1QLSA 2M8UA 4C0LA 2TN4A 4D1EA 1K2HA 1CDPA 1S26D 3OHMB 1ALVA 1K93D 2K8MB 2LLTA 1TCFA 1GQMA 2KYFA 3LLEA 4YGAA 4CLNA 1CLLA 1UHNA 2FCDA 3EVVA 3GK1A 2LVIA 1LKJA 3OX6A 4FQOA 5JJGA 5BPJA 1QTXA 2LUXA 1YX7A 2WCFA 1IQ5A 3JTDC 4OVNF 1NWDA 2KQYA 3PLFB 1WRKA 4WQ2A 2F3YA 3SIAA 1ALWA 1NCYA 3SG7A 2QACA 4DUQA 1QX5B 1YURA 1TNXA 2GV5A 2P6BB 1DMOA 2KI4B 3JVTB 1EJ3A 2RGIA 1NX0A 3O4YA 1OZOA 5HLOA 4ORAB 1B8CA 1DJYA 1G8IA 1N2DA 1NCXA 1W7IB 2DOQA 2LC5A 1J7PA 4Q04A 3CR4X 1B8RA 1CFDA 1TNQA 1B8LA 1A4PA 1SMGA 3DVMA 1SBJA 4IL1A 1A03A 1K9UA 1DJWA 3M0WA 2L0PA 1B9AA 4PHMA 1BOCA 2ZKMX 2FOTA 1CLBA 1XFYO 3CGAA 2L2EA 2ZNEA 1DVIA 1KFXL 2CT9A 2R2IA 5AEQA 1Q80A 2MLEC 1JUOA 2Y1MA 1UHKA 2CBLA 1AK8A 1EXRA 1OQPA 3LK1A 4DCKA 4M2OA 1J1EA 2MA2A 2HPSA 1BODA 1L7ZA 3A4UB 4M2QA 1BG1A 3I5HB 1BLQA 5KU1A 1FF1A 1PALA 1HQVA 1SL8A 1AJ5A 1YUTA 2L4HA 3BXKA 4FTGA 1SR6B 2E6WA 5CSJA 1WRZA 3F45A 1D1OA 3BUNB 1XK4C 1M31A 2M3WA 2I18A 3NSOA 2KNEA 2VRGA 2WNDA 2LUCA 4MZKA 1CMGA 1FI5A 1KQVA 4TNCA 1SKTA 1QASA 1UHIA 1IG5A 1DJZA 4DRWA 2F3ZA 2KOTA 1SCMB 1K90D 2OPOA 5CSIA 1PSBA 2MJWB 3CZTX 4MRYA 1K8UA 1UP5A 4CIDA 3BOWB 1QV1A 3NSKA 2JRFA 1ZMZA 1LA3A 4JPZB 3TS5B 1CDMA 1PRWA 1KK8C 1L2OB 2ZRTA 5DKNA 3AKBA 4PDZA 3OB1B 2M97A 3DVJA 3SG2A 3BUOB 3I5IB 2LLUA 5KSZA 1ZACA 4CPVA 3TZ1A 1S3PA 1IJ6A 1Y1XA 3VRNA 1SY9A 2I2RE 1RTP1 3CLNA 1M45A 2EC6C 2BCBA 2PVBA 5B8IB 2F2OA 2KAVA 2LLSA 4GGFA 3VRRA 1GGWA 2LM5A 5AXIA 2K7DA 1TN4A 3SG3A 5AFPA 2JTTA 1H4BA 2CCMA 2JNFA 4GBAA 4ORCB 2JNXA 5ER5A 1DJXA 3SG6A 1JF0A 1WDCB 1KSMA 1SL7A 1NUBA 1S36A 1SNLA 3E3RA 1IGVA 2BE4A 1OMRA 3CWGA 3CR2A 4XJKB 2LMUA 3I5GC 5HKWA 4A4BA 1YR5A 1RECA 4HRHA 1AHRA 1DJHA 4GAOA 5TNCA 4MN0A 1Y6WA 2HF5A 4I5NB 4DIRA 1YRUB 5I2QA 4YI9A 1KWOB 2KI6D 1KFUL 4YGEB 4NDDA 1DT7B 2MAZA 4R1EA 5AANA 1YX8A 2JPTA 1QJTA 1JWDA 3D10A 2WCBA 1CM1A 2B1UA 2BL0B 2G9BA 1Y1AA 4QJ5B 1CLMA 1B1GA 2M0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HX4 A;  4MZJ A;  2F33 A;  2OS8 B;  3SG4 A;  1KFU S;  2F2P A;  4F0Z B;  1OMD A;  3GK2 A;  4PCW A;  3ZNI A;  2JT0 A;  2PAS A;  3DVK A;  2JTZ A;  1FBV A;  2L51 A;  2LAN A;  1EL4 A;  1NX2 A;  1OSA A;  3FS7 A;  1R2U A;  3OX5 A;  3SG5 A;  3JTD B;  4NDB A;  1BR4 B;  1DGV A;  2K2A A;  3JVT C;  3H4S E;  2NCO A;  3KF9 A;  3O78 A;  4CFQ A;  2NZ0 A;  1SL9 A;  1KSO A;  3HCM A;  4MVF A;  1CKK A;  1OMV A;  1IH0 A;  2BE6 A;  2JZI A;  3O6B A;  4JQ0 D;  4MRX A;  4N1G A;  4DS7 A;  1B4C A;  2EHB A;  2GGM A;  1XA5 A;  3PSR A;  1EG3 A;  1NX1 A;  1QV0 A;  3BUW B;  2V53 A;  2EGD A;  1YVH A;  3PN7 B;  2IS9 A;  1CNP A;  4UPG A;  2FJU B;  1C7V A;  1J7Q A;  4OCI A;  2M9G A;  4XJK A;  2ISD A;  4HRE E;  4MZL A;  4U8D A;  4GGF C;  1QIV A;  2JWW A;  3PFV A;  2AUC A;  2LNK A;  2ZRS A;  2LVK A;  2L98 A;  1NX3 A;  2KI6 C;  5IBW A;  1W7J B;  1GJY A;  1XVJ A;  2A4J A;  2CTN A;  3KEV A;  1GGZ A;  2AAO A;  1Y1U A;  1YRT B;  3LL8 B;  4GGN A;  5HKY A;  3EK4 A;  4HRG A;  1U5I B;  1B7T Z;  1DF0 B;  3PAL A;  2G2B A;  1NIW A;  4PE4 A;  2JXC A;  1SYM A;  1KFX S;  1MXL C;  3VGO A;  1A75 B;  5F6T A;  1EG4 A;  3I5H C;  1XO5 A;  3WNX B;  4NQG A;  1CDN A;  1B7T Y;  1R6P A;  4USL A;  3NXA A;  4YGB B;  4P2Y B;  1SR6 C;  2ZND A;  3PAT A;  5HYD A;  1ZUZ A;  3GK4 X;  1QVI Z;  5I8N A;  3OP0 A;  4L9M A;  1KK7 Z;  2LE9 B;  3IQQ A;  1OOJ A;  4PE1 A;  1FW4 A;  2PAL A;  1K9K A;  4GPL B;  3BUX B;  1B47 A;  2KAY A;  4AQJ A;  1QVI Y;  4C0K A;  1UUS A;  1JFK A;  1KK7 Y;  2PSR A;  2BKH B;  1RFJ A;  1TNP A;  1LIN A;  1XFX O;  2ZN9 A;  3D0Y B;  2GGZ A;  2JT3 A;  3NSL A;  5FYX A;  5G08 A;  1QS7 A;  1KCY A;  5J3X A;  1QXP A;  2SAS A;  5DKQ A;  2Q91 A;  2JOJ A;  2LV7 A;  1J7O A;  5JOL A;  2HQ8 A;  3A8R A;  2LVJ A;  1OZS A;  2KBM A;  4WQ3 A;  3I5F C;  3TS5 C;  1AVS A;  1L2O C;  3BYA A;  3WHT B;  4JWQ A;  2KFF A;  1G33 A;  1TRF A;  3EKJ A;  3SJS A;  3I5I C;  1M46 A;  1MR8 A;  5ER4 X;  1IJ5 A;  2OTG C;  1KQM C;  1V1G A;  2KHN A;  2K7O A;  3QRX A;  4YRU A;  3SIB A;  1YTZ C;  2KSP A;  5GQQ C;  2JT8 A;  2EC6 B;  5I2L A;  1J7R A;  1F4O A;  2H2K A;  3MSE B;  2M7L A;  1N0Y A;  1U5I A;  3WXA A;  1SW8 A;  3GOF A;  1XFU O;  1C07 A;  4WRI A;  4A4C A;  3TUY B;  1H8B A;  2HET A;  2KQ6 A;  4PE0 A;  2BBM A;  1S5G Z;  5K89 A;  2LP2 A;  3DD4 A;  3LCP C;  1QLK A;  4C0J A;  3I5G B;  1YUU A;  2CNP A;  1WRL A;  2NCP A;  1SCV A;  2LMV A;  3NSI A;  4BY4 A;  1IRJ A;  2MBX A;  3KO0 A;  1K94 A;  4PHN A;  1JC2 A;  1MWN A;  1S5G Y;  2SCP A;  2LAP A;  1LA0 A;  2BKI B;  2K2F A;  2O60 A;  1QX7 A;  2KGR A;  1UHH A;  3BOW A;  1BT6 A;  4PAL A;  1X02 A;  3D0Y A;  3FIA A;  1PVA A;  1VRK A;  2BL0 C;  1J55 A;  1ZOT B;  1MXE A;  2COL B;  1MQ1 A;  2AMI A;  2JUL A;  2PRU A;  3BQ3 A;  3C1V A;  2BCX A;  2M49 B;  3RLZ A;  2Y5I A;  2OS8 C;  1BR1 B;  4QJ3 B;  2F8P A;  1TIZ A;  2KDH A;  2LHL A;  2M7N A;  4OR9 B;  5CSN A;  3WHU B;  1PK0 D;  2Y4Q A;  3AKA A;  4I5K A;  3VRO A;  1BF5 A;  1K95 A;  1PVB A;  1RWY A;  3FWC A;  2NXQ A;  2K61 A;  3LK0 A;  4OV2 A;  3VRQ A;  3K21 A;  1UWO A;  2KI4 C;  1XFV O;  2H61 A;  4ICB A;  1FI6 A;  3DVE A;  1S6J A;  1YVL A;  1NPQ A;  1DJI A;  4ETO A;  1MHO A;  2LHI A;  1CFF A;  4YGD B;  1DGU A;  5D7F A;  1SPY A;  1DTL A;  1F8H A;  1PSR A;  1PUL A;  1TOP A;  1WLM A;  4GNK B;  4NDC A;  4PHJ A;  1OE9 B;  3ZWH A;  4GUK A;  1E8A A;  2JQ6 A;  4YGC B;  1WY9 A;  2MLF C;  3PN7 C;  1Y0V H;  4ZCV A;  1JF2 A;  2K7B A;  4XYN A;  1XFZ O;  5CSF A;  3TDI A;  4GFT A;  3EVU A;  3IF7 A;  1JFJ A;  2FCE A;  3PM8 A;  1S6C A;  1IQ3 A;  1C7W A;  3KPX A;  2L5X B;  3DF0 B;  2D8N A;  1S6I A;  2Y1N A;  5CPV A;  2PMY A;  1TCO B;  1FPW A;  3EK7 A;  1EH2 A;  2M29 A;  3ICB A;  1LVC D;  3CR5 X;  5HKZ A;  1F55 A;  4N1F A;  4QJ4 B;  2M1U A;  1RJV A;  2NLN A;  1YUS A;  4HSZ A;  3BUM B;  2L50 A;  1CB1 A;  4AOM A;  4AQI A;  4YI8 A;  1AUI B;  3TDZ A;  2E30 A;  1LXF C;  2WOS A;  1G4Y R;  1MF8 B;  2MHH A;  1N65 A;  1AP4 A;  3EVR A;  1SK6 D;  4I5L B;  1A2X A;  4CFR A;  1SRA A;  2LP3 A;  2L4I A;  4E68 A;  1SCM C;  1NYA A;  2M1K B;  1J1D A;  2I7A A;  2ZFD A;  2Q4U A;  3EK8 A;  1BJF A;  2BBN A;  4N5X A;  2JXL A;  5AER A;  1AJ4 A;  2QPT A;  4ORB B;  1MUX A;  4MEW A;  1UHJ A;  5PAL A;  1K9P A;  1CDL A;  2LVV A;  1JBA A;  4OKH A;  1CMF A;  1NCZ A;  2WC8 A;  3TDU A;  1QX2 A;  1QAT A;  1ZFS A;  1F70 A;  1HT9 A;  2K7C A;  2K0J A;  2I94 A;  2KGB C;  1CFC A;  1TTX A;  1KK8 B;  1WLZ A;  2WCE A;  1F71 A;  2JU0 A;  3RM1 A;  4ZCU A;  1DJG A;  2H61 C;  5KTY A;  1IKU A;  2ZN8 A;  1NSH A;  3I5F B;  1BMO A;  2CXJ A;  2BCA A;  2KFH A;  3EKH A;  1ODB A;  1S1E A;  4YBH B;  1A29 A;  2O5G A;  1BU3 A;  1V1F A;  4M2P A;  1WDC C;  2KFG A;  3VRP A;  1M63 B;  2JC2 A;  3DF0 A;  1M39 A;  2MRD A;  2OTG B;  1KQM B;  1DF0 A;  2HQW A;  1F4Q A;  1CFP A;  1XFW O;  3OB2 B;  1CTR A;  4P5O E;  5D69 A;  2LMT A;  3AAK A;  1F54 A;  3AAJ A;  4MBE A;  1A75 A;  4PE7 A;  1JSA A;  1K96 A;  5I2O A;  5HLV A;  3O2P A;  1CM4 A;  2BEC A;  1NP8 A;  1QIW A;  3TUY C;  1RRO A;  2KAX A;  3CTN A;  1KWO C;  2LCP A;  3IQO A;  1IWQ A;  1TNW A;  3KHE A;  2KBI A;  3CS1 A;  1RK9 A;  1XK4 A;  4BY5 A;  4MLW A;  2KYC A;  3FWB A;  4PHK A;  1XYD A;  5DKR A;  2WOR A;  1UUR A;  4MSP A;  4I5J A;  1QLS A;  2M8U A;  4C0L A;  2TN4 A;  4D1E A;  1K2H A;  1CDP A;  1S26 D;  3OHM B;  1ALV A;  1K93 D;  2K8M B;  2LLT A;  1TCF A;  1GQM A;  2KYF A;  3LLE A;  4YGA A;  4CLN A;  1CLL A;  1UHN A;  2FCD A;  3EVV A;  3GK1 A;  2LVI A;  1LKJ A;  3OX6 A;  4FQO A;  5JJG A;  5BPJ A;  1QTX A;  2LUX A;  1YX7 A;  2WCF A;  1IQ5 A;  3JTD C;  4OVN F;  1NWD A;  2KQY A;  3PLF B;  1WRK A;  4WQ2 A;  2F3Y A;  3SIA A;  1ALW A;  1NCY A;  3SG7 A;  2QAC A;  4DUQ A;  1QX5 B;  1YUR A;  1TNX A;  2GV5 A;  2P6B B;  1DMO A;  2KI4 B;  3JVT B;  1EJ3 A;  2RGI A;  1NX0 A;  3O4Y A;  1OZO A;  5HLO A;  4ORA B;  1B8C A;  1DJY A;  1G8I A;  1N2D A;  1NCX A;  1W7I B;  2DOQ A;  2LC5 A;  1J7P A;  4Q04 A;  3CR4 X;  1B8R A;  1CFD A;  1TNQ A;  1B8L A;  1A4P A;  1SMG A;  3DVM A;  1SBJ A;  4IL1 A;  1A03 A;  1K9U A;  1DJW A;  3M0W A;  2L0P A;  1B9A A;  4PHM A;  1BOC A;  2ZKM X;  2FOT A;  1CLB A;  1XFY O;  3CGA A;  2L2E A;  2ZNE A;  1DVI A;  1KFX L;  2CT9 A;  2R2I A;  5AEQ A;  1Q80 A;  2MLE C;  1JUO A;  2Y1M A;  1UHK A;  2CBL A;  1AK8 A;  1EXR A;  1OQP A;  3LK1 A;  4DCK A;  4M2O A;  1J1E A;  2MA2 A;  2HPS A;  1BOD A;  1L7Z A;  3A4U B;  4M2Q A;  1BG1 A;  3I5H B;  1BLQ A;  5KU1 A;  1FF1 A;  1PAL A;  1HQV A;  1SL8 A;  1AJ5 A;  1YUT A;  2L4H A;  3BXK A;  4FTG A;  1SR6 B;  2E6W A;  5CSJ A;  1WRZ A;  3F45 A;  1D1O A;  3BUN B;  1XK4 C;  1M31 A;  2M3W A;  2I18 A;  3NSO A;  2KNE A;  2VRG A;  2WND A;  2LUC A;  4MZK A;  1CMG A;  1FI5 A;  1KQV A;  4TNC A;  1SKT A;  1QAS A;  1UHI A;  1IG5 A;  1DJZ A;  4DRW A;  2F3Z A;  2KOT A;  1SCM B;  1K90 D;  2OPO A;  5CSI A;  1PSB A;  2MJW B;  3CZT X;  4MRY A;  1K8U A;  1UP5 A;  4CID A;  3BOW B;  1QV1 A;  3NSK A;  2JRF A;  1ZMZ A;  1LA3 A;  4JPZ B;  3TS5 B;  1CDM A;  1PRW A;  1KK8 C;  1L2O B;  2ZRT A;  5DKN A;  3AKB A;  4PDZ A;  3OB1 B;  2M97 A;  3DVJ A;  3SG2 A;  3BUO B;  3I5I B;  2LLU A;  5KSZ A;  1ZAC A;  4CPV A;  3TZ1 A;  1S3P A;  1IJ6 A;  1Y1X A;  3VRN A;  1SY9 A;  2I2R E;  1RTP 1;  3CLN A;  1M45 A;  2EC6 C;  2BCB A;  2PVB A;  5B8I B;  2F2O A;  2KAV A;  2LLS A;  4GGF A;  3VRR A;  1GGW A;  2LM5 A;  5AXI A;  2K7D A;  1TN4 A;  3SG3 A;  5AFP A;  2JTT A;  1H4B A;  2CCM A;  2JNF A;  4GBA A;  4ORC B;  2JNX A;  5ER5 A;  1DJX A;  3SG6 A;  1JF0 A;  1WDC B;  1KSM A;  1SL7 A;  1NUB A;  1S36 A;  1SNL A;  3E3R A;  1IGV A;  2BE4 A;  1OMR A;  3CWG A;  3CR2 A;  4XJK B;  2LMU A;  3I5G C;  5HKW A;  4A4B A;  1YR5 A;  1REC A;  4HRH A;  1AHR A;  1DJH A;  4GAO A;  5TNC A;  4MN0 A;  1Y6W A;  2HF5 A;  4I5N B;  4DIR A;  1YRU B;  5I2Q A;  4YI9 A;  1KWO B;  2KI6 D;  1KFU L;  4YGE B;  4NDD A;  1DT7 B;  2MAZ A;  4R1E A;  5AAN A;  1YX8 A;  2JPT A;  1QJT A;  1JWD A;  3D10 A;  2WCB A;  1CM1 A;  2B1U A;  2BL0 B;  2G9B A;  1Y1A A;  4QJ5 B;  1CLM A;  1B1G A;  2M0R A; 
#chains in the Genus database with same CATH topology
 3HX4 A;  4MZJ A;  3UO9 A;  2F33 A;  2OS8 B;  3SG4 A;  3FE6 A;  1KFU S;  2F2P A;  4F0Z B;  1OMD A;  3GK2 A;  3D73 A;  4PCW A;  3D76 A;  3ZNI A;  2JT0 A;  2PAS A;  3DVK A;  2JTZ A;  1FBV A;  2L51 A;  2LAN A;  1EL4 A;  1NX2 A;  1OSA A;  3CDN A;  2QDI A;  1R2U A;  3FS7 A;  2BNX A;  3OX5 A;  1W9Z A;  3SG5 A;  3JTD B;  4NDB A;  1BR4 B;  1DGV A;  2K2A A;  3JVT C;  3H4S E;  2NCO A;  3KF9 A;  3DXL A;  1LS8 A;  3O78 A;  4CFQ A;  2NZ0 A;  1SL9 A;  1KSO A;  3HCM A;  4MVF A;  1CKK A;  1OMV A;  1IH0 A;  2BE6 A;  2JZI A;  3O6B A;  4JQ0 D;  4MRX A;  4N1G A;  4DS7 A;  1B4C A;  2EHB A;  2GGM A;  1XA5 A;  3PSR A;  1EG3 A;  1NX1 A;  1QV0 A;  3BUW B;  2V53 A;  2EGD A;  3DYE A;  1YVH A;  4JD9 A;  3PN7 B;  2IS9 A;  1CNP A;  4UPG A;  2FJU B;  1C7V A;  1J7Q A;  4OCI A;  2M9G A;  4XJK A;  2ISD A;  4HRE E;  4MZL A;  4U8D A;  3CYZ A;  4GGF C;  1QIV A;  2JWW A;  2K60 A;  3PFV A;  2AUC A;  2L2C A;  2LNK A;  2ZRS A;  2LVK A;  2L98 A;  3UNW A;  1NX3 A;  2KI6 C;  5IBW A;  1W7J B;  1GJY A;  1XVJ A;  2A4J A;  2CTN A;  3KEV A;  1GGZ A;  2AAO A;  3NHT A;  1Y1U A;  1YRT B;  3LL8 B;  4GGN A;  5HKY A;  3EK4 A;  5FI7 A;  4HRG A;  1U5I B;  1B7T Z;  1DF0 B;  2WCL A;  3PAL A;  2G2B A;  1NIW A;  4PE4 A;  2JXC A;  1SYM A;  1KFX S;  1MXL C;  3VGO A;  1A75 B;  5F6T A;  1EG4 A;  3I5H C;  1XO5 A;  3WNX B;  4NQG A;  1CDN A;  1B7T Y;  1R6P A;  2YGU A;  4USL A;  3NXA A;  3DZT A;  4YGB B;  4P2Y B;  1SR6 C;  2QEO A;  2ZND A;  3PAT A;  5HYD A;  1ZUZ A;  3GK4 X;  1QVI Z;  5I8N A;  3OP0 A;  4L9M A;  1KK7 Z;  2LE9 B;  3IQQ A;  1OOJ A;  4PE1 A;  1FW4 A;  1P28 A;  2GTE A;  2PAL A;  1K9K A;  4GPL B;  2ERB A;  3BUX B;  1B47 A;  2KAY A;  3R1V A;  5FI2 A;  3B86 A;  4AQJ A;  1QVI Y;  4C0K A;  1UUS A;  1JFK A;  1KK7 Y;  2PSR A;  1XFX O;  1RFJ A;  1TNP A;  1LIN A;  2BKH B;  2KLE A;  2ZN9 A;  2GGZ A;  2JT3 A;  3NSL A;  5FYX A;  5G08 A;  2JPO A;  1QS7 A;  1KCY A;  5J3X A;  1DC1 A;  1QXP A;  2SAS A;  3V2L A;  5DKQ A;  3CZ1 A;  2Q91 A;  2JOJ A;  2LV7 A;  1J7O A;  5JOL A;  2HQ8 A;  2H8V A;  2LVJ A;  3A8R A;  1OZS A;  3VB1 A;  2KBM A;  4WQ3 A;  1T14 A;  3I5F C;  3TS5 C;  1AVS A;  3D0Y B;  1L2O C;  3BYA A;  3WHT B;  3K1E A;  4JWQ A;  2KFF A;  1G33 A;  1TRF A;  3EKJ A;  3SJS A;  3I5I C;  1M46 A;  3NHI A;  1MR8 A;  4F7F A;  5ER4 X;  1IJ5 A;  2OTG C;  1OOF A;  1KQM C;  1V1G A;  2KHN A;  2K7O A;  3QRX A;  4YRU A;  3SIB A;  1YTZ C;  2KSP A;  3S0F A;  2L5Y A;  5GQQ C;  2JT8 A;  2EC6 B;  2QEV A;  3L47 A;  5I2L A;  1J7R A;  1F4O A;  2H2K A;  3MSE B;  2M7L A;  1DEK A;  1N0Y A;  1U5I A;  3WXA A;  1SW8 A;  3GOF A;  1XFU O;  1C07 A;  4WRI A;  4A4C A;  3TUY B;  1H8B A;  2HET A;  2KQ6 A;  4INX A;  4PE0 A;  2BBM A;  1S5G Z;  5K89 A;  2LP2 A;  3DD4 A;  3LCP C;  1QLK A;  4C0J A;  2P70 A;  3I5G B;  1YUU A;  2CNP A;  1WRL A;  2NCP A;  1SCV A;  2LMV A;  3NSI A;  4BY4 A;  1IRJ A;  2MBX A;  3KO0 A;  1K94 A;  4PHN A;  1JC2 A;  1MWN A;  1S5G Y;  2SCP A;  2LAP A;  1LA0 A;  3DY9 A;  2BKI B;  2K2F A;  2O60 A;  1QX7 A;  2KGR A;  1UHH A;  2WCM A;  3BOW A;  1BT6 A;  3IVT A;  4PAL A;  1X02 A;  3D0Y A;  3FIA A;  1PVA A;  2WCJ A;  1VRK A;  2BL0 C;  1J55 A;  4IJ7 A;  1ZOT B;  1MXE A;  2COL B;  1MQ1 A;  2AMI A;  2JUL A;  2PRU A;  3BQ3 A;  3C1V A;  2BCX A;  2M49 B;  3RLZ A;  3R72 A;  2Y5I A;  3SS3 A;  2OS8 C;  3EG5 B;  1BR1 B;  4QJ3 B;  2F8P A;  1TIZ A;  2KDH A;  2LHL A;  2M7N A;  4OR9 B;  5CSN A;  3WHU B;  1PK0 D;  2Y4Q A;  3AKA A;  3NGV A;  4I5K A;  3VRO A;  1BF5 A;  1K95 A;  1PVB A;  1RWY A;  3FWC A;  2NXQ A;  2K61 A;  3LK0 A;  4OV2 A;  3VRQ A;  3K21 A;  1UWO A;  2KI4 C;  3S0G A;  1XFV O;  2H61 A;  3CZ2 A;  4ICB A;  1FI6 A;  3DVE A;  1S6J A;  1YVL A;  1NPQ A;  1DJI A;  4ETO A;  1MHO A;  2LHI A;  1CFF A;  4YGD B;  1DGU A;  2BAP A;  5D7F A;  1SPY A;  1DTL A;  1F8H A;  1PSR A;  1PUL A;  1TOP A;  1OOG A;  1WLM A;  4GNK B;  4NDC A;  4PHJ A;  1DQE A;  1OE9 B;  3ZWH A;  4GUK A;  3L4L A;  1E8A A;  2JQ6 A;  3D78 A;  2WCK A;  4YGC B;  1WY9 A;  2MLF C;  3CZ0 A;  3PN7 C;  1Y0V H;  4ZCV A;  1JF2 A;  2K7B A;  4XYN A;  1XFZ O;  5CSF A;  3TDI A;  4GFT A;  1SSE B;  3EVU A;  3BJH A;  3IF7 A;  1JFJ A;  2FCE A;  3PM8 A;  1S6C A;  1IQ3 A;  1C7W A;  3KPX A;  2L5X B;  3DF0 B;  2D8N A;  3R1O A;  1S6I A;  2Y1N A;  5CPV A;  2PMY A;  1TCO B;  1FPW A;  3EK7 A;  1EH2 A;  2M29 A;  3ICB A;  1LVC D;  3S0A A;  3CR5 X;  5HKZ A;  1F55 A;  4N1F A;  4QJ4 B;  2M1U A;  1RJV A;  2NLN A;  3SS4 A;  1YUS A;  4HSZ A;  3BUM B;  2L50 A;  1CB1 A;  4AOM A;  4AQI A;  4YI8 A;  1AUI B;  3TDZ A;  2E30 A;  5D3O A;  1LXF C;  2WOS A;  1G4Y R;  1MF8 B;  2MHH A;  1N65 A;  1AP4 A;  3EVR A;  1SK6 D;  3B7A A;  2WC6 A;  1A2X A;  4I5L B;  1SRA A;  4CFR A;  2LP3 A;  2L4I A;  3Q8I A;  1SCM C;  3RZS A;  4E68 A;  1NYA A;  2KLD A;  1J1D A;  2M1K B;  2I7A A;  2ZFD A;  2Q4U A;  3OBV A;  3EK8 A;  1BJF A;  2BBN A;  4N5X A;  2JXL A;  5AER A;  1AJ4 A;  2QPT A;  4ORB B;  1MUX A;  4MEW A;  1UHJ A;  2QEB A;  5PAL A;  1K9P A;  3D77 A;  1CDL A;  2LVV A;  1JBA A;  1DEL A;  4OKH A;  1CMF A;  1NCZ A;  2KPH A;  2WC8 A;  3TDU A;  1QX2 A;  1QAT A;  1GM0 A;  1ZFS A;  1F70 A;  1HT9 A;  2K7C A;  3B87 A;  2K0J A;  2I94 A;  2KGB C;  1CFC A;  1TTX A;  1KK8 B;  1WLZ A;  3S0B A;  3D75 A;  2WCE A;  1F71 A;  2JU0 A;  3RM1 A;  4ZCU A;  1DJG A;  2H61 C;  5KTY A;  1IKU A;  2ZN8 A;  1NSH A;  3I5F B;  1BMO A;  2CXJ A;  2BCA A;  2KFH A;  3EKH A;  1ODB A;  1S1E A;  4YBH B;  1A29 A;  2QEH A;  2O5G A;  1BU3 A;  1V1F A;  4M2P A;  1WDC C;  2KFG A;  3VRP A;  1M63 B;  2JC2 A;  3DF0 A;  1M39 A;  2MRD A;  2OTG B;  3PJI A;  1KQM B;  1DF0 A;  2HQW A;  1F4Q A;  4INW A;  1XFW O;  3OB2 B;  1CTR A;  4P5O E;  5D69 A;  1CFP A;  2LMT A;  3AAK A;  5HL1 A;  1F54 A;  3AAJ A;  4MBE A;  1A75 A;  4PE7 A;  5FI6 A;  1JSA A;  4FQT A;  1K96 A;  5I2O A;  5HLV A;  3O2P A;  1CM4 A;  2BEC A;  1NP8 A;  1QIW A;  3TUY C;  1RRO A;  3PM2 A;  2KAX A;  3CTN A;  1KWO C;  2LCP A;  1TUZ A;  3IQO A;  1IWQ A;  1TNW A;  3KHE A;  2KBI A;  2WC5 A;  3CS1 A;  1RK9 A;  1XK4 A;  3BFB A;  4BY5 A;  4MLW A;  2KYC A;  3FWB A;  4PHK A;  1XYD A;  5DKR A;  2WOR A;  1UUR A;  2FJY A;  4I5J A;  4MSP A;  1QLS A;  1OW4 A;  2M8U A;  4C0L A;  2TN4 A;  4D1E A;  1K2H A;  1CDP A;  1S26 D;  3OHM B;  1ALV A;  1K93 D;  2K8M B;  2LLT A;  1TCF A;  1GQM A;  2KYF A;  3FE8 A;  3LLE A;  4YGA A;  4CLN A;  1CLL A;  1UHN A;  2FCD A;  4KYN A;  3EVV A;  3GK1 A;  1C3Z A;  2LVI A;  1LKJ A;  3OX6 A;  4FQO A;  5JJG A;  5BPJ A;  1QTX A;  2LUX A;  1YX7 A;  2WCF A;  1IQ5 A;  3JTD C;  4OVN F;  1NWD A;  2KQY A;  3PLF B;  1WRK A;  4JKT A;  2F3Y A;  4WQ2 A;  3SIA A;  1ALW A;  1NCY A;  3SG7 A;  2QAC A;  4DUQ A;  1Z4H A;  1QX5 B;  1YUR A;  1TNX A;  2GV5 A;  2P6B B;  3D74 A;  1DMO A;  2KI4 B;  3JVT B;  1EJ3 A;  3N7H A;  2RGI A;  1NX0 A;  3O4Y A;  1OZO A;  5HLO A;  4ORA B;  1B8C A;  3S0D A;  1DJY A;  1G8I A;  1N2D A;  1NCX A;  1W7I B;  2DOQ A;  2LC5 A;  1J7P A;  1XFR A;  1OOI X;  4Q04 A;  3CR4 X;  3L4A A;  1B8R A;  1CFD A;  1TNQ A;  1B8L A;  1A4P A;  1SMG A;  3DVM A;  1SBJ A;  4IL1 A;  1A03 A;  1K9U A;  1DJW A;  3M0W A;  2L0P A;  2PQL A;  1B9A A;  4PHM A;  1BOC A;  3BFA A;  2ZKM X;  2FOT A;  1CLB A;  1XFY O;  3B6X A;  3CGA A;  2L2E A;  2ZNE A;  1DVI A;  1KFX L;  2CT9 A;  2R2I A;  5AEQ A;  1Q80 A;  2MLE C;  1JUO A;  2Y1M A;  1UHK A;  2CBL A;  1AK8 A;  1EXR A;  1OQP A;  3LK1 A;  4DCK A;  4M2O A;  1J1E A;  2MA2 A;  2HPS A;  1BOD A;  1L7Z A;  3A4U B;  4M2Q A;  1BG1 A;  3I5H B;  4PT1 A;  1BLQ A;  5KU1 A;  1FF1 A;  1PAL A;  1HQV A;  1SL8 A;  1AJ5 A;  1YUT A;  2L4H A;  3BXK A;  4FTG A;  1SR6 B;  2E6W A;  5CSJ A;  1WRZ A;  1QWV A;  3F45 A;  3BUN B;  1XK4 C;  3R1P A;  1D1O A;  1M31 A;  2M3W A;  2I18 A;  3NSO A;  2KNE A;  2VRG A;  2WND A;  2LUC A;  4MZK A;  1CMG A;  3CAB A;  1FI5 A;  1KQV A;  4TNC A;  1SKT A;  1QAS A;  1UHI A;  1IG5 A;  1DJZ A;  2P71 A;  4DRW A;  2F3Z A;  2KOT A;  1SCM B;  1K90 D;  2OPO A;  5CSI A;  1IIO A;  1PSB A;  3QME A;  2MJW B;  3CZT X;  4MRY A;  1K8U A;  1UP5 A;  4CID A;  3BOW B;  1QV1 A;  3NSK A;  2JRF A;  1ZMZ A;  1LA3 A;  4JPZ B;  3TS5 B;  1CDM A;  1PRW A;  1KK8 C;  1L2O B;  2ZRT A;  5DKN A;  3AKB A;  4PDZ A;  3OB1 B;  2M97 A;  3B88 A;  3DVJ A;  3SG2 A;  3BUO B;  3I5I B;  2LLU A;  1Z2C B;  5KSZ A;  1ZAC A;  4CPV A;  3TZ1 A;  1S3P A;  1IJ6 A;  1Y1X A;  3VRN A;  1SY9 A;  2I2R E;  1RTP 1;  3CLN A;  1M45 A;  2EC6 C;  2BCB A;  2PVB A;  5DIC A;  1TUJ A;  5B8I B;  2F2O A;  2KAV A;  4OZD A;  2LLS A;  4GGF A;  3VRR A;  1GGW A;  2LM5 A;  3S0E A;  5AXI A;  2K7D A;  1TN4 A;  1TWO A;  3O4X A;  3SG3 A;  2JTT A;  5AFP A;  2WCH A;  1H4B A;  2CCM A;  2JNF A;  4GBA A;  4ORC B;  2JNX A;  5ER5 A;  1DJX A;  3SG6 A;  1JF0 A;  1WDC B;  1KSM A;  1SL7 A;  1NUB A;  1S36 A;  1SNL A;  3E3R A;  1IGV A;  5EL2 A;  2BE4 A;  1C3Y A;  1OMR A;  3CWG A;  3CR2 A;  4XJK B;  2LMU A;  3I5G C;  5HKW A;  4A4B A;  1YR5 A;  1REC A;  4HRH A;  3FE9 A;  1AHR A;  1DJH A;  4GAO A;  5TNC A;  3SS5 A;  4MN0 A;  1Y6W A;  2HF5 A;  4I5N B;  5I94 A;  4DIR A;  1YRU B;  5I2Q A;  4YI9 A;  2PYQ A;  1ORG A;  1KWO B;  2KI6 D;  1KFU L;  4YGE B;  4NDD A;  1DT7 B;  2MAZ A;  4R1E A;  5AAN A;  1YX8 A;  3BFH A;  2JPT A;  1QJT A;  1JWD A;  3D10 A;  2WCB A;  1CM1 A;  2B1U A;  2BL0 B;  2G9B A;  3OGN A;  1Y1A A;  4QJ5 B;  1CLM A;  1B1G A;  1OOH A;  2M0R A; 
#chains in the Genus database with same CATH homology
 3HX4 A;  4MZJ A;  2F33 A;  2OS8 B;  3SG4 A;  1KFU S;  2F2P A;  4F0Z B;  1OMD A;  3GK2 A;  4PCW A;  3ZNI A;  2JT0 A;  2PAS A;  3DVK A;  2JTZ A;  1FBV A;  2L51 A;  2LAN A;  1EL4 A;  1NX2 A;  1OSA A;  3FS7 A;  1R2U A;  3OX5 A;  3SG5 A;  3JTD B;  4NDB A;  1BR4 B;  1DGV A;  2K2A A;  3JVT C;  3H4S E;  2NCO A;  3KF9 A;  3O78 A;  4CFQ A;  2NZ0 A;  1SL9 A;  1KSO A;  3HCM A;  4MVF A;  1CKK A;  1OMV A;  1IH0 A;  2BE6 A;  2JZI A;  3O6B A;  4JQ0 D;  4MRX A;  4N1G A;  4DS7 A;  1B4C A;  2EHB A;  2GGM A;  1XA5 A;  3PSR A;  1EG3 A;  1NX1 A;  1QV0 A;  3BUW B;  2V53 A;  2EGD A;  1YVH A;  3PN7 B;  2IS9 A;  1CNP A;  4UPG A;  2FJU B;  1C7V A;  1J7Q A;  4OCI A;  2M9G A;  4XJK A;  2ISD A;  4HRE E;  4MZL A;  4U8D A;  4GGF C;  1QIV A;  2JWW A;  3PFV A;  2AUC A;  2LNK A;  2ZRS A;  2LVK A;  2L98 A;  1NX3 A;  2KI6 C;  5IBW A;  1W7J B;  1GJY A;  1XVJ A;  2A4J A;  2CTN A;  3KEV A;  1GGZ A;  2AAO A;  1Y1U A;  1YRT B;  3LL8 B;  4GGN A;  5HKY A;  3EK4 A;  4HRG A;  1U5I B;  1B7T Z;  1DF0 B;  3PAL A;  2G2B A;  1NIW A;  4PE4 A;  2JXC A;  1SYM A;  1KFX S;  1MXL C;  3VGO A;  1A75 B;  5F6T A;  1EG4 A;  3I5H C;  1XO5 A;  3WNX B;  4NQG A;  1CDN A;  1B7T Y;  1R6P A;  4USL A;  3NXA A;  4YGB B;  4P2Y B;  1SR6 C;  2ZND A;  3PAT A;  5HYD A;  1ZUZ A;  3GK4 X;  1QVI Z;  5I8N A;  3OP0 A;  4L9M A;  1KK7 Z;  2LE9 B;  3IQQ A;  1OOJ A;  4PE1 A;  1FW4 A;  2PAL A;  1K9K A;  4GPL B;  3BUX B;  1B47 A;  2KAY A;  4AQJ A;  1QVI Y;  4C0K A;  1UUS A;  1JFK A;  1KK7 Y;  2PSR A;  2BKH B;  1RFJ A;  1TNP A;  1LIN A;  1XFX O;  2ZN9 A;  3D0Y B;  2GGZ A;  2JT3 A;  3NSL A;  5FYX A;  5G08 A;  1QS7 A;  1KCY A;  5J3X A;  1QXP A;  2SAS A;  5DKQ A;  2Q91 A;  2JOJ A;  2LV7 A;  1J7O A;  5JOL A;  2HQ8 A;  3A8R A;  2LVJ A;  1OZS A;  2KBM A;  4WQ3 A;  3I5F C;  3TS5 C;  1AVS A;  1L2O C;  3BYA A;  3WHT B;  4JWQ A;  2KFF A;  1G33 A;  1TRF A;  3EKJ A;  3SJS A;  3I5I C;  1M46 A;  1MR8 A;  5ER4 X;  1IJ5 A;  2OTG C;  1KQM C;  1V1G A;  2KHN A;  2K7O A;  3QRX A;  4YRU A;  3SIB A;  1YTZ C;  2KSP A;  5GQQ C;  2JT8 A;  2EC6 B;  5I2L A;  1J7R A;  1F4O A;  2H2K A;  3MSE B;  2M7L A;  1N0Y A;  1U5I A;  3WXA A;  1SW8 A;  3GOF A;  1XFU O;  1C07 A;  4WRI A;  4A4C A;  3TUY B;  1H8B A;  2HET A;  2KQ6 A;  4PE0 A;  2BBM A;  1S5G Z;  5K89 A;  2LP2 A;  3DD4 A;  3LCP C;  1QLK A;  4C0J A;  3I5G B;  1YUU A;  2CNP A;  1WRL A;  2NCP A;  1SCV A;  2LMV A;  3NSI A;  4BY4 A;  1IRJ A;  2MBX A;  3KO0 A;  1K94 A;  4PHN A;  1JC2 A;  1MWN A;  1S5G Y;  2SCP A;  2LAP A;  1LA0 A;  2BKI B;  2K2F A;  2O60 A;  1QX7 A;  2KGR A;  1UHH A;  3BOW A;  1BT6 A;  4PAL A;  1X02 A;  3D0Y A;  3FIA A;  1PVA A;  1VRK A;  2BL0 C;  1J55 A;  1ZOT B;  1MXE A;  2COL B;  1MQ1 A;  2AMI A;  2JUL A;  2PRU A;  3BQ3 A;  3C1V A;  2BCX A;  2M49 B;  3RLZ A;  2Y5I A;  2OS8 C;  1BR1 B;  4QJ3 B;  2F8P A;  1TIZ A;  2KDH A;  2LHL A;  2M7N A;  4OR9 B;  5CSN A;  3WHU B;  1PK0 D;  2Y4Q A;  3AKA A;  4I5K A;  3VRO A;  1BF5 A;  1K95 A;  1PVB A;  1RWY A;  3FWC A;  2NXQ A;  2K61 A;  3LK0 A;  4OV2 A;  3VRQ A;  3K21 A;  1UWO A;  2KI4 C;  1XFV O;  2H61 A;  4ICB A;  1FI6 A;  3DVE A;  1S6J A;  1YVL A;  1NPQ A;  1DJI A;  4ETO A;  1MHO A;  2LHI A;  1CFF A;  4YGD B;  1DGU A;  5D7F A;  1SPY A;  1DTL A;  1F8H A;  1PSR A;  1PUL A;  1TOP A;  1WLM A;  4GNK B;  4NDC A;  4PHJ A;  1OE9 B;  3ZWH A;  4GUK A;  1E8A A;  2JQ6 A;  4YGC B;  1WY9 A;  2MLF C;  3PN7 C;  1Y0V H;  4ZCV A;  1JF2 A;  2K7B A;  4XYN A;  1XFZ O;  5CSF A;  3TDI A;  4GFT A;  3EVU A;  3IF7 A;  1JFJ A;  2FCE A;  3PM8 A;  1S6C A;  1IQ3 A;  1C7W A;  3KPX A;  2L5X B;  3DF0 B;  2D8N A;  1S6I A;  2Y1N A;  5CPV A;  2PMY A;  1TCO B;  1FPW A;  3EK7 A;  1EH2 A;  2M29 A;  3ICB A;  1LVC D;  3CR5 X;  5HKZ A;  1F55 A;  4N1F A;  4QJ4 B;  2M1U A;  1RJV A;  2NLN A;  1YUS A;  4HSZ A;  3BUM B;  2L50 A;  1CB1 A;  4AOM A;  4AQI A;  4YI8 A;  1AUI B;  3TDZ A;  2E30 A;  1LXF C;  2WOS A;  1G4Y R;  1MF8 B;  2MHH A;  1N65 A;  1AP4 A;  3EVR A;  1SK6 D;  4I5L B;  1A2X A;  4CFR A;  1SRA A;  2LP3 A;  2L4I A;  4E68 A;  1SCM C;  1NYA A;  2M1K B;  1J1D A;  2I7A A;  2ZFD A;  2Q4U A;  3EK8 A;  1BJF A;  2BBN A;  4N5X A;  2JXL A;  5AER A;  1AJ4 A;  2QPT A;  4ORB B;  1MUX A;  4MEW A;  1UHJ A;  5PAL A;  1K9P A;  1CDL A;  2LVV A;  1JBA A;  4OKH A;  1CMF A;  1NCZ A;  2WC8 A;  3TDU A;  1QX2 A;  1QAT A;  1ZFS A;  1F70 A;  1HT9 A;  2K7C A;  2K0J A;  2I94 A;  2KGB C;  1CFC A;  1TTX A;  1KK8 B;  1WLZ A;  2WCE A;  1F71 A;  2JU0 A;  3RM1 A;  4ZCU A;  1DJG A;  2H61 C;  5KTY A;  1IKU A;  2ZN8 A;  1NSH A;  3I5F B;  1BMO A;  2CXJ A;  2BCA A;  2KFH A;  3EKH A;  1ODB A;  1S1E A;  4YBH B;  1A29 A;  2O5G A;  1BU3 A;  1V1F A;  4M2P A;  1WDC C;  2KFG A;  3VRP A;  1M63 B;  2JC2 A;  3DF0 A;  1M39 A;  2MRD A;  2OTG B;  1KQM B;  1DF0 A;  2HQW A;  1F4Q A;  1CFP A;  1XFW O;  3OB2 B;  1CTR A;  4P5O E;  5D69 A;  2LMT A;  3AAK A;  1F54 A;  3AAJ A;  4MBE A;  1A75 A;  4PE7 A;  1JSA A;  1K96 A;  5I2O A;  5HLV A;  3O2P A;  1CM4 A;  2BEC A;  1NP8 A;  1QIW A;  3TUY C;  1RRO A;  2KAX A;  3CTN A;  1KWO C;  2LCP A;  3IQO A;  1IWQ A;  1TNW A;  3KHE A;  2KBI A;  3CS1 A;  1RK9 A;  1XK4 A;  4BY5 A;  4MLW A;  2KYC A;  3FWB A;  4PHK A;  1XYD A;  5DKR A;  2WOR A;  1UUR A;  4MSP A;  4I5J A;  1QLS A;  2M8U A;  4C0L A;  2TN4 A;  4D1E A;  1K2H A;  1CDP A;  1S26 D;  3OHM B;  1ALV A;  1K93 D;  2K8M B;  2LLT A;  1TCF A;  1GQM A;  2KYF A;  3LLE A;  4YGA A;  4CLN A;  1CLL A;  1UHN A;  2FCD A;  3EVV A;  3GK1 A;  2LVI A;  1LKJ A;  3OX6 A;  4FQO A;  5JJG A;  5BPJ A;  1QTX A;  2LUX A;  1YX7 A;  2WCF A;  1IQ5 A;  3JTD C;  4OVN F;  1NWD A;  2KQY A;  3PLF B;  1WRK A;  4WQ2 A;  2F3Y A;  3SIA A;  1ALW A;  1NCY A;  3SG7 A;  2QAC A;  4DUQ A;  1QX5 B;  1YUR A;  1TNX A;  2GV5 A;  2P6B B;  1DMO A;  2KI4 B;  3JVT B;  1EJ3 A;  2RGI A;  1NX0 A;  3O4Y A;  1OZO A;  5HLO A;  4ORA B;  1B8C A;  1DJY A;  1G8I A;  1N2D A;  1NCX A;  1W7I B;  2DOQ A;  2LC5 A;  1J7P A;  4Q04 A;  3CR4 X;  1B8R A;  1CFD A;  1TNQ A;  1B8L A;  1A4P A;  1SMG A;  3DVM A;  1SBJ A;  4IL1 A;  1A03 A;  1K9U A;  1DJW A;  3M0W A;  2L0P A;  1B9A A;  4PHM A;  1BOC A;  2ZKM X;  2FOT A;  1CLB A;  1XFY O;  3CGA A;  2L2E A;  2ZNE A;  1DVI A;  1KFX L;  2CT9 A;  2R2I A;  5AEQ A;  1Q80 A;  2MLE C;  1JUO A;  2Y1M A;  1UHK A;  2CBL A;  1AK8 A;  1EXR A;  1OQP A;  3LK1 A;  4DCK A;  4M2O A;  1J1E A;  2MA2 A;  2HPS A;  1BOD A;  1L7Z A;  3A4U B;  4M2Q A;  1BG1 A;  3I5H B;  1BLQ A;  5KU1 A;  1FF1 A;  1PAL A;  1HQV A;  1SL8 A;  1AJ5 A;  1YUT A;  2L4H A;  3BXK A;  4FTG A;  1SR6 B;  2E6W A;  5CSJ A;  1WRZ A;  3F45 A;  1D1O A;  3BUN B;  1XK4 C;  1M31 A;  2M3W A;  2I18 A;  3NSO A;  2KNE A;  2VRG A;  2WND A;  2LUC A;  4MZK A;  1CMG A;  1FI5 A;  1KQV A;  4TNC A;  1SKT A;  1QAS A;  1UHI A;  1IG5 A;  1DJZ A;  4DRW A;  2F3Z A;  2KOT A;  1SCM B;  1K90 D;  2OPO A;  5CSI A;  1PSB A;  2MJW B;  3CZT X;  4MRY A;  1K8U A;  1UP5 A;  4CID A;  3BOW B;  1QV1 A;  3NSK A;  2JRF A;  1ZMZ A;  1LA3 A;  4JPZ B;  3TS5 B;  1CDM A;  1PRW A;  1KK8 C;  1L2O B;  2ZRT A;  5DKN A;  3AKB A;  4PDZ A;  3OB1 B;  2M97 A;  3DVJ A;  3SG2 A;  3BUO B;  3I5I B;  2LLU A;  5KSZ A;  1ZAC A;  4CPV A;  3TZ1 A;  1S3P A;  1IJ6 A;  1Y1X A;  3VRN A;  1SY9 A;  2I2R E;  1RTP 1;  3CLN A;  1M45 A;  2EC6 C;  2BCB A;  2PVB A;  5B8I B;  2F2O A;  2KAV A;  2LLS A;  4GGF A;  3VRR A;  1GGW A;  2LM5 A;  5AXI A;  2K7D A;  1TN4 A;  3SG3 A;  5AFP A;  2JTT A;  1H4B A;  2CCM A;  2JNF A;  4GBA A;  4ORC B;  2JNX A;  5ER5 A;  1DJX A;  3SG6 A;  1JF0 A;  1WDC B;  1KSM A;  1SL7 A;  1NUB A;  1S36 A;  1SNL A;  3E3R A;  1IGV A;  2BE4 A;  1OMR A;  3CWG A;  3CR2 A;  4XJK B;  2LMU A;  3I5G C;  5HKW A;  4A4B A;  1YR5 A;  1REC A;  4HRH A;  1AHR A;  1DJH A;  4GAO A;  5TNC A;  4MN0 A;  1Y6W A;  2HF5 A;  4I5N B;  4DIR A;  1YRU B;  5I2Q A;  4YI9 A;  1KWO B;  2KI6 D;  1KFU L;  4YGE B;  4NDD A;  1DT7 B;  2MAZ A;  4R1E A;  5AAN A;  1YX8 A;  2JPT A;  1QJT A;  1JWD A;  3D10 A;  2WCB A;  1CM1 A;  2B1U A;  2BL0 B;  2G9B A;  1Y1A A;  4QJ5 B;  1CLM A;  1B1G A;  2M0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...