5I2OA

Structure of ef-hand containing protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
102
Chain Sequence
FNPYTEFKEFSRKQIKDMEKMFKQYDDGFIDLMALKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EF-hand domain-containing protein D2
publication title Structural implications of Ca(2+)-dependent actin-bundling function of human EFhd2/Swiprosin-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 30
structure length 102
sequence length 105
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5i2oA00
1BMOA 4MRYA 1DGVA 2LE9B 3PFVA 3BUMB 3PATA 2D8NA 2GV5A 2JT8A 1BF5A 3C1VA 4M2OA 2LV7A 1HT9A 1RJVA 3GK4X 5HYDA 3TZ1A 1S26D 1DMOA 1CDNA 1OQPA 3LCPC 1NX1A 2H61C 1G4YR 4GNKB 1QTXA 1J7OA 5TNCA 1KK7Y 3BOWA 2NZ0A 1OSAA 1FPWA 5BPJA 2Q4UA 1KQMB 3KF9A 1HQVA 1OMDA 4CLNA 1KK8B 1DVIA 2JT3A 3BYAA 3I5GC 1QIWA 3PN7B 1KFXS 2B1UA 1B8LA 1MXEA 2AUCA 1EG4A 3IQOA 2I7AA 1XFUO 1S6JA 2BL0C 1B7TY 2K8MB 1G33A 1SR6B 2ZKMX 2OPOA 1DF0A 2KAVA 1J55A 1TTXA 2M0RA 1DJXA 2ZN9A 1ZUZA 2ZNEA 2ZRTA 4ICBA 1Q80A 2KYCA 2Y1NA 2KFGA 1YRTB 1XK4C 1B47A 1QATA 5I2LA 1CM4A 2JXCA 1SCMB 1JFKA 2E6WA 5HKWA 2L2EA 3I5IC 4C0JA 1QVIY 1SYMA 1SW8A 4C0LA 1SKTA 2BCXA 1MXLC 1NCZA 1UP5A 1WRLA 2CCMA 4YBHB 4MBEA 1WDCB 3AKAA 1M39A 2LVIA 2SCPA 2TN4A 5KU1A 4I5LB 1GGZA 1AJ5A 1NX3A 1J7RA 5D7FA 3MSEB 3PLFB 4YI9A 1OMVA 2KI4B 4PHKA 1YUSA 1Y1AA 3D10A 2L98A 5JOLA 1PALA 3EK7A 4GUKA 2I18A 3GOFA 1F4QA 2KI6C 1UWOA 1GJYA 2LNKA 1YVLA 3AKBA 1BJFA 1J7QA 1CDMA 3OX5A 1QJTA 1DJIA 1XYDA 4NDDA 4AQIA 2BECA 2FCDA 2KOTA 2EC6C 4FQOA 1JF0A 1MHOA 4YGAA 1IKUA 1CKKA 1A29A 1WLMA 4XYNA 1XVJA 1SL9A 1EG3A 2V53A 1PK0D 3OB2B 4P5OE 1IG5A 1WRKA 2M9GA 4F0ZB 1EXRA 3KO0A 1GQMA 1YRUB 3RLZA 1UHKA 2G2BA 2Y5IA 4ZCUA 1KCYA 1TRFA 1KFXL 2QACA 1UHHA 1XA5A 1L2OC 3EVUA 1S5GY 1LA0A 1YX8A 2OS8B 1F8HA 1PRWA 1F55A 3BUXB 1CLBA 4DCKA 3EVVA 1FBVA 1XFWO 3DF0B 3EKJA 3PSRA 1D1OA 3TDIA 3TUYB 1FI6A 3DVEA 2L4IA 1DJZA 2JNFA 3OHMB 2MHHA 1G8IA 4AOMA 1A75A 4DS7A 1NSHA 4HSZA 1SPYA 3VRRA 1QX5B 2LVVA 1K90D 3O4YA 4MZKA 4D1EA 2PASA 3LK1A 1OMRA 1LXFC 2JRFA 2KBIA 4IL1A 4MLWA 5AERA 1ZFSA 1S1EA 2F3ZA 1XFZO 4N5XA 3FWCA 1NUBA 2KYFA 4BY5A 5K89A 4PE1A 1IRJA 4MZLA 5DKNA 4NDCA 3FIAA 1B8CA 1IWQA 1L7ZA 2BKHB 3CS1A 1CLMA 4OKHA 3PALA 1E8AA 4YGBB 3SG3A 4PE0A 3ZNIA 1EH2A 4I5KA 3HX4A 2FCEA 2LANA 3NSIA 3PM8A 1K2HA 1KWOB 3SG2A 1ALWA 1RTP1 2RGIA 1CFDA 1QLKA 2CT9A 1LINA 1N0YA 2M8UA 5G08A 2KSPA 2M7NA 4NDBA 3LLEA 2KI6D 2EGDA 2M1UA 5HLVA 3EK8A 1DJWA 4CIDA 5I8NA 2JC2A 1OZOA 1NYAA 1TCFA 1TIZA 2HETA 5AANA 2NCPA 5I2OA 2LUCA 1NCXA 2JQ6A 4GGFC 1BU3A 2KGBC 1JWDA 1XK4A 2K7CA 2K0JA 4MVFA 4I5NB 4BY4A 1K96A 1ALVA 1NX2A 3I5HB 4MRXA 3JVTB 1KQMC 1NCYA 5HKYA 1UURA 1KK8C 2BBMA 3PN7C 1H8BA 4XJKA 5DKRA 1A4PA 3KHEA 2WCBA 1K9PA 1SY9A 2WCEA 1QV0A 2QPTA 1KK7Z 1S36A 1SR6C 2MJWB 1N65A 4DUQA 1J1EA 4M2QA 1KSMA 1YVHA 1NPQA 2PMYA 4WRIA 3VRPA 2LMTA 2K2FA 1VRKA 4MEWA 3NSKA 1PVBA 1CB1A 4P2YB 1M46A 1NIWA 4YGCB 4YI8A 1SCMC 3CZTX 4PHJA 1K8UA 1M45A 3O6BA 3VROA 4M2PA 3KEVA 2NCOA 3O78A 2K7BA 4HREE 1F54A 1J1DA 1NWDA 2JPTA 1XO5A 2LP2A 1CM1A 1SCVA 1C7WA 2ZFDA 1WRZA 1WDCC 1BODA 3NSOA 4QJ5B 1SL8A 4CPVA 2LUXA 2L0PA 4GFTA 1PVAA 2LMVA 3BOWB 2KI4C 2FJUB 2M7LA 3ICBA 2NXQA 1IGVA 1ZMZA 5B8IB 5HLOA 4ORCB 1RECA 1TOPA 2KHNA 3O2PA 3VRNA 4JPZB 5ER5A 5PALA 1OZSA 4CFQA 1DT7B 2KGRA 1DF0B 4UPGA 3D0YA 3IQQA 2KQ6A 5KSZA 4HRHA 1MQ1A 1YX7A 4N1GA 1TNWA 1EL4A 1UHNA 1CFCA 1X02A 1U5IA 2JWWA 4AQJA 1BLQA 2PRUA 2Y1MA 4N1FA 4DIRA 5HKZA 2HPSA 5CPVA 1WLZA 1B4CA 2LMUA 2OS8C 1CLLA 4OV2A 1QXPA 2KQYA 1IJ5A 2PVBA 2A4JA 2LVKA 4PDZA 2LCPA 5D69A 1SNLA 2BBNA 1JBAA 3TUYC 2JTTA 3CWGA 1ODBA 2BE6A 4PALA 2F8PA 2L50A 2K61A 4QJ4B 1F70A 3IF7A 1F4OA 2JOJA 2JXLA 2WC8A 1FI5A 1M63B 1XFXO 3NXAA 2HF5A 1XFYO 1EJ3A 3FWBA 2MLFC 3BXKA 4CFRA 3SIBA 1AJ4A 1YR5A 3I5FB 5CSIA 1DTLA 1IH0A 2M1KB 2GGZA 1C07A 1SMGA 2LHIA 2OTGB 2P6BB 4GGFA 3TS5B 1MUXA 3JTDB 4MN0A 4YGEB 3NSLA 4PHNA 1PULA 4FTGA 4PHMA 4PE4A 5CSNA 1W7IB 3WHUB 1AK8A 3CGAA 3SG5A 1BR4B 3K21A 3E3RA 4ZCVA 1KWOC 1IQ3A 1TNPA 1JFJA 3DD4A 2HQWA 4A4CA 1GGWA 5J3XA 1BT6A 1KFUS 3HCMA 2M3WA 2G9BA 2LM5A 2O5GA 2BKIB 2EHBA 3OX6A 4DRWA 2KBMA 1B1GA 2H2KA 1A75B 5DKQA 1QS7A 2LLUA 3SJSA 3CR4X 1WY9A 2MRDA 1JSAA 1QX2A 4L9MA 1B8RA 4R1EA 2M29A 1UHIA 4OVNF 1XFVO 2WNDA 4GGNA 3I5HC 3JVTC 1FF1A 5F6TA 2L4HA 1DJGA 3LK0A 4ETOA 1K9UA 1IJ6A 2WORA 1LKJA 2Y4QA 2ZN8A 3VRQA 3SG6A 3WNXB 1ZOTB 2KNEA 2K2AA 2JULA 1SL7A 1BR1B 2WOSA 2IS9A 2JNXA 2L5XB 4NQGA 1YTZC 2JT0A 1DJHA 2F33A 1CDLA 1QX7A 1TNXA 2F2OA 4GBAA 5AEQA 1BG1A 3SG4A 1OE9B 1AUIB 2FOTA 3I5GB 1B7TZ 1N2DA 3RM1A 5I2QA 1UUSA 4I5JA 1R2UA 2KFFA 2BL0B 2KAXA 3SG7A 4MSPA 3A4UB 3DVKA 1MR8A 2CBLA 3BQ3A 5GQQC 1TCOB 1K93D 3BUWB 2K7OA 1S6CA 4OR9B 3WXAA 4U8DA 1Y0VH 2R2IA 1LVCD 2WCFA 3CLNA 4WQ2A 1QVIZ 4GPLB 2KFHA 3OP0A 1A03A 2MLEC 3M0WA 3KPXA 4TNCA 1KSOA 1R6PA 1V1FA 3I5IB 2JZIA 1KFUL 1YURA 2I2RE 1FW4A 3DF0A 1OOJA 1JC2A 4XJKB 1K9KA 1QLSA 1CMGA 2CTNA 5IBWA 1QIVA 3GK2A 1SK6D 2SASA 2PALA 4HRGA 2DOQA 1CNPA 3GK1A 5CSFA 1A2XA 2F3YA 1K95A 2M97A 3CTNA 2O60A 3LL8B 4PE7A 1J7PA 1K94A 4YRUA 1AP4A 3EK4A 2MBXA 1TNQA 3VGOA 4A4BA 3TDZA 3AAKA 1DGUA 3AAJA 2BCBA 2E30A 2NLNA 2EC6B 2PSRA 4C0KA 1BOCA 1QV1A 3EVRA 1MF8B 1S5GZ 2GGMA 2L51A 1S3PA 1DJYA 1SRAA 4JQ0D 5JJGA 1B9AA 1SBJA 3BUNB 1H4BA 1L2OB 2CXJA 3CR5X 2LC5A 5KTYA 1QASA 2KDHA 5AFPA 1Y1XA 1CDPA 2LAPA 1NX0A 2I94A 3WHTB 1IQ5A 1PSRA 4MZJA 2M49B 2F2PA 2VRGA 2AMIA 2BCAA 2LLTA 2LLSA 3EKHA 3I5FC 2HQ8A 4ORBB 1CMFA 1JF2A 1ZACA 2KAYA 3TDUA 4WQ3A 2K7DA 3D0YB 2LP3A 2JU0A 1CFPA 2AAOA 4YGDB 2ISDA 1JUOA 1TN4A 1YUTA 2OTGC 4PCWA 3H4SE 3TS5C 1M31A 3JTDC 1CFFA 3DVJA 1U5IB 5CSJA 3OB1B 1W7JB 1F71A 3FS7A 2LHLA 1C7VA 1AVSA 5AXIA 1Y1UA 2JTZA 2MA2A 4Q04A 1S6IA 2COLB 1PSBA 4QJ3B 5ER4X 5FYXA 3ZWHA 1YUUA 3F45A 1CTRA 3DVMA 2BE4A 4JWQA 1RROA 1RFJA 2ZRSA 3SIAA 1NP8A 2MAZA 4OCIA 3QRXA 2H61A 1Y6WA 1RK9A 2Q91A 4GAOA 3BUOB 4USLA 3A8RA 4ORAB 1MWNA 4E68A 2CNPA 1UHJA 2LVJA 3CR2A 1AHRA 1V1GA 1RWYA 1KQVA 1LA3A 2ZNDA
chains in the Genus database with same CATH superfamily
1BMOA 2WCHA 4MRYA 1DGVA 2LE9B 3PFVA 3BUMB 3PATA 2D8NA 2GV5A 2JT8A 3CABA 1BF5A 1W9ZA 3C1VA 4INXA 4M2OA 2LV7A 1HT9A 1RJVA 3GK4X 5HYDA 3TZ1A 1S26D 1DMOA 1CDNA 4PT1A 1OQPA 3DXLA 3LCPC 3UO9A 1NX1A 2H61C 1G4YR 4GNKB 1QTXA 1ORGA 3R1VA 3NGVA 5TNCA 1KK7Y 1J7OA 3BOWA 2NZ0A 1OSAA 1FPWA 5BPJA 2Q4UA 1KQMB 3KF9A 1HQVA 5FI7A 1OMDA 4CLNA 1KK8B 1DVIA 2JT3A 3BYAA 3I5GC 1QIWA 3PN7B 1KFXS 2B1UA 1B8LA 1MXEA 2AUCA 1EG4A 4KYNA 3IQOA 2I7AA 1XFUO 1S6JA 2BL0C 1B7TY 2K8MB 1G33A 1P28A 1SR6B 2ZKMX 2OPOA 1DF0A 2KAVA 1J55A 1TTXA 2M0RA 1DJXA 2ZN9A 1ZUZA 2ZNEA 2ZRTA 4ICBA 1Q80A 2KYCA 5DICA 2Y1NA 2KFGA 1YRTB 1XK4C 1B47A 1QATA 5I2LA 1CM4A 2JXCA 1SCMB 1JFKA 2E6WA 5HKWA 2L2EA 3CZ2A 3I5IC 4C0JA 1QVIY 1SYMA 1SW8A 4C0LA 3SS3A 1SKTA 2BCXA 1MXLC 1NCZA 1UP5A 1WRLA 2CCMA 4YBHB 4MBEA 2WC5A 1WDCB 3AKAA 1M39A 2LVIA 2SCPA 2TN4A 5KU1A 4I5LB 1GGZA 1AJ5A 1NX3A 1J7RA 5D7FA 3B6XA 3MSEB 3PLFB 4YI9A 1OMVA 2KI4B 4PHKA 1YUSA 1Y1AA 3D10A 2L98A 5JOLA 3B86A 1PALA 3EK7A 4GUKA 2I18A 3BFAA 3GOFA 1F4QA 2KI6C 1UWOA 1GJYA 2LNKA 1YVLA 3AKBA 1BJFA 1J7QA 1CDMA 3OX5A 1QJTA 1DJIA 1XYDA 4JD9A 4NDDA 4AQIA 2BECA 2FCDA 2KOTA 2EC6C 4FQOA 1JF0A 1MHOA 2JPOA 4YGAA 1IKUA 1CKKA 1A29A 2QEHA 1WLMA 4XYNA 1XVJA 1SL9A 1EG3A 2V53A 1PK0D 3OB2B 4P5OE 1IG5A 1WRKA 2M9GA 4F0ZB 1EXRA 3KO0A 1GQMA 1YRUB 1Z4HA 1UHKA 2G2BA 3D77A 3Q8IA 3RLZA 2Y5IA 4ZCUA 1KCYA 1T14A 1TRFA 1KFXL 2QACA 1UHHA 1XA5A 1L2OC 3EVUA 1S5GY 1LA0A 1YX8A 2OS8B 1F8HA 1PRWA 1F55A 3BUXB 1CLBA 4DCKA 3EVVA 1FBVA 1OOHA 1XFWO 3DF0B 3EKJA 3PSRA 1D1OA 5HL1A 3TDIA 3TUYB 1FI6A 3DVEA 2L4IA 1DJZA 2JNFA 3OHMB 2MHHA 3CZ1A 1G8IA 4AOMA 1A75A 4DS7A 3S0GA 1NSHA 4HSZA 1SPYA 3DZTA 3VRRA 1QX5B 2LVVA 1K90D 3O4YA 4MZKA 4D1EA 4FQTA 2PASA 3LK1A 3OGNA 1OMRA 1LXFC 2JRFA 2KBIA 4IL1A 4MLWA 1Z2CB 1ZFSA 1S1EA 2F3ZA 1XFZO 4N5XA 5AERA 3OBVA 3FWCA 1NUBA 2GTEA 3NHTA 2KYFA 4BY5A 5K89A 4PE1A 1IRJA 4MZLA 5DKNA 4NDCA 3FIAA 1B8CA 1IWQA 3CZ0A 1L7ZA 2PYQA 2BKHB 3CS1A 1CLMA 4OKHA 3PALA 1E8AA 4YGBB 3SG3A 4PE0A 3ZNIA 1EH2A 3SS4A 4I5KA 3R72A 3HX4A 2FCEA 2LANA 3NSIA 3PM8A 5I94A 1K2HA 1C3YA 1KWOB 3SG2A 1ALWA 1RTP1 2RGIA 1CFDA 1QLKA 2CT9A 1LINA 1DEKA 1N0YA 2M8UA 2KSPA 2M7NA 5G08A 4NDBA 3LLEA 2KI6D 2EGDA 2M1UA 2KPHA 5HLVA 3EK8A 1DJWA 4CIDA 5I8NA 2JC2A 1OZOA 1NYAA 2PQLA 1TCFA 1TIZA 2HETA 5AANA 2NCPA 5I2OA 2LUCA 1NCXA 2JQ6A 4GGFC 1BU3A 2KGBC 1JWDA 1XK4A 2K7CA 2K0JA 3PM2A 4MVFA 4I5NB 4JKTA 4BY4A 1K96A 1ALVA 1NX2A 3I5HB 4MRXA 3JVTB 1KQMC 1NCYA 5HKYA 3VB1A 1UURA 1KK8C 2BBMA 2QDIA 3PN7C 1H8BA 4XJKA 5DKRA 1A4PA 3KHEA 2WCBA 1K9PA 1SY9A 2WCEA 1QV0A 2QPTA 1KK7Z 4OZDA 1S36A 1SR6C 1TUZA 3L4AA 4F7FA 2MJWB 1N65A 4DUQA 1J1EA 1OOGA 5FI2A 4M2QA 1KSMA 1YVHA 1NPQA 2PMYA 3N7HA 3PJIA 4WRIA 3VRPA 2LMTA 2K2FA 1VRKA 4MEWA 3NSKA 1PVBA 1CB1A 4P2YB 1M46A 1NIWA 4YGCB 4YI8A 1SCMC 3CZTX 4PHJA 1K8UA 1M45A 3O6BA 3VROA 4M2PA 3KEVA 2NCOA 3O78A 2K7BA 4HREE 1F54A 1J1DA 1NWDA 2JPTA 1XO5A 3QMEA 2LP2A 1CM1A 1SCVA 1C7WA 1TUJA 3FE8A 2ZFDA 1WRZA 1WDCC 3EG5B 1BODA 3NSOA 4QJ5B 1SL8A 4CPVA 2LUXA 2L0PA 4GFTA 1PVAA 2LMVA 3BOWB 2KI4C 2FJUB 3IVTA 2M7LA 3ICBA 2NXQA 1IGVA 1ZMZA 3L4LA 5B8IB 5HLOA 4ORCB 1RECA 1TOPA 2KHNA 3O2PA 2YGUA 3VRNA 1LS8A 4JPZB 5ER5A 5PALA 1OZSA 3D75A 4CFQA 1DT7B 2KGRA 1DF0B 4UPGA 3D0YA 3IQQA 2KQ6A 5KSZA 4HRHA 1MQ1A 1YX7A 1SSEB 4N1GA 1TNWA 3BFHA 1EL4A 1TWOA 1UHNA 1CFCA 1X02A 1U5IA 2JWWA 4AQJA 1BLQA 2PRUA 2Y1MA 2L2CA 4N1FA 4DIRA 5HKZA 2HPSA 5CPVA 1WLZA 1B4CA 2LMUA 2OS8C 1CLLA 3CDNA 4OV2A 1QXPA 2KQYA 1IJ5A 2PVBA 2A4JA 2LVKA 4PDZA 2LCPA 5D69A 1SNLA 2BBNA 1JBAA 3TUYC 2JTTA 3CWGA 3K1EA 1ODBA 2BE6A 2FJYA 2QEBA 1OOFA 2F8PA 4PALA 2L50A 2K61A 5EL2A 3R1PA 1GM0A 4QJ4B 1F70A 3IF7A 1F4OA 2JOJA 2JXLA 2WC8A 1FI5A 1M63B 1XFXO 3NXAA 2HF5A 1XFYO 1EJ3A 3FWBA 2MLFC 3NHIA 3BXKA 4CFRA 3SIBA 1AJ4A 1YR5A 3I5FB 5CSIA 1DTLA 1IH0A 2M1KB 2GGZA 1C07A 1SMGA 2LHIA 3V2LA 1DC1A 3S0EA 1OOIX 2OTGB 2P6BB 4GGFA 3TS5B 1MUXA 3JTDB 4MN0A 4YGEB 3R1OA 3NSLA 4PHNA 1PULA 4FTGA 4PHMA 4PE4A 5CSNA 1W7IB 3WHUB 2KLEA 1AK8A 2L5YA 3CGAA 3SG5A 1BR4B 2K60A 3K21A 3B88A 3E3RA 4ZCVA 1KWOC 1IQ3A 1TNPA 1JFJA 3DD4A 2HQWA 1DQEA 4A4CA 1GGWA 5J3XA 1BT6A 1KFUS 3HCMA 2WCMA 2M3WA 2G9BA 2LM5A 2O5GA 2BKIB 3S0FA 2EHBA 3OX6A 4DRWA 2KBMA 1B1GA 2H2KA 1A75B 5DKQA 1QS7A 2LLUA 3SJSA 3SS5A 3CR4X 3L47A 1WY9A 2MRDA 1JSAA 1QX2A 4L9MA 1B8RA 4R1EA 2M29A 1UHIA 4OVNF 1XFVO 2WNDA 4GGNA 2QEOA 3I5HC 2P70A 3JVTC 1FF1A 5F6TA 3S0AA 2L4HA 1DJGA 2H8VA 3LK0A 4ETOA 1K9UA 1IJ6A 2WORA 1LKJA 2Y4QA 2ZN8A 3VRQA 3SG6A 3WNXB 1ZOTB 2KNEA 2K2AA 2JULA 1SL7A 1BR1B 2WOSA 2IS9A 2JNXA 2L5XB 2KLDA 4NQGA 3D76A 1YTZC 2JT0A 3FE6A 1DJHA 2F33A 1CDLA 1QX7A 1TNXA 2F2OA 3D74A 4GBAA 5AEQA 1BG1A 2P71A 3SG4A 1OE9B 1AUIB 2BNXA 2FOTA 1B7TZ 3I5GB 1N2DA 3RM1A 5I2QA 1UUSA 4I5JA 1R2UA 2KFFA 2BL0B 2KAXA 3SG7A 4MSPA 3A4UB 3DVKA 1MR8A 2CBLA 3BQ3A 5GQQC 1TCOB 1K93D 3BUWB 3DYEA 2K7OA 1S6CA 3D78A 4OR9B 3UNWA 3WXAA 4U8DA 1Y0VH 2R2IA 3CYZA 1LVCD 2WCFA 3CLNA 4WQ2A 1QVIZ 4GPLB 4INWA 3RZSA 2KFHA 3OP0A 3S0DA 1A03A 2MLEC 3M0WA 3KPXA 2WC6A 4TNCA 1KSOA 1R6PA 1V1FA 2ERBA 3I5IB 2JZIA 1KFUL 1YURA 2I2RE 1FW4A 3DF0A 1OOJA 1XFRA 1JC2A 4XJKB 1K9KA 1QLSA 1CMGA 2CTNA 5IBWA 1QIVA 3GK2A 1SK6D 2SASA 2PALA 2BAPA 4HRGA 2DOQA 1CNPA 3GK1A 3O4XA 3BFBA 5CSFA 1A2XA 2F3YA 1K95A 2M97A 3CTNA 2O60A 3LL8B 4PE7A 1J7PA 1K94A 4YRUA 1AP4A 3B7AA 3EK4A 2MBXA 1TNQA 3VGOA 1DELA 4A4BA 3TDZA 3AAKA 1DGUA 3AAJA 1IIOA 2BCBA 2E30A 2NLNA 2EC6B 2PSRA 3S0BA 4C0KA 1BOCA 1QV1A 3EVRA 1MF8B 1S5GZ 2GGMA 2L51A 1S3PA 1DJYA 1SRAA 4JQ0D 5JJGA 1B9AA 1SBJA 3BUNB 1H4BA 1QWVA 1L2OB 2CXJA 2QEVA 3CR5X 2LC5A 5KTYA 1QASA 2KDHA 5AFPA 1Y1XA 1CDPA 2LAPA 1NX0A 2I94A 3WHTB 1IQ5A 1PSRA 4MZJA 2M49B 2F2PA 2VRGA 2AMIA 2BCAA 2LLTA 3B87A 2LLSA 3EKHA 3I5FC 2HQ8A 4ORBB 1CMFA 1JF2A 1ZACA 2KAYA 3DY9A 4WQ3A 3TDUA 2K7DA 1OW4A 3D0YB 2LP3A 2JU0A 1CFPA 2AAOA 4YGDB 2ISDA 1JUOA 1TN4A 1YUTA 2OTGC 4PCWA 3H4SE 3TS5C 1M31A 3JTDC 1CFFA 3DVJA 1U5IB 5CSJA 3OB1B 1W7JB 1F71A 2WCLA 3FS7A 2LHLA 1C7VA 1AVSA 5AXIA 1Y1UA 2JTZA 4IJ7A 2MA2A 4Q04A 1S6IA 2COLB 3FE9A 1PSBA 4QJ3B 5ER4X 5FYXA 3ZWHA 1YUUA 3F45A 1CTRA 3DVMA 2BE4A 2WCJA 4JWQA 1RROA 1RFJA 2ZRSA 3SIAA 1NP8A 2MAZA 4OCIA 3QRXA 2H61A 1Y6WA 1RK9A 2Q91A 4GAOA 3BUOB 4USLA 3A8RA 4ORAB 1MWNA 2WCKA 3D73A 4E68A 2CNPA 1UHJA 5D3OA 2LVJA 3BJHA 3CR2A 5FI6A 1AHRA 1V1GA 1RWYA 1KQVA 1LA3A 2ZNDA 1C3ZA
chains in the Genus database with same CATH topology
1BMOA 4MRYA 1DGVA 2LE9B 3PFVA 3BUMB 3PATA 2D8NA 2GV5A 2JT8A 1BF5A 3C1VA 4M2OA 2LV7A 1HT9A 1RJVA 3GK4X 5HYDA 3TZ1A 1S26D 1DMOA 1CDNA 1OQPA 3LCPC 1NX1A 2H61C 1G4YR 4GNKB 1QTXA 1J7OA 5TNCA 1KK7Y 3BOWA 2NZ0A 1OSAA 1FPWA 5BPJA 2Q4UA 1KQMB 3KF9A 1HQVA 1OMDA 4CLNA 1KK8B 1DVIA 2JT3A 3BYAA 3I5GC 1QIWA 3PN7B 1KFXS 2B1UA 1B8LA 1MXEA 2AUCA 1EG4A 3IQOA 2I7AA 1XFUO 1S6JA 2BL0C 1B7TY 2K8MB 1G33A 1SR6B 2ZKMX 2OPOA 1DF0A 2KAVA 1J55A 1TTXA 2M0RA 1DJXA 2ZN9A 1ZUZA 2ZNEA 2ZRTA 4ICBA 1Q80A 2KYCA 2Y1NA 2KFGA 1YRTB 1XK4C 1B47A 1QATA 5I2LA 1CM4A 2JXCA 1SCMB 1JFKA 2E6WA 5HKWA 2L2EA 3I5IC 4C0JA 1QVIY 1SYMA 1SW8A 4C0LA 1SKTA 2BCXA 1MXLC 1NCZA 1UP5A 1WRLA 2CCMA 4YBHB 4MBEA 1WDCB 3AKAA 1M39A 2LVIA 2SCPA 2TN4A 5KU1A 4I5LB 1GGZA 1AJ5A 1NX3A 1J7RA 5D7FA 3MSEB 3PLFB 4YI9A 1OMVA 2KI4B 4PHKA 1YUSA 1Y1AA 3D10A 2L98A 5JOLA 1PALA 3EK7A 4GUKA 2I18A 3GOFA 1F4QA 2KI6C 1UWOA 1GJYA 2LNKA 1YVLA 3AKBA 1BJFA 1J7QA 1CDMA 3OX5A 1QJTA 1DJIA 1XYDA 4NDDA 4AQIA 2BECA 2FCDA 2KOTA 2EC6C 4FQOA 1JF0A 1MHOA 4YGAA 1IKUA 1CKKA 1A29A 1WLMA 4XYNA 1XVJA 1SL9A 1EG3A 2V53A 1PK0D 3OB2B 4P5OE 1IG5A 1WRKA 2M9GA 4F0ZB 1EXRA 3KO0A 1GQMA 1YRUB 3RLZA 1UHKA 2G2BA 2Y5IA 4ZCUA 1KCYA 1TRFA 1KFXL 2QACA 1UHHA 1XA5A 1L2OC 3EVUA 1S5GY 1LA0A 1YX8A 2OS8B 1F8HA 1PRWA 1F55A 3BUXB 1CLBA 4DCKA 3EVVA 1FBVA 1XFWO 3DF0B 3EKJA 3PSRA 1D1OA 3TDIA 3TUYB 1FI6A 3DVEA 2L4IA 1DJZA 2JNFA 3OHMB 2MHHA 1G8IA 4AOMA 1A75A 4DS7A 1NSHA 4HSZA 1SPYA 3VRRA 1QX5B 2LVVA 1K90D 3O4YA 4MZKA 4D1EA 2PASA 3LK1A 1OMRA 1LXFC 2JRFA 2KBIA 4IL1A 4MLWA 5AERA 1ZFSA 1S1EA 2F3ZA 1XFZO 4N5XA 3FWCA 1NUBA 2KYFA 4BY5A 5K89A 4PE1A 1IRJA 4MZLA 5DKNA 4NDCA 3FIAA 1B8CA 1IWQA 1L7ZA 2BKHB 3CS1A 1CLMA 4OKHA 3PALA 1E8AA 4YGBB 3SG3A 4PE0A 3ZNIA 1EH2A 4I5KA 3HX4A 2FCEA 2LANA 3NSIA 3PM8A 1K2HA 1KWOB 3SG2A 1ALWA 1RTP1 2RGIA 1CFDA 1QLKA 2CT9A 1LINA 1N0YA 2M8UA 5G08A 2KSPA 2M7NA 4NDBA 3LLEA 2KI6D 2EGDA 2M1UA 5HLVA 3EK8A 1DJWA 4CIDA 5I8NA 2JC2A 1OZOA 1NYAA 1TCFA 1TIZA 2HETA 5AANA 2NCPA 5I2OA 2LUCA 1NCXA 2JQ6A 4GGFC 1BU3A 2KGBC 1JWDA 1XK4A 2K7CA 2K0JA 4MVFA 4I5NB 4BY4A 1K96A 1ALVA 1NX2A 3I5HB 4MRXA 3JVTB 1KQMC 1NCYA 5HKYA 1UURA 1KK8C 2BBMA 3PN7C 1H8BA 4XJKA 5DKRA 1A4PA 3KHEA 2WCBA 1K9PA 1SY9A 2WCEA 1QV0A 2QPTA 1KK7Z 1S36A 1SR6C 2MJWB 1N65A 4DUQA 1J1EA 4M2QA 1KSMA 1YVHA 1NPQA 2PMYA 4WRIA 3VRPA 2LMTA 2K2FA 1VRKA 4MEWA 3NSKA 1PVBA 1CB1A 4P2YB 1M46A 1NIWA 4YGCB 4YI8A 1SCMC 3CZTX 4PHJA 1K8UA 1M45A 3O6BA 3VROA 4M2PA 3KEVA 2NCOA 3O78A 2K7BA 4HREE 1F54A 1J1DA 1NWDA 2JPTA 1XO5A 2LP2A 1CM1A 1SCVA 1C7WA 2ZFDA 1WRZA 1WDCC 1BODA 3NSOA 4QJ5B 1SL8A 4CPVA 2LUXA 2L0PA 4GFTA 1PVAA 2LMVA 3BOWB 2KI4C 2FJUB 2M7LA 3ICBA 2NXQA 1IGVA 1ZMZA 5B8IB 5HLOA 4ORCB 1RECA 1TOPA 2KHNA 3O2PA 3VRNA 4JPZB 5ER5A 5PALA 1OZSA 4CFQA 1DT7B 2KGRA 1DF0B 4UPGA 3D0YA 3IQQA 2KQ6A 5KSZA 4HRHA 1MQ1A 1YX7A 4N1GA 1TNWA 1EL4A 1UHNA 1CFCA 1X02A 1U5IA 2JWWA 4AQJA 1BLQA 2PRUA 2Y1MA 4N1FA 4DIRA 5HKZA 2HPSA 5CPVA 1WLZA 1B4CA 2LMUA 2OS8C 1CLLA 4OV2A 1QXPA 2KQYA 1IJ5A 2PVBA 2A4JA 2LVKA 4PDZA 2LCPA 5D69A 1SNLA 2BBNA 1JBAA 3TUYC 2JTTA 3CWGA 1ODBA 2BE6A 4PALA 2F8PA 2L50A 2K61A 4QJ4B 1F70A 3IF7A 1F4OA 2JOJA 2JXLA 2WC8A 1FI5A 1M63B 1XFXO 3NXAA 2HF5A 1XFYO 1EJ3A 3FWBA 2MLFC 3BXKA 4CFRA 3SIBA 1AJ4A 1YR5A 3I5FB 5CSIA 1DTLA 1IH0A 2M1KB 2GGZA 1C07A 1SMGA 2LHIA 2OTGB 2P6BB 4GGFA 3TS5B 1MUXA 3JTDB 4MN0A 4YGEB 3NSLA 4PHNA 1PULA 4FTGA 4PHMA 4PE4A 5CSNA 1W7IB 3WHUB 1AK8A 3CGAA 3SG5A 1BR4B 3K21A 3E3RA 4ZCVA 1KWOC 1IQ3A 1TNPA 1JFJA 3DD4A 2HQWA 4A4CA 1GGWA 5J3XA 1BT6A 1KFUS 3HCMA 2M3WA 2G9BA 2LM5A 2O5GA 2BKIB 2EHBA 3OX6A 4DRWA 2KBMA 1B1GA 2H2KA 1A75B 5DKQA 1QS7A 2LLUA 3SJSA 3CR4X 1WY9A 2MRDA 1JSAA 1QX2A 4L9MA 1B8RA 4R1EA 2M29A 1UHIA 4OVNF 1XFVO 2WNDA 4GGNA 3I5HC 3JVTC 1FF1A 5F6TA 2L4HA 1DJGA 3LK0A 4ETOA 1K9UA 1IJ6A 2WORA 1LKJA 2Y4QA 2ZN8A 3VRQA 3SG6A 3WNXB 1ZOTB 2KNEA 2K2AA 2JULA 1SL7A 1BR1B 2WOSA 2IS9A 2JNXA 2L5XB 4NQGA 1YTZC 2JT0A 1DJHA 2F33A 1CDLA 1QX7A 1TNXA 2F2OA 4GBAA 5AEQA 1BG1A 3SG4A 1OE9B 1AUIB 2FOTA 3I5GB 1B7TZ 1N2DA 3RM1A 5I2QA 1UUSA 4I5JA 1R2UA 2KFFA 2BL0B 2KAXA 3SG7A 4MSPA 3A4UB 3DVKA 1MR8A 2CBLA 3BQ3A 5GQQC 1TCOB 1K93D 3BUWB 2K7OA 1S6CA 4OR9B 3WXAA 4U8DA 1Y0VH 2R2IA 1LVCD 2WCFA 3CLNA 4WQ2A 1QVIZ 4GPLB 2KFHA 3OP0A 1A03A 2MLEC 3M0WA 3KPXA 4TNCA 1KSOA 1R6PA 1V1FA 3I5IB 2JZIA 1KFUL 1YURA 2I2RE 1FW4A 3DF0A 1OOJA 1JC2A 4XJKB 1K9KA 1QLSA 1CMGA 2CTNA 5IBWA 1QIVA 3GK2A 1SK6D 2SASA 2PALA 4HRGA 2DOQA 1CNPA 3GK1A 5CSFA 1A2XA 2F3YA 1K95A 2M97A 3CTNA 2O60A 3LL8B 4PE7A 1J7PA 1K94A 4YRUA 1AP4A 3EK4A 2MBXA 1TNQA 3VGOA 4A4BA 3TDZA 3AAKA 1DGUA 3AAJA 2BCBA 2E30A 2NLNA 2EC6B 2PSRA 4C0KA 1BOCA 1QV1A 3EVRA 1MF8B 1S5GZ 2GGMA 2L51A 1S3PA 1DJYA 1SRAA 4JQ0D 5JJGA 1B9AA 1SBJA 3BUNB 1H4BA 1L2OB 2CXJA 3CR5X 2LC5A 5KTYA 1QASA 2KDHA 5AFPA 1Y1XA 1CDPA 2LAPA 1NX0A 2I94A 3WHTB 1IQ5A 1PSRA 4MZJA 2M49B 2F2PA 2VRGA 2AMIA 2BCAA 2LLTA 2LLSA 3EKHA 3I5FC 2HQ8A 4ORBB 1CMFA 1JF2A 1ZACA 2KAYA 3TDUA 4WQ3A 2K7DA 3D0YB 2LP3A 2JU0A 1CFPA 2AAOA 4YGDB 2ISDA 1JUOA 1TN4A 1YUTA 2OTGC 4PCWA 3H4SE 3TS5C 1M31A 3JTDC 1CFFA 3DVJA 1U5IB 5CSJA 3OB1B 1W7JB 1F71A 3FS7A 2LHLA 1C7VA 1AVSA 5AXIA 1Y1UA 2JTZA 2MA2A 4Q04A 1S6IA 2COLB 1PSBA 4QJ3B 5ER4X 5FYXA 3ZWHA 1YUUA 3F45A 1CTRA 3DVMA 2BE4A 4JWQA 1RROA 1RFJA 2ZRSA 3SIAA 1NP8A 2MAZA 4OCIA 3QRXA 2H61A 1Y6WA 1RK9A 2Q91A 4GAOA 3BUOB 4USLA 3A8RA 4ORAB 1MWNA 4E68A 2CNPA 1UHJA 2LVJA 3CR2A 1AHRA 1V1GA 1RWYA 1KQVA 1LA3A 2ZNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMO A;  4MRY A;  1DGV A;  2LE9 B;  3PFV A;  3BUM B;  3PAT A;  2D8N A;  2GV5 A;  2JT8 A;  1BF5 A;  3C1V A;  4M2O A;  2LV7 A;  1HT9 A;  1RJV A;  3GK4 X;  5HYD A;  3TZ1 A;  1S26 D;  1DMO A;  1CDN A;  1OQP A;  3LCP C;  1NX1 A;  2H61 C;  1G4Y R;  4GNK B;  1QTX A;  1J7O A;  5TNC A;  1KK7 Y;  3BOW A;  2NZ0 A;  1OSA A;  1FPW A;  5BPJ A;  2Q4U A;  1KQM B;  3KF9 A;  1HQV A;  1OMD A;  4CLN A;  1KK8 B;  1DVI A;  2JT3 A;  3BYA A;  3I5G C;  1QIW A;  3PN7 B;  1KFX S;  2B1U A;  1B8L A;  1MXE A;  2AUC A;  1EG4 A;  3IQO A;  2I7A A;  1XFU O;  1S6J A;  2BL0 C;  1B7T Y;  2K8M B;  1G33 A;  1SR6 B;  2ZKM X;  2OPO A;  1DF0 A;  2KAV A;  1J55 A;  1TTX A;  2M0R A;  1DJX A;  2ZN9 A;  1ZUZ A;  2ZNE A;  2ZRT A;  4ICB A;  1Q80 A;  2KYC A;  2Y1N A;  2KFG A;  1YRT B;  1XK4 C;  1B47 A;  1QAT A;  5I2L A;  1CM4 A;  2JXC A;  1SCM B;  1JFK A;  2E6W A;  5HKW A;  2L2E A;  3I5I C;  4C0J A;  1QVI Y;  1SYM A;  1SW8 A;  4C0L A;  1SKT A;  2BCX A;  1MXL C;  1NCZ A;  1UP5 A;  1WRL A;  2CCM A;  4YBH B;  4MBE A;  1WDC B;  3AKA A;  1M39 A;  2LVI A;  2SCP A;  2TN4 A;  5KU1 A;  4I5L B;  1GGZ A;  1AJ5 A;  1NX3 A;  1J7R A;  5D7F A;  3MSE B;  3PLF B;  4YI9 A;  1OMV A;  2KI4 B;  4PHK A;  1YUS A;  1Y1A A;  3D10 A;  2L98 A;  5JOL A;  1PAL A;  3EK7 A;  4GUK A;  2I18 A;  3GOF A;  1F4Q A;  2KI6 C;  1UWO A;  1GJY A;  2LNK A;  1YVL A;  3AKB A;  1BJF A;  1J7Q A;  1CDM A;  3OX5 A;  1QJT A;  1DJI A;  1XYD A;  4NDD A;  4AQI A;  2BEC A;  2FCD A;  2KOT A;  2EC6 C;  4FQO A;  1JF0 A;  1MHO A;  4YGA A;  1IKU A;  1CKK A;  1A29 A;  1WLM A;  4XYN A;  1XVJ A;  1SL9 A;  1EG3 A;  2V53 A;  1PK0 D;  3OB2 B;  4P5O E;  1IG5 A;  1WRK A;  2M9G A;  4F0Z B;  1EXR A;  3KO0 A;  1GQM A;  1YRU B;  3RLZ A;  1UHK A;  2G2B A;  2Y5I A;  4ZCU A;  1KCY A;  1TRF A;  1KFX L;  2QAC A;  1UHH A;  1XA5 A;  1L2O C;  3EVU A;  1S5G Y;  1LA0 A;  1YX8 A;  2OS8 B;  1F8H A;  1PRW A;  1F55 A;  3BUX B;  1CLB A;  4DCK A;  3EVV A;  1FBV A;  1XFW O;  3DF0 B;  3EKJ A;  3PSR A;  1D1O A;  3TDI A;  3TUY B;  1FI6 A;  3DVE A;  2L4I A;  1DJZ A;  2JNF A;  3OHM B;  2MHH A;  1G8I A;  4AOM A;  1A75 A;  4DS7 A;  1NSH A;  4HSZ A;  1SPY A;  3VRR A;  1QX5 B;  2LVV A;  1K90 D;  3O4Y A;  4MZK A;  4D1E A;  2PAS A;  3LK1 A;  1OMR A;  1LXF C;  2JRF A;  2KBI A;  4IL1 A;  4MLW A;  5AER A;  1ZFS A;  1S1E A;  2F3Z A;  1XFZ O;  4N5X A;  3FWC A;  1NUB A;  2KYF A;  4BY5 A;  5K89 A;  4PE1 A;  1IRJ A;  4MZL A;  5DKN A;  4NDC A;  3FIA A;  1B8C A;  1IWQ A;  1L7Z A;  2BKH B;  3CS1 A;  1CLM A;  4OKH A;  3PAL A;  1E8A A;  4YGB B;  3SG3 A;  4PE0 A;  3ZNI A;  1EH2 A;  4I5K A;  3HX4 A;  2FCE A;  2LAN A;  3NSI A;  3PM8 A;  1K2H A;  1KWO B;  3SG2 A;  1ALW A;  1RTP 1;  2RGI A;  1CFD A;  1QLK A;  2CT9 A;  1LIN A;  1N0Y A;  2M8U A;  5G08 A;  2KSP A;  2M7N A;  4NDB A;  3LLE A;  2KI6 D;  2EGD A;  2M1U A;  5HLV A;  3EK8 A;  1DJW A;  4CID A;  5I8N A;  2JC2 A;  1OZO A;  1NYA A;  1TCF A;  1TIZ A;  2HET A;  5AAN A;  2NCP A;  5I2O A;  2LUC A;  1NCX A;  2JQ6 A;  4GGF C;  1BU3 A;  2KGB C;  1JWD A;  1XK4 A;  2K7C A;  2K0J A;  4MVF A;  4I5N B;  4BY4 A;  1K96 A;  1ALV A;  1NX2 A;  3I5H B;  4MRX A;  3JVT B;  1KQM C;  1NCY A;  5HKY A;  1UUR A;  1KK8 C;  2BBM A;  3PN7 C;  1H8B A;  4XJK A;  5DKR A;  1A4P A;  3KHE A;  2WCB A;  1K9P A;  1SY9 A;  2WCE A;  1QV0 A;  2QPT A;  1KK7 Z;  1S36 A;  1SR6 C;  2MJW B;  1N65 A;  4DUQ A;  1J1E A;  4M2Q A;  1KSM A;  1YVH A;  1NPQ A;  2PMY A;  4WRI A;  3VRP A;  2LMT A;  2K2F A;  1VRK A;  4MEW A;  3NSK A;  1PVB A;  1CB1 A;  4P2Y B;  1M46 A;  1NIW A;  4YGC B;  4YI8 A;  1SCM C;  3CZT X;  4PHJ A;  1K8U A;  1M45 A;  3O6B A;  3VRO A;  4M2P A;  3KEV A;  2NCO A;  3O78 A;  2K7B A;  4HRE E;  1F54 A;  1J1D A;  1NWD A;  2JPT A;  1XO5 A;  2LP2 A;  1CM1 A;  1SCV A;  1C7W A;  2ZFD A;  1WRZ A;  1WDC C;  1BOD A;  3NSO A;  4QJ5 B;  1SL8 A;  4CPV A;  2LUX A;  2L0P A;  4GFT A;  1PVA A;  2LMV A;  3BOW B;  2KI4 C;  2FJU B;  2M7L A;  3ICB A;  2NXQ A;  1IGV A;  1ZMZ A;  5B8I B;  5HLO A;  4ORC B;  1REC A;  1TOP A;  2KHN A;  3O2P A;  3VRN A;  4JPZ B;  5ER5 A;  5PAL A;  1OZS A;  4CFQ A;  1DT7 B;  2KGR A;  1DF0 B;  4UPG A;  3D0Y A;  3IQQ A;  2KQ6 A;  5KSZ A;  4HRH A;  1MQ1 A;  1YX7 A;  4N1G A;  1TNW A;  1EL4 A;  1UHN A;  1CFC A;  1X02 A;  1U5I A;  2JWW A;  4AQJ A;  1BLQ A;  2PRU A;  2Y1M A;  4N1F A;  4DIR A;  5HKZ A;  2HPS A;  5CPV A;  1WLZ A;  1B4C A;  2LMU A;  2OS8 C;  1CLL A;  4OV2 A;  1QXP A;  2KQY A;  1IJ5 A;  2PVB A;  2A4J A;  2LVK A;  4PDZ A;  2LCP A;  5D69 A;  1SNL A;  2BBN A;  1JBA A;  3TUY C;  2JTT A;  3CWG A;  1ODB A;  2BE6 A;  4PAL A;  2F8P A;  2L50 A;  2K61 A;  4QJ4 B;  1F70 A;  3IF7 A;  1F4O A;  2JOJ A;  2JXL A;  2WC8 A;  1FI5 A;  1M63 B;  1XFX O;  3NXA A;  2HF5 A;  1XFY O;  1EJ3 A;  3FWB A;  2MLF C;  3BXK A;  4CFR A;  3SIB A;  1AJ4 A;  1YR5 A;  3I5F B;  5CSI A;  1DTL A;  1IH0 A;  2M1K B;  2GGZ A;  1C07 A;  1SMG A;  2LHI A;  2OTG B;  2P6B B;  4GGF A;  3TS5 B;  1MUX A;  3JTD B;  4MN0 A;  4YGE B;  3NSL A;  4PHN A;  1PUL A;  4FTG A;  4PHM A;  4PE4 A;  5CSN A;  1W7I B;  3WHU B;  1AK8 A;  3CGA A;  3SG5 A;  1BR4 B;  3K21 A;  3E3R A;  4ZCV A;  1KWO C;  1IQ3 A;  1TNP A;  1JFJ A;  3DD4 A;  2HQW A;  4A4C A;  1GGW A;  5J3X A;  1BT6 A;  1KFU S;  3HCM A;  2M3W A;  2G9B A;  2LM5 A;  2O5G A;  2BKI B;  2EHB A;  3OX6 A;  4DRW A;  2KBM A;  1B1G A;  2H2K A;  1A75 B;  5DKQ A;  1QS7 A;  2LLU A;  3SJS A;  3CR4 X;  1WY9 A;  2MRD A;  1JSA A;  1QX2 A;  4L9M A;  1B8R A;  4R1E A;  2M29 A;  1UHI A;  4OVN F;  1XFV O;  2WND A;  4GGN A;  3I5H C;  3JVT C;  1FF1 A;  5F6T A;  2L4H A;  1DJG A;  3LK0 A;  4ETO A;  1K9U A;  1IJ6 A;  2WOR A;  1LKJ A;  2Y4Q A;  2ZN8 A;  3VRQ A;  3SG6 A;  3WNX B;  1ZOT B;  2KNE A;  2K2A A;  2JUL A;  1SL7 A;  1BR1 B;  2WOS A;  2IS9 A;  2JNX A;  2L5X B;  4NQG A;  1YTZ C;  2JT0 A;  1DJH A;  2F33 A;  1CDL A;  1QX7 A;  1TNX A;  2F2O A;  4GBA A;  5AEQ A;  1BG1 A;  3SG4 A;  1OE9 B;  1AUI B;  2FOT A;  3I5G B;  1B7T Z;  1N2D A;  3RM1 A;  5I2Q A;  1UUS A;  4I5J A;  1R2U A;  2KFF A;  2BL0 B;  2KAX A;  3SG7 A;  4MSP A;  3A4U B;  3DVK A;  1MR8 A;  2CBL A;  3BQ3 A;  5GQQ C;  1TCO B;  1K93 D;  3BUW B;  2K7O A;  1S6C A;  4OR9 B;  3WXA A;  4U8D A;  1Y0V H;  2R2I A;  1LVC D;  2WCF A;  3CLN A;  4WQ2 A;  1QVI Z;  4GPL B;  2KFH A;  3OP0 A;  1A03 A;  2MLE C;  3M0W A;  3KPX A;  4TNC A;  1KSO A;  1R6P A;  1V1F A;  3I5I B;  2JZI A;  1KFU L;  1YUR A;  2I2R E;  1FW4 A;  3DF0 A;  1OOJ A;  1JC2 A;  4XJK B;  1K9K A;  1QLS A;  1CMG A;  2CTN A;  5IBW A;  1QIV A;  3GK2 A;  1SK6 D;  2SAS A;  2PAL A;  4HRG A;  2DOQ A;  1CNP A;  3GK1 A;  5CSF A;  1A2X A;  2F3Y A;  1K95 A;  2M97 A;  3CTN A;  2O60 A;  3LL8 B;  4PE7 A;  1J7P A;  1K94 A;  4YRU A;  1AP4 A;  3EK4 A;  2MBX A;  1TNQ A;  3VGO A;  4A4B A;  3TDZ A;  3AAK A;  1DGU A;  3AAJ A;  2BCB A;  2E30 A;  2NLN A;  2EC6 B;  2PSR A;  4C0K A;  1BOC A;  1QV1 A;  3EVR A;  1MF8 B;  1S5G Z;  2GGM A;  2L51 A;  1S3P A;  1DJY A;  1SRA A;  4JQ0 D;  5JJG A;  1B9A A;  1SBJ A;  3BUN B;  1H4B A;  1L2O B;  2CXJ A;  3CR5 X;  2LC5 A;  5KTY A;  1QAS A;  2KDH A;  5AFP A;  1Y1X A;  1CDP A;  2LAP A;  1NX0 A;  2I94 A;  3WHT B;  1IQ5 A;  1PSR A;  4MZJ A;  2M49 B;  2F2P A;  2VRG A;  2AMI A;  2BCA A;  2LLT A;  2LLS A;  3EKH A;  3I5F C;  2HQ8 A;  4ORB B;  1CMF A;  1JF2 A;  1ZAC A;  2KAY A;  3TDU A;  4WQ3 A;  2K7D A;  3D0Y B;  2LP3 A;  2JU0 A;  1CFP A;  2AAO A;  4YGD B;  2ISD A;  1JUO A;  1TN4 A;  1YUT A;  2OTG C;  4PCW A;  3H4S E;  3TS5 C;  1M31 A;  3JTD C;  1CFF A;  3DVJ A;  1U5I B;  5CSJ A;  3OB1 B;  1W7J B;  1F71 A;  3FS7 A;  2LHL A;  1C7V A;  1AVS A;  5AXI A;  1Y1U A;  2JTZ A;  2MA2 A;  4Q04 A;  1S6I A;  2COL B;  1PSB A;  4QJ3 B;  5ER4 X;  5FYX A;  3ZWH A;  1YUU A;  3F45 A;  1CTR A;  3DVM A;  2BE4 A;  4JWQ A;  1RRO A;  1RFJ A;  2ZRS A;  3SIA A;  1NP8 A;  2MAZ A;  4OCI A;  3QRX A;  2H61 A;  1Y6W A;  1RK9 A;  2Q91 A;  4GAO A;  3BUO B;  4USL A;  3A8R A;  4ORA B;  1MWN A;  4E68 A;  2CNP A;  1UHJ A;  2LVJ A;  3CR2 A;  1AHR A;  1V1G A;  1RWY A;  1KQV A;  1LA3 A;  2ZND A; 
#chains in the Genus database with same CATH topology
 1BMO A;  2WCH A;  4MRY A;  1DGV A;  2LE9 B;  3PFV A;  3BUM B;  3PAT A;  2D8N A;  2GV5 A;  2JT8 A;  3CAB A;  1BF5 A;  1W9Z A;  3C1V A;  4INX A;  4M2O A;  2LV7 A;  1HT9 A;  1RJV A;  3GK4 X;  5HYD A;  3TZ1 A;  1S26 D;  1DMO A;  1CDN A;  4PT1 A;  1OQP A;  3DXL A;  3LCP C;  3UO9 A;  1NX1 A;  2H61 C;  1G4Y R;  4GNK B;  1QTX A;  1ORG A;  3R1V A;  3NGV A;  5TNC A;  1KK7 Y;  1J7O A;  3BOW A;  2NZ0 A;  1OSA A;  1FPW A;  5BPJ A;  2Q4U A;  1KQM B;  3KF9 A;  1HQV A;  5FI7 A;  1OMD A;  4CLN A;  1KK8 B;  1DVI A;  2JT3 A;  3BYA A;  3I5G C;  1QIW A;  3PN7 B;  1KFX S;  2B1U A;  1B8L A;  1MXE A;  2AUC A;  1EG4 A;  4KYN A;  3IQO A;  2I7A A;  1XFU O;  1S6J A;  2BL0 C;  1B7T Y;  2K8M B;  1G33 A;  1P28 A;  1SR6 B;  2ZKM X;  2OPO A;  1DF0 A;  2KAV A;  1J55 A;  1TTX A;  2M0R A;  1DJX A;  2ZN9 A;  1ZUZ A;  2ZNE A;  2ZRT A;  4ICB A;  1Q80 A;  2KYC A;  5DIC A;  2Y1N A;  2KFG A;  1YRT B;  1XK4 C;  1B47 A;  1QAT A;  5I2L A;  1CM4 A;  2JXC A;  1SCM B;  1JFK A;  2E6W A;  5HKW A;  2L2E A;  3CZ2 A;  3I5I C;  4C0J A;  1QVI Y;  1SYM A;  1SW8 A;  4C0L A;  3SS3 A;  1SKT A;  2BCX A;  1MXL C;  1NCZ A;  1UP5 A;  1WRL A;  2CCM A;  4YBH B;  4MBE A;  2WC5 A;  1WDC B;  3AKA A;  1M39 A;  2LVI A;  2SCP A;  2TN4 A;  5KU1 A;  4I5L B;  1GGZ A;  1AJ5 A;  1NX3 A;  1J7R A;  5D7F A;  3B6X A;  3MSE B;  3PLF B;  4YI9 A;  1OMV A;  2KI4 B;  4PHK A;  1YUS A;  1Y1A A;  3D10 A;  2L98 A;  5JOL A;  3B86 A;  1PAL A;  3EK7 A;  4GUK A;  2I18 A;  3BFA A;  3GOF A;  1F4Q A;  2KI6 C;  1UWO A;  1GJY A;  2LNK A;  1YVL A;  3AKB A;  1BJF A;  1J7Q A;  1CDM A;  3OX5 A;  1QJT A;  1DJI A;  1XYD A;  4JD9 A;  4NDD A;  4AQI A;  2BEC A;  2FCD A;  2KOT A;  2EC6 C;  4FQO A;  1JF0 A;  1MHO A;  2JPO A;  4YGA A;  1IKU A;  1CKK A;  1A29 A;  2QEH A;  1WLM A;  4XYN A;  1XVJ A;  1SL9 A;  1EG3 A;  2V53 A;  1PK0 D;  3OB2 B;  4P5O E;  1IG5 A;  1WRK A;  2M9G A;  4F0Z B;  1EXR A;  3KO0 A;  1GQM A;  1YRU B;  1Z4H A;  1UHK A;  2G2B A;  3D77 A;  3Q8I A;  3RLZ A;  2Y5I A;  4ZCU A;  1KCY A;  1T14 A;  1TRF A;  1KFX L;  2QAC A;  1UHH A;  1XA5 A;  1L2O C;  3EVU A;  1S5G Y;  1LA0 A;  1YX8 A;  2OS8 B;  1F8H A;  1PRW A;  1F55 A;  3BUX B;  1CLB A;  4DCK A;  3EVV A;  1FBV A;  1OOH A;  1XFW O;  3DF0 B;  3EKJ A;  3PSR A;  1D1O A;  5HL1 A;  3TDI A;  3TUY B;  1FI6 A;  3DVE A;  2L4I A;  1DJZ A;  2JNF A;  3OHM B;  2MHH A;  3CZ1 A;  1G8I A;  4AOM A;  1A75 A;  4DS7 A;  3S0G A;  1NSH A;  4HSZ A;  1SPY A;  3DZT A;  3VRR A;  1QX5 B;  2LVV A;  1K90 D;  3O4Y A;  4MZK A;  4D1E A;  4FQT A;  2PAS A;  3LK1 A;  3OGN A;  1OMR A;  1LXF C;  2JRF A;  2KBI A;  4IL1 A;  4MLW A;  1Z2C B;  1ZFS A;  1S1E A;  2F3Z A;  1XFZ O;  4N5X A;  5AER A;  3OBV A;  3FWC A;  1NUB A;  2GTE A;  3NHT A;  2KYF A;  4BY5 A;  5K89 A;  4PE1 A;  1IRJ A;  4MZL A;  5DKN A;  4NDC A;  3FIA A;  1B8C A;  1IWQ A;  3CZ0 A;  1L7Z A;  2PYQ A;  2BKH B;  3CS1 A;  1CLM A;  4OKH A;  3PAL A;  1E8A A;  4YGB B;  3SG3 A;  4PE0 A;  3ZNI A;  1EH2 A;  3SS4 A;  4I5K A;  3R72 A;  3HX4 A;  2FCE A;  2LAN A;  3NSI A;  3PM8 A;  5I94 A;  1K2H A;  1C3Y A;  1KWO B;  3SG2 A;  1ALW A;  1RTP 1;  2RGI A;  1CFD A;  1QLK A;  2CT9 A;  1LIN A;  1DEK A;  1N0Y A;  2M8U A;  2KSP A;  2M7N A;  5G08 A;  4NDB A;  3LLE A;  2KI6 D;  2EGD A;  2M1U A;  2KPH A;  5HLV A;  3EK8 A;  1DJW A;  4CID A;  5I8N A;  2JC2 A;  1OZO A;  1NYA A;  2PQL A;  1TCF A;  1TIZ A;  2HET A;  5AAN A;  2NCP A;  5I2O A;  2LUC A;  1NCX A;  2JQ6 A;  4GGF C;  1BU3 A;  2KGB C;  1JWD A;  1XK4 A;  2K7C A;  2K0J A;  3PM2 A;  4MVF A;  4I5N B;  4JKT A;  4BY4 A;  1K96 A;  1ALV A;  1NX2 A;  3I5H B;  4MRX A;  3JVT B;  1KQM C;  1NCY A;  5HKY A;  3VB1 A;  1UUR A;  1KK8 C;  2BBM A;  2QDI A;  3PN7 C;  1H8B A;  4XJK A;  5DKR A;  1A4P A;  3KHE A;  2WCB A;  1K9P A;  1SY9 A;  2WCE A;  1QV0 A;  2QPT A;  1KK7 Z;  4OZD A;  1S36 A;  1SR6 C;  1TUZ A;  3L4A A;  4F7F A;  2MJW B;  1N65 A;  4DUQ A;  1J1E A;  1OOG A;  5FI2 A;  4M2Q A;  1KSM A;  1YVH A;  1NPQ A;  2PMY A;  3N7H A;  3PJI A;  4WRI A;  3VRP A;  2LMT A;  2K2F A;  1VRK A;  4MEW A;  3NSK A;  1PVB A;  1CB1 A;  4P2Y B;  1M46 A;  1NIW A;  4YGC B;  4YI8 A;  1SCM C;  3CZT X;  4PHJ A;  1K8U A;  1M45 A;  3O6B A;  3VRO A;  4M2P A;  3KEV A;  2NCO A;  3O78 A;  2K7B A;  4HRE E;  1F54 A;  1J1D A;  1NWD A;  2JPT A;  1XO5 A;  3QME A;  2LP2 A;  1CM1 A;  1SCV A;  1C7W A;  1TUJ A;  3FE8 A;  2ZFD A;  1WRZ A;  1WDC C;  3EG5 B;  1BOD A;  3NSO A;  4QJ5 B;  1SL8 A;  4CPV A;  2LUX A;  2L0P A;  4GFT A;  1PVA A;  2LMV A;  3BOW B;  2KI4 C;  2FJU B;  3IVT A;  2M7L A;  3ICB A;  2NXQ A;  1IGV A;  1ZMZ A;  3L4L A;  5B8I B;  5HLO A;  4ORC B;  1REC A;  1TOP A;  2KHN A;  3O2P A;  2YGU A;  3VRN A;  1LS8 A;  4JPZ B;  5ER5 A;  5PAL A;  1OZS A;  3D75 A;  4CFQ A;  1DT7 B;  2KGR A;  1DF0 B;  4UPG A;  3D0Y A;  3IQQ A;  2KQ6 A;  5KSZ A;  4HRH A;  1MQ1 A;  1YX7 A;  1SSE B;  4N1G A;  1TNW A;  3BFH A;  1EL4 A;  1TWO A;  1UHN A;  1CFC A;  1X02 A;  1U5I A;  2JWW A;  4AQJ A;  1BLQ A;  2PRU A;  2Y1M A;  2L2C A;  4N1F A;  4DIR A;  5HKZ A;  2HPS A;  5CPV A;  1WLZ A;  1B4C A;  2LMU A;  2OS8 C;  1CLL A;  3CDN A;  4OV2 A;  1QXP A;  2KQY A;  1IJ5 A;  2PVB A;  2A4J A;  2LVK A;  4PDZ A;  2LCP A;  5D69 A;  1SNL A;  2BBN A;  1JBA A;  3TUY C;  2JTT A;  3CWG A;  3K1E A;  1ODB A;  2BE6 A;  2FJY A;  2QEB A;  1OOF A;  2F8P A;  4PAL A;  2L50 A;  2K61 A;  5EL2 A;  3R1P A;  1GM0 A;  4QJ4 B;  1F70 A;  3IF7 A;  1F4O A;  2JOJ A;  2JXL A;  2WC8 A;  1FI5 A;  1M63 B;  1XFX O;  3NXA A;  2HF5 A;  1XFY O;  1EJ3 A;  3FWB A;  2MLF C;  3NHI A;  3BXK A;  4CFR A;  3SIB A;  1AJ4 A;  1YR5 A;  3I5F B;  5CSI A;  1DTL A;  1IH0 A;  2M1K B;  2GGZ A;  1C07 A;  1SMG A;  2LHI A;  3V2L A;  1DC1 A;  3S0E A;  1OOI X;  2OTG B;  2P6B B;  4GGF A;  3TS5 B;  1MUX A;  3JTD B;  4MN0 A;  4YGE B;  3R1O A;  3NSL A;  4PHN A;  1PUL A;  4FTG A;  4PHM A;  4PE4 A;  5CSN A;  1W7I B;  3WHU B;  2KLE A;  1AK8 A;  2L5Y A;  3CGA A;  3SG5 A;  1BR4 B;  2K60 A;  3K21 A;  3B88 A;  3E3R A;  4ZCV A;  1KWO C;  1IQ3 A;  1TNP A;  1JFJ A;  3DD4 A;  2HQW A;  1DQE A;  4A4C A;  1GGW A;  5J3X A;  1BT6 A;  1KFU S;  3HCM A;  2WCM A;  2M3W A;  2G9B A;  2LM5 A;  2O5G A;  2BKI B;  3S0F A;  2EHB A;  3OX6 A;  4DRW A;  2KBM A;  1B1G A;  2H2K A;  1A75 B;  5DKQ A;  1QS7 A;  2LLU A;  3SJS A;  3SS5 A;  3CR4 X;  3L47 A;  1WY9 A;  2MRD A;  1JSA A;  1QX2 A;  4L9M A;  1B8R A;  4R1E A;  2M29 A;  1UHI A;  4OVN F;  1XFV O;  2WND A;  4GGN A;  2QEO A;  3I5H C;  2P70 A;  3JVT C;  1FF1 A;  5F6T A;  3S0A A;  2L4H A;  1DJG A;  2H8V A;  3LK0 A;  4ETO A;  1K9U A;  1IJ6 A;  2WOR A;  1LKJ A;  2Y4Q A;  2ZN8 A;  3VRQ A;  3SG6 A;  3WNX B;  1ZOT B;  2KNE A;  2K2A A;  2JUL A;  1SL7 A;  1BR1 B;  2WOS A;  2IS9 A;  2JNX A;  2L5X B;  2KLD A;  4NQG A;  3D76 A;  1YTZ C;  2JT0 A;  3FE6 A;  1DJH A;  2F33 A;  1CDL A;  1QX7 A;  1TNX A;  2F2O A;  3D74 A;  4GBA A;  5AEQ A;  1BG1 A;  2P71 A;  3SG4 A;  1OE9 B;  1AUI B;  2BNX A;  2FOT A;  1B7T Z;  3I5G B;  1N2D A;  3RM1 A;  5I2Q A;  1UUS A;  4I5J A;  1R2U A;  2KFF A;  2BL0 B;  2KAX A;  3SG7 A;  4MSP A;  3A4U B;  3DVK A;  1MR8 A;  2CBL A;  3BQ3 A;  5GQQ C;  1TCO B;  1K93 D;  3BUW B;  3DYE A;  2K7O A;  1S6C A;  3D78 A;  4OR9 B;  3UNW A;  3WXA A;  4U8D A;  1Y0V H;  2R2I A;  3CYZ A;  1LVC D;  2WCF A;  3CLN A;  4WQ2 A;  1QVI Z;  4GPL B;  4INW A;  3RZS A;  2KFH A;  3OP0 A;  3S0D A;  1A03 A;  2MLE C;  3M0W A;  3KPX A;  2WC6 A;  4TNC A;  1KSO A;  1R6P A;  1V1F A;  2ERB A;  3I5I B;  2JZI A;  1KFU L;  1YUR A;  2I2R E;  1FW4 A;  3DF0 A;  1OOJ A;  1XFR A;  1JC2 A;  4XJK B;  1K9K A;  1QLS A;  1CMG A;  2CTN A;  5IBW A;  1QIV A;  3GK2 A;  1SK6 D;  2SAS A;  2PAL A;  2BAP A;  4HRG A;  2DOQ A;  1CNP A;  3GK1 A;  3O4X A;  3BFB A;  5CSF A;  1A2X A;  2F3Y A;  1K95 A;  2M97 A;  3CTN A;  2O60 A;  3LL8 B;  4PE7 A;  1J7P A;  1K94 A;  4YRU A;  1AP4 A;  3B7A A;  3EK4 A;  2MBX A;  1TNQ A;  3VGO A;  1DEL A;  4A4B A;  3TDZ A;  3AAK A;  1DGU A;  3AAJ A;  1IIO A;  2BCB A;  2E30 A;  2NLN A;  2EC6 B;  2PSR A;  3S0B A;  4C0K A;  1BOC A;  1QV1 A;  3EVR A;  1MF8 B;  1S5G Z;  2GGM A;  2L51 A;  1S3P A;  1DJY A;  1SRA A;  4JQ0 D;  5JJG A;  1B9A A;  1SBJ A;  3BUN B;  1H4B A;  1QWV A;  1L2O B;  2CXJ A;  2QEV A;  3CR5 X;  2LC5 A;  5KTY A;  1QAS A;  2KDH A;  5AFP A;  1Y1X A;  1CDP A;  2LAP A;  1NX0 A;  2I94 A;  3WHT B;  1IQ5 A;  1PSR A;  4MZJ A;  2M49 B;  2F2P A;  2VRG A;  2AMI A;  2BCA A;  2LLT A;  3B87 A;  2LLS A;  3EKH A;  3I5F C;  2HQ8 A;  4ORB B;  1CMF A;  1JF2 A;  1ZAC A;  2KAY A;  3DY9 A;  4WQ3 A;  3TDU A;  2K7D A;  1OW4 A;  3D0Y B;  2LP3 A;  2JU0 A;  1CFP A;  2AAO A;  4YGD B;  2ISD A;  1JUO A;  1TN4 A;  1YUT A;  2OTG C;  4PCW A;  3H4S E;  3TS5 C;  1M31 A;  3JTD C;  1CFF A;  3DVJ A;  1U5I B;  5CSJ A;  3OB1 B;  1W7J B;  1F71 A;  2WCL A;  3FS7 A;  2LHL A;  1C7V A;  1AVS A;  5AXI A;  1Y1U A;  2JTZ A;  4IJ7 A;  2MA2 A;  4Q04 A;  1S6I A;  2COL B;  3FE9 A;  1PSB A;  4QJ3 B;  5ER4 X;  5FYX A;  3ZWH A;  1YUU A;  3F45 A;  1CTR A;  3DVM A;  2BE4 A;  2WCJ A;  4JWQ A;  1RRO A;  1RFJ A;  2ZRS A;  3SIA A;  1NP8 A;  2MAZ A;  4OCI A;  3QRX A;  2H61 A;  1Y6W A;  1RK9 A;  2Q91 A;  4GAO A;  3BUO B;  4USL A;  3A8R A;  4ORA B;  1MWN A;  2WCK A;  3D73 A;  4E68 A;  2CNP A;  1UHJ A;  5D3O A;  2LVJ A;  3BJH A;  3CR2 A;  5FI6 A;  1AHR A;  1V1G A;  1RWY A;  1KQV A;  1LA3 A;  2ZND A;  1C3Z A; 
#chains in the Genus database with same CATH homology
 1BMO A;  4MRY A;  1DGV A;  2LE9 B;  3PFV A;  3BUM B;  3PAT A;  2D8N A;  2GV5 A;  2JT8 A;  1BF5 A;  3C1V A;  4M2O A;  2LV7 A;  1HT9 A;  1RJV A;  3GK4 X;  5HYD A;  3TZ1 A;  1S26 D;  1DMO A;  1CDN A;  1OQP A;  3LCP C;  1NX1 A;  2H61 C;  1G4Y R;  4GNK B;  1QTX A;  1J7O A;  5TNC A;  1KK7 Y;  3BOW A;  2NZ0 A;  1OSA A;  1FPW A;  5BPJ A;  2Q4U A;  1KQM B;  3KF9 A;  1HQV A;  1OMD A;  4CLN A;  1KK8 B;  1DVI A;  2JT3 A;  3BYA A;  3I5G C;  1QIW A;  3PN7 B;  1KFX S;  2B1U A;  1B8L A;  1MXE A;  2AUC A;  1EG4 A;  3IQO A;  2I7A A;  1XFU O;  1S6J A;  2BL0 C;  1B7T Y;  2K8M B;  1G33 A;  1SR6 B;  2ZKM X;  2OPO A;  1DF0 A;  2KAV A;  1J55 A;  1TTX A;  2M0R A;  1DJX A;  2ZN9 A;  1ZUZ A;  2ZNE A;  2ZRT A;  4ICB A;  1Q80 A;  2KYC A;  2Y1N A;  2KFG A;  1YRT B;  1XK4 C;  1B47 A;  1QAT A;  5I2L A;  1CM4 A;  2JXC A;  1SCM B;  1JFK A;  2E6W A;  5HKW A;  2L2E A;  3I5I C;  4C0J A;  1QVI Y;  1SYM A;  1SW8 A;  4C0L A;  1SKT A;  2BCX A;  1MXL C;  1NCZ A;  1UP5 A;  1WRL A;  2CCM A;  4YBH B;  4MBE A;  1WDC B;  3AKA A;  1M39 A;  2LVI A;  2SCP A;  2TN4 A;  5KU1 A;  4I5L B;  1GGZ A;  1AJ5 A;  1NX3 A;  1J7R A;  5D7F A;  3MSE B;  3PLF B;  4YI9 A;  1OMV A;  2KI4 B;  4PHK A;  1YUS A;  1Y1A A;  3D10 A;  2L98 A;  5JOL A;  1PAL A;  3EK7 A;  4GUK A;  2I18 A;  3GOF A;  1F4Q A;  2KI6 C;  1UWO A;  1GJY A;  2LNK A;  1YVL A;  3AKB A;  1BJF A;  1J7Q A;  1CDM A;  3OX5 A;  1QJT A;  1DJI A;  1XYD A;  4NDD A;  4AQI A;  2BEC A;  2FCD A;  2KOT A;  2EC6 C;  4FQO A;  1JF0 A;  1MHO A;  4YGA A;  1IKU A;  1CKK A;  1A29 A;  1WLM A;  4XYN A;  1XVJ A;  1SL9 A;  1EG3 A;  2V53 A;  1PK0 D;  3OB2 B;  4P5O E;  1IG5 A;  1WRK A;  2M9G A;  4F0Z B;  1EXR A;  3KO0 A;  1GQM A;  1YRU B;  3RLZ A;  1UHK A;  2G2B A;  2Y5I A;  4ZCU A;  1KCY A;  1TRF A;  1KFX L;  2QAC A;  1UHH A;  1XA5 A;  1L2O C;  3EVU A;  1S5G Y;  1LA0 A;  1YX8 A;  2OS8 B;  1F8H A;  1PRW A;  1F55 A;  3BUX B;  1CLB A;  4DCK A;  3EVV A;  1FBV A;  1XFW O;  3DF0 B;  3EKJ A;  3PSR A;  1D1O A;  3TDI A;  3TUY B;  1FI6 A;  3DVE A;  2L4I A;  1DJZ A;  2JNF A;  3OHM B;  2MHH A;  1G8I A;  4AOM A;  1A75 A;  4DS7 A;  1NSH A;  4HSZ A;  1SPY A;  3VRR A;  1QX5 B;  2LVV A;  1K90 D;  3O4Y A;  4MZK A;  4D1E A;  2PAS A;  3LK1 A;  1OMR A;  1LXF C;  2JRF A;  2KBI A;  4IL1 A;  4MLW A;  5AER A;  1ZFS A;  1S1E A;  2F3Z A;  1XFZ O;  4N5X A;  3FWC A;  1NUB A;  2KYF A;  4BY5 A;  5K89 A;  4PE1 A;  1IRJ A;  4MZL A;  5DKN A;  4NDC A;  3FIA A;  1B8C A;  1IWQ A;  1L7Z A;  2BKH B;  3CS1 A;  1CLM A;  4OKH A;  3PAL A;  1E8A A;  4YGB B;  3SG3 A;  4PE0 A;  3ZNI A;  1EH2 A;  4I5K A;  3HX4 A;  2FCE A;  2LAN A;  3NSI A;  3PM8 A;  1K2H A;  1KWO B;  3SG2 A;  1ALW A;  1RTP 1;  2RGI A;  1CFD A;  1QLK A;  2CT9 A;  1LIN A;  1N0Y A;  2M8U A;  5G08 A;  2KSP A;  2M7N A;  4NDB A;  3LLE A;  2KI6 D;  2EGD A;  2M1U A;  5HLV A;  3EK8 A;  1DJW A;  4CID A;  5I8N A;  2JC2 A;  1OZO A;  1NYA A;  1TCF A;  1TIZ A;  2HET A;  5AAN A;  2NCP A;  5I2O A;  2LUC A;  1NCX A;  2JQ6 A;  4GGF C;  1BU3 A;  2KGB C;  1JWD A;  1XK4 A;  2K7C A;  2K0J A;  4MVF A;  4I5N B;  4BY4 A;  1K96 A;  1ALV A;  1NX2 A;  3I5H B;  4MRX A;  3JVT B;  1KQM C;  1NCY A;  5HKY A;  1UUR A;  1KK8 C;  2BBM A;  3PN7 C;  1H8B A;  4XJK A;  5DKR A;  1A4P A;  3KHE A;  2WCB A;  1K9P A;  1SY9 A;  2WCE A;  1QV0 A;  2QPT A;  1KK7 Z;  1S36 A;  1SR6 C;  2MJW B;  1N65 A;  4DUQ A;  1J1E A;  4M2Q A;  1KSM A;  1YVH A;  1NPQ A;  2PMY A;  4WRI A;  3VRP A;  2LMT A;  2K2F A;  1VRK A;  4MEW A;  3NSK A;  1PVB A;  1CB1 A;  4P2Y B;  1M46 A;  1NIW A;  4YGC B;  4YI8 A;  1SCM C;  3CZT X;  4PHJ A;  1K8U A;  1M45 A;  3O6B A;  3VRO A;  4M2P A;  3KEV A;  2NCO A;  3O78 A;  2K7B A;  4HRE E;  1F54 A;  1J1D A;  1NWD A;  2JPT A;  1XO5 A;  2LP2 A;  1CM1 A;  1SCV A;  1C7W A;  2ZFD A;  1WRZ A;  1WDC C;  1BOD A;  3NSO A;  4QJ5 B;  1SL8 A;  4CPV A;  2LUX A;  2L0P A;  4GFT A;  1PVA A;  2LMV A;  3BOW B;  2KI4 C;  2FJU B;  2M7L A;  3ICB A;  2NXQ A;  1IGV A;  1ZMZ A;  5B8I B;  5HLO A;  4ORC B;  1REC A;  1TOP A;  2KHN A;  3O2P A;  3VRN A;  4JPZ B;  5ER5 A;  5PAL A;  1OZS A;  4CFQ A;  1DT7 B;  2KGR A;  1DF0 B;  4UPG A;  3D0Y A;  3IQQ A;  2KQ6 A;  5KSZ A;  4HRH A;  1MQ1 A;  1YX7 A;  4N1G A;  1TNW A;  1EL4 A;  1UHN A;  1CFC A;  1X02 A;  1U5I A;  2JWW A;  4AQJ A;  1BLQ A;  2PRU A;  2Y1M A;  4N1F A;  4DIR A;  5HKZ A;  2HPS A;  5CPV A;  1WLZ A;  1B4C A;  2LMU A;  2OS8 C;  1CLL A;  4OV2 A;  1QXP A;  2KQY A;  1IJ5 A;  2PVB A;  2A4J A;  2LVK A;  4PDZ A;  2LCP A;  5D69 A;  1SNL A;  2BBN A;  1JBA A;  3TUY C;  2JTT A;  3CWG A;  1ODB A;  2BE6 A;  4PAL A;  2F8P A;  2L50 A;  2K61 A;  4QJ4 B;  1F70 A;  3IF7 A;  1F4O A;  2JOJ A;  2JXL A;  2WC8 A;  1FI5 A;  1M63 B;  1XFX O;  3NXA A;  2HF5 A;  1XFY O;  1EJ3 A;  3FWB A;  2MLF C;  3BXK A;  4CFR A;  3SIB A;  1AJ4 A;  1YR5 A;  3I5F B;  5CSI A;  1DTL A;  1IH0 A;  2M1K B;  2GGZ A;  1C07 A;  1SMG A;  2LHI A;  2OTG B;  2P6B B;  4GGF A;  3TS5 B;  1MUX A;  3JTD B;  4MN0 A;  4YGE B;  3NSL A;  4PHN A;  1PUL A;  4FTG A;  4PHM A;  4PE4 A;  5CSN A;  1W7I B;  3WHU B;  1AK8 A;  3CGA A;  3SG5 A;  1BR4 B;  3K21 A;  3E3R A;  4ZCV A;  1KWO C;  1IQ3 A;  1TNP A;  1JFJ A;  3DD4 A;  2HQW A;  4A4C A;  1GGW A;  5J3X A;  1BT6 A;  1KFU S;  3HCM A;  2M3W A;  2G9B A;  2LM5 A;  2O5G A;  2BKI B;  2EHB A;  3OX6 A;  4DRW A;  2KBM A;  1B1G A;  2H2K A;  1A75 B;  5DKQ A;  1QS7 A;  2LLU A;  3SJS A;  3CR4 X;  1WY9 A;  2MRD A;  1JSA A;  1QX2 A;  4L9M A;  1B8R A;  4R1E A;  2M29 A;  1UHI A;  4OVN F;  1XFV O;  2WND A;  4GGN A;  3I5H C;  3JVT C;  1FF1 A;  5F6T A;  2L4H A;  1DJG A;  3LK0 A;  4ETO A;  1K9U A;  1IJ6 A;  2WOR A;  1LKJ A;  2Y4Q A;  2ZN8 A;  3VRQ A;  3SG6 A;  3WNX B;  1ZOT B;  2KNE A;  2K2A A;  2JUL A;  1SL7 A;  1BR1 B;  2WOS A;  2IS9 A;  2JNX A;  2L5X B;  4NQG A;  1YTZ C;  2JT0 A;  1DJH A;  2F33 A;  1CDL A;  1QX7 A;  1TNX A;  2F2O A;  4GBA A;  5AEQ A;  1BG1 A;  3SG4 A;  1OE9 B;  1AUI B;  2FOT A;  3I5G B;  1B7T Z;  1N2D A;  3RM1 A;  5I2Q A;  1UUS A;  4I5J A;  1R2U A;  2KFF A;  2BL0 B;  2KAX A;  3SG7 A;  4MSP A;  3A4U B;  3DVK A;  1MR8 A;  2CBL A;  3BQ3 A;  5GQQ C;  1TCO B;  1K93 D;  3BUW B;  2K7O A;  1S6C A;  4OR9 B;  3WXA A;  4U8D A;  1Y0V H;  2R2I A;  1LVC D;  2WCF A;  3CLN A;  4WQ2 A;  1QVI Z;  4GPL B;  2KFH A;  3OP0 A;  1A03 A;  2MLE C;  3M0W A;  3KPX A;  4TNC A;  1KSO A;  1R6P A;  1V1F A;  3I5I B;  2JZI A;  1KFU L;  1YUR A;  2I2R E;  1FW4 A;  3DF0 A;  1OOJ A;  1JC2 A;  4XJK B;  1K9K A;  1QLS A;  1CMG A;  2CTN A;  5IBW A;  1QIV A;  3GK2 A;  1SK6 D;  2SAS A;  2PAL A;  4HRG A;  2DOQ A;  1CNP A;  3GK1 A;  5CSF A;  1A2X A;  2F3Y A;  1K95 A;  2M97 A;  3CTN A;  2O60 A;  3LL8 B;  4PE7 A;  1J7P A;  1K94 A;  4YRU A;  1AP4 A;  3EK4 A;  2MBX A;  1TNQ A;  3VGO A;  4A4B A;  3TDZ A;  3AAK A;  1DGU A;  3AAJ A;  2BCB A;  2E30 A;  2NLN A;  2EC6 B;  2PSR A;  4C0K A;  1BOC A;  1QV1 A;  3EVR A;  1MF8 B;  1S5G Z;  2GGM A;  2L51 A;  1S3P A;  1DJY A;  1SRA A;  4JQ0 D;  5JJG A;  1B9A A;  1SBJ A;  3BUN B;  1H4B A;  1L2O B;  2CXJ A;  3CR5 X;  2LC5 A;  5KTY A;  1QAS A;  2KDH A;  5AFP A;  1Y1X A;  1CDP A;  2LAP A;  1NX0 A;  2I94 A;  3WHT B;  1IQ5 A;  1PSR A;  4MZJ A;  2M49 B;  2F2P A;  2VRG A;  2AMI A;  2BCA A;  2LLT A;  2LLS A;  3EKH A;  3I5F C;  2HQ8 A;  4ORB B;  1CMF A;  1JF2 A;  1ZAC A;  2KAY A;  3TDU A;  4WQ3 A;  2K7D A;  3D0Y B;  2LP3 A;  2JU0 A;  1CFP A;  2AAO A;  4YGD B;  2ISD A;  1JUO A;  1TN4 A;  1YUT A;  2OTG C;  4PCW A;  3H4S E;  3TS5 C;  1M31 A;  3JTD C;  1CFF A;  3DVJ A;  1U5I B;  5CSJ A;  3OB1 B;  1W7J B;  1F71 A;  3FS7 A;  2LHL A;  1C7V A;  1AVS A;  5AXI A;  1Y1U A;  2JTZ A;  2MA2 A;  4Q04 A;  1S6I A;  2COL B;  1PSB A;  4QJ3 B;  5ER4 X;  5FYX A;  3ZWH A;  1YUU A;  3F45 A;  1CTR A;  3DVM A;  2BE4 A;  4JWQ A;  1RRO A;  1RFJ A;  2ZRS A;  3SIA A;  1NP8 A;  2MAZ A;  4OCI A;  3QRX A;  2H61 A;  1Y6W A;  1RK9 A;  2Q91 A;  4GAO A;  3BUO B;  4USL A;  3A8R A;  4ORA B;  1MWN A;  4E68 A;  2CNP A;  1UHJ A;  2LVJ A;  3CR2 A;  1AHR A;  1V1G A;  1RWY A;  1KQV A;  1LA3 A;  2ZND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...